1NVOA

Solution structure of a four-helix bundle model, apo-df1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preorganization of molecular binding sites in designed diiron proteins
pubmed doi rcsb
molecule tags Unknown function
molecule keywords Homodimeric Alpha2 Four-Helix Bundle
total genus 17
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1nvoA00
3FXDA 5DJUB 1H0TA 1Q2NA 1MFTA 1BDDA 4ZMDA 2ZAEB 4HJGH 2M5AA 1JMBA 3ZDMA 4NPDA 1LP1A 2B87A 4JBZA 1OVUA 1EDKA 2JWDA 2RKLA 2LXBA 4NPEA 4GOEA 5CBOA 1BDCA 2KI7B 1Y47A 4WWIA 1LP1B 2SPZA 2KS1B 2P58A 3MZWB 2LXCB 1JM0A 4ZNCA 4K3AA 3MHVA 1ZXGA 1X0TA 4ASWA 4MN4C 3RGUA 1EDLA 4GOFA 5EFWB 4KJMA 2KIKA 1OVRA 4BXLA 1EC5A 2OTKE 4GODA 3S1KA 5K5GB 5CBNA 2HR3A 2KZJA 2B88A 1EDJA 2R44A 2KUBA 2I8DA 2B87B 2QRXA 4HB1A 2UWJE 1OVVA 4HKZH 2M5AB 1DEEG 1S3JA 1SS1A 2Q1KA 4EYYQ 5C39A 1NVOA 5DJTB 2M0BA 4CPGA 3FXEA 2K3RA 1ZW0A 4ASVA 1U7JA 2LR2A 3PH0A 1U7MA 2WMMA 4IOIH 2B89A 1H0TB 1EDIA 2QVAA 1FC2C 3QWOC 4NPFX 4K35A 2KZIA 1LT1A
chains in the Genus database with same CATH superfamily
3G71P 3P8MC 2HPCB 1NJIQ 3L71G 1XTCC 2P1JA 3V6IA 4U3FJ 3MIWA 2KSEA 5DJUB 3U1AA 4PV1B 5KAIH 2JP3A 3BRTB 4BRYA 4L73A 4HYTB 1LTTC 1OMIA 4BWNA 1H0TA 1DD3A 4H13B 4EI2A 5CCGA 3D71A 1LTGC 3CXHI 4ZMDA 2OYHC 2OTLP 4YXWH 2KP8A 3KXDA 1GMJA 3CCJP 1NTZE 4GKGA 5KTBA 3CCLP 1RQVA 1JMBA 3I55P 1VPCA 4NPDA 3HTKA 3H25A 4PJ0H 2JWDA 2CK3H 1KORA 1SFCB 3HUSA 1JTHA 1LT9C 2P67A 2RKLA 2WPSA 1SQVG 1RY3A 2YKPA 3T97A 4DT0A 5KJ7C 1GU5A 4L75A 4IL6X 2OYHA 3IR9A 1AJYA 3H1KD 1S5LX 1NKZB 3KHUA 1KFMA 2OYIA 1FU1A 1L0LD 1LGHB 1KZUB 1JY3O 2A45G 2JDIH 2XV5A 3BCCD 3JCUH 3L37A 4Y28J 2WT7B 4TLFA 1GDTA 1KQFB 3AE1C 3EQ2A 1L0LG 3R4YA 2O3JA 4PV1C 3OAKA 4N6JA 1AVOA 1PPJG 2IZ0A 5KLIC 1OZHA 1KQLA 2KS1B 3TGUJ 1PPJE 2Y0EA 2YO2A 1VQ7P 2J5UA 4XA4A 2A45H 3MHVA 3CX5E 1L0LE 4JQ0D 2WSEH 3G3ZA 1GL2C 1ZXGA 2K9JA 2E74C 2LKMA 3JCUE 3A3YB 3TNUA 2MJZA 3N7NA 1NTKK 1VDFA 1P84D 4Y99B 3HD7D 2Q9IA 3CC4P 4GDOA 4KJMA 1EDLA 1NTZD 1KQGB 1RE4A 4C7RA 3RL0g 1LTSC 1YBKA 3TSIA 2E76C 2WQYC 4DZOA 3CCQP 1SFCC 3GW6A 4RESB 1S9KE 1S9KD 1YITP 1VQKP 5B5EE 2YNYA 1FZCC 1SQQK 1A02J 2YIUB 3L73J 2QJYB 3VMAA 4WB4A 3CCVP 3SWFA 3B5NC 1JOCA 1HH0A 1P84E 1BGYE 1WT6A 2WITA 1BSHA 1CW5A 4W80A 1SQPE 3EFGA 1N2DC 1VF5C 2BEZF 2ZXEB 1A02F 1VQ9P 3H1JD 5BU5A 1KYOH 3CCUP 1N7SD 3L74D 4JF7A 2FYNB 1BCCD 4I7ZB 3VOPA 3H1KE 1KMIZ 5APTA 1OW6A 4AUWA 1LTJB 2QJPB 2UWJE 4HB1A 5AVQB 1P84I 4HKZH 1LJ2A 4DOJA 2Q1KA 1SQBD 3PJSK 2FYUK 2H8PD 2KNCB 5GTIH 2ZYDA 1W2EA 4H44C 2KYVA 3L75D 3PRJA 3W67A 3BCCE 4RO0A 4WVZA 1NVOA 5KJ7A 1AA0A 1LNQA 2W6BA 1UIXA 4WY4C 5GTHH 5KKZB 3ABVC 3GHGB 3H1IG 2P2UA 3CMAP 3KPEA 4EOTA 1SVFA 1BCCG 3H1HJ 2YO3A 1NO4A 2ITAA 3AECC 3IAOA 2Q7CA 1FOSF 3F89A 3G9RA 1YQ3C 1KFNA 4H13C 3G6EP 3TGUD 3L70G 1ZR4A 1FDMA 1RF1B 1FE6A 1KYOI 4ASVA 2XDJA 3BRVB 5H2FH 3WMM0 1OIPA 1U7JA 3PH0A 1GK4A 1R5LA 3L73G 2IBZG 3GHGA 2W6AA 1G2CA 2N1TD 3P7KA 2B89A 2ZVNB 4WY4D 4EDFA 1YJWP 1NWQA 1SFCD 1NTKE 1NTKD 4N78D 4N78E 1YHQP 3TK1A 2YKQA 1J1EC 3HRNA 4K35A 1SQXE 4OH8B 2FYUJ 3VN0A 2KLUA 1Z56A 1H8AA 1LWUA 1SQPG 