1NVOA

Solution structure of a four-helix bundle model, apo-df1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homodimeric Alpha2 Four-Helix Bundle
publication title Preorganization of molecular binding sites in designed diiron proteins
pubmed doi rcsb
molecule tags Unknown function
total genus 17
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1nvoA00
1JMBA 2RKLA 2UWJE 1Y47A 2R44A 3MZWB 2KI7B 4HKZH 2JWDA 2K3RA 1X0TA 3S1KA 4NPDA 4ASWA 1EDIA 1LP1B 4NPFX 2P58A 4K3AA 2WMMA 4BXLA 1LP1A 2SPZA 2QVAA 1SS1A 1JM0A 2ZAEB 1ZW0A 1U7JA 2KS1B 4GODA 1S3JA 4MN4C 2M5AB 1FC2C 2KIKA 4GOEA 3RGUA 1MFTA 2B89A 2OTKE 2KZJA 4HJGH 3QWOC 1BDDA 1LT1A 5DJUB 4HB1A 5CBOA 4WWIA 1U7MA 2B88A 4CPGA 2M0BA 4EYYQ 2HR3A 2LXBA 2M5AA 4IOIH 1EDJA 1OVUA 4ZNCA 4ASVA 3MHVA 1NVOA 2KUBA 5EFWB 2I8DA 3ZDMA 3FXEA 1BDCA 2QRXA 1ZXGA 2B87B 4K35A 5C39A 2KZIA 3PH0A 4NPEA 1DEEG 1H0TB 2Q1KA 1EDLA 1EC5A 2B87A 1EDKA 2LXCB 2LR2A 4JBZA 1OVRA 1H0TA 1OVVA 5K5GB 4ZMDA 1Q2NA 4GOFA 5DJTB 4KJMA 3FXDA 5CBNA
chains in the Genus database with same CATH superfamily
4JQ0D 3CXHI 5TJHA 1BGYG 3PHLA 1JY2O 3JCUE 1S5LE 2WPRA 2HFED 2CPSA 1S72P 2ITAA 2KOGA 1PP9D 3GF7A 1EXJA 2QEXP 1OMIA 2BASA 3N4XA 4GT1A 4KT0J 1UIIA 2O3JA 3H1IJ 2WSFJ 2XZRA 1Q90D 2E74D 1GK6A 3K5BA 1RF1C 1SQQJ 1NJIQ 3I5CA 4B86A 3HE4A 4RJTA 2FXOA 2C9LY 1YITP 4H0LD 1J1DC 3A3YB 3CC7P 3G71P 1KB9D 1U57A 1YIJP 3P7KA 4WVZA 3I55P 4D6TG 4ZKUA 3KHUA 4I1LA 1SFCD 1SQVJ 2BCCJ 3H1ID 3BRVB 1VF5B 4PJ0H 2HODB 1EC5A 1GU5A 2R32A 4RO0A 3IR9A 3V2PA 1SQQD 3V4WA 1HJBA 1IZNB 3USSA 5AW7B 1LJ2A 1QX8A 2JP3A 2POHA 1HGVA 1YQ3C 3M0DA 1NTKK 2K3RA 4ASWA 2QA4P 1NAYA 3Q5PA 1NWQA 3N7NA 3G6EP 1GW4A 1S4XA 3FWNA 4NPFX 3KYQA 2IZ1A 1SQVD 2BCCD 5APQA 1L0LE 3M91A 1N73B 4OVNF 5TISE 2ZVNB 1MUUA 1SS1A 1JM0A 2QVAA 1KILD 2OYHB 3P8CE 1SQBG 3RBXA 1KQGB 1NKZB 2ZYDA 2KB7P 1M1JB 2N9BA 1FOSE 1K05A 5KAIH 3L70G 3CCUP 1SQXJ 1ZMEC 1VF5C 1P84I 1SLQA 3L74G 1FZBA 1BCCE 4WB4A 3HD7D 3VP8A 3SWYA 4EIJA 1EZVE 2B88A 2KNCA 1VL2A 1Q86Q 1SQPE 1SFCA 4BRYB 2YKQA 2MJZA 2Q6QA 4ASVA 1NVOA 5EFWB 3TNUA 3FXEA 1BDCA 1ZXGA 1Y8AA 2KZIA 2KSEA 2JKVA 2Q9IA 1SQXD 1JOCA 1OVVA 2XNDH 2Y0CA 4U7JA 3H1JE 4PV1D 2IBZI 2OYHC 2ZXEB 1PP9G 5GTIH 2IZ0A 1M1JC 1JMBA 3AE1C 5AW8B 2N1TD 1ZP0C 3SWKA 1PL5A 3OA7A 1KILA 4NPDA 2H7HA 1VPCA 1LP1B 4HH2A 1RF1A 1UIXA 4R4LA 1R5SA 4IFFA 1NH4A 1KORA 3D6YA 3WUVA 4WY4B 4MN4C 1LTJB 3P8MC 3KDPB 3RGUA 2XDJA 1KQFB 2JWAA 1RE3A 3BCCJ 3AE4C 1RHZB 5CCGD 3QWOC 1IFJA 2OYIB 2OARA 4PD4H 1NYHA 1J2JB 1VQNP 1T3JA 3RL0D 2AXCA 1DX7A 2HG5D 1XTGB 4PD4E 1HTLC 3TK1A 1URQB 1FZCA 2FYUE 3EFGA 2A06D 2HR3A 3M9BA 5AVRB 3S9OA 2ZJSE 1SQQG 2IFNA 2KUBA 4WBAA 1K8AQ 2QRXA 1GTWA 1AVYA 3CXHD 1IFIA 4KHXA 4N78D 1NU1G 1DEEG 3BCCD 2B87A 3BRTB 3C9IA 1GU4A 2WWWA 4WY4C 4ZMDA 1SQVG 2BCCG 2N1TA 2P10A 1LTJC 1RE4C 1PFIA 2ZXXA 4KJMA 3V6IA 3L73J 3NTNA 1L0LK 4LGDE 5KLVE 1LTSC 4H44D 4EDFA 2OYIC 5B5EE 1T8ZA 2K37A 1NTKD 1BGYJ 2FFDB 4OGQB 3H1HE 3G9RA 4O9BA 1RQVA 5CCGA 3L72E 1KFMA 1YJNP 2Q5UA 2KS1A 2WZ7A 1K9MQ 3EWKA 3CX5E 3L73D 1BDDA 2ZT9D 1CI6A 5H2FE 1SQPK 5AW2B 2WITA 3HE4B 3OW2O 5AVZB 3AE7C 