1NVOA

Solution structure of a four-helix bundle model, apo-df1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homodimeric Alpha2 Four-Helix Bundle
publication title Preorganization of molecular binding sites in designed diiron proteins
pubmed doi rcsb
molecule tags Unknown function
total genus 17
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1nvoA00
2B87A 5CBNA 5CBOA 1OVVA 4HKZH 1X0TA 4HJGH 1H0TB 5C39A 1DEEG 4EYYQ 4IOIH 2M5AB 1MFTA 1U7JA 2SPZA 2ZAEB 4NPEA 4K3AA 4ASVA 4K35A 1OVRA 3MZWB 4BXLA 2UWJE 2WMMA 1LP1B 4ZMDA 2I8DA 3S1KA 2KI7B 2K3RA 4KJMA 2B88A 3MHVA 3PH0A 2M0BA 2KUBA 4MN4C 5DJUB 4JBZA 2Q1KA 2KS1B 2QRXA 1U7MA 4NPDA 1EDKA 1ZW0A 1LT1A 1OVUA 4GOEA 2R44A 1EDLA 1FC2C 1H0TA 1JMBA 4CPGA 4ZNCA 2M5AA 2KIKA 2QVAA 2P58A 1ZXGA 4HB1A 1BDCA 2RKLA 2LR2A 1NVOA 1EDIA 4GODA 2B89A 2KZIA 1LP1A 3FXDA 1EDJA 3QWOC 3FXEA 4NPFX 5DJTB 1EC5A 1SS1A 1JM0A 2B87B 2HR3A 1S3JA 4GOFA 4ASWA 4WWIA 5EFWB 1BDDA 1Q2NA 3ZDMA 5K5GB 2JWDA 3RGUA 1Y47A 2KZJA 2LXBA 2OTKE 2LXCB
chains in the Genus database with same CATH superfamily
3ITKA 1NU1D 1SQVE 2ZYDA 1QL1A 1FZGA 2FYUG 2P7JA 2P1JA 3P8CE 1SQPG 3CXHD 3PHLA 1AJYA 3HD7C 1BSHA 3H1KG 4U7JA 3BRVB 3AECC 4BXLA 3C9IA 2I8DA 1KORA 2Z5HA 4KJMA 4YTPC 2W6BA 3V6IA 1JO5A 3MD0A 1LNQA 1YHQP 4I1LA 1PP9D 3H1HG 3USSA 5AW0B 3GF7A 1PPJD 2E5TA 4RESB 3MTUE 3S9OA 1BGYD 5AW9B 1FZFA 2OYHB 1PL5A 1KILA 2D2CB 1URQB 2PRRA 1LTJC 3BCCJ 1S5LH 1SQXG 4GODA 3M9HA 3BCCE 3L73D 3SWYA 2YMYA 2RN0A 2H43A 5APXA 3H1ID 1M1JC 1X8YA 2BCCD 1G2CA 4N78E 4WVZA 1JY2N 2IBZE 3CLQA 3HE5A 3NTNA 1EQ7A 1L0LE 5AVUB 3V2RA 3GG2A 1BE3D 1HJ0A 3JSVC 3E1IA 5KJ7A 1YBKA 1Q90D 3RL0g 2N9BA 3KPEA 2OYOA 3A0HE 4GOEA 4OGQC 3QH9A 1FC2C 1JY2P 5KAIH 1Z56A 5CMZA 2K1AA 2HLOA 3KDPB 1FOSF 3CX5H 2MKVA 1WT6A 2L91A 4NPFX 2E74D 1JNMA 1VL2A 3BASA 