1NVOA

Solution structure of a four-helix bundle model, apo-df1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
b'DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homodimeric Alpha2 Four-Helix Bundle
molecule tags Unknown function
publication title Preorganization of molecular binding sites in designed diiron proteins
pubmed doi rcsb
total genus 17
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1nvoA00
2R44A 3MHVA 2M5AA 4IOIH 2HR3A 4ZNCA 1LP1B 2QVAA 1FC2C 2LXCB 4GODA 2B87B 5DJUB 1SS1A 2KZJA 2OTKE 2B89A 1MFTA 2KZIA 5CBNA 2LR2A 3QWOC 1NVOA 4GOFA 1OVVA 3RGUA 4MN4C 3ZDMA 2SPZA 1X0TA 1Y47A 4HJGH 4BXLA 4NPDA 1LP1A 4CPGA 1U7MA 4NPFX 2RKLA 2LXBA 2Q1KA 2KI7B 3PH0A 2I8DA 4K35A 1OVUA 1U7JA 1Q2NA 2K3RA 4ASVA 1OVRA 1EDKA 3MZWB 4EYYQ 1LT1A 1BDCA 1H0TB 2KUBA 1EDLA 4JBZA 2WMMA 4ASWA 1BDDA 1DEEG 2UWJE 1ZW0A 4HKZH 4ZMDA 5CBOA 1EDJA 5K5GB 2QRXA 4KJMA 1JMBA 1EC5A 5EFWB 4HB1A 5DJTB 2KS1B 2B88A 5C39A 3FXDA 1JM0A 4K3AA 4NPEA 1EDIA 2M5AB 2P58A 2JWDA 1S3JA 2ZAEB 2KIKA 1ZXGA 2B87A 1H0TA 3S1KA 4GOEA 4WWIA 3FXEA 2M0BA
chains in the Genus database with same CATH superfamily
2KNCA 2XNDH 3MHVA 1EXIA 4I6MC 3M91A 1L0LJ 2W6AA 4EI2A 4N3YB 3L72G 2O1KA 1BCCD 1A02F 2E43A 1CI6B 1CSBA 1SQXJ 1K73Q 2ZFCA 4BWNA 1LP1B 2QVAA 1ZR4A 1OIPA 3G9RA 3L72J 1FC2C 3PRJA 3RL0C 2OTLP 1NU1K 1QLED 3NMDA 1PGPA 1L0NG 2Y0DA 5CCHA 5CCHC 3CWBG 5DJUB 4WY4C 1VQMP 4EIJA 4H0LC 1SQBD 3M0AA 4YPCA 2G8YA 4U3FG 5APWA 2B89A 2E75C 5AVVB 3SWFA 3II6A 3I55P 3D71A 1KV4A 1DD3A 1LTSC 2FBWC 3L74E 1BCCE 1IFNA 2ZT9B 2PAJA 3AEBC 2L91A 1DIPA 5KJ7C 3L75D 5AW9B 3RL0D 3IAOA 1YTZI 3RK3E 2WSFH 2D2CB 5KLVK 3BCCG 5CCHD 1URQC 3TF5A 1RE3C 1NJIQ 4HYTB 2A45I 1EQ7A 2KNCB 3Q5PA 4ZKUA 3RGUA 2D2CC 1IK9A 2KOGA 4UB6H 3L75E 3BCCJ 2SPZA 2ZYAA 2NRGA 4D6TD 4WBAA 1FS0E 1Y47A 1ZLLA 2HLOA 2FKWB 3PP5A 1GL2D 1VQ7P 1NKZB 1PFIA 2QSIA 3C1LA 2HODA 3P7KA 2Z5HA 3JCUE 5KJ7A 1SQQJ 2OYHB 5CMZA 1RH5B 2WSCJ 2Z5IA 1OX3A 1KYOH 2ZVNB 1URQD 1ZV8A 2BCCD 4O9BA 2OYIC 3AE3C 1S2EA 1AFOA 1FZCB 1NTZE 2D2CD 3AECC 2AXTH 1YTZT 3Q2YA 1M57D 1K05A 2Y9YA 4PD4H 2RKLA 3KPEA 2QJPB 3EQ2A 1LTIC 2LXBA 5BU5A 5H2FH 3A7OA 4OGQB 1LTJC 5B5EH 3H1JJ 1GL2C 2HPCA 1FZCC 2BEQD 3NTNA 5KKZB 5CHXA 4GKGA 4ASVA 2YMYA 1KB9D 1YITP 1OFCX 3HD7D 4ZKPA 3N7NA 2NPSB 3CLQA 3EFFK 1KQLA 2L5GB 2PP6A 2R32A 3PLNA 3MZWB 1SFCA 3GW6A 1MUUA 2VRSA 4A7PA 1BGYG 2AXTE 1ZR2A 2N1TA 2OGUA 4EYYQ 5AVYB 1Q81Q 3BRVB 1NGMB 3V2PA 1T2KD 1R5LA 1QVGO 1NTKE 2V7QH 3GHGA 1FOSF 4N6JA 3UIAA 1OWAA 2WMMA 1FZFA 2KYVA 2UWJE 4L73A 4WY4B 4HKZH 1K8AQ 1NWQA 1SQPE 5TISE 3W68A 2R5DA 2ZVOB 3HD7C 3LIEA 4IL6X 2XNXA 4ZMDA 3M9HA 1CI6A 4PV1D 3O6QA 4KJMA 2E76B 2RH0A 4H13D 4IFMA 5CJ4A 1NTME 1JUNA 3L71E 1JTHB 1M8OB 2JDIH 2O01N 3MIWA 5APSA 2WTYA 3G3ZA 1JM0A 3L75G 1LJ2A 1LTBC 4NPEA 2FYNC 2A06G 1NTMD 2GUVA 3RK2C 1NKNA 1SQPG 3WUTA 1R8EA 1J1EB 1M56D 1RE4A 3A0HH 1JMMA 1G2CB 1M1JB 5KLVE 3U1CA 2OQQA 2I1JA 3BCCE 2WSEH 3AEEC 2AEMA 1BSHA 1CW5A 4H13C 2R5BA 1YJNP 1Q7YQ 4DOJA 2J5UA 4H44C 5AVRB 3AEFC 1RQUA 2E5YA 3L73D 4H0LD 4I7ZC 2KIKA 1ZXGA 3H1LE 4H13B 4DJGA 3OW2O 3T97A 2FXPA 5KAIE 1S72P 4PD4E 