2DW3A 1QLED 3AEFC 2KB7P 2IBZD 4H13D 1BGYG 2RN0A 4N3YB 1S5LH 1N7SC 4PV1D 2FFDA 3CCEP 5CCHC 2NPSB 1NTMK 2M3BA 3OA7A 2FKWB 1RE3A 4XE5B 1Q2NA 2M8RA 3FWLA 1BDDA 3H1IJ 1CI6A 1IFJA 2BASA 2YMYA 1USDA 1VQMP 3M06A 1BE3E 1BE3J 2IFNA 4AYCA 1H89A 3EWKA 4HJGH 1XTGB 4R4LA 2B87A 2O1JA 2QE7H 1J1EB 5TISH 2E74B 1OVUA 2GUSA 2IYOA 3II6A 3W68A 1IFIA 1RF1A 2OARA 2WPQA 3CX5H 2J59M 1RF0C 4KT0J 1PV3A 2YIUC 4W7ZA 1BDCA 2KLVA 2QM7A 1N73C 2KI7B 1NU1J 1PGJA 2P10A 3EFFK 3L70E 1Y47A 3PTZA 1L4AB 4YPCA 5TISE 1JNMA 1T2KD 1H0TB 3AE5C 4XFJA 2IBZI 1LP1B 1RE4C 3AEEC 4OVNF 2Q3IA 4U7JA 1MFZA 2KNCA 2P58A 3CC2P 1HF9A 2LXCB 2QM8A 5APQA 1CZQA 3C9IA 3RK3E 4ZNCA 4K3AA 1LTJA 2ZT9D 5AVZB 3B5ND 1J1DC 2Q3EA 5KLIB 3A0HE 2WT7A 1QVGO 1X0TA 3IF4A 3WUUA 1L0NK 1SQVE 2BEQD 4GT1A 4MN4C 3RGUA 1S5LE 4ASWA 5CCGD 3CCRP 3VP9A 1FOSE 1VQNP 2R3CA 1KB9E 1M1JB 3CWBG 4GOFA 3VP8A 3T97B 2FYUD 3NTNA 4OGQD 1SQBK 1NTZG 1KILE 1M8OB 2QG4A 1URQD 3HUSB 5GTIE 3Q5RA 3CD6P 4JYBA 1VQ6P 2BCCD 4DJGA 2H88C 2NZ2A 2H43A 1HTLC 1WMKA 3D6ZA 2Y9ZA 1K73Q 1EC5A 1RH5B 2MKVA 2QJKC 4U3FG 1NTMD 2IDBA 1LWUC 1OWAA 2FY8A 2QSIA 2ZYGA 3AE6C 3B71A 1IK7A 2FXMA 3CX5D 3MUDC 3V5BA 2Z4EA 3Q2YA 4BRYB 2GM4A 5K5GB 1J1DB 1JEKA 4PD4E 5CCHA 1SQQD 3JSVC 3G4SP 1SQXK 2KZJA 1L0LK 2L91A 1NU1G 4M3LA 3D70A 1EZVI 3AE8C 1RE3C 3A5TA 3MUDA 1KD1Q 2E75D 3B8EB 3KQGA 3LIEA 1FJPA 2R44A 1SQVJ 2G8YA 2ZYAA 3H1HE 3CXHE 2QRXA 3RK2B 1X8YA 2K88A 1OVVA 3L35A 2M5AB 3H1LD 4L76A 1BE3G 1DEEG 4C7NB 1QL1A 1S3JA 3HE5A 3BATA 1VQLP 1ZP0C 2KS1A 1EZVE 4I6MC 2WPRA 3P8CD 4EYYQ 2AEFA 4D6TG 1NH4A 1VF5D 1NOHA 2QJYC 3VYIA 1R8EA 1NAFA 1RQUA 5KLVG 2QEXP 2JEEA 1DX7A 3HE5B 1JCCA 1KILC 2M0BA 2ZVOB 3AE4C 2D2CB 3L73E 1QVFO 1YTZT 1HGZA 1NU1E 1NU1D 3CX5I 3E7KA 1IC2A 3NFQA 2OYHB 1JB0J 3O8ZA 3RL0C 1FDIA 1JTHB 1SQQG 2KSJA 1KN7A 1D7MA 2K3RA 2E76D 4H0LD 3U1CA 1KILA 2L5GB 3A2AA 2C9NY 1LTJC 2QJPC 1PGOA 3I5CA 3P32A 3GMAA 1EZVD 5AVWB 1FS0E 3QH9A 1Q81Q 1X22A 4IOIH 2XZRA 2M3EA 1GK6A 1T3UA 1RF0A 1L0LJ 3AE3C 3V2PA 5BVZA 1EDIA 2PGDA 2V4HA 3E1IA 4PJ0E 3PP5A 2QA4P 3RK3B 2A06D 2CPBA 1FC2C 3AE9C 3TGUG 1L4AC 1KILB 5CHXA 3CWBJ 1FAVA 3CWBE 3H1LJ 3V2NA 3B4SA 3K5BA 1URQA 3RL0D 1QL2A 1JO5A 2RH0A 3FX0A 1JY3N 3L71E 1RF1C 3N4XA 2O1KA 1N86A 3CL3D 4A7PA 3TDKA 3O6QB 3H1IE 1NHLA 5APWA 1N73A 1IO4A 1ZRTD 1EXJA 3NMDA 1KV4A 3Q5PA 5KLVJ 5CCHD 1MFTA 1R5SA 4H44D 1KYOD 1FZEA 1LTBC 2FBWC 5APVA 4PD4I 5B66H 2O01N 4IFDK 1L0NE 1M57D 1SQVK 3RK3C 3M0DC 4UB6H 1DEBA 2M5AA 4GIFA 1J2JB 1LP1A 2G3AA 3RBXA 4D6TE 1GL2B 1S72P 1USEA 1PGQA 1EZVG 1FZBA 1EDKA 5E79E 1S1CX 4AQRD 1L4AA 1UIIA 2B9BA 4WY4A 2YMKA 3L72E 2WPVB 4LC1A 3KZIE 4NPEA 4GOEA 1GU4A 2QJKB 3H1HG 3M0AA 3Q1MA 1FJKA 3Q5SA 1DH3A 5BU8B 1QGKB 3WU2H 1ZN5A 3M91A 5CMZA 1VQ8P 3JC22 1JCDA 1JMMA 1ZR2A 2KK7A 1KQSO 2AEJA 1JY2P 1PIXA 2JJLA 4D6TJ 4WWIA 1KB9I 3A0HH 3H1LE 4O9BA 2C9LY 2JO1A 1GZLA 1W5CE 2HFED 3AEAC 3CI9A 4IFFA 4EIJA 1NGMB 5AW7B 2IPPA 1SQPK 5APYA 3S9OA 1NYHA 1JM0A 1CI6B 3H1LG 3LIDA 4D6TD 1VQ4P 2HODA 4PD4H 5APSA 1Q90D 1TU3F 3VMZA 3AEBC 3HE4A 3SSUA 1HJ0A 1OX3A 2JR8A 4U3FD 3MGNA 4PD4D 1YTZI 1K04A 1M1JA 3L71J 4OWFA 1H88A 1IFDA 1LTIC 