2YIUB 2Y0EA 3BVHA 5AVZB 1GK4A 1M1KQ 1OMIA 1ZP0C 4RKUJ 4D6TD 1KQFB 1MZ9A 1T3JA 1YQ3C 2KXPB 3HE4A 3GHGA 2AEMA 1RH5B 4PV1D 1NU1E 3A2AA 5M1BA 2ITAA 2G3AA 1KFNA 1LWUA 3L72D 3M9BA 1NTMD 2E42A 2ZYAA 1L0NJ 2B9BA 1OXZA 2C9LY 2A45I 3IF4A 1YYCA 4W80A 3U1CA 1IFMA 1S1CX 2QJKC 1YIJP 1OWAA 3K5BA 2L5GB 2E5YA 2R5DA 3H1JG 1E5WA 5KLIC 1LTBC 1FDIA 3FX0A 1CI6B 1GU4A 3C8VA 3FGAD 1PP9E 3WUUA 1PPJE 2B89A 1KYOE 4U3FD 5E79E 1SVFA 2C9NY 2A06G 4PD4E 1HVVA 2KS1A 3AEEC 3HD7A 2AXTE 3T97A 3F89A 1KYOI 3W68A 1KC8Q 4WY4B 2ZJSE 4PD4I 2LXCB 2WSCH 3TF5A 3Q3DA 3TGUJ 5KTBA 1YTZI 3V5BA 1IJDB 2WPVB 2WWWA 4EDFA 2FBWC 2N1TD 4PJ0H 3H1IE 1SQBE 1NTKG 1TU3F 2YO3A 4NPEA 3B5NC 2GUVA 3TGUE 1M7LA 4IFFA 1VQNP 1OX3A 2BCCE 4DJGA 3A0BH 1LTJA 3SWKA 5AVRB 2B88A 2NPSD 2RMZA 2N1TC 2WT7A 3BRTB 1Q81Q 2YKPA 5H2FH 2M3BA 4AUWA 3L71J 1G1IA 3CD6P 1ZW0A 5APUA 1BE3E 1H89A 1SQQG 1GL2D 4C7NA 3AE2C 5AW7B 4YPCA 5KLVK 1M1JA 1CZQA 2J59M 3TNUA 1U57A 3CCJP 3H1LJ 1E79H 3CL3D 1VDFA 3BCCD 5AW1B 3S4RA 1VQPP 2HR3A 1NTKK 1S3JA 1RE4C 1RF1B 4DOJA 4ASWA 4WWIA 3H1LE 3L75J 2VRSA 5GTHH 1Q82Q 3RK2D 4H13D 4EOTA 3VMAA 3G3ZA 3L75E 3TYYA 1JY2O 4H0LD 2QG4A 3L70J 2E75B 3MIWA 4K3AA 3RK2C 5APQA 1ZR4A 4D6TE 4DT0A 2WSCJ 2WSSH 4EIJA 3RL0B 2K3RA 1M57D 2O1KA 2JP3A 5CHXA 1N7SC 2Q3EA 4H0LC 4R4LA 1IK9A 2O01H 5AVWB 3HRNA 3CWBG 2OYIB 1AVOA 1A02J 1R5LA 2NRGA 1NTME 1D7MA 2O3JA 4JYBA 3RK3B 5B5EH 1FDOA 4C46A 2RKLA 2FYUJ 2W6AA 1P84H 1GMJA 1SQPJ 1T6AA 2HYNA 3L74J 4YXDC 2WSEJ 3D71A 1UIIA 3FXEA 4IL6E 2J58A 5CCGC 3H1KJ 1DIPA 1N73B 1EZVG 3D6ZA 2D2CD 2FYUE 1URQD 1SQPE 5GTIH 3U1AA 3O6QB 1AQ5A 1BDDA 1GW4A 1OW8A 3CCUP 1Y47A 2W90A 3GLMA 3H1KE 3HTKB 3H1HJ 2OYHC 3JCUH 3KZIE 3CMEP 4H13B 4HKZH 3ABVC 3PP5A 2AXCA 3CCSP 2Q5UA 3H1HE 4XE5B 2ZAEB 4KT0J 1SQXJ 3EWKA 2ZXXA 3CC2P 2UWJE 1FZBA 1KQSO 1AQTA 2HODA 2YNYA 1X9VA 