2DW3A 4U3FE 1H0TA 3TK1A 3I5CA 1BCCJ 3KXDA 3RBXA 1Q82Q 4EDFA 1VPCA 3WU2E 1EZVI 2ZYDA 3P8CD 4D6TJ 2IZ1A 1J2JB 4IOIH 1T3JA 2HG5D 1TU3F 4Y28J 3HE4B 1NTZK 3BATA 2OTJP 1GU5A 4ZNCA 1PIXA 1YIJP 1RF1B 2GA1A 1ZMEC 2BEZF 1KB9E 2YXRB 2OYOA 2P2UA 1VQOP 3V5BA 1S5LE 4BRYB 1LNQA 1NTKG 3CXHI 3GHGC 2WSSH 2YXQB 3F5HA 3RBZA 1SQPD 2B87B 1N7SD 5CJ0A 2A06D 3WU2H 3HTKB 5GTIE 1SQVG 2KK7A 1NTKD 4D6TE 1WMKA 3TGUG 1YI2P 1JY2P 1LTAC 3CC7P 2FXMA 2Q7CA 1RF0A 3ABVC 3A5TA 1L4AB 1OW6A 3CCEP 5AW7B 1IC2A 3B4SA 1FJPA 3QWOC 4TT3H 1YQ4C 2YKOA 1JNMA 1ZP0C 1FJKA 2IPPA 3O8ZA 1NVOA 1CZQA 2FXOA 5AW8B 3SFDC 4GOFA 1N7SC 2QJYC 2K37A 3OJAB 2KXPB 3AE7C 3D70A 2V7QJ 1ZOYC 3RK3C 3A0BH 1LWUA 2E74B 3E1RA 1DH3A 1L0LK 1Y9BA 2XDJA 1QVFO 4RESB 3L73E 1U57A 3G6EP 1NU1G 3G71P 3AE2C 1L0NK 3CWBE 3MGNA 3O6QB 3C8VA 3JSVC 3VMAA 3Q5SA 1DX7A 2JO1A 3U1AA 4LC1A 2JR8A 2IBZI 2P7JA 4PD4D 2NZ2A 4KT0J 2M3BA 4U3FD 3V2RA 3C9IA 3G4SP 1NU1J 3S1KA 3JC22 4QMAA 5AW5B 3SSUA 2QE7H 2WSEJ 3TYYA 3CWBD 5BVZA 2NPSC 4JYBA 2G3AA 4NPFX 3VTPC 1SQVE 4WY4D 1AA0A 1XTCC 4PV1C 1DD4A 4N78E 3LIDA 2N1TB 3CX5H 5CCGD 1AV1A 1H88A 2H7HA 2I8DA 2YIUB 4IFFA 2FYUK 1WRGA 5APXA 3B5NB 1Q2NA 2N1TC 2K3RA 2QG4A 2WQYC 1RQVA 2ZYGA 3MP7B 5AW2B 5KTBA 3I56P 1VQ9P 3P8CE 1HH0A 1X79B 4DZOA 1EDKA 1PGQA 4D6TG 2KS1A 2QJPC 3H1ID 3KQGA 3RK2D 3L71D 3VP8A 4YXDC 2NPSD 3P8MC 1KFNA 5E79H 3TSIA 3JCUH 5CCGA 5GTHE 1X8YA 2JKVA 1YHQP 1FZCA 1H0TB 2KUBA 5KAFH 5CCGC 2C0XA 4N78D 1LGHB 1M7LA 2PGDA 3L71J 3PTZA 4H44D 3MUDA 1JY3P 3CMAP 1VQ5P 1ZW0A 2N1TD 1KZUB 2WSFJ 1VQNP 1IZNB 2HYNA 5KLVD 1E79H 3BCCD 3L72E 2Q3EA 2WWWA 4AYCA 1XTGB 3AE4C 3WMM0 2Y0CA 5CBOA 1SQVJ 2BASA 3HE5A 1NTZJ 1EC5A 1BE3J 1PP9J 4Y99B 2P10A 1SQXK 4HB1A 1IFMA 1G1IA 1HTLC 3CX5I 3VYIA 1FDMA 2WT7A 1MFZA 3E1IA 1T8ZA 3Q3DA 2XKMA 4AQRD 2WITA 2IYOA 1W2EA 3AEDC 3EFGA 1GU4A 2M5AB 3H1JD 4WVZA 3TNUA 4C7RA 1JY3N 3CXHE 3RK3B 1HBWA 1PPJE 1L4AA 1ZN5A 3VN0A 4DCKA 5H2FE 1FE6A 2E74D 1HGVA 1PZQA 2QIWA 1S3JA 5TJHA 3B71A 2E42A 1FBMA 1KILB 2ZAEB 4OH8B 3H1JE 2FYUD 1BCCG 3H6PA 5BU8B 3K5BA 1GK6A 3B8EB 3HRNA 2POHA 3H1JG 3IR9A 3MUDC 3RL0B 2YO3A 1AVOA 1A02J 1M1KQ 3FXEA 2M0BA 1RF1C 1GW4A 1SLQA 2JP3A 2XV5A 3HUSA 2K88A 4HH2A 4I7ZB 3CXHD 2H43A 3CD6P 2E74C 1AVYA 3H1IE 1NAFA 3WUUA 1VL2A 2FFDA 1SQXD 4AUWA 1T6AA 3AE9C 1H89A 2HPCB 1SQQK 1IFPA 4PJ0E 1LTGC 1L0LD 1N73B 2K9JB 2P67A 3GF7A 2Q9IA 1VQ8P 2Y9ZA 1NYHA 1J1EC 1LTTC 2LXCB 3RK2B 4GODA 3CCUP 1LT9A 5AW4B 3V4WA 3AE1C 2O1JA 1SS1A 3KYQA 4TLFA 1KQGB 1VF5C 3L70E 1VQKP 2J58A 2OTKE 3FWNA 2KSJA 1KILA 2CPSA 1SQQE 1NH4A 2IBZE 3TDKA 1NTMJ 1MFTA 2HODB 4RKUJ 2OARA 3L73J 3A3YB 2FFDC 3R2PA 1DEBA 2E75B 2QA4P 3L35A 5AVQB 3H25A 2LKMA 3CL3D 2GM4A 3VMZA 2K9YA 1P84H 1NTMG 3L37A 4C46A 1RF1A 2B9BA 1OVVA 2KP8A 5AW3B 1NTZG 4H0LB 1SQVD 3VMYA 2OYHA 1JO5A 3HE4A 3H1LG 4MN4C 5KAIH 3ZDMA 2YMKA 3CXHH 3GG2A 1OW8A 2XZRA 3H32A 2FYUE 3H1KG 3KZIH 1GD2E 3CC2P 3H1LD 1K9MQ 2E5TA 4BXLA 1JCCA 1YQ3C 4C7NB 1JCDA 4RO0A 1SQBG 1HWTC 2YIUC 1SQVK 1M1JA 3L70J 3B5NC 1ZRTE 3H1KJ 1L0ND 2WPQA 1BE3E 1PP9E 1YJ9P 1M90Q 5AW0B 5APUA 1U7MA 1J1DC 3F89A 2W8ZA 1GK4A 2YNYA 4XFJA 4JYCA 1KYOD 3CCJP 1IFDA 