3A0BH 2V4HA 1BGYD 1SQXG 1DIPA 1KC8Q 2K9YA 4L74A 2YKOA 2A45G 2I1KA 4ZNCA 3L75E 3T97A 1M1JA 4RESB 1LTGC 1KYOD 2W8ZA 5KAFH 1L0NE 1AA0A 1IO4A 2FFDC 2W27A 3GHGA 4OGQC 1EDKA 2IX7C 2LKMA 4W7YA 2KLUA 1H0TA 4GOFA 1QEXA 3VN0A 3AEGC 4BRYA 3SFDC 1M1KQ 1FOSF 3V2NA 2WTYA 3CL3D 4LLHA 2P2UA 5APTA 3CCVP 3G3ZA 3AE8C 2E74B 1PIXA 5APYA 1NU1K 5AVWB 1JTHA 4Z1MH 1N86A 1KMIZ 2A06G 5KJ7C 1SQBJ 1JCDA 3AEFC 2A45I 1X9VA 1MKMA 4HB1A 1FAVA 2KNCB 1SFCB 3BCCG 3L74J 3D71A 3B4SA 1NTME 1G2CB 3B8EB 1G1JA 1EDJA 3M0DC 1T2KD 2IBZD 2HYNA 1OX3A 3H1LE 3LW5H 2C0XA 1SQBD 2QJYB 4AYCA 1NTKG 2E74C 5KLVK 3OJAB 2OTJP 1M7LA 1E79H 2QIWA 2W90A 4L73A 2K9JA 3L74D 3FXDA 2WPVB 3AEAC 3AEEC 3PP5A 4H0LC 1JY2P 1KILB 2H43A 3TF5A 1SQPJ 4HKZH 1RF1B 4XFJA 1X0TA 3P8CD 1EDIA 1IJDB 5APUA 2E5TA 3L71J 3EQ2A 1SFCC 2WSSH 4AUWA 1L4AD 1GL2D 1ZW0A 5APSA 1FC2C 1LT9B 1EZVD 2WPQA 1AQ5A 1D7MA 4H13D 2KLVA 2QJYC 2QSIA 1FU1A 2FKWB 1SQPD 2H89C 2FFDA 1LTBC 3KZIE 1FZCB 3L35A 2BEZF 2IDBA 2KP8A 3RBZA 3L71D 3AE6C 3LIDA 1R8EA 2OGUA 3CWBE 3II6A 1KILC 4PV1B 1JMMA 2RMZA 2B87B 1JY3O 3PH0A 1VQ9P 4U3FJ 1DD4A 5CMZA 2QJKB 2Y0EA 2N1TB 4JBZA 1LGHB 1Q7YQ 5BU8B 1NU1J 1VQMP 1SVFA 1RE3C 3HD7C 4W80A 3MD0A 1N7SD 1LT9C 2WSCJ 5KTBA 3V2RA 5AVVB 2XV5A 1VQ8P 5KJ7A 1VQOP 1HH0A 1VQKP 5AW9B 1RQUA 1AFOA 1FZCC 4K3AA 4U3FD 1K04A 2JO1A 2XU6A 1KYOI 2L91A 2KS1B 3RL0B 1NU1D 2B9BA 2J58A 4W7ZA 1CI6B 4PV1C 5TISH 1OXZA 1Q81Q 2B89A 3CCLP 2IBZG 1FS0E 1NTMK 2D2CB 5CHXA 1JO5A 1X79B 1BSNA 2QJKC 5KLVJ 2G8YA 2N1TC 2QJPB 1MZ9A 1SP4A 2JR8A 4WWIA 1S9KD 3FX0A 3L70E 3T97B 1OW6A 2XKMA 2I8DA 2W6JH 3GHGB 5AVXB 3E1RA 1L0LG 1H0TB 2HPCB 4H44B 5CCGC 2WVRA 5KLVD 1N7SA 3CPWO 2ZVOB 3M9QA 3RL0C 1G2CA 1MFZA 2O01H 4L75A 1G1IA 2Q7CA 1NTZK 1VQPP 2QM7A 2D2CC 3TSIA 1BCCG 1PP9E 3VOPA 3L75J 2M3EA 3S1KA 5AW4B 3MTUE 2ZYAA 1EZVG 2QJPC 2YMYA 1YYCA 4BXLA 2W6BA 1SQPG 4QMAA 2ZT9B 1M57D 1JTHB 3CCSP 2P7JA 2WSEH 3RK2D 3L71G 3C8VA 3GHGC 2KXPB 2E42A 3MP7B 2R5DA 2Y0DA 4H44C 3L75D 1PGPA 2WSFH 1VQLP 1U7MA 1KB9E 3F5HA 4YXWH 3VP9A 3CC2P 2O1KA 2LXBA 3HD7A 4IL6X 1JCCA 3H1IE 1JNMA 2JDIH 1LT9A 1FZFA 4OWFA 3H32A 1PGJA 2QG4A 1JEKA 3L36A 1SQQE 4LC1A 1KZUB 4JYCA 2O01N 3NFQA 2ZT9C 1NGMB 1EZVI 2K9JB 4ZKPA 1S2EA 1Q2NA 3KQGA 4U3FG 2J59M 1NTKJ 1OVUA 1JB0J 2Q3IA 5CCHD 1KTMA 1HGZA 1SQVE 2BCCE 1S1CX 3L37A 3H25A 2M8RA 5AVQB 1IK7A 5GTHE 1KILE 2YXRB 1NKNA 1LWUA 2E76D 2FYUG 5B5EH 3TGUJ 1DH3A 1CSBA 1XTCC 1YTZT 1ZV8A 1IFPA 1VDFA 1ZRTD 3VTPC 1HWTC 1Y9BA 2GM4A 2OQQA 5CBOA 3CX5H 2V7QH 3H1KJ 1WT6A 1HF9A 4C7NA 1X22A 5H2FH 3Q5SA 4Y99B 5KLVG 2P1JA 4IOIH 3TGUD 1NTZJ 3AE3C 1HUCA 3Q5RA 1VQ4P 3Q1MA 2JEEA 5KKZC 3H1HG 2J5UA 4TLFA 2LXCB 2N9YB 2Y9ZA 3CCMP 2E75D 3G4SP 3RK3D 3BASA 3L72G 1VQ7P 3A2AA 3H1KD 4PD4I 1RY3A 2C0WA 1L4AB 1GL2B 1QVFO 4EOTA 1NTZD 1FZEA 1T2KC 2WT7A 3CMAP 1DD3A 2PRRA 2HPCA 2WMMA 4UB8H 2FYNC 3GG2A 4H13B 3JSVC 1ZN5A 4YTPC 2ZAEB 3L75G 2YMKA 4GODA 4Y99C 3QH9A 4IFDK 1Q82Q 1GZLA 4UB8E 4DZOA 3M06A 2FXPA 2KZJA 1S5LX 3A0HH 2NPSD 3HUSC 1IFMA 2OTLP 5AW1B 3CXHH 2A06E 5BVZA 1URQD 3A0HE 3GF3A 5KLIB 1TU3F 4H0LB 3CXHE 1L4AC 1GL2C 2BEQD 2FYUK 1FDOA 2WQYC 2Z5HA 2R5BA 3AEBC 