3L74G 3GW6A 1HUCA 1OW6A 1SQXE 1EXIA 2GA1A 3AE9C 2OARA 2WPQA 1J1DC 2YXQB 2DW3A 2V4HA 1SFCB 1L0ND 1JMBA 4BRYA 1T3UA 1VF5B 1FJKA 3AE3C 2ZT9B 2C0WA 4WB4A 1NTZK 1FOSE 1JUNA 1KYOD 1LP1A 2I1JA 1YJ9P 3GF3A 4R4MA 1L4AB 4PD4D 5DJTB 4JQ0D 5TISH 1RF0C 5CCHD 1JCCA 1NWQA 1Q2NA 1JY3O 3V2NA 3B5NA 3ZDMA 2QEXP 1SQVG 1A02F 3PRJA 1PGQA 1KB9I 2FXMA 1WRGA 2N1TA 1X0TA 3KHUA 2XU6A 1YQ4C 1S9KE 3MGNA 2Y9YA 2ZXEB 1SQBD 3V4WA 3IAOA 4ZKUA 1RY3A 4OVNF 1OVRA 3Q1MA 3TGUD 4O9BA 2FYZA 3S1KA 3V2QA 3CXHH 2KS1B 1DH3A 2QRXA 2WSFH 2V7QJ 5AW2B 2QJYC 1JCDA 4LLHA 3HUSA 1M56D 3LW5J 4IFDK 2JDIH 1HH0A 1S72P 1RE4A 1YTZT 1QLED 3L71D 5APSA 1SQVK 4KHXA 5AVYB 5AVQB 5AW4B 4L76A 1AVYA 3WU2H 1ZN5A 4H44B 5AW8B 1W2EA 3CI9A 1ZMEC 1LT9C 1J1EC 1LTJB 2WT7B 4UB8H 2W27A 1CW5A 2QIWA 1GZLA 4LC1A 3H1LD 4A7PA 2LXBA 2FXPA 5CBNA 4JYCA 3N7NA 1VPCA 5AW5B 1N7SA 3H1JJ 2IBZG 4EYYQ 3L75D 1NKZB 1FZCC 1G1JA 1U7JA 2SPZA 4IL6X 4WY4D 3V4QA 3M0AA 1S4XA 3CCVP 1QX8A 1M1JB 2E74C 1IFPA 3TNUB 1IFIA 3H1JE 3JC22 1KQLA 1S5LE 3R4YA 2JJLA 3L70D 2Q1KA 1M8OB 3A5TA 4WY4C 1KZUB 5B66H 4Y99C 1FAVA 5CCGA 1IFNA 1EDLA 1H88A 2P67A 5KLVJ 2WSFJ 3IN6A 4PV1C 2IX7C 2Y0CA 2OYHA 4N6JA 2QJPC 1L0NE 1NTKJ 3EQ2A 4OGQB 1JM0A 1ZV8A 2B87B 4OWFA 1L0LK 3GMAA 3I55P 1HF9A 2FYUD 1LJ2A 2Y9ZA 1SQPD 4XA4A 4TT3H 1M90Q 3AE7C 1X22A 1LTSC 3H1KD 3B8EB 3G6EP 3WMM0 2K88A 3OAKA 2Z5IA 3AEAC 5KKZB 2FYNB 2I1KA 3H1HD 1LTAC 1SQQJ 2CPBA 3H25A 4K35A 2QM7A 3PTZA 5KLVG 5KAIE 1K8AQ 5APYA 2XDJA 1RF1C 2QSIA 3CC4P 4I2LC 1SQQE 2N9YB 5AW3B 3B71A 2IFMA 1SQXD 2E75D 3CX5E 1VQ6P 1VQOP 3WUVA 1RE3A 1PGJA 3RL0D 5BU8B 2M5AA 1VQLP 2HG5D 1PP9G 1RF0A 2WITA 4AQRD 2WPRA 1PPJG 3CX5I 4M3LA 1EDIA 1BGYG 2PFXA 3A3YB 2R5BA 3RL0C 2JO1A 4Z1MH 2NPSC 3RK3D 3A7OA 4UB6H 1KB9D 3EFFK 1NU1K 3L71E 4L74A 1BCCJ 5L8RJ 5EFWB 2OYIC 3I56P 1GTWA 1DX7A 2FFDC 1JMMA 4I7ZB 