1HJ0A 1D7MA 1JY2N 1L4AD 2Q1KA 3TNUB 1LWUB 2KI7B 1SQXE 1OZHA 1AQTA 1U7JA 4IL6H 3H1IJ 5AVXB 5GTIH 1KYOE 3A0BE 4M3LA 3S4RA 1IFIA 1KFMA 3VMXA 2R3CA 3D6YA 1N7SB 1RY3A 2QJYB 3CCLP 1VQPP 1JB0J 1EZVE 1JTHA 1L0LG 3GMAA 3V2NA 4JF7A 1BE3D 1KB9H 1PP9D 1Y8AA 2XU6A 1LT9C 4U3FJ 3TGUD 1BDCA 2H8PD 3HE5B 3M06A 5M1BA 1KTMA 3M0DC 1EDLA 1SQQD 2IBZD 4PD4I 1EXJA 2MJZA 2MKVA 3HD7B 1BDDA 1DEEG 1MZ9A 4IL6E 2BCCG 4OGQD 4ASWA 4GIFA 3M9QA 1KD1Q 3TGUE 1H8AA 2W83C 1PPJD 1L2PA 4UB8H 1M1JC 2QRXA 1PL5A 2A45H 1PV3A 1WT6A 2A45G 3GLMA 1SFCB 5EFWB 5DJTB 5L8RJ 2KS1B 2FYUG 2RN0A 2B88A 2O01J 1URQB 2PRRA 3AE5C 4UB6E 1QEXA 1KILD 4DT0A 2GUSA 1IK7A 1VQ6P 3KZIE 4OVNF 1Q86Q 2C9LY 3L36A 1GL2B 3AE6C 1UIIA 1KYOI 1GMJA 2QJKB 5KAFE 1GZLA 1MV8A 3L75J 2WPVB 2JWDA 2IFNA 1KMIZ 1ZRTD 3H1LJ 1L0NE 3H1HD 3MTUE 1SP4A 1SFCD 1VF5D 3V2QA 3VOPA 1EZVG 3CCVP 1HVVA 1G1JA 1N2DC 1QL1A 3OA7A 4YTPC 2OYIB 3CCQP 2FY8A 1FZEA 2K1AA 1SQBJ 1S9KD 1N86A 2QM8A 3A0HE 1FDIA 2K9JA 2IYPA 3A2AA 5GTHH 4W80A 1RHZB 1S1CX 1SQXG 2P1JA 5KLVG 3H1HG 2R44A 3CX5E 2M5AA 1IJDB 2H88C 3OAKA 1EZVD 3IF4A 1RF0C 2HR3A 1BSNA 2WZ7A 4H44B 3CMEP 4KHXA 1QX8A 3BRTB 1NOHA 2M8RA 3IN6A 2QM7A 4WB4A 1KN7A 3QH9A 2ZXEB 3L71G 4WY4A 3CI9A 2W90A 3HUSC 5B66E 3M0DA 1VQLP 1AJYA 1LTJA 3PJSK 3N4XA 5E79E 5AVSB 5KLIB 2YKPA 1NU1E 1N8RQ 3L72D 1Q90D 2O01H 4L74A 2KZJA 2KSEA 2ITAA 1HJBA 2Y0EA 1NTKJ 3B5ND 3D6ZA 1JY3O 2FYUJ 2KZIA 1OXZA 2FFDB 5CBNA 2KB7P 4EOTA 2H89C 2LR2A 1VF5B 2N9YB 3E7KA 2AXCA 3H32B 2WPRA 1HGZA 1KILE 1L4AC 2JJLA 1PPJG 2YO2A 1BGYE 1QL2A 2JEEA 5APTA 3AEGC 2NPSA 4GDOA 1BE3G 1PP9G 4JQ0D 3EWKA 3RL0g 1JY2O 2Q3IA 1N73A 1P84D 1SQQG 2IBZG 3B5NA 1FZGA 1IO4A 2ZT9C 1JEKA 4IFDK 1X0TA 1RE3A 2BCCE 3H1HE 1J1DB 3SWKA 4B86A 3L74J 4HJGH 3CC4P 1GDTA 3CCRP 3H1KE 2PFXA 4R4LA 3AE8C 4RJTA 1LTJB 3CCSP 3NFQA 3KHUA 3VP9A 1S9KE 3L4FA 4NPDA 3U59A 2IDBA 1Z56A 3L74G 1OMIA 4LGDE 2E75D 1LP1A 1FDOA 1USEA 4OGQC 3S9OA 4CPGA 5KKZC 2CK3H 2WVRA 3GHGB 1NO4A 2W6BA 2JWAA 3H1HJ 4L75A 2J59M 1N7SA 3LW5J 4U7JA 3H1IG 5AVUB 5TISH 1FAVA 2ZT9D 2HFED 5KJ7D 2OYHC 3SFEC 1X22A 2Q6QA 1KB9I 2C9NY 3CPWO 1NTMK 3PH0A 1AQ5A 2KLUA 4K35A 2Z4EA 1BGYJ 1OVUA 2R3SA 3Q1MA 1L0LE 1PGOA 1SVFA 1IFJA 3CX5D 3FGAD 1OVRA 3IFMA 1USDA 2QJKC 5KLVJ 1KILC 3CWBJ 1OW7A 1SQPK 2Q5UA 3R4YA 3LW5H 5APYA 3AEAC 5AW6B 5B66H 2YKQA 3KDPB 2BCCJ 1LT1A 2I1KA 1NTZD 1SQBE 2RMZA 1NHLA 3L70D 3MD0A 1JOCA 1KORA 2ZXXA 1FU1A 3ITKA 4I1LA 2M3EA 4I2LC 4XA4A 3P32A 4JBZA 5AW1B 4W7ZA 1SQBK 2IX7C 1E5WA 1G2CA 3L74D 1SFCC 3T97B 1YJWP 1GTWA 1HF9A 2CPBA 1NU1D 1N7LA 1S5LX 1L0NJ 2A06E 1LT9B 3BASA 4R4MA 4LLHA 2N9BA 4Y99C 3V6IA 1EDJA 1VDFA 5K5GB 1FOSE 4PJ0H 1S5LH 1BGYD 5B5EE 1JMBA 4OWFA 1GL2A 4W7YA 2FYNB 3TGUJ 1FZBA 2W27A 3BVHA 4YXWH 3M9BA 5APVA 2ZJSE 4XE5B 3L73G 1UIXA 2WSCH 1P84E 5AVTB 5C39A 2W6JH 5AVWB 3FXDA 1LWUC 3USSA 1HUCA 2V4HA 3FWLA 4K3AA 3PHLA 5APQA 1P84I 5AVZB 3FX0A 3RK3D 1KQSO 1EDIA 2OYIA 2E76C 5KLIC 3HUSB 3WUVA 1W2BO 1W5CE 2AEJA 1T2KC 1QGKB 2P58A 1GW3A 3L70G 1NTKK 2KLVA 1PGJA 2AEFA 1S4XA 1SQPJ 1YBKA 1KQFB 1FZAA 1RE4C 2WPSA 1VQ4P 3Q5RA 3H1KD 3HD7A 4BRYA 3CCMP 2IFMA 4L76A 4UB8E 1N73C 1X9VA 3V4QA 2C0WA 2B87A 3W67A 2IZ0A 1KC8Q 1R5SA 3SWYA 3HTKA 4C7NA 4Z1MH 1K04A 4JPZB 2FYZA 1YYCA 2O3JA 4GOEA 1URQA 1T3UA 2E76D 3GF3A 4GT1A 1MKMA 4WWIA 2WT7B 4PV1B 3NXSA 1NAYA 2QEXP