1ZRTE 3H32B 2FFDB 1YQ4C 2HYNA 1S4XA 2IZ1A 5AVUB 1FZCA 4LLHA 5EFWB 1HUCA 1NTMJ 2HLOA 1MKMA 1SQPJ 1NTKG 4OGQC 1MZ9A 3L71D 3VTPC 1W2BO 1PP9G 3V2QA 1DD4A 5AVSB 5AVRB 2WZ7A 3M9BA 5AW2B 4H0LB 3WUTA 3S4RA 2AXTH 2N9BA 2FXPA 2W8ZA 3U59A 1PZQA 1AQTA 3AE7C 1SQXJ 1Y8AA 3MP7B 2C0XA 3CCSP 2A06E 2WVRA 2WSSH 2POHA 5AW6B 1K8AQ 2D2CC 1JY2N 4UB8E 2AEMA 3A0BE 1PFIA 1JUNA 3GF3A 1AQ5A 1NKNA 2O01H 2FYUG 1M1JC 2PAJA 2XNDH 3MTUE 1G1IA 4ZKUA 2W90A 3L75J 3CMEP 1YIJP 1EDJA 2KUBA 2V7QH 1SLQA 2B87B 2XKMA 3M0DA 5APUA 5CJ4A 3L72D 2WSEJ 1SS1A 3RK2D 5AW0B 1OW8A 3D6YA 1L0NG 5C39A 1N8RQ 2I1KA 2GUVA 3R2PA 4KHXA 1L0ND 5AW1B 5AVXB 3FGAD 2Z5HA 2NPSA 2E75C 5KAFE 5KAFH 5KLVD 3L74G 1OW7A 2OYOA 1GTWA 1MV8A 3BCCJ 1FZGA 3H1ID 2ZFCA 4RJTA 1LWUB 3SFEC 1BE3D 3USSA 1ZW0A 3CXHD 1FZFA 3RBZA 2LR2A 2NPSC 3LW5H 3OW2O 4L74A 3RK2C 1U7MA 2WSFH 3L75E 3PHLA 3TGUE 3P8CE 1QX8A 2WMMA 1AVYA 3MD0A 1M1KQ 1NTZJ 1SQXG 3KYQA 3IN6A 3SWYA 2FYZA 1G2CB 2QVAA 2W27A 2Y0CA 4I7ZC 4YXDC 1VQOP 5AW8B 1GL2D 3E1RA 3AEGC 2Y0DA 1VQ5P 3GHGC 4NPFX 1X9VA 4UB8H 1IFMA 2KZIA 3KDPB 5AVYB 1YJNP 2J58A 2R3SA 2H7HA 1IJDB 1L2PA 1NTMG 1SQXD 1ZOYC 2HG5D 4H44B 5AW5B 2ZT9B 1SQPD 1NTKJ 1SQQE 1SQBJ 1S2EA 2NRGA 3VMXA 2BCCE 3L36A 3AE2C 1FZAA 1YYCA 1T8ZA 2E5TA 3FXDA 2BCCG 2FXOA 4I1LA 1E5WA 1EQ7A 3H1JJ 3OJAB 1G1JA 1YI2P 2E42A 1L0NJ 3TNUB 1NTME 3SWKA 2JWAA 2K9JB 3V4QA 3GG2A 3BASA 1AV1A 1ZMEC 1P84H 1M7LA 1WRGA 1L4AD 2W83C 2JKVA 5TJHA 5KLVE 1Q7YQ 4U3FE 2Q5UA 3RL0B 2K37A 3I56P 1HGVA 1RHZB 5AW9B 1KILD 2IYPA 2ZAEB 3ZDMA 2N1TC 3BCCG 1ZLLA 3M9HA 4RKUJ 3IFMA 2WSFJ 4JBZA 3L70J 3RK3D 3LW5J 3L75G 3L73D 2C0WA 1KB9H 2LXBA 4Y99C 4YTPC 5AVTB 1SQVD 3TYYA 1VQPP 1X79B 1FZCB 2OYIB 4H0LC 3H1KG 2K9YA 3H32A 3WU2E 2P7JA 5CBOA 1KTMA 3F5HA 3L70D 2N9YB 1HVVA 2PRRA 2OQQA 3L4FA 3C1LA 1T6AA 1PPJD 2E76B 2ZJSE 1CSBA 3HE4B 1IZNB 1FDOA 1SQBE 1SQQJ 2AXTE 3HTKB 5AVVB 1LTAC 4W7YA 3GF7A 2NPSD 3CLQA 2R5DA 5E79H 2SPZA 1BCCJ 3MZWB 2RMZA 5M1BA 1YJ9P 3L74J 2D2CD 3KZIH 2FYNC 4TT3H 5B66E 1EXIA 1M56D 1SP4A 1SQBG 2KOGA 2R5BA 1BGYJ 1NTZK 1PGPA 1N7LA 1KYOE 1VF5B 2CPSA 2V7QJ 3L72G 4UB6E 3CPWO 2BCCJ 1GW3A 2E5YA 4I2LC 1U57A 5APXA 1IK9A 3H1JG 4IL6H 1PL5A 2A45I 3H6PA 3CCMP 2FYUE 4WY4B 1URQC 2WSCJ 1NAYA 5KJ7D 2N1TB 4ZKPA 1IFNA 1JY2O 2Z5IA 1Q86Q 2E75B 1QEXA 2PP6A 2QIWA 1LT9B 1DIPA 2KIKA 1OVRA 2R32A 5B5EH 2A06G 2OGUA 2OTKE 4BXLA 4GODA 3BVHA 1AFOA 3CWBD 3PLNA 1NU1K 2I1JA 1KB9D 1T3JA 3S1KA 4LGDE 5AW3B 3M9QA 5CBNA 1PP9E 1VL2A 2Q6QA 5L8RJ 2HR3A 4JPZB 3O6QA 1K05A 1HWTC 2B88A 2WSCH 4JYCA 3V2RA 2XNXA 3VMYA 1T2KC 1SFCA 1GD2E 1URQB 3HD7C 2K1AA 3HUSC 2I8DA 2HODB 1BSNA 4OGQB 2E43A 2W6JH 3WUVA 3B5NA 1HBWA 2ZT9C 2YXQB 1N7SA 2FFDC 2IX7C 5DJTB 2H89C 1N7SB 2KXPB 2AXCA 3B5NB 3L72J 1OXZA 5AW4B 4B86A 3H1KJ 1KC8Q 2HPCA 2ZXXA 3A7OA 4CPGA 2O01J 2OTJP 5KLVK 3FWNA 2VRSA 2WTYA 1K9MQ 4IFMA 1JY3P 3C8VA 3FXEA 3A0BH 3H1HD 1Y9BA 1GL2A 5KAIE 3UIAA 4DCKA 1BCCE 3GLMA 5GTHE 3L74E 4R4MA 1Q82Q 3HD7A 3CXHH 4Z1MH 1MUUA 1ZV8A 4IL6E 1IFPA 2YXRB 3SFDC 5CJ0A 3CC7P 1OFCX 3Q3DA 1E79H 1BGYD 3V4WA 2Y9YA 2E74D 3ITKA 3NXSA 4WBAA 1N73B 2GA1A 1PP9J 2PFXA 2IBZE 3AEDC 3HD7B 3QWOC 4QMAA 4C7NA 1LT9A 5KKZC 1FBMA 4C46A 2YKOA 2WWWA 2XU6A 3H1JE 2IFMA 1GW4A 2N1TA 5H2FE 1LT1A 1HJBA 4HH2A 2OYIC 5CCGC 1M90Q 1PP9D 3TF5A