1FE6A 1KN7A 3CC7P 2OTLP 3HUSC 3L73G 2KLVA 3CWBJ 2XZRA 1OW7A 3KZIH 3H32A 2YMKA 1GL2C 4IFMA 1JTHA 1P84D 4BRYB 3H1IG 2KNCA 5KAFE 1S9KD 1VQ7P 5KJ7D 1NKNA 3VMYA 3II6A 1IK7A 1N7LA 3NXSA 2YKOA 1N73C 2KSJA 1LP1B 2M0BA 2KP8A 3VMXA 1KILB 3CCQP 2XNDH 3B5NB 3VN0A 4H13C 1LT9A 2YKQA 1H0TA 2JR8A 2AEJA 1BCCG 1NTZJ 2JEEA 2KIKA 1FBMA 2P58A 3IFMA 3L70E 1FDMA 3PJSK 4HB1A 1W2BO 2LR2A 1NVOA 4RO0A 3H6PA 3Q5PA 1ZRTE 1MV8A 4GIFA 2KZIA 3RBXA 1QVFO 1HGZA 2G8YA 1EDJA 2KB7P 1SFCD 2YXRB 1CI6A 3IR9A 1HJBA 1EC5A 1EZVI 1SQBK 1NOHA 2Z4EA 1VF5D 1G2CB 2ZT9D 1FZCA 3HE5B 1SFCC 3A0BE 1RQUA 1L4AD 2KYVA 1VF5C 2ZT9C 3G71P 5H2FE 4WY4A 3D70A 3L74E 1LGHB 1YJNP 4D6TG 4JF7A 1NTZG 1L4AC 2XNXA 1Y9BA 2D2CC 3H1JD 4ZMDA 2KI7B 1URQC 2H89C 3MHVA 2C0XA 2E76B 2RH0A 4W7ZA 1RHZB 2YO2A 3M06A 1FZEA 1YI2P 3UIAA 1QVGO 1OZHA 1KD1Q 1EDKA 1PGOA 3L72G 2NZ2A 1OVUA 3VMZA 3SFEC 2A06D 1UIXA 5AVVB 1SQVJ 2OTJP 1KILE 1VQ9P 3CCEP 1N7SB 2WPSA 4B86A 3HD7D 2K9JA 1IFDA 4L75A 3FXDA 4TLFA 5KLVD 1KQGB 3A0HH 5BVZA 2CK3H 1AFOA 1FS0E 1WMKA 3L36A 2O01J 1KTMA 3HE4B 4U3FG 3O8ZA 1USEA 1VQMP 1NTKD 3Q2YA 1K05A 3GHGB 3SWFA 4H44D 1RF1A 3VP9A 3RK3E 4BWNA 1RE3C 1J2JB 4GT1A 2WZ7A 1KB9E 1LWUB 1KV4A 1NTMK 4OH8B 1MKMA 1H8AA 4H44C 2W6JH 2WMMA 5B5EE 2Q9IA 3P32A 3MUDC 1AA0A 1P84E 5CCHC 2GM4A 3CCMP 2Y0DA 1SQQD 2OQQA 1NGMB 1T8ZA 1S2EA 4EI2A 1NO4A 3CX5D 2FYUK 2A45H 1SQPK 1YITP 1CSBA 3N4XA 1NAFA 2NPSA 3Q5RA 1P84I 3AE1C 5GTIE 2AEFA 4I6MC 2W8ZA 2YIUC 2FY8A 2OYIA 3U59A 3W67A 2FFDA 2MJZA 1PZQA 1HWTC 3JCUE 3HD7B 3T97B 2HPCA 2JKVA 4ZKPA 1USDA 1J1DB 1L0LJ 3C1LA 4N3YB 1GL2A 3E1RA 3L35A 1LTTC 3FWLA 3WUTA 5AVXB 4L73A 3OJAB 5APWA 3BCCG 1N73A 1YJWP 1KYOH 2R3SA 5CBOA 4OGQD 5E79H 1SQXK 2P10A 4PD4H 1DD3A 3O6QA 2IBZI 1BCCD 3OA7A 2Q7CA 2M5AB 2IDBA 3KXDA 5BU5A 2Q6QA 1MFTA 3HTKA 2AXTH 2H7HA 4YXWH 3CWBD 1L2PA 