4K35A 1LTIC 3RL0g 3CX5I 5C39A 1QL2A 1N7SB 3IFMA 4Y28J 1YHQP 1X8YA 2GA1A 3W67A 1YQ4C 4H13C 1OVRA 1JY2N 1L0LJ 3U1AA 2JJLA 3U59A 1OW8A 4C46A 1PPJE 4DOJA 2KI7B 1IC2A 3F89A 1NTMG 2KSJA 1BCCJ 1W5CE 5KLIC 4DCKA 3GMAA 3CI9A 1BE3E 1ZLLA 2PP6A 3H1LG 1N8RQ 1L0LD 3L73E 4GOEA 1JY3N 2Y9YA 1RF0C 3TGUG 4HJGH 1BGYE 1T3UA 1N7SC 3EFFK 1OZHA 4HYTB 3V2QA 3HD7B 3LIEA 1J1EB 3H1JJ 1BCCD 1KYOE 2HLOA 3FWLA 3KZIH 1GMJA 3H32B 3MHVA 3H1KG 4I2LC 3M0AA 3ZDMA 3ITKA 4M3LA 1JY3P 4TT3H 2PFXA 2YIUB 1EDLA 1NTZG 2WSEJ 1FZAA 3CLQA 1L0NK 2QM8A 3HE5A 2YO2A 3TYYA 1P84H 4RKUJ 4EI2A 1PZQA 3H1JD 3B5ND 2C9NY 3MZWB 3VYIA 1LWUB 1DEBA 3RK2B 1P84E 4C7RA 4D6TE 1PV3A 3HUSA 3AE2C 2P58A 1NO4A 3CWBG 3OAKA 1J1EC 3CCQP 1H89A 1CZQA 2FYUJ 2G3AA 2KIKA 3AE5C 3WMM0 1MFTA 1L4AA 1GL2A 3AECC 2YIUC 2DW3A 4I7ZB 3A7OA 3IN6A 3W68A 4C7NB 3V4QA 1GW3A 1OIPA 1FJPA 4DJGA 2IBZE 1W2EA 3O6QB 3WUTA 5AVTB 1VQ5P 1H88A 2PGDA 2M0BA 5APXA 3HTKB 1HVVA 4PJ0E 2M3BA 4PD4D 1SQBE 2FYUD 1MV8A 2FY8A 1LWUC 3HRNA 3RK2C 2ZYGA 5L8RJ 3AE9C 3L74E 3D70A 3H1HJ 2H88C 4OH8B 3B5NA 3CMEP 2OYOA 2IFMA 2E76B 3L72J 3VMXA 2WT7B 1Y47A 2AEFA 1RF0A 4I7ZC 2V7QJ 4N3YB 1QL1A 1LNQA 5AVUB 4XA4A 2I1JA 2FXMA 1ZR2A 4XE5B 2SPZA 5AW0B 1ZOYC 2FBWC 1YI2P 3VMZA 2WPSA 1FDMA 2NRGA 5KAIE 1S3JA 2R3SA 3H1HD 3S4RA 1YJ9P 3H6PA 3R4YA 2CPBA 3I56P 3R2PA 3L72D 5CCHC 1YJWP 1L0NJ 3L71E 1IFNA 3CX5D 1PGOA 2QE7H 3SWFA 1QVGO 2W83C 4JYBA 1N73C 4CPGA 2E76C 2K88A 2E75B 3RK3B 1FZGA 3MUDC 3BATA 1KB9H 1WRGA 1ZR4A 2E5YA 3H1JG 2AEMA 2IPPA 1NAFA 1NOHA 3ABVC 5CJ0A 1AJYA 1KQSO 1PGQA 2LR2A 5GTIE 1QGKB 1L0ND 3KXDA 1M56D 2ZFCA 2YKPA 2VRSA 1VF5D 5M1BA 4DT0A 2R44A 4U3FE 4GKGA 3A5TA 2E43A 1RH5B 3UIAA 2R3CA 3BVHA 3MGNA 2XNXA 1YBKA 2WSCH 3CCEP 1NU1E 2GUSA 1H8AA 4AQRD 2GUVA 2NPSB 2YO3A 5AVYB 2PAJA 5GTHH 3H1IG 2W6AA 4BWNA 3Q3DA 1NTMJ 5AW6B 2M5AB 2E75C 3RK3C 3WU2H 3SSUA 3PRJA 2D2CD 3NMDA 1BSHA 5KKZB 1GD2E 3H1LJ 1GDTA 1KN7A 4A7PA 1S9KE 2NZ2A 1USEA 3WU2E 2P67A 1WMKA 5AW3B 3WUUA 1SQBK 2AXTH 1T6AA 3B71A 3KPEA 3LW5J 1LTTC 3FGAD 1NTMD 2AXTE 1BE3J 4GIFA 3CCRP 2FYZA 2RH0A 2MKVA 3H1LD 2FYNB 3HE5B 2HODA 1PPJD 5AW5B 2NPSC 3O6QA 5APVA 2A45H 1KB9I 3VMAA 4GDOA 5DJTB 1N7LA 1URQC 3HTKA 2Z5IA 1SQXE 3HUSB 1LTAC 2JWDA 3CCJP 1BE3D 4L76A 5B66H 5CCHA 2IYOA 1L2PA 1W2BO 4IL6H 3V5BA 2Z4EA 1EQ7A 2KK7A 1IFDA 1QLED 5B66E 1JUNA 2O1JA 1N73A 5AVSB 4IL6E 3CWBJ 2OYHA 2YXQB 3MUDA 2OTKE 3A0BE 2KYVA 3GLMA 1AVOA 1LT1A 1KQLA 5DJUB 3VMYA 1KD1Q 1FDIA 4WY4D 1A02F 4N6JA 3PJSK 1IK9A 5E79H 4D6TJ 2IYPA 3CC4P 1N2DC 3GW6A 2K1AA 2Q3EA 5KAFE 3CD6P 1L0NG 1USDA 5E79E 1KV4A 1HBWA 2YNYA 3L4FA 3CWBD 3PLNA 4YPCA 1AQTA 1EXIA 3IAOA 1E5WA 1Z56A 2Q1KA 3NXSA 3U1CA 1FBMA 3B5NB 3AEDC 3IF4A 1SQQK 5K5GB 4JPZB 3D6ZA 4N78E 1P84D 2RN0A 3M9HA 4D6TD 3BCCE 5APWA 5CBNA 3C1LA 2RKLA 2UWJE 3Q2YA 3E7KA 1SQVK 4IFMA 4I6MC 1LP1A 1A02J 1U7JA 3L70J 1NTKE 1KFNA 3JC22 1AV1A 1ZRTE 4UB6H 1FE6A 1HJ0A 4WY4A 3TNUB 1LTJA 4OGQD 1RE4A 2H8PD 4UB6E 5BU5A 3B5NC 2OYIA 1CW5A 3TGUE 4JF7A 5CJ4A 1M8OB 1VQ6P 2NPSA 4EYYQ 1PPJG 1R5LA 2M5AA 1OFCX 3L70D 1YTZI 1URQA 4YXDC 1KYOH 2L5GB 4NPEA 3RK3E 1FJKA 1PP9J 3MIWA 3O8ZA 1SQXK 2O01J 3H1KE 4R4MA 3E1IA 1OW7A 1BE3G 2CK3H 1NHLA 1OWAA 3P32A 3L73G 1GK4A 2AEJA 3TDKA 1K73Q 3PTZA 3JCUH 1S5LH 5KJ7D 3SFEC 1M90Q 1NTZE 1J1DB