chains in the Genus database with same CATH topology
3FXDA 5DJUB 1H0TA 1Q2NA 1MFTA 1BDDA 4ZMDA 2ZAEB 4HJGH 2M5AA 1JMBA 3ZDMA 4NPDA 1LP1A 2B87A 4JBZA 1OVUA 1EDKA 2JWDA 2RKLA 2LXBA 4NPEA 4GOEA 5CBOA 1BDCA 2KI7B 1Y47A 4WWIA 1LP1B 2SPZA 2KS1B 2P58A 3MZWB 2LXCB 1JM0A 4ZNCA 4K3AA 3MHVA 1ZXGA 1X0TA 4ASWA 4MN4C 3RGUA 1EDLA 4GOFA 5EFWB 4KJMA 2KIKA 1OVRA 4BXLA 1EC5A 2OTKE 4GODA 3S1KA 5K5GB 5CBNA 2HR3A 2KZJA 2B88A 1EDJA 2R44A 2KUBA 2I8DA 2B87B 2QRXA 4HB1A 2UWJE 1OVVA 4HKZH 2M5AB 1DEEG 1S3JA 1SS1A 2Q1KA 4EYYQ 5C39A 1NVOA 5DJTB 2M0BA 4CPGA 3FXEA 2K3RA 1ZW0A 4ASVA 1U7JA 2LR2A 3PH0A 1U7MA 2WMMA 4IOIH 2B89A 1H0TB 1EDIA 2QVAA 1FC2C 3QWOC 4NPFX 4K35A 2KZIA 1LT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD A;  5DJU B;  1H0T A;  1Q2N A;  1MFT A;  1BDD A;  4ZMD A;  2ZAE B;  4HJG H;  2M5A A;  1JMB A;  3ZDM A;  4NPD A;  1LP1 A;  2B87 A;  4JBZ A;  1OVU A;  1EDK A;  2JWD A;  2RKL A;  2LXB A;  4NPE A;  4GOE A;  5CBO A;  1BDC A;  2KI7 B;  1Y47 A;  4WWI A;  1LP1 B;  2SPZ A;  2KS1 B;  2P58 A;  3MZW B;  2LXC B;  1JM0 A;  4ZNC A;  4K3A A;  3MHV A;  1ZXG A;  1X0T A;  4ASW A;  4MN4 C;  3RGU A;  1EDL A;  4GOF A;  5EFW B;  4KJM A;  2KIK A;  1OVR A;  4BXL A;  1EC5 A;  2OTK E;  4GOD A;  3S1K A;  5K5G B;  5CBN A;  2HR3 A;  2KZJ A;  2B88 A;  1EDJ A;  2R44 A;  2KUB A;  2I8D A;  2B87 B;  2QRX A;  4HB1 A;  2UWJ E;  1OVV A;  4HKZ H;  2M5A B;  1DEE G;  1S3J A;  1SS1 A;  2Q1K A;  4EYY Q;  5C39 A;  1NVO A;  5DJT B;  2M0B A;  4CPG A;  3FXE A;  2K3R A;  1ZW0 A;  4ASV A;  1U7J A;  2LR2 A;  3PH0 A;  1U7M A;  2WMM A;  4IOI H;  2B89 A;  1H0T B;  1EDI A;  2QVA A;  1FC2 C;  3QWO C;  4NPF X;  4K35 A;  2KZI A;  1LT1 A; 
#chains in the Genus database with same CATH topology
 3G71 P;  3P8M C;  2HPC B;  1NJI Q;  3L71 G;  1XTC C;  2P1J A;  3V6I A;  4U3F J;  3MIW A;  2KSE A;  5DJU B;  3U1A A;  4PV1 B;  5KAI H;  2JP3 A;  3BRT B;  4BRY A;  4L73 A;  4HYT B;  1LTT C;  1OMI A;  4BWN A;  1H0T A;  1DD3 A;  4H13 B;  4EI2 A;  5CCG A;  3D71 A;  1LTG C;  3CXH I;  4ZMD A;  2OYH C;  2OTL P;  4YXW H;  2KP8 A;  3KXD A;  1GMJ A;  3CCJ P;  1NTZ E;  4GKG A;  5KTB A;  3CCL P;  1RQV A;  1JMB A;  3I55 P;  1VPC A;  4NPD A;  3HTK A;  3H25 A;  4PJ0 H;  2JWD A;  2CK3 H;  1KOR A;  1SFC B;  3HUS A;  1JTH A;  1LT9 C;  2P67 A;  2RKL A;  2WPS A;  1SQV G;  1RY3 A;  2YKP A;  3T97 A;  4DT0 A;  5KJ7 C;  1GU5 A;  4L75 A;  4IL6 X;  2OYH A;  3IR9 A;  1AJY A;  3H1K D;  1S5L X;  1NKZ B;  3KHU A;  1KFM A;  2OYI A;  1FU1 A;  1L0L D;  1LGH B;  1KZU B;  1JY3 O;  2A45 G;  2JDI H;  2XV5 A;  3BCC D;  3JCU H;  3L37 A;  4Y28 J;  2WT7 B;  4TLF A;  1GDT A;  1KQF B;  3AE1 C;  3EQ2 A;  1L0L G;  3R4Y A;  2O3J A;  4PV1 C;  3OAK A;  4N6J A;  1AVO A;  1PPJ G;  2IZ0 A;  5KLI C;  1OZH A;  1KQL A;  2KS1 B;  3TGU J;  1PPJ E;  2Y0E A;  2YO2 A;  1VQ7 P;  2J5U A;  4XA4 A;  2A45 H;  3MHV A;  3CX5 E;  1L0L E;  4JQ0 D;  2WSE H;  3G3Z A;  1GL2 C;  1ZXG A;  