1PV3A 2R3CA 1K73Q 3AE8C 3CMAP 5APVA 4XFJA 3D6YA 2Q3IA 2IFNA 1L0LG 1U7MA 1R5SA 4C7NB 5AW6B 1FZAA 2XKMA 1LT1A 2R44A 3EFGA 5TISE 1XTCC 1JEKA 1NHLA 2QVAA 1EZVD 5KKZC 1DEBA 1ZXGA 2HFED 3H32B 2FYNC 1BDCA 1JTHB 2IZ1A 2KNCB 3V2PA 1HGVA 1SFCA 2QJYB 1Q7YQ 1ZRTD 3P7KA 3RBZA 5CJ4A 1NTZD 3AEFC 2A06E 1NU1J 3M0DC 2ZYGA 1GW3A 2ZVOB 5TJHA 1OFCX 5AVTB 1IO4A 2BEZF 3KQGA 3RGUA 1L4AA 3L4FA 2PAJA 1JOCA 3TDKA 1URQA 5KLVE 1XTGB 1RQVA 2KOGA 1PGPA 1JB0J 1OVVA 1QEXA 3VTPC 3CXHE 1LT9B 1H0TB 1J1EB 5C39A 1DEEG 1MUUA 3L74D 5KAFH 4AYCA 1PP9J 1NTKE 3OW2O 1BSNA 3MZWB 3SSUA 2K9YA 3CXHI 1BGYJ 3VOPA 2JWAA 1KFMA 2KUBA 4MN4C 2A45G 3LIEA 4I7ZC 3WU2E 1FU1A 1FZCB 3SFDC 1BGYE 1NU1G 3AEDC 3VP8A 2E74B 2IPPA 2IYPA 4CPGA 1Q86Q 1DD4A 3F5HA 4UB8E 1LTGC 3L73J 2M3EA 1KILD 1JY3N 1NH4A 2CPSA 3H1IJ 1L0NG 1SQBJ 3AE6C 3B5ND 3QWOC 4Y99B 4DZOA 1SQVD 1ZR2A 3L73E 1PFIA 2J5UA 3TSIA 3P8CD 1EXJA 1KILC 2BCCJ 4GOFA 1MFZA 1LTIC 3AEBC 1VQKP 2E75C 2QJKB 4PV1B 1HTLC 2OTKE 2KLUA 2QJPB 2OGUA 3MUDA 2FKWB 5KLIB 1BE3J 4IL6H 5CCHA 4HJGH 1ZOYC 1JY3P 2WVRA 4C7RA 2QM8A 4IOIH 3NFQA 2HODB 3MP7B 5B66E 2POHA 2K37A 2WSEH 2WTYA 2K9JB 2H88C 3RK3C 4RJTA 1BCCE 1N8RQ 5DJUB 1N86A 1SQBG 1L0NK 2O1JA 2M8RA 1VQ5P 3TGUG 2H8PD 3CWBE 2PP6A 3R2PA 1KMIZ 2BCCG 1W5CE 4DCKA 1T2KD 1NJIQ 3AE5C 1Y8AA 2E76D 2IZ0A 1OIPA 3G4SP 2BASA 3KYQA 3PLNA 4HYTB 5KJ7C 1NYHA 1K04A 3G9RA 1T2KC 1BE3G 2XV5A 1VQ8P 3L37A 3FWNA 2E76C 1SS1A 4D6TJ 4N78D 2QA4P 1GK6A 3L71G 1EZVE 2KK7A 2N1TB 2BEQD 3I5CA 1N7SD 2IBZD 4Y28J 5CJ0A 2JWDA 1GD2E 1IC2A 1L0LD 2LKMA 2KZJA 1S5LX 1NTZE 2B87A 1SQQK 2W83C 2QE7H 1X79B 3CCRP 1FJPA 2R32A 2NPSB 2ZFCA 3L72J 1NTMJ 4PJ0E 3E7KA 1QGKB 3CCLP 1KB9H 3H1LG 3Q5SA 2WQYC 3LIDA 1ZLLA 1QL2A 2FFDB 3AEGC 3BATA 4ASVA 3TK1A 3HUSB 2HPCB 3L72E 4GDOA 1GU5A 3PH0A 5CCGD 4LGDE 3L75G 1IZNB 2FXOA 1GL2B 4JBZA 