chains in the Genus database with same CATH topology
1JMBA 2RKLA 2UWJE 1Y47A 2R44A 3MZWB 2KI7B 4HKZH 2JWDA 2K3RA 1X0TA 3S1KA 4NPDA 4ASWA 1EDIA 1LP1B 4NPFX 2P58A 4K3AA 2WMMA 4BXLA 1LP1A 2SPZA 2QVAA 1SS1A 1JM0A 2ZAEB 1ZW0A 1U7JA 2KS1B 4GODA 1S3JA 4MN4C 2M5AB 1FC2C 2KIKA 4GOEA 3RGUA 1MFTA 2B89A 2OTKE 2KZJA 4HJGH 3QWOC 1BDDA 1LT1A 5DJUB 4HB1A 5CBOA 4WWIA 1U7MA 2B88A 4CPGA 2M0BA 4EYYQ 2HR3A 2LXBA 2M5AA 4IOIH 1EDJA 1OVUA 4ZNCA 4ASVA 3MHVA 1NVOA 2KUBA 5EFWB 2I8DA 3ZDMA 3FXEA 1BDCA 2QRXA 1ZXGA 2B87B 4K35A 5C39A 2KZIA 3PH0A 4NPEA 1DEEG 1H0TB 2Q1KA 1EDLA 1EC5A 2B87A 1EDKA 2LXCB 2LR2A 4JBZA 1OVRA 1H0TA 1OVVA 5K5GB 4ZMDA 1Q2NA 4GOFA 5DJTB 4KJMA 3FXDA 5CBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMB A;  2RKL A;  2UWJ E;  1Y47 A;  2R44 A;  3MZW B;  2KI7 B;  4HKZ H;  2JWD A;  2K3R A;  1X0T A;  3S1K A;  4NPD A;  4ASW A;  1EDI A;  1LP1 B;  4NPF X;  2P58 A;  4K3A A;  2WMM A;  4BXL A;  1LP1 A;  2SPZ A;  2QVA A;  1SS1 A;  1JM0 A;  2ZAE B;  1ZW0 A;  1U7J A;  2KS1 B;  4GOD A;  1S3J A;  4MN4 C;  2M5A B;  1FC2 C;  2KIK A;  4GOE A;  3RGU A;  1MFT A;  2B89 A;  2OTK E;  2KZJ A;  4HJG H;  3QWO C;  1BDD A;  1LT1 A;  5DJU B;  4HB1 A;  5CBO A;  4WWI A;  1U7M A;  2B88 A;  4CPG A;  2M0B A;  4EYY Q;  2HR3 A;  2LXB A;  2M5A A;  4IOI H;  1EDJ A;  1OVU A;  4ZNC A;  4ASV A;  3MHV A;  1NVO A;  2KUB A;  5EFW B;  2I8D A;  3ZDM A;  3FXE A;  1BDC A;  2QRX A;  1ZXG A;  2B87 B;  4K35 A;  5C39 A;  2KZI A;  3PH0 A;  4NPE A;  1DEE G;  1H0T B;  2Q1K A;  1EDL A;  1EC5 A;  2B87 A;  1EDK A;  2LXC B;  2LR2 A;  4JBZ A;  1OVR A;  1H0T A;  1OVV A;  5K5G B;  4ZMD A;  1Q2N A;  4GOF A;  5DJT B;  4KJM A;  3FXD A;  5CBN A; 
#chains in the Genus database with same CATH topology
 4JQ0 D;  3CXH I;  5TJH A;  1BGY G;  3PHL A;  1JY2 O;  3JCU E;  1S5L E;  2WPR A;  2HFE D;  2CPS A;  1S72 P;  2ITA A;  2KOG A;  1PP9 D;  3GF7 A;  1EXJ A;  2QEX P;  1OMI A;  2BAS A;  3N4X A;  4GT1 A;  4KT0 J;  1UII A;  2O3J A;  3H1I J;  2WSF J;  2XZR A;  1Q90 D;  2E74 D;  1GK6 A;  3K5B A;  1RF1 C;  1SQQ J;  1NJI Q;  3I5C A;  4B86 A;  3HE4 A;  4RJT A;  2FXO A;  2C9L Y;  1YIT P;  4H0L D;  1J1D C;  3A3Y B;  3CC7 P;  3G71 P;  1KB9 D;  1U57 A;  1YIJ P;  3P7K A;  4WVZ A;  3I55 P;  4D6T G;  4ZKU A;  3KHU A;  4I1L A;  1SFC D;  1SQV J;  2BCC J;  3H1I D;  3BRV B;  1VF5 B;  4PJ0 H;  2HOD B;  1EC5 A;  1GU5 A;  2R32 A;  4RO0 A;  3IR9 A;  3V2P A;  1SQQ D;  3V4W A;  1HJB A;  1IZN B;  3USS A;  5AW7 B;  1LJ2 A;  1QX8 A;  2JP3 A;  2POH A;  1HGV A;  1YQ3 C;  3M0D A;  1NTK K;  2K3R A;  4ASW A;  2QA4 P;  1NAY A;  3Q5P A;  1NWQ A;  3N7N A;  3G6E P;  1GW4 A;  1S4X A;  3FWN A;  4NPF X;  3KYQ A;  2IZ1 A;  1SQV D;  2BCC D;  5APQ A;  1L0L E;  3M91 A;  1N73 B;  4OVN F;  5TIS E;  2ZVN B;  1MUU A;  1SS1 A;  1JM0 A;  2QVA A;  1KIL D;  2OYH B;  3P8C E;  1SQB G;  3RBX A;  1KQG B;  1NKZ B;  2ZYD A;  2KB7 P;  1M1J B;  2N9B A;  1FOS E;  1K05 A;  5KAI H;  