2K9J A;  2E74 C;  2LKM A;  3JCU E;  3A3Y B;  3TNU A;  2MJZ A;  3N7N A;  1NTK K;  1VDF A;  1P84 D;  4Y99 B;  3HD7 D;  2Q9I A;  3CC4 P;  4GDO A;  4KJM A;  1EDL A;  1NTZ D;  1KQG B;  1RE4 A;  4C7R A;  3RL0 g;  1LTS C;  1YBK A;  3TSI A;  2E76 C;  2WQY C;  4DZO A;  3CCQ P;  1SFC C;  3GW6 A;  4RES B;  1S9K E;  1S9K D;  1YIT P;  1VQK P;  5B5E E;  2YNY A;  1FZC C;  1SQQ K;  1A02 J;  2YIU B;  3L73 J;  2QJY B;  3VMA A;  4WB4 A;  3CCV P;  3SWF A;  3B5N C;  1JOC A;  1HH0 A;  1P84 E;  1BGY E;  1WT6 A;  2WIT A;  1BSH A;  1CW5 A;  4W80 A;  1SQP E;  3EFG A;  1N2D C;  1VF5 C;  2BEZ F;  2ZXE B;  1A02 F;  1VQ9 P;  3H1J D;  5BU5 A;  1KYO H;  3CCU P;  1N7S D;  3L74 D;  4JF7 A;  2FYN B;  1BCC D;  4I7Z B;  3VOP A;  3H1K E;  1KMI Z;  5APT A;  1OW6 A;  4AUW A;  1LTJ B;  2QJP B;  2UWJ E;  4HB1 A;  5AVQ B;  1P84 I;  4HKZ H;  1LJ2 A;  4DOJ A;  2Q1K A;  1SQB D;  3PJS K;  2FYU K;  2H8P D;  2KNC B;  5GTI H;  2ZYD A;  1W2E A;  4H44 C;  2KYV A;  3L75 D;  3PRJ A;  3W67 A;  3BCC E;  4RO0 A;  4WVZ A;  1NVO A;  5KJ7 A;  1AA0 A;  1LNQ A;  2W6B A;  1UIX A;  4WY4 C;  5GTH H;  5KKZ B;  3ABV C;  3GHG B;  3H1I G;  2P2U A;  3CMA P;  3KPE A;  4EOT A;  1SVF A;  1BCC G;  3H1H J;  2YO3 A;  1NO4 A;  2ITA A;  3AEC C;  3IAO A;  2Q7C A;  1FOS F;  3F89 A;  3G9R A;  1YQ3 C;  1KFN A;  4H13 C;  3G6E P;  3TGU D;  3L70 G;  1ZR4 A;  1FDM A;  1RF1 B;  1FE6 A;  1KYO I;  4ASV A;  2XDJ A;  3BRV B;  5H2F H;  3WMM 0;  1OIP A;  1U7J A;  3PH0 A;  1GK4 A;  1R5L A;  3L73 G;  2IBZ G;  3GHG A;  2W6A A;  1G2C A;  2N1T D;  3P7K A;  2B89 A;  2ZVN B;  4WY4 D;  4EDF A;  1YJW P;  1NWQ A;  1SFC D;  1NTK E;  1NTK D;  4N78 D;  4N78 E;  1YHQ P;  3TK1 A;  2YKQ A;  1J1E C;  3HRN A;  4K35 A;  1SQX E;  4OH8 B;  2FYU J;  3VN0 A;  2KLU A;  1Z56 A;  1H8A A;  1LWU A;  1SQP G;  2DW3 A;  1QLE D;  3AEF C;  2KB7 P;  2IBZ D;  4H13 D;  1BGY G;  2RN0 A;  4N3Y B;  1S5L H;  1N7S C;  4PV1 D;  2FFD A;  3CCE P;  5CCH C;  2NPS B;  1NTM K;  2M3B A;  3OA7 A;  2FKW B;  1RE3 A;  4XE5 B;  1Q2N A;  2M8R A;  3FWL A;  1BDD A;  3H1I J;  1CI6 A;  1IFJ A;  2BAS A;  2YMY A;  1USD A;  1VQM P;  3M06 A;  1BE3 E;  1BE3 J;  2IFN A;  4AYC A;  1H89 A;  3EWK A;  4HJG H;  1XTG B;  4R4L A;  2B87 A;  2O1J A;  2QE7 H;  1J1E B;  5TIS H;  2E74 B;  1OVU A;  2GUS A;  2IYO A;  3II6 A;  3W68 A;  1IFI A;  1RF1 A;  2OAR A;  2WPQ A;  3CX5 H;  2J59 M;  1RF0 C;  4KT0 J;  1PV3 A;  2YIU C;  4W7Z A;  1BDC A;  2KLV A;  2QM7 A;  1N73 C;  2KI7 B;  1NU1 J;  1PGJ A;  2P10 A;  3EFF K;  3L70 E;  1Y47 A;  3PTZ A;  1L4A B;  4YPC A;  5TIS E;  1JNM A;  1T2K D;  1H0T B;  3AE5 C;  4XFJ A;  2IBZ I;  1LP1 B;  1RE4 C;  3AEE C;  4OVN F;  2Q3I A;  4U7J A;  1MFZ A;  2KNC A;  2P58 A;  3CC2 P;  1HF9 A;  2LXC B;  2QM8 A;  5APQ A;  1CZQ A;  3C9I A;  3RK3 E;  4ZNC A;  4K3A A;  1LTJ A;  2ZT9 D;  5AVZ B;  3B5N D;  1J1D C;  2Q3E A;  5KLI B;  3A0H E;  2WT7 A;  1QVG O;  1X0T A;  3IF4 A;  3WUU A;  1L0N K;  1SQV E;  2BEQ D;  4GT1 A;  4MN4 C;  3RGU A;  1S5L E;  4ASW A;  5CCG D;  3CCR P;  3VP9 A;  1FOS E;  1VQN P;  2R3C A;  1KB9 E;  1M1J