1IFJA 3M91A 1N2DC 5AVSB 3GHGC 4HH2A 2GUSA 2O01N 4NPDA 1PIXA 4JPZB 4UB6E 3B4SA 4U3FJ 3M0DA 2P2UA 4WBAA 1LWUC 4ZNCA 3L70G 2PGDA 1AV1A 1NAYA 2IYOA 1R8EA 5APTA 1VQ4P 1K9MQ 4U3FE 3M9QA 1SP4A 4QMAA 4W7YA 3NMDA 2KSEA 3RK2B 1NTMG 4GKGA 2ZVNB 3AE4C 2E43A 3CPWO 2V7QH 3P8MC 4H0LB 5GTHE 5K5GB 3LW5H 1HBWA 3VYIA 1GDTA 1SLQA
chains in the Genus database with same CATH topology
2B87A 5CBNA 5CBOA 1OVVA 4HKZH 1X0TA 4HJGH 1H0TB 5C39A 1DEEG 4EYYQ 4IOIH 2M5AB 1MFTA 1U7JA 2SPZA 2ZAEB 4NPEA 4K3AA 4ASVA 4K35A 1OVRA 3MZWB 4BXLA 2UWJE 2WMMA 1LP1B 4ZMDA 2I8DA 3S1KA 2KI7B 2K3RA 4KJMA 2B88A 3MHVA 3PH0A 2M0BA 2KUBA 4MN4C 5DJUB 4JBZA 2Q1KA 2KS1B 2QRXA 1U7MA 4NPDA 1EDKA 1ZW0A 1LT1A 1OVUA 4GOEA 2R44A 1EDLA 1FC2C 1H0TA 1JMBA 4CPGA 4ZNCA 2M5AA 2KIKA 2QVAA 2P58A 1ZXGA 4HB1A 1BDCA 2RKLA 2LR2A 1NVOA 1EDIA 4GODA 2B89A 2KZIA 1LP1A 3FXDA 1EDJA 3QWOC 3FXEA 4NPFX 5DJTB 1EC5A 1SS1A 1JM0A 2B87B 2HR3A 1S3JA 4GOFA 4ASWA 4WWIA 5EFWB 1BDDA 1Q2NA 3ZDMA 5K5GB 2JWDA 3RGUA 1Y47A 2KZJA 2LXBA 2OTKE 2LXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B87 A;  5CBN A;  5CBO A;  1OVV A;  4HKZ H;  1X0T A;  4HJG H;  1H0T B;  5C39 A;  1DEE G;  4EYY Q;  4IOI H;  2M5A B;  1MFT A;  1U7J A;  2SPZ A;  2ZAE B;  4NPE A;  4K3A A;  4ASV A;  4K35 A;  1OVR A;  3MZW B;  4BXL A;  2UWJ E;  2WMM A;  1LP1 B;  4ZMD A;  2I8D A;  3S1K A;  2KI7 B;  2K3R A;  4KJM A;  2B88 A;  3MHV A;  3PH0 A;  2M0B A;  2KUB A;  4MN4 C;  5DJU B;  4JBZ A;  2Q1K A;  2KS1 B;  2QRX A;  1U7M A;  4NPD A;  1EDK A;  1ZW0 A;  1LT1 A;  1OVU A;  4GOE A;  2R44 A;  1EDL A;  1FC2 C;  1H0T A;  1JMB A;  4CPG A;  4ZNC A;  2M5A A;  2KIK A;  2QVA A;  2P58 A;  1ZXG A;  4HB1 A;  1BDC A;  2RKL A;  2LR2 A;  1NVO A;  1EDI A;  4GOD A;  2B89 A;  2KZI A;  1LP1 A;  3FXD A;  1EDJ A;  3QWO C;  3FXE A;  4NPF X;  5DJT B;  1EC5 A;  1SS1 A;  1JM0 A;  2B87 B;  2HR3 A;  1S3J A;  4GOF A;  4ASW A;  4WWI A;  5EFW B;  1BDD A;  1Q2N A;  3ZDM A;  5K5G B;  2JWD A;  3RGU A;  1Y47 A;  2KZJ A;  2LXB A;  2OTK E;  2LXC B; 