chains in the Genus database with same CATH topology
2R44A 3MHVA 2M5AA 4IOIH 2HR3A 4ZNCA 1LP1B 2QVAA 1FC2C 2LXCB 4GODA 2B87B 5DJUB 1SS1A 2KZJA 2OTKE 2B89A 1MFTA 2KZIA 5CBNA 2LR2A 3QWOC 1NVOA 4GOFA 1OVVA 3RGUA 4MN4C 3ZDMA 2SPZA 1X0TA 1Y47A 4HJGH 4BXLA 4NPDA 1LP1A 4CPGA 1U7MA 4NPFX 2RKLA 2LXBA 2Q1KA 2KI7B 3PH0A 2I8DA 4K35A 1OVUA 1U7JA 1Q2NA 2K3RA 4ASVA 1OVRA 1EDKA 3MZWB 4EYYQ 1LT1A 1BDCA 1H0TB 2KUBA 1EDLA 4JBZA 2WMMA 4ASWA 1BDDA 1DEEG 2UWJE 1ZW0A 4HKZH 4ZMDA 5CBOA 1EDJA 5K5GB 2QRXA 4KJMA 1JMBA 1EC5A 5EFWB 4HB1A 5DJTB 2KS1B 2B88A 5C39A 3FXDA 1JM0A 4K3AA 4NPEA 1EDIA 2M5AB 2P58A 2JWDA 1S3JA 2ZAEB 2KIKA 1ZXGA 2B87A 1H0TA 3S1KA 4GOEA 4WWIA 3FXEA 2M0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R44 A;  3MHV A;  2M5A A;  4IOI H;  2HR3 A;  4ZNC A;  1LP1 B;  2QVA A;  1FC2 C;  2LXC B;  4GOD A;  2B87 B;  5DJU B;  1SS1 A;  2KZJ A;  2OTK E;  2B89 A;  1MFT A;  2KZI A;  5CBN A;  2LR2 A;  3QWO C;  1NVO A;  4GOF A;  1OVV A;  3RGU A;  4MN4 C;  3ZDM A;  2SPZ A;  1X0T A;  1Y47 A;  4HJG H;  4BXL A;  4NPD A;  1LP1 A;  4CPG A;  1U7M A;  4NPF X;  2RKL A;  2LXB A;  2Q1K A;  2KI7 B;  3PH0 A;  2I8D A;  4K35 A;  1OVU A;  1U7J A;  1Q2N A;  2K3R A;  4ASV A;  1OVR A;  1EDK A;  3MZW B;  4EYY Q;  1LT1 A;  1BDC A;  1H0T B;  2KUB A;  1EDL A;  4JBZ A;  2WMM A;  4ASW A;  1BDD A;  1DEE G;  2UWJ E;  1ZW0 A;  4HKZ H;  4ZMD A;  5CBO A;  1EDJ A;  5K5G B;  2QRX A;  4KJM A;  1JMB A;  1EC5 A;  5EFW B;  4HB1 A;  5DJT B;  2KS1 B;  2B88 A;  5C39 A;  3FXD A;  1JM0 A;  4K3A A;  4NPE A;  1EDI A;  2M5A B;  2P58 A;  2JWD A;  1S3J A;  2ZAE B;  2KIK A;  1ZXG A;  2B87 A;  1H0T A;  3S1K A;  4GOE A;  4WWI A;  3FXE A;  2M0B A; 
#chains in the Genus database with same CATH topology
 2KNC A;  2XND H;  3MHV A;  1EXI A;  4I6M C;  3M91 A;  1L0L J;  2W6A A;  4EI2 A;  4N3Y B;  3L72 G;  2O1K A;  1BCC D;  1A02 F;  2E43 A;  1CI6 B;  1CSB A;  1SQX J;  1K73 Q;  2ZFC A;  4BWN A;  1LP1 B;  2QVA A;  1ZR4 A;  1OIP A;  3G9R A;  3L72 J;  1FC2 C;  3PRJ A;  3RL0 C;  2OTL P;  1NU1 K;  1QLE D;  3NMD A;  1PGP A;  1L0N G;  2Y0D A;  5CCH A;  5CCH C;  3CWB G;  5DJU B;  4WY4 C;  1VQM P;  4EIJ A;  4H0L C;  1SQB D;  3M0A A;  4YPC A;  2G8Y A;  4U3F G;  5APW A;  2B89 A;  2E75 C;  5AVV B;  3SWF A;  3II6 A;  3I55 P;  3D71 A;  1KV4 A;  1DD3 A;  1LTS C;  2FBW C;  3L74 E;  1BCC E;  1IFN A;  2ZT9 B;  2PAJ A;  3AEB C;  2L91 A;  1DIP A;  5KJ7 C;  3L75 D;  5AW9 B;  3RL0 D;  3IAO A;  1YTZ I;  3RK3 E;  2WSF H;  2D2C B;  5KLV K;  3BCC G;  5CCH D;  1URQ C;  3TF5 A;  1RE3 C;  1NJI Q;  4HYT B;  2A45 I;  1EQ7 A;  2KNC B;  3Q5P A;  4ZKU A;  3RGU A;  2D2C C;  1IK9 A;  2KOG A;  4UB6 H;  3L75 E;  3BCC J;  2SPZ A;  2ZYA A;  2NRG A;  4D6T D;  4WBA A;  1FS0 E;  1Y47 A;  1ZLL A;  2HLO A;  2FKW B;  3PP5 A;  1GL2 D;  1VQ7 P;  1NKZ B;  1PFI A;  2QSI A;  3C1L A;  2HOD A;  3P7K A;  2Z5H A;  3JCU E;  5KJ7 A;  1SQQ J;  2OYH