B;  3CWB G;  4GOF A;  3VP8 A;  3T97 B;  2FYU D;  3NTN A;  4OGQ D;  1SQB K;  1NTZ G;  1KIL E;  1M8O B;  2QG4 A;  1URQ D;  3HUS B;  5GTI E;  3Q5R A;  3CD6 P;  4JYB A;  1VQ6 P;  2BCC D;  4DJG A;  2H88 C;  2NZ2 A;  2H43 A;  1HTL C;  1WMK A;  3D6Z A;  2Y9Z A;  1K73 Q;  1EC5 A;  1RH5 B;  2MKV A;  2QJK C;  4U3F G;  1NTM D;  2IDB A;  1LWU C;  1OWA A;  2FY8 A;  2QSI A;  2ZYG A;  3AE6 C;  3B71 A;  1IK7 A;  2FXM A;  3CX5 D;  3MUD C;  3V5B A;  2Z4E A;  3Q2Y A;  4BRY B;  2GM4 A;  5K5G B;  1J1D B;  1JEK A;  4PD4 E;  5CCH A;  1SQQ D;  3JSV C;  3G4S P;  1SQX K;  2KZJ A;  1L0L K;  2L91 A;  1NU1 G;  4M3L A;  3D70 A;  1EZV I;  3AE8 C;  1RE3 C;  3A5T A;  3MUD A;  1KD1 Q;  2E75 D;  3B8E B;  3KQG A;  3LIE A;  1FJP A;  2R44 A;  1SQV J;  2G8Y A;  2ZYA A;  3H1H E;  3CXH E;  2QRX A;  3RK2 B;  1X8Y A;  2K88 A;  1OVV A;  3L35 A;  2M5A B;  3H1L D;  4L76 A;  1BE3 G;  1DEE G;  4C7N B;  1QL1 A;  1S3J A;  3HE5 A;  3BAT A;  1VQL P;  1ZP0 C;  2KS1 A;  1EZV E;  4I6M C;  2WPR A;  3P8C D;  4EYY Q;  2AEF A;  4D6T G;  1NH4 A;  1VF5 D;  1NOH A;  2QJY C;  3VYI A;  1R8E A;  1NAF A;  1RQU A;  5KLV G;  2QEX P;  2JEE A;  1DX7 A;  3HE5 B;  1JCC A;  1KIL C;  2M0B A;  2ZVO B;  3AE4 C;  2D2C B;  3L73 E;  1QVF O;  1YTZ T;  1HGZ A;  1NU1 E;  1NU1 D;  3CX5 I;  3E7K A;  1IC2 A;  3NFQ A;  2OYH B;  1JB0 J;  3O8Z A;  3RL0 C;  1FDI A;  1JTH B;  1SQQ G;  2KSJ A;  1KN7 A;  1D7M A;  2K3R A;  2E76 D;  4H0L D;  3U1C A;  1KIL A;  2L5G B;  3A2A A;  2C9N Y;  1LTJ C;  2QJP C;  1PGO A;  3I5C A;  3P32 A;  3GMA A;  1EZV D;  5AVW B;  1FS0 E;  3QH9 A;  1Q81 Q;  1X22 A;  4IOI H;  2XZR A;  2M3E A;  1GK6 A;  1T3U A;  1RF0 A;  1L0L J;  3AE3 C;  3V2P A;  5BVZ A;  1EDI A;  2PGD A;  2V4H A;  3E1I A;  4PJ0 E;  3PP5 A;  2QA4 P;  3RK3 B;  2A06 D;  2CPB A;  1FC2 C;  3AE9 C;  3TGU G;  1L4A C;  1KIL B;  5CHX A;  3CWB J;  1FAV A;  3CWB E;  3H1L J;  3V2N A;  3B4S A;  3K5B A;  1URQ A;  3RL0 D;  1QL2 A;  1JO5 A;  2RH0 A;  3FX0 A;  1JY3 N;  3L71 E;  1RF1 C;  3N4X A;  2O1K A;  1N86 A;  3CL3 D;  4A7P A;  3TDK A;  3O6Q B;  3H1I E;  1NHL A;  5APW A;  1N73 A;  1IO4 A;  1ZRT D;  1EXJ A;  3NMD A;  1KV4 A;  3Q5P A;  5KLV J;  5CCH D;  1MFT A;  1R5S A;  4H44 D;  1KYO D;  1FZE A;  1LTB C;  2FBW C;  5APV A;  4PD4 I;  5B66 H;  2O01 N;  4IFD K;  1L0N E;  1M57 D;  1SQV K;  3RK3 C;  3M0D C;  4UB6 H;  1DEB A;  2M5A A;  4GIF A;  1J2J B;  1LP1 A;  2G3A A;  3RBX A;  4D6T E;  1GL2 B;  1S72 P;  1USE A;  1PGQ A;  1EZV G;  1FZB A;  1EDK A;  5E79 E;  1S1C X;  4AQR D;  1L4A A;  1UII A;  2B9B A;  4WY4 A;  2YMK A;  3L72 E;  2WPV B;  4LC1 A;  3KZI E;  4NPE A;  4GOE A;  1GU4 A;  2QJK B;  3H1H G;  3M0A A;  3Q1M A;  1FJK A;  3Q5S A;  1DH3 A;  5BU8 B;  1QGK B;  3WU2 H;  1ZN5 A;  3M91 A;  5CMZ A;  1VQ8 P;  3JC2 2;  1JCD A;  1JMM A;  1ZR2 A;  2KK7 A;  1KQS O;  2AEJ A;  1JY2 P;  1PIX A;  2JJL A;  4D6T J;  4WWI A;  1KB9 I;  3A0H H;  3H1L E;  4O9B A;  2C9L Y;  2JO1 A;  1GZL A;  1W5C E;  2HFE D;  3AEA C;  3CI9 A;  4IFF A;  4EIJ A;  1NGM B;  5AW7 B;  2IPP A;  1SQP K;  5APY A;  3S9O A;  1NYH A;  1JM0 