#chains in the Genus database with same CATH topology
 3ITK A;  1NU1 D;  1SQV E;  2ZYD A;  1QL1 A;  1FZG A;  2FYU G;  2P7J A;  2P1J A;  3P8C E;  1SQP G;  3CXH D;  3PHL A;  1AJY A;  3HD7 C;  1BSH A;  3H1K G;  4U7J A;  3BRV B;  3AEC C;  4BXL A;  3C9I A;  2I8D A;  1KOR A;  2Z5H A;  4KJM A;  4YTP C;  2W6B A;  3V6I A;  1JO5 A;  3MD0 A;  1LNQ A;  1YHQ P;  4I1L A;  1PP9 D;  3H1H G;  3USS A;  5AW0 B;  3GF7 A;  1PPJ D;  2E5T A;  4RES B;  3MTU E;  3S9O A;  1BGY D;  5AW9 B;  1FZF A;  2OYH B;  1PL5 A;  1KIL A;  2D2C B;  1URQ B;  2PRR A;  1LTJ C;  3BCC J;  1S5L H;  1SQX G;  4GOD A;  3M9H A;  3BCC E;  3L73 D;  3SWY A;  2YMY A;  2RN0 A;  2H43 A;  5APX A;  3H1I D;  1M1J C;  1X8Y A;  2BCC D;  1G2C A;  4N78 E;  4WVZ A;  1JY2 N;  2IBZ E;  3CLQ A;  3HE5 A;  3NTN A;  1EQ7 A;  1L0L E;  5AVU B;  3V2R A;  3GG2 A;  1BE3 D;  1HJ0 A;  3JSV C;  3E1I A;  5KJ7 A;  1YBK A;  1Q90 D;  3RL0 g;  2N9B A;  3KPE A;  2OYO A;  3A0H E;  4GOE A;  4OGQ C;  3QH9 A;  1FC2 C;  1JY2 P;  5KAI H;  1Z56 A;  5CMZ A;  2K1A A;  2HLO A;  3KDP B;  1FOS F;  3CX5 H;  2MKV A;  1WT6 A;  2L91 A;  4NPF X;  2E74 D;  1JNM A;  1VL2 A;  3BAS A;  2YIU B;  2Y0E A;  3BVH A;  5AVZ B;  1GK4 A;  1M1K Q;  1OMI A;  1ZP0 C;  4RKU J;  4D6T D;  1KQF B;  1MZ9 A;  1T3J A;  1YQ3 C;  2KXP B;  3HE4 A;  3GHG A;  2AEM A;  1RH5 B;  4PV1 D;  1NU1 E;  3A2A A;  5M1B A;  2ITA A;  2G3A A;  1KFN A;  1LWU A;  3L72 D;  3M9B A;  1NTM D;  2E42 A;  2ZYA A;  1L0N J;  2B9B A;  1OXZ A;  2C9L Y;  2A45 I;  3IF4 A;  1YYC A;  4W80 A;  3U1C A;  1IFM A;  1S1C X;  2QJK C;  1YIJ P;  1OWA A;  3K5B A;  