3L70 G;  3CCU P;  1SQX J;  1ZME C;  1VF5 C;  1P84 I;  1SLQ A;  3L74 G;  1FZB A;  1BCC E;  4WB4 A;  3HD7 D;  3VP8 A;  3SWY A;  4EIJ A;  1EZV E;  2B88 A;  2KNC A;  1VL2 A;  1Q86 Q;  1SQP E;  1SFC A;  4BRY B;  2YKQ A;  2MJZ A;  2Q6Q A;  4ASV A;  1NVO A;  5EFW B;  3TNU A;  3FXE A;  1BDC A;  1ZXG A;  1Y8A A;  2KZI A;  2KSE A;  2JKV A;  2Q9I A;  1SQX D;  1JOC A;  1OVV A;  2XND H;  2Y0C A;  4U7J A;  3H1J E;  4PV1 D;  2IBZ I;  2OYH C;  2ZXE B;  1PP9 G;  5GTI H;  2IZ0 A;  1M1J C;  1JMB A;  3AE1 C;  5AW8 B;  2N1T D;  1ZP0 C;  3SWK A;  1PL5 A;  3OA7 A;  1KIL A;  4NPD A;  2H7H A;  1VPC A;  1LP1 B;  4HH2 A;  1RF1 A;  1UIX A;  4R4L A;  1R5S A;  4IFF A;  1NH4 A;  1KOR A;  3D6Y A;  3WUV A;  4WY4 B;  4MN4 C;  1LTJ B;  3P8M C;  3KDP B;  3RGU A;  2XDJ A;  1KQF B;  2JWA A;  1RE3 A;  3BCC J;  3AE4 C;  1RHZ B;  5CCG D;  3QWO C;  1IFJ A;  2OYI B;  2OAR A;  4PD4 H;  1NYH A;  1J2J B;  1VQN P;  1T3J A;  3RL0 D;  2AXC A;  1DX7 A;  2HG5 D;  1XTG B;  4PD4 E;  1HTL C;  3TK1 A;  1URQ B;  1FZC A;  2FYU E;  3EFG A;  2A06 D;  2HR3 A;  3M9B A;  5AVR B;  3S9O A;  2ZJS E;  1SQQ G;  2IFN A;  2KUB A;  4WBA A;  1K8A Q;  2QRX A;  1GTW A;  1AVY A;  3CXH D;  1IFI A;  4KHX A;  4N78 D;  1NU1 G;  1DEE G;  3BCC D;  2B87 A;  3BRT B;  3C9I A;  1GU4 A;  2WWW A;  4WY4 C;  4ZMD A;  1SQV G;  2BCC G;  2N1T A;  2P10 A;  1LTJ C;  1RE4 C;  1PFI A;  2ZXX A;  4KJM A;  3V6I A;  3L73 J;  3NTN A;  1L0L K;  4LGD E;  5KLV E;  1LTS C;  4H44 D;  4EDF A;  2OYI C;  5B5E E;  1T8Z A;  2K37 A;  1NTK D;  1BGY J;  2FFD B;  4OGQ B;  3H1H E;  3G9R A;  4O9B A;  1RQV A;  5CCG A;  3L72 E;  1KFM A;  1YJN P;  2Q5U A;  2KS1 A;  2WZ7 A;  1K9M Q;  3EWK A;  3CX5 E;  3L73 D;  1BDD A;  2ZT9 D;  1CI6 A;  5H2F E;  1SQP K;  5AW2 B;  2WIT A;  3HE4 B;  3OW2 O;  5AVZ B;  3AE7 C;  3A0B H;  2V4H A;  1BGY D;  1SQX G;  1DIP A;  1KC8 Q;  2K9Y A;  4L74 A;  2YKO A;  2A45 G;  2I1K A;  4ZNC A;  3L75 E;  3T97 A;  1M1J A;  4RES B;  1LTG C;  1KYO D;  2W8Z A;  5KAF H;  1L0N E;  1AA0 A;  1IO4 A;  2FFD C;  2W27 A;  3GHG A;  4OGQ C;  1EDK A;  2IX7 C;  2LKM A;  4W7Y A;  2KLU A;  1H0T A;  4GOF A;  1QEX A;  3VN0 A;  3AEG C;  4BRY A;  3SFD C;  1M1K Q;  1FOS F;  3V2N A;  2WTY A;  3CL3 D;  4LLH A;  2P2U A;  5APT A;  3CCV P;  3G3Z A;  3AE8 C;  2E74 B;  1PIX A;  5APY A;  1NU1 K;  5AVW B;  1JTH A;  4Z1M H;  1N86 A;  1KMI Z;  2A06 G;  5KJ7 C;  1SQB J;  1JCD A;  3AEF C;  2A45 I;  1X9V A;  1MKM A;  4HB1 A;  1FAV A;  2KNC B;  1SFC B;  3BCC G;  3L74 J;  3D71 A;  3B4S A;  1NTM E;  1G2C B;  3B8E B;  1G1J A;  1EDJ A;  3M0D C;  1T2K D;  2IBZ D;  2HYN A;  1OX3 A;  3H1L E;  3LW5 H;  2C0X A;  1SQB D;  2QJY B;  4AYC A;  1NTK G;  2E74 C;  5KLV K;  3OJA B;  2OTJ P;  1M7L A;  1E79 H;  2QIW A;  2W90 A;  4L73 A;  2K9J A;  3L74 D;  3FXD A;  2WPV B;  3AEA C;  3AEE C;  3PP5 A;  4H0L C;  1JY2 P;  1KIL B;  2H43 A;  3TF5 A;  1SQP J;  4HKZ H;  1RF1 B;  4XFJ A;  1X0T A;  3P8C D;  1EDI A;  1IJD B;  5APU A;  2E5T A;  3L71 J;  3EQ2 A;  1SFC C;  2WSS H;  4AUW A;  1L4A D;  1GL2 D;  1ZW0 A;  5APS A;  1FC2 C;  1LT9 