B;  5CMZ A;  1RH5 B;  2WSC J;  2Z5I A;  1OX3 A;  1KYO H;  2ZVN B;  1URQ D;  1ZV8 A;  2BCC D;  4O9B A;  2OYI C;  3AE3 C;  1S2E A;  1AFO A;  1FZC B;  1NTZ E;  2D2C D;  3AEC C;  2AXT H;  1YTZ T;  3Q2Y A;  1M57 D;  1K05 A;  2Y9Y A;  4PD4 H;  2RKL A;  3KPE A;  2QJP B;  3EQ2 A;  1LTI C;  2LXB A;  5BU5 A;  5H2F H;  3A7O A;  4OGQ B;  1LTJ C;  5B5E H;  3H1J J;  1GL2 C;  2HPC A;  1FZC C;  2BEQ D;  3NTN A;  5KKZ B;  5CHX A;  4GKG A;  4ASV A;  2YMY A;  1KB9 D;  1YIT P;  1OFC X;  3HD7 D;  4ZKP A;  3N7N A;  2NPS B;  3CLQ A;  3EFF K;  1KQL A;  2L5G B;  2PP6 A;  2R32 A;  3PLN A;  3MZW B;  1SFC A;  3GW6 A;  1MUU A;  2VRS A;  4A7P A;  1BGY G;  2AXT E;  1ZR2 A;  2N1T A;  2OGU A;  4EYY Q;  5AVY B;  1Q81 Q;  3BRV B;  1NGM B;  3V2P A;  1T2K D;  1R5L A;  1QVG O;  1NTK E;  2V7Q H;  3GHG A;  1FOS F;  4N6J A;  3UIA A;  1OWA A;  2WMM A;  1FZF A;  2KYV A;  2UWJ E;  4L73 A;  4WY4 B;  4HKZ H;  1K8A Q;  1NWQ A;  1SQP E;  5TIS E;  3W68 A;  2R5D A;  2ZVO B;  3HD7 C;  3LIE A;  4IL6 X;  2XNX A;  4ZMD A;  3M9H A;  1CI6 A;  4PV1 D;  3O6Q A;  4KJM A;  2E76 B;  2RH0 A;  4H13 D;  4IFM A;  5CJ4 A;  1NTM E;  1JUN A;  3L71 E;  1JTH B;  1M8O B;  2JDI H;  2O01 N;  3MIW A;  5APS A;  2WTY A;  3G3Z A;  1JM0 A;  3L75 G;  1LJ2 A;  1LTB C;  4NPE A;  2FYN C;  2A06 G;  1NTM D;  2GUV A;  3RK2 C;  1NKN A;  1SQP G;  3WUT A;  1R8E A;  1J1E B;  1M56 D;  1RE4 A;  3A0H H;  1JMM A;  1G2C B;  1M1J B;  5KLV E;  3U1C A;  2OQQ A;  2I1J A;  3BCC E;  2WSE H;  3AEE C;  2AEM A;  1BSH A;  1CW5 A;  4H13 C;  2R5B A;  1YJN P;  1Q7Y Q;  4DOJ A;  2J5U A;  4H44 C;  5AVR B;  3AEF C;  1RQU A;  2E5Y A;  3L73 D;  4H0L D;  4I7Z C;  2KIK A;  1ZXG A;  3H1L E;  4H13 B;  4DJG A;  3OW2 O;  3T97 A;  2FXP A;  5KAI E;  1S72 P;  4PD4 E;  2DW3 A;  4U3F E;  1H0T A;  3TK1 A;  3I5C A;  1BCC J;  3KXD A;  3RBX A;  1Q82 Q;  4EDF A;  1VPC A;  3WU2 E;  1EZV I;  2ZYD A;  3P8C D;  4D6T J;  2IZ1 A;  1J2J B;  4IOI H;  1T3J A;  2HG5 D;  1TU3 F;  4Y28 J;  3HE4 B;  1NTZ K;  3BAT A;  2OTJ P;  1GU5 A;  4ZNC A;  1PIX A;  1YIJ P;  1RF1 B;  2GA1 A;  1ZME C;  2BEZ F;  1KB9 E;  2YXR B;  2OYO A;  2P2U A;  1VQO P;  3V5B A;  1S5L E;  4BRY B;  1LNQ A;  1NTK G;  3CXH I;  3GHG C;  2WSS H;  2YXQ B;  3F5H A;  3RBZ A;  1SQP D;  2B87 B;  1N7S D;  5CJ0 A;  2A06 D;  3WU2 H;  3HTK B;  5GTI E;  1SQV G;  2KK7 A;  1NTK D;  4D6T E;  1WMK A;  3TGU G;  1YI2 P;  1JY2 P;  1LTA C;  3CC7 P;  2FXM A;  2Q7C A;  1RF0 A;  3ABV C;  3A5T A;  1L4A B;  1OW6 A;  3CCE P;  5AW7 B;  1IC2 A;  3B4S A;  1FJP A;  3QWO C;  4TT3 H;  1YQ4 C;  2YKO A;  1JNM A;  1ZP0 C;  1FJK A;  2IPP A;  3O8Z A;  1NVO A;  1CZQ A;  2FXO A;  5AW8 B;  3SFD C;  4GOF A;  1N7S C;  2QJY C;  2K37 A;  3OJA B;  2KXP B;  3AE7 C;  3D70 A;  2V7Q J;  1ZOY C;  3RK3 C;  3A0B H;  1LWU A;  2E74 B;  3E1R A;  1DH3 A;  1L0L K;  1Y9B A;  2XDJ A;  1QVF O;  4RES B;  3L73 E;  1U57 A;  3G6E P;  1NU1 G;  3G71 P;  3AE2 C;  1L0N K;  3CWB E;  3MGN A;  3O6Q B;  3C8V A;  3JSV C;  3VMA A;  3Q5S A;  1DX7 A;  2JO1 A;  3U1A A;  4LC1 A;  2JR8 A;  2IBZ I;  2P7J A;  4PD4 D;  2NZ2 A;  