A;  1CI6 B;  3H1L G;  3LID A;  4D6T D;  1VQ4 P;  2HOD A;  4PD4 H;  5APS A;  1Q90 D;  1TU3 F;  3VMZ A;  3AEB C;  3HE4 A;  3SSU A;  1HJ0 A;  1OX3 A;  2JR8 A;  4U3F D;  3MGN A;  4PD4 D;  1YTZ I;  1K04 A;  1M1J A;  3L71 J;  4OWF A;  1H88 A;  1IFD A;  1LTI C;  1ZRT E;  3H32 B;  2FFD B;  1YQ4 C;  2HYN A;  1S4X A;  2IZ1 A;  5AVU B;  1FZC A;  4LLH A;  5EFW B;  1HUC A;  1NTM J;  2HLO A;  1MKM A;  1SQP J;  1NTK G;  4OGQ C;  1MZ9 A;  3L71 D;  3VTP C;  1W2B O;  1PP9 G;  3V2Q A;  1DD4 A;  5AVS B;  5AVR B;  2WZ7 A;  3M9B A;  5AW2 B;  4H0L B;  3WUT A;  3S4R A;  2AXT H;  2N9B A;  2FXP A;  2W8Z A;  3U59 A;  1PZQ A;  1AQT A;  3AE7 C;  1SQX J;  1Y8A A;  3MP7 B;  2C0X A;  3CCS P;  2A06 E;  2WVR A;  2WSS H;  2POH A;  5AW6 B;  1K8A Q;  2D2C C;  1JY2 N;  4UB8 E;  2AEM A;  3A0B E;  1PFI A;  1JUN A;  3GF3 A;  1AQ5 A;  1NKN A;  2O01 H;  2FYU G;  1M1J C;  2PAJ A;  2XND H;  3MTU E;  1G1I A;  4ZKU A;  2W90 A;  3L75 J;  3CME P;  1YIJ P;  1EDJ A;  2KUB A;  2V7Q H;  1SLQ A;  2B87 B;  2XKM A;  3M0D A;  5APU A;  5CJ4 A;  3L72 D;  2WSE J;  1SS1 A;  3RK2 D;  5AW0 B;  1OW8 A;  3D6Y A;  1L0N G;  5C39 A;  1N8R Q;  2I1K A;  2GUV A;  3R2P A;  4KHX A;  1L0N D;  5AW1 B;  5AVX B;  3FGA D;  2Z5H A;  2NPS A;  2E75 C;  5KAF E;  5KAF H;  5KLV D;  3L74 G;  1OW7 A;  2OYO A;  1GTW A;  1MV8 A;  3BCC J;  1FZG A;  3H1I D;  2ZFC A;  4RJT A;  1LWU B;  3SFE C;  1BE3 D;  3USS A;  1ZW0 A;  3CXH D;  1FZF A;  3RBZ A;  2LR2 A;  2NPS C;  3LW5 H;  3OW2 O;  4L74 A;  3RK2 C;  1U7M A;  2WSF H;  3L75 E;  3PHL A;  3TGU E;  3P8C E;  1QX8 A;  2WMM A;  1AVY A;  3MD0 A;  1M1K Q;  1NTZ J;  1SQX G;  3KYQ A;  3IN6 A;  3SWY A;  2FYZ A;  1G2C B;  2QVA A;  2W27 A;  2Y0C A;  4I7Z C;  4YXD C;  1VQO P;  5AW8 B;  1GL2 D;  3E1R A;  3AEG C;  2Y0D A;  1VQ5 P;  3GHG C;  4NPF X;  1X9V A;  4UB8 H;  1IFM A;  2KZI A;  3KDP B;  5AVY B;  1YJN P;  2J58 A;  2R3S A;  2H7H A;  1IJD B;  1L2P A;  1NTM G;  1SQX D;  1ZOY C;  2HG5 D;  4H44 B;  5AW5 B;  2ZT9 B;  1SQP D;  1NTK J;  1SQQ E;  1SQB J;  1S2E A;  2NRG A;  3VMX A;  2BCC E;  3L36 A;  3AE2 C;  1FZA A;  1YYC A;  1T8Z A;  2E5T A;  3FXD A;  2BCC G;  2FXO A;  4I1L A;  1E5W A;  1EQ7 A;  3H1J J;  3OJA B;  1G1J A;  1YI2 P;  2E42 A;  1L0N J;  3TNU B;  1NTM E;  3SWK A;  2JWA A;  2K9J B;  3V4Q A;  3GG2 A;  3BAS A;  1AV1 A;  1ZME C;  1P84 H;  1M7L A;  1WRG A;  1L4A D;  2W83 C;  2JKV A;  5TJH A;  5KLV E;  1Q7Y Q;  4U3F E;  2Q5U A;  3RL0 B;  2K37 A;  3I56 P;  1HGV A;  1RHZ B;  5AW9 B;  1KIL D;  2IYP A;  2ZAE B;  3ZDM A;  2N1T C;  3BCC G;  1ZLL A;  3M9H A;  4RKU J;  3IFM A;  2WSF J;  4JBZ A;  3L70 J;  3RK3 D;  3LW5 J;  3L75 G;  3L73 D;  2C0W A;  1KB9 H;  2LXB A;  4Y99 C;  4YTP C;  5AVT B;  1SQV D;  3TYY A;  1VQP P;  1X79 B;  1FZC B;  2OYI B;  4H0L C;  3H1K G;  2K9Y A;  3H32 A;  3WU2 E;  2P7J A;  5CBO A;  1KTM A;  3F5H A;  3L70 D;  2N9Y B;  1HVV A;  2PRR A;  2OQQ A;  3L4F A;  3C1L A;  1T6A A;  1PPJ D;  2E76 B;  2ZJS E;  1CSB A;  3HE4 B;  1IZN B;  1FDO A;  1SQB E;  1SQQ J;  2AXT E;  3HTK B;  5AVV B;  1LTA C;  4W7Y A;  3GF7 A;  