B;  1EZV D;  2WPQ A;  1AQ5 A;  1D7M A;  4H13 D;  2KLV A;  2QJY C;  2QSI A;  1FU1 A;  2FKW B;  1SQP D;  2H89 C;  2FFD A;  1LTB C;  3KZI E;  1FZC B;  3L35 A;  2BEZ F;  2IDB A;  2KP8 A;  3RBZ A;  3L71 D;  3AE6 C;  3LID A;  1R8E A;  2OGU A;  3CWB E;  3II6 A;  1KIL C;  4PV1 B;  1JMM A;  2RMZ A;  2B87 B;  1JY3 O;  3PH0 A;  1VQ9 P;  4U3F J;  1DD4 A;  5CMZ A;  2QJK B;  2Y0E A;  2N1T B;  4JBZ A;  1LGH B;  1Q7Y Q;  5BU8 B;  1NU1 J;  1VQM P;  1SVF A;  1RE3 C;  3HD7 C;  4W80 A;  3MD0 A;  1N7S D;  1LT9 C;  2WSC J;  5KTB A;  3V2R A;  5AVV B;  2XV5 A;  1VQ8 P;  5KJ7 A;  1VQO P;  1HH0 A;  1VQK P;  5AW9 B;  1RQU A;  1AFO A;  1FZC C;  4K3A A;  4U3F D;  1K04 A;  2JO1 A;  2XU6 A;  1KYO I;  2L91 A;  2KS1 B;  3RL0 B;  1NU1 D;  2B9B A;  2J58 A;  4W7Z A;  1CI6 B;  4PV1 C;  5TIS H;  1OXZ A;  1Q81 Q;  2B89 A;  3CCL P;  2IBZ G;  1FS0 E;  1NTM K;  2D2C B;  5CHX A;  1JO5 A;  1X79 B;  1BSN A;  2QJK C;  5KLV J;  2G8Y A;  2N1T C;  2QJP B;  1MZ9 A;  1SP4 A;  2JR8 A;  4WWI A;  1S9K D;  3FX0 A;  3L70 E;  3T97 B;  1OW6 A;  2XKM A;  2I8D A;  2W6J H;  3GHG B;  5AVX B;  3E1R A;  1L0L G;  1H0T B;  2HPC B;  4H44 B;  5CCG C;  2WVR A;  5KLV D;  1N7S A;  3CPW O;  2ZVO B;  3M9Q A;  3RL0 C;  1G2C A;  1MFZ A;  2O01 H;  4L75 A;  1G1I A;  2Q7C A;  1NTZ K;  1VQP P;  2QM7 A;  2D2C C;  3TSI A;  1BCC G;  1PP9 E;  3VOP A;  3L75 J;  2M3E A;  3S1K A;  5AW4 B;  3MTU E;  2ZYA A;  1EZV G;  2QJP C;  2YMY A;  1YYC A;  4BXL A;  2W6B A;  1SQP G;  4QMA A;  2ZT9 B;  1M57 D;  1JTH B;  3CCS P;  2P7J A;  2WSE H;  3RK2 D;  3L71 G;  3C8V A;  3GHG C;  2KXP B;  2E42 A;  3MP7 B;  2R5D A;  2Y0D A;  4H44 C;  3L75 D;  1PGP A;  2WSF H;  1VQL P;  1U7M A;  1KB9 E;  3F5H A;  4YXW H;  3VP9 A;  3CC2 P;  2O1K A;  2LXB A;  3HD7 A;  4IL6 X;  1JCC A;  3H1I E;  1JNM A;  2JDI H;  1LT9 A;  1FZF A;  4OWF A;  3H32 A;  1PGJ A;  2QG4 A;  1JEK A;  3L36 A;  1SQQ E;  4LC1 A;  1KZU B;  4JYC A;  2O01 N;  3NFQ A;  2ZT9 C;  1NGM B;  1EZV I;  2K9J B;  4ZKP A;  1S2E A;  1Q2N A;  3KQG A;  4U3F G;  2J59 M;  1NTK J;  1OVU A;  1JB0 J;  2Q3I A;  5CCH D;  1KTM A;  1HGZ A;  1SQV E;  2BCC E;  1S1C X;  3L37 A;  3H25 A;  2M8R A;  5AVQ B;  1IK7 A;  5GTH E;  1KIL E;  2YXR B;  1NKN A;  1LWU A;  2E76 D;  2FYU G;  5B5E H;  3TGU J;  1DH3 A;  1CSB A;  1XTC C;  1YTZ T;  1ZV8 A;  1IFP A;  1VDF A;  1ZRT D;  3VTP C;  1HWT C;  1Y9B A;  2GM4 A;  2OQQ A;  5CBO A;  3CX5 H;  2V7Q H;  3H1K J;  1WT6 A;  1HF9 A;  4C7N A;  1X22 A;  5H2F H;  3Q5S A;  4Y99 B;  5KLV G;  2P1J A;  4IOI H;  3TGU D;  1NTZ J;  3AE3 C;  1HUC A;  3Q5R A;  1VQ4 P;  3Q1M A;  2JEE A;  5KKZ C;  3H1H G;  2J5U A;  4TLF A;  2LXC B;  2N9Y B;  2Y9Z A;  3CCM P;  2E75 D;  3G4S P;  3RK3 D;  3BAS A;  3L72 G;  1VQ7 P;  3A2A A;  3H1K D;  4PD4 I;  1RY3 A;  2C0W A;  1L4A B;  1GL2 B;  1QVF O;  4EOT A;  1NTZ D;  1FZE A;  1T2K C;  2WT7 A;  3CMA P;  1DD3 A;  2PRR A;  2HPC A;  2WMM A;  4UB8 H;  2FYN C;  3GG2 A;  4H13 B;  3JSV C;  1ZN5 A;  4YTP C;  2ZAE B;  3L75 G;  2YMK A;  4GOD A;  4Y99 C;  3QH9 A;  4IFD K;  1Q82 Q;  1GZL A;  4UB8 E;  4DZO A;  3M06 