4KT0 J;  2M3B A;  4U3F D;  3V2R A;  3C9I A;  3G4S P;  1NU1 J;  3S1K A;  3JC2 2;  4QMA A;  5AW5 B;  3SSU A;  2QE7 H;  2WSE J;  3TYY A;  3CWB D;  5BVZ A;  2NPS C;  4JYB A;  2G3A A;  4NPF X;  3VTP C;  1SQV E;  4WY4 D;  1AA0 A;  1XTC C;  4PV1 C;  1DD4 A;  4N78 E;  3LID A;  2N1T B;  3CX5 H;  5CCG D;  1AV1 A;  1H88 A;  2H7H A;  2I8D A;  2YIU B;  4IFF A;  2FYU K;  1WRG A;  5APX A;  3B5N B;  1Q2N A;  2N1T C;  2K3R A;  2QG4 A;  2WQY C;  1RQV A;  2ZYG A;  3MP7 B;  5AW2 B;  5KTB A;  3I56 P;  1VQ9 P;  3P8C E;  1HH0 A;  1X79 B;  4DZO A;  1EDK A;  1PGQ A;  4D6T G;  2KS1 A;  2QJP C;  3H1I D;  3KQG A;  3RK2 D;  3L71 D;  3VP8 A;  4YXD C;  2NPS D;  3P8M C;  1KFN A;  5E79 H;  3TSI A;  3JCU H;  5CCG A;  5GTH E;  1X8Y A;  2JKV A;  1YHQ P;  1FZC A;  1H0T B;  2KUB A;  5KAF H;  5CCG C;  2C0X A;  4N78 D;  1LGH B;  1M7L A;  2PGD A;  3L71 J;  3PTZ A;  4H44 D;  3MUD A;  1JY3 P;  3CMA P;  1VQ5 P;  1ZW0 A;  2N1T D;  1KZU B;  2WSF J;  1VQN P;  1IZN B;  2HYN A;  5KLV D;  1E79 H;  3BCC D;  3L72 E;  2Q3E A;  2WWW A;  4AYC A;  1XTG B;  3AE4 C;  3WMM 0;  2Y0C A;  5CBO A;  1SQV J;  2BAS A;  3HE5 A;  1NTZ J;  1EC5 A;  1BE3 J;  1PP9 J;  4Y99 B;  2P10 A;  1SQX K;  4HB1 A;  1IFM A;  1G1I A;  1HTL C;  3CX5 I;  3VYI A;  1FDM A;  2WT7 A;  1MFZ A;  3E1I A;  1T8Z A;  3Q3D A;  2XKM A;  4AQR D;  2WIT A;  2IYO A;  1W2E A;  3AED C;  3EFG A;  1GU4 A;  2M5A B;  3H1J D;  4WVZ A;  3TNU A;  4C7R A;  1JY3 N;  3CXH E;  3RK3 B;  1HBW A;  1PPJ E;  1L4A A;  1ZN5 A;  3VN0 A;  4DCK A;  5H2F E;  1FE6 A;  2E74 D;  1HGV A;  1PZQ A;  2QIW A;  1S3J A;  5TJH A;  3B71 A;  2E42 A;  1FBM A;  1KIL B;  2ZAE B;  4OH8 B;  3H1J E;  2FYU D;  1BCC G;  3H6P A;  5BU8 B;  3K5B A;  1GK6 A;  3B8E B;  3HRN A;  2POH A;  3H1J G;  3IR9 A;  3MUD C;  3RL0 B;  2YO3 A;  1AVO A;  1A02 J;  1M1K Q;  3FXE A;  2M0B A;  1RF1 C;  1GW4 A;  1SLQ A;  2JP3 A;  2XV5 A;  3HUS A;  2K88 A;  4HH2 A;  4I7Z B;  3CXH D;  2H43 A;  3CD6 P;  2E74 C;  1AVY A;  3H1I E;  1NAF A;  3WUU A;  1VL2 A;  2FFD A;  1SQX D;  4AUW A;  1T6A A;  3AE9 C;  1H89 A;  2HPC B;  1SQQ K;  1IFP A;  4PJ0 E;  1LTG C;  1L0L D;  1N73 B;  2K9J B;  2P67 A;  3GF7 A;  2Q9I A;  1VQ8 P;  2Y9Z A;  1NYH A;  1J1E C;  1LTT C;  2LXC B;  3RK2 B;  4GOD A;  3CCU P;  1LT9 A;  5AW4 B;  3V4W A;  3AE1 C;  2O1J A;  1SS1 A;  3KYQ A;  4TLF A;  1KQG B;  1VF5 C;  3L70 E;  1VQK P;  2J58 A;  2OTK E;  3FWN A;  2KSJ A;  1KIL A;  2CPS A;  1SQQ E;  1NH4 A;  2IBZ E;  3TDK A;  1NTM J;  1MFT A;  2HOD B;  4RKU J;  2OAR A;  3L73 J;  3A3Y B;  2FFD C;  3R2P A;  1DEB A;  2E75 B;  2QA4 P;  3L35 A;  5AVQ B;  3H25 A;  2LKM A;  3CL3 D;  2GM4 A;  3VMZ A;  2K9Y A;  1P84 H;  1NTM G;  3L37 A;  4C46 A;  1RF1 A;  2B9B A;  1OVV A;  2KP8 A;  5AW3 B;  1NTZ G;  4H0L B;  1SQV D;  3VMY A;  2OYH A;  1JO5 A;  3HE4 A;  3H1L G;  4MN4 C;  5KAI H;  3ZDM A;  2YMK A;  3CXH H;  3GG2 A;  1OW8 A;  2XZR A;  3H32 A;  2FYU E;  3H1K G;  3KZI H;  1GD2 E;  3CC2 P;  3H1L D;  1K9M Q;  2E5T A;  4BXL A;  1JCC A;  1YQ3 C;  4C7N B;  1JCD A;  4RO0 A;  1SQB G;  1HWT C;  2YIU C;  1SQV K;  1M1J