2NPS D;  3CLQ A;  2R5D A;  5E79 H;  2SPZ A;  1BCC J;  3MZW B;  2RMZ A;  5M1B A;  1YJ9 P;  3L74 J;  2D2C D;  3KZI H;  2FYN C;  4TT3 H;  5B66 E;  1EXI A;  1M56 D;  1SP4 A;  1SQB G;  2KOG A;  2R5B A;  1BGY J;  1NTZ K;  1PGP A;  1N7L A;  1KYO E;  1VF5 B;  2CPS A;  2V7Q J;  3L72 G;  4UB6 E;  3CPW O;  2BCC J;  1GW3 A;  2E5Y A;  4I2L C;  1U57 A;  5APX A;  1IK9 A;  3H1J G;  4IL6 H;  1PL5 A;  2A45 I;  3H6P A;  3CCM P;  2FYU E;  4WY4 B;  1URQ C;  2WSC J;  1NAY A;  5KJ7 D;  2N1T B;  4ZKP A;  1IFN A;  1JY2 O;  2Z5I A;  1Q86 Q;  2E75 B;  1QEX A;  2PP6 A;  2QIW A;  1LT9 B;  1DIP A;  2KIK A;  1OVR A;  2R32 A;  5B5E H;  2A06 G;  2OGU A;  2OTK E;  4BXL A;  4GOD A;  3BVH A;  1AFO A;  3CWB D;  3PLN A;  1NU1 K;  2I1J A;  1KB9 D;  1T3J A;  3S1K A;  4LGD E;  5AW3 B;  3M9Q A;  5CBN A;  1PP9 E;  1VL2 A;  2Q6Q A;  5L8R J;  2HR3 A;  4JPZ B;  3O6Q A;  1K05 A;  1HWT C;  2B88 A;  2WSC H;  4JYC A;  3V2R A;  2XNX A;  3VMY A;  1T2K C;  1SFC A;  1GD2 E;  1URQ B;  3HD7 C;  2K1A A;  3HUS C;  2I8D A;  2HOD B;  1BSN A;  4OGQ B;  2E43 A;  2W6J H;  3WUV A;  3B5N A;  1HBW A;  2ZT9 C;  2YXQ B;  1N7S A;  2FFD C;  2IX7 C;  5DJT B;  2H89 C;  1N7S B;  2KXP B;  2AXC A;  3B5N B;  3L72 J;  1OXZ A;  5AW4 B;  4B86 A;  3H1K J;  1KC8 Q;  2HPC A;  2ZXX A;  3A7O A;  4CPG A;  2O01 J;  2OTJ P;  5KLV K;  3FWN A;  2VRS A;  2WTY A;  1K9M Q;  4IFM A;  1JY3 P;  3C8V A;  3FXE A;  3A0B H;  3H1H D;  1Y9B A;  1GL2 A;  5KAI E;  3UIA A;  4DCK A;  1BCC E;  3GLM A;  5GTH E;  3L74 E;  4R4M A;  1Q82 Q;  3HD7 A;  3CXH H;  4Z1M H;  1MUU A;  1ZV8 A;  4IL6 E;  1IFP A;  2YXR B;  3SFD C;  5CJ0 A;  3CC7 P;  1OFC X;  3Q3D A;  1E79 H;  1BGY D;  3V4W A;  2Y9Y A;  2E74 D;  3ITK A;  3NXS A;  4WBA A;  1N73 B;  2GA1 A;  1PP9 J;  2PFX A;  2IBZ E;  3AED C;  3HD7 B;  3QWO C;  4QMA A;  4C7N A;  1LT9 A;  5KKZ C;  1FBM A;  4C46 A;  2YKO A;  2WWW A;  2XU6 A;  3H1J E;  2IFM A;  1GW4 A;  2N1T A;  5H2F E;  1LT1 A;  1HJB A;  4HH2 A;  2OYI C;  5CCG C;  1M90 Q;  1PP9 D;  3TF5 A; 
#chains in the Genus database with same CATH homology
 3FXD A;  5DJU B;  1H0T A;  1Q2N A;  1MFT A;  1BDD A;  4ZMD A;  2ZAE B;  4HJG H;  2M5A A;  1JMB A;  3ZDM A;  4NPD A;  1LP1 A;  2B87 A;  4JBZ A;  1OVU A;  1EDK A;  2JWD A;  2RKL A;  2LXB A;  4NPE A;  4GOE A;  5CBO A;  1BDC A;  2KI7 B;  1Y47 A;  4WWI A;  1LP1 B;  2SPZ A;  2KS1 B;  2P58 A;  3MZW B;  2LXC B;  1JM0 A;  4ZNC A;  4K3A A;  3MHV A;  1ZXG A;  1X0T A;  4ASW A;  4MN4 C;  3RGU A;  1EDL A;  4GOF A;  5EFW B;  4KJM A;  2KIK A;  1OVR A;  4BXL A;  1EC5 A;  2OTK E;  4GOD A;  3S1K A;  5K5G B;  5CBN A;  2HR3 A;  2KZJ A;  2B88 A;  1EDJ A;  2R44 A;  2KUB A;  2I8D A;  2B87 B;  2QRX A;  4HB1 A;  2UWJ E;  1OVV A;  4HKZ H;  2M5A B;  1DEE G;  1S3J A;  1SS1 A;  2Q1K A;  4EYY Q;  5C39 A;  1NVO A;  5DJT B;  2M0B A;  4CPG A;  3FXE A;  2K3R A;  1ZW0 A;  4ASV A;  1U7J A;  2LR2 A;  3PH0 A;  1U7M A;  2WMM A;  4IOI H;  2B89 A;  1H0T B;  1EDI A;  2QVA A;  1FC2 C;  3QWO C;  4NPF X;  4K35 A;  2KZI A;  1LT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...