A;  2FXP A;  2KZJ A;  1S5L X;  3A0H H;  2NPS D;  3HUS C;  1IFM A;  2OTL P;  5AW1 B;  3CXH H;  2A06 E;  5BVZ A;  1URQ D;  3A0H E;  3GF3 A;  5KLI B;  1TU3 F;  4H0L B;  3CXH E;  1L4A C;  1GL2 C;  2BEQ D;  2FYU K;  1FDO A;  2WQY C;  2Z5H A;  2R5B A;  3AEB C;  4K35 A;  1LTI C;  3RL0 g;  3CX5 I;  5C39 A;  1QL2 A;  1N7S B;  3IFM A;  4Y28 J;  1YHQ P;  1X8Y A;  2GA1 A;  3W67 A;  1YQ4 C;  4H13 C;  1OVR A;  1JY2 N;  1L0L J;  3U1A A;  2JJL A;  3U59 A;  1OW8 A;  4C46 A;  1PPJ E;  4DOJ A;  2KI7 B;  1IC2 A;  3F89 A;  1NTM G;  2KSJ A;  1BCC J;  1W5C E;  5KLI C;  4DCK A;  3GMA A;  3CI9 A;  1BE3 E;  1ZLL A;  2PP6 A;  3H1L G;  1N8R Q;  1L0L D;  3L73 E;  4GOE A;  1JY3 N;  2Y9Y A;  1RF0 C;  3TGU G;  4HJG H;  1BGY E;  1T3U A;  1N7S C;  3EFF K;  1OZH A;  4HYT B;  3V2Q A;  3HD7 B;  3LIE A;  1J1E B;  3H1J J;  1BCC D;  1KYO E;  2HLO A;  3FWL A;  3KZI H;  1GMJ A;  3H32 B;  3MHV A;  3H1K G;  4I2L C;  3M0A A;  3ZDM A;  3ITK A;  4M3L A;  1JY3 P;  4TT3 H;  2PFX A;  2YIU B;  1EDL A;  1NTZ G;  2WSE J;  1FZA A;  3CLQ A;  1L0N K;  2QM8 A;  3HE5 A;  2YO2 A;  3TYY A;  1P84 H;  4RKU J;  4EI2 A;  1PZQ A;  3H1J D;  3B5N D;  2C9N Y;  3MZW B;  3VYI A;  1LWU B;  1DEB A;  3RK2 B;  1P84 E;  4C7R A;  4D6T E;  1PV3 A;  3HUS A;  3AE2 C;  2P58 A;  1NO4 A;  3CWB G;  3OAK A;  1J1E C;  3CCQ P;  1H89 A;  1CZQ A;  2FYU J;  2G3A A;  2KIK A;  3AE5 C;  3WMM 0;  1MFT A;  1L4A A;  1GL2 A;  3AEC C;  2YIU C;  2DW3 A;  4I7Z B;  3A7O A;  3IN6 A;  3W68 A;  4C7N B;  3V4Q A;  1GW3 A;  1OIP A;  1FJP A;  4DJG A;  2IBZ E;  1W2E A;  3O6Q B;  3WUT A;  5AVT B;  1VQ5 P;  1H88 A;  2PGD A;  2M0B A;  5APX A;  3HTK B;  1HVV A;  4PJ0 E;  2M3B A;  4PD4 D;  1SQB E;  2FYU D;  1MV8 A;  2FY8 A;  1LWU C;  3HRN A;  3RK2 C;  2ZYG A;  5L8R J;  3AE9 C;  3L74 E;  3D70 A;  3H1H J;  2H88 C;  4OH8 B;  3B5N A;  3CME P;  2OYO A;  2IFM A;  2E76 B;  3L72 J;  3VMX A;  2WT7 B;  1Y47 A;  2AEF A;  1RF0 A;  4I7Z C;  2V7Q J;  4N3Y B;  1QL1 A;  1LNQ A;  5AVU B;  4XA4 A;  2I1J A;  2FXM A;  1ZR2 A;  4XE5 B;  2SPZ A;  5AW0 B;  1ZOY C;  2FBW C;  1YI2 P;  3VMZ A;  2WPS A;  1FDM A;  2NRG A;  5KAI E;  1S3J A;  2R3S A;  3H1H D;  3S4R A;  1YJ9 P;  3H6P A;  3R4Y A;  2CPB A;  3I56 P;  3R2P A;  3L72 D;  5CCH C;  1YJW P;  1L0N J;  3L71 E;  1IFN A;  3CX5 D;  1PGO A;  2QE7 H;  3SWF A;  1QVG O;  2W83 C;  4JYB A;  1N73 C;  4CPG A;  2E76 C;  2K88 A;  2E75 B;  3RK3 B;  1FZG A;  3MUD C;  3BAT A;  1KB9 H;  1WRG A;  1ZR4 A;  2E5Y A;  3H1J G;  2AEM A;  2IPP A;  1NAF A;  1NOH A;  3ABV C;  5CJ0 A;  1AJY A;  1KQS O;  1PGQ A;  2LR2 A;  5GTI E;  1QGK B;  1L0N D;  3KXD A;  1M56 D;  2ZFC A;  2YKP A;  2VRS A;  1VF5 D;  5M1B A;  4DT0 A;  2R44 A;  4U3F E;  4GKG A;  3A5T A;  2E43 A;  1RH5 B;  3UIA A;  2R3C A;  3BVH A;  3MGN A;  2XNX A;  1YBK A;  2WSC H;  3CCE P;  1NU1 E;  2GUS A;  1H8A A;  4AQR D;  2GUV A;  2NPS B;  2YO3 A;  5AVY B;  2PAJ A;  5GTH H;  3H1I G;  2W6A A;  4BWN A;  3Q3D A;  1NTM J;  5AW6 B;  2M5A B;  2E75 C;  3RK3 C;  3WU2 H;  3SSU A;  3PRJ A;  2D2C D;  3NMD A;  1BSH A;  5KKZ B;  1GD2 E;  