A;  3L70 J;  3B5N C;  1ZRT E;  3H1K J;  1L0N D;  2WPQ A;  1BE3 E;  1PP9 E;  1YJ9 P;  1M90 Q;  5AW0 B;  5APU A;  1U7M A;  1J1D C;  3F89 A;  2W8Z A;  1GK4 A;  2YNY A;  4XFJ A;  4JYC A;  1KYO D;  3CCJ P;  1IFD A;  1HJ0 A;  1D7M A;  1JY2 N;  1L4A D;  2Q1K A;  3TNU B;  1LWU B;  2KI7 B;  1SQX E;  1OZH A;  1AQT A;  1U7J A;  4IL6 H;  3H1I J;  5AVX B;  5GTI H;  1KYO E;  3A0B E;  4M3L A;  3S4R A;  1IFI A;  1KFM A;  3VMX A;  2R3C A;  3D6Y A;  1N7S B;  1RY3 A;  2QJY B;  3CCL P;  1VQP P;  1JB0 J;  1EZV E;  1JTH A;  1L0L G;  3GMA A;  3V2N A;  4JF7 A;  1BE3 D;  1KB9 H;  1PP9 D;  1Y8A A;  2XU6 A;  1LT9 C;  4U3F J;  3TGU D;  1BDC A;  2H8P D;  3HE5 B;  3M06 A;  5M1B A;  1KTM A;  3M0D C;  1EDL A;  1SQQ D;  2IBZ D;  4PD4 I;  1EXJ A;  2MJZ A;  2MKV A;  3HD7 B;  1BDD A;  1DEE G;  1MZ9 A;  4IL6 E;  2BCC G;  4OGQ D;  4ASW A;  4GIF A;  3M9Q A;  1KD1 Q;  3TGU E;  1H8A A;  2W83 C;  1PPJ D;  1L2P A;  4UB8 H;  1M1J C;  2QRX A;  1PL5 A;  2A45 H;  1PV3 A;  1WT6 A;  2A45 G;  3GLM A;  1SFC B;  5EFW B;  5DJT B;  5L8R J;  2KS1 B;  2FYU G;  2RN0 A;  2B88 A;  2O01 J;  1URQ B;  2PRR A;  3AE5 C;  4UB6 E;  1QEX A;  1KIL D;  4DT0 A;  2GUS A;  1IK7 A;  1VQ6 P;  3KZI E;  4OVN F;  1Q86 Q;  2C9L Y;  3L36 A;  1GL2 B;  3AE6 C;  1UII A;  1KYO I;  1GMJ A;  2QJK B;  5KAF E;  1GZL A;  1MV8 A;  3L75 J;  2WPV B;  2JWD A;  2IFN A;  1KMI Z;  1ZRT D;  3H1L J;  1L0N E;  3H1H D;  3MTU E;  1SP4 A;  1SFC D;  1VF5 D;  3V2Q A;  3VOP A;  1EZV G;  3CCV P;  1HVV A;  1G1J A;  1N2D C;  1QL1 A;  3OA7 A;  4YTP C;  2OYI B;  3CCQ P;  2FY8 A;  1FZE A;  2K1A A;  1SQB J;  1S9K D;  1N86 A;  2QM8 A;  3A0H E;  1FDI A;  2K9J A;  2IYP A;  3A2A A;  5GTH H;  4W80 A;  1RHZ B;  1S1C X;  1SQX G;  2P1J A;  5KLV G;  3H1H G;  2R44 A;  3CX5 E;  2M5A A;  1IJD B;  2H88 C;  3OAK A;  1EZV D;  3IF4 A;  1RF0 C;  2HR3 A;  1BSN A;  2WZ7 A;  4H44 B;  3CME P;  4KHX A;  1QX8 A;  3BRT B;  1NOH A;  2M8R A;  3IN6 A;  2QM7 A;  4WB4 A;  1KN7 A;  3QH9 A;  2ZXE B;  3L71 G;  4WY4 A;  3CI9 A;  2W90 A;  3HUS C;  5B66 E;  3M0D A;  1VQL P;  1AJY A;  1LTJ A;  3PJS K;  3N4X A;  5E79 E;  5AVS B;  5KLI B;  2YKP A;  1NU1 E;  1N8R Q;  3L72 D;  1Q90 D;  2O01 H;  4L74 A;  2KZJ A;  2KSE A;  2ITA A;  1HJB A;  2Y0E A;  1NTK J;  3B5N D;  3D6Z A;  1JY3 O;  2FYU J;  2KZI A;  1OXZ A;  2FFD B;  5CBN A;  2KB7 P;  4EOT A;  2H89 C;  2LR2 A;  1VF5 B;  2N9Y B;  3E7K A;  2AXC A;  3H32 B;  2WPR A;  1HGZ A;  1KIL E;  1L4A C;  2JJL A;  1PPJ G;  2YO2 A;  1BGY E;  1QL2 A;  2JEE A;  5APT A;  3AEG C;  2NPS A;  4GDO A;  1BE3 G;  1PP9 G;  4JQ0 D;  3EWK A;  3RL0 g;  1JY2 O;  2Q3I A;  1N73 A;  1P84 D;  1SQQ G;  2IBZ G;  3B5N A;  1FZG A;  1IO4 A;  2ZT9 C;  1JEK A;  4IFD K;  1X0T A;  1RE3 A;  2BCC E;  3H1H E;  1J1D B;  3SWK A;  4B86 A;  3L74 J;  4HJG H;  3CC4 P;  1GDT A;  3CCR P;  3H1K E;  2PFX A;  4R4L A;  3AE8 C;  4RJT A;  1LTJ B;  3CCS P;  3NFQ A;  3KHU A;  3VP9 A;  1S9K E;  3L4F A;  4NPD A;  3U59 A;  2IDB A;  1Z56 A;  3L74 G;  1OMI A;  4LGD E;  2E75 D;  1LP1 A;  1FDO A;  1USE A;  4OGQ C;  3S9O A;  4CPG A;  5KKZ C;  