3H1L J;  1GDT A;  1KN7 A;  4A7P A;  1S9K E;  2NZ2 A;  1USE A;  3WU2 E;  2P67 A;  1WMK A;  5AW3 B;  3WUU A;  1SQB K;  2AXT H;  1T6A A;  3B71 A;  3KPE A;  3LW5 J;  1LTT C;  3FGA D;  1NTM D;  2AXT E;  1BE3 J;  4GIF A;  3CCR P;  2FYZ A;  2RH0 A;  2MKV A;  3H1L D;  2FYN B;  3HE5 B;  2HOD A;  1PPJ D;  5AW5 B;  2NPS C;  3O6Q A;  5APV A;  2A45 H;  1KB9 I;  3VMA A;  4GDO A;  5DJT B;  1N7L A;  1URQ C;  3HTK A;  2Z5I A;  1SQX E;  3HUS B;  1LTA C;  2JWD A;  3CCJ P;  1BE3 D;  4L76 A;  5B66 H;  5CCH A;  2IYO A;  1L2P A;  1W2B O;  4IL6 H;  3V5B A;  2Z4E A;  1EQ7 A;  2KK7 A;  1IFD A;  1QLE D;  5B66 E;  1JUN A;  2O1J A;  1N73 A;  5AVS B;  4IL6 E;  3CWB J;  2OYH A;  2YXQ B;  3MUD A;  2OTK E;  3A0B E;  2KYV A;  3GLM A;  1AVO A;  1LT1 A;  1KQL A;  5DJU B;  3VMY A;  1KD1 Q;  1FDI A;  4WY4 D;  1A02 F;  4N6J A;  3PJS K;  1IK9 A;  5E79 H;  4D6T J;  2IYP A;  3CC4 P;  1N2D C;  3GW6 A;  2K1A A;  2Q3E A;  5KAF E;  3CD6 P;  1L0N G;  1USD A;  5E79 E;  1KV4 A;  1HBW A;  2YNY A;  3L4F A;  3CWB D;  3PLN A;  4YPC A;  1AQT A;  1EXI A;  3IAO A;  1E5W A;  1Z56 A;  2Q1K A;  3NXS A;  3U1C A;  1FBM A;  3B5N B;  3AED C;  3IF4 A;  1SQQ K;  5K5G B;  4JPZ B;  3D6Z A;  4N78 E;  1P84 D;  2RN0 A;  3M9H A;  4D6T D;  3BCC E;  5APW A;  5CBN A;  3C1L A;  2RKL A;  2UWJ E;  3Q2Y A;  3E7K A;  1SQV K;  4IFM A;  4I6M C;  1LP1 A;  1A02 J;  1U7J A;  3L70 J;  1NTK E;  1KFN A;  3JC2 2;  1AV1 A;  1ZRT E;  4UB6 H;  1FE6 A;  1HJ0 A;  4WY4 A;  3TNU B;  1LTJ A;  4OGQ D;  1RE4 A;  2H8P D;  4UB6 E;  5BU5 A;  3B5N C;  2OYI A;  1CW5 A;  3TGU E;  4JF7 A;  5CJ4 A;  1M8O B;  1VQ6 P;  2NPS A;  4EYY Q;  1PPJ G;  1R5L A;  2M5A A;  1OFC X;  3L70 D;  1YTZ I;  1URQ A;  4YXD C;  1KYO H;  2L5G B;  4NPE A;  3RK3 E;  1FJK A;  1PP9 J;  3MIW A;  3O8Z A;  1SQX K;  2O01 J;  3H1K E;  4R4M A;  3E1I A;  1OW7 A;  1BE3 G;  2CK3 H;  1NHL A;  1OWA A;  3P32 A;  3L73 G;  1GK4 A;  2AEJ A;  3TDK A;  1K73 Q;  3PTZ A;  3JCU H;  1S5L H;  5KJ7 D;  3SFE C;  1M90 Q;  1NTZ E;  1J1D B; 
#chains in the Genus database with same CATH homology
 1JMB A;  2RKL A;  2UWJ E;  1Y47 A;  2R44 A;  3MZW B;  2KI7 B;  4HKZ H;  2JWD A;  2K3R A;  1X0T A;  3S1K A;  4NPD A;  4ASW A;  1EDI A;  1LP1 B;  4NPF X;  2P58 A;  4K3A A;  2WMM A;  4BXL A;  1LP1 A;  2SPZ A;  2QVA A;  1SS1 A;  1JM0 A;  2ZAE B;  1ZW0 A;  1U7J A;  2KS1 B;  4GOD A;  1S3J A;  4MN4 C;  2M5A B;  1FC2 C;  2KIK A;  4GOE A;  3RGU A;  1MFT A;  2B89 A;  2OTK E;  2KZJ A;  4HJG H;  3QWO C;  1BDD A;  1LT1 A;  5DJU B;  4HB1 A;  5CBO A;  4WWI A;  1U7M A;  2B88 A;  4CPG A;  2M0B A;  4EYY Q;  2HR3 A;  2LXB A;  2M5A A;  4IOI H;  1EDJ A;  1OVU A;  4ZNC A;  4ASV A;  3MHV A;  1NVO A;  2KUB A;  5EFW B;  2I8D A;  3ZDM A;  3FXE A;  1BDC A;  2QRX A;  1ZXG A;  2B87 B;  4K35 A;  5C39 A;  2KZI A;  3PH0 A;  4NPE A;  1DEE G;  1H0T B;  2Q1K A;  1EDL A;  1EC5 A;  2B87 A;  1EDK A;  2LXC B;  2LR2 A;  4JBZ A;  1OVR A;  1H0T A;  1OVV A;  5K5G B;  4ZMD A;  1Q2N A;  4GOF A;  5DJT B;  4KJM A;  3FXD A;  5CBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...