2CK3 H;  2WVR A;  3GHG B;  1NO4 A;  2W6B A;  2JWA A;  3H1H J;  4L75 A;  2J59 M;  1N7S A;  3LW5 J;  4U7J A;  3H1I G;  5AVU B;  5TIS H;  1FAV A;  2ZT9 D;  2HFE D;  5KJ7 D;  2OYH C;  3SFE C;  1X22 A;  2Q6Q A;  1KB9 I;  2C9N Y;  3CPW O;  1NTM K;  3PH0 A;  1AQ5 A;  2KLU A;  4K35 A;  2Z4E A;  1BGY J;  1OVU A;  2R3S A;  3Q1M A;  1L0L E;  1PGO A;  1SVF A;  1IFJ A;  3CX5 D;  3FGA D;  1OVR A;  3IFM A;  1USD A;  2QJK C;  5KLV J;  1KIL C;  3CWB J;  1OW7 A;  1SQP K;  2Q5U A;  3R4Y A;  3LW5 H;  5APY A;  3AEA C;  5AW6 B;  5B66 H;  2YKQ A;  3KDP B;  2BCC J;  1LT1 A;  2I1K A;  1NTZ D;  1SQB E;  2RMZ A;  1NHL A;  3L70 D;  3MD0 A;  1JOC A;  1KOR A;  2ZXX A;  1FU1 A;  3ITK A;  4I1L A;  2M3E A;  4I2L C;  4XA4 A;  3P32 A;  4JBZ A;  5AW1 B;  4W7Z A;  1SQB K;  2IX7 C;  1E5W A;  1G2C A;  3L74 D;  1SFC C;  3T97 B;  1YJW P;  1GTW A;  1HF9 A;  2CPB A;  1NU1 D;  1N7L A;  1S5L X;  1L0N J;  2A06 E;  1LT9 B;  3BAS A;  4R4M A;  4LLH A;  2N9B A;  4Y99 C;  3V6I A;  1EDJ A;  1VDF A;  5K5G B;  1FOS E;  4PJ0 H;  1S5L H;  1BGY D;  5B5E E;  1JMB A;  4OWF A;  1GL2 A;  4W7Y A;  2FYN B;  3TGU J;  1FZB A;  2W27 A;  3BVH A;  4YXW H;  3M9B A;  5APV A;  2ZJS E;  4XE5 B;  3L73 G;  1UIX A;  2WSC H;  1P84 E;  5AVT B;  5C39 A;  2W6J H;  5AVW B;  3FXD A;  1LWU C;  3USS A;  1HUC A;  2V4H A;  3FWL A;  4K3A A;  3PHL A;  5APQ A;  1P84 I;  5AVZ B;  3FX0 A;  3RK3 D;  1KQS O;  1EDI A;  2OYI A;  2E76 C;  5KLI C;  3HUS B;  3WUV A;  1W2B O;  1W5C E;  2AEJ A;  1T2K C;  1QGK B;  2P58 A;  1GW3 A;  3L70 G;  1NTK K;  2KLV A;  1PGJ A;  2AEF A;  1S4X A;  1SQP J;  1YBK A;  1KQF B;  1FZA A;  1RE4 C;  2WPS A;  1VQ4 P;  3Q5R A;  3H1K D;  3HD7 A;  4BRY A;  3CCM P;  2IFM A;  4L76 A;  4UB8 E;  1N73 C;  1X9V A;  3V4Q A;  2C0W A;  2B87 A;  3W67 A;  2IZ0 A;  1KC8 Q;  1R5S A;  3SWY A;  3HTK A;  4C7N A;  4Z1M H;  1K04 A;  4JPZ B;  2FYZ A;  1YYC A;  2O3J A;  4GOE A;  1URQ A;  1T3U A;  2E76 D;  3GF3 A;  4GT1 A;  1MKM A;  4WWI A;  2WT7 B;  4PV1 B;  3NXS A;  1NAY A;  2QEX P; 
#chains in the Genus database with same CATH homology
 2R44 A;  3MHV A;  2M5A A;  4IOI H;  2HR3 A;  4ZNC A;  1LP1 B;  2QVA A;  1FC2 C;  2LXC B;  4GOD A;  2B87 B;  5DJU B;  1SS1 A;  2KZJ A;  2OTK E;  2B89 A;  1MFT A;  2KZI A;  5CBN A;  2LR2 A;  3QWO C;  1NVO A;  4GOF A;  1OVV A;  3RGU A;  4MN4 C;  3ZDM A;  2SPZ A;  1X0T A;  1Y47 A;  4HJG H;  4BXL A;  4NPD A;  1LP1 A;  4CPG A;  1U7M A;  4NPF X;  2RKL A;  2LXB A;  2Q1K A;  2KI7 B;  3PH0 A;  2I8D A;  4K35 A;  1OVU A;  1U7J A;  1Q2N A;  2K3R A;  4ASV A;  1OVR A;  1EDK A;  3MZW B;  4EYY Q;  1LT1 A;  1BDC A;  1H0T B;  2KUB A;  1EDL A;  4JBZ A;  2WMM A;  4ASW A;  1BDD A;  1DEE G;  2UWJ E;  1ZW0 A;  4HKZ H;  4ZMD A;  5CBO A;  1EDJ A;  5K5G B;  2QRX A;  4KJM A;  1JMB A;  1EC5 A;  5EFW B;  4HB1 A;  5DJT B;  2KS1 B;  2B88 A;  5C39 A;  3FXD A;  1JM0 A;  4K3A A;  4NPE A;  1EDI A;  2M5A B;  2P58 A;  2JWD A;  1S3J A;  2ZAE B;  2KIK A;  1ZXG A;  2B87 A;  1H0T A;  3S1K A;  4GOE A;  4WWI A;  3FXE A;  2M0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...