2L5G B;  2E5Y A;  2R5D A;  3H1J G;  1E5W A;  5KLI C;  1LTB C;  1FDI A;  3FX0 A;  1CI6 B;  1GU4 A;  3C8V A;  3FGA D;  1PP9 E;  3WUU A;  1PPJ E;  2B89 A;  1KYO E;  4U3F D;  5E79 E;  1SVF A;  2C9N Y;  2A06 G;  4PD4 E;  1HVV A;  2KS1 A;  3AEE C;  3HD7 A;  2AXT E;  3T97 A;  3F89 A;  1KYO I;  3W68 A;  1KC8 Q;  4WY4 B;  2ZJS E;  4PD4 I;  2LXC B;  2WSC H;  3TF5 A;  3Q3D A;  3TGU J;  5KTB A;  1YTZ I;  3V5B A;  1IJD B;  2WPV B;  2WWW A;  4EDF A;  2FBW C;  2N1T D;  4PJ0 H;  3H1I E;  1SQB E;  1NTK G;  1TU3 F;  2YO3 A;  4NPE A;  3B5N C;  2GUV A;  3TGU E;  1M7L A;  4IFF A;  1VQN P;  1OX3 A;  2BCC E;  4DJG A;  3A0B H;  1LTJ A;  3SWK A;  5AVR B;  2B88 A;  2NPS D;  2RMZ A;  2N1T C;  2WT7 A;  3BRT B;  1Q81 Q;  2YKP A;  5H2F H;  2M3B A;  4AUW A;  3L71 J;  1G1I A;  3CD6 P;  1ZW0 A;  5APU A;  1BE3 E;  1H89 A;  1SQQ G;  1GL2 D;  4C7N A;  3AE2 C;  5AW7 B;  4YPC A;  5KLV K;  1M1J A;  1CZQ A;  2J59 M;  3TNU A;  1U57 A;  3CCJ P;  3H1L J;  1E79 H;  3CL3 D;  1VDF A;  3BCC D;  5AW1 B;  3S4R A;  1VQP P;  2HR3 A;  1NTK K;  1S3J A;  1RE4 C;  1RF1 B;  4DOJ A;  4ASW A;  4WWI A;  3H1L E;  3L75 J;  2VRS A;  5GTH H;  1Q82 Q;  3RK2 D;  4H13 D;  4EOT A;  3VMA A;  3G3Z A;  3L75 E;  3TYY A;  1JY2 O;  4H0L D;  2QG4 A;  3L70 J;  2E75 B;  3MIW A;  4K3A A;  3RK2 C;  5APQ A;  1ZR4 A;  4D6T E;  4DT0 A;  2WSC J;  2WSS H;  4EIJ A;  3RL0 B;  2K3R A;  1M57 D;  2O1K A;  2JP3 A;  5CHX A;  1N7S C;  2Q3E A;  4H0L C;  4R4L A;  1IK9 A;  2O01 H;  5AVW B;  3HRN A;  3CWB G;  2OYI B;  1AVO A;  1A02 J;  1R5L A;  2NRG A;  1NTM E;  1D7M A;  2O3J A;  4JYB A;  3RK3 B;  5B5E H;  1FDO A;  4C46 A;  2RKL A;  2FYU J;  2W6A A;  1P84 H;  1GMJ A;  1SQP J;  1T6A A;  2HYN A;  3L74 J;  4YXD C;  2WSE J;  3D71 A;  1UII A;  3FXE A;  4IL6 E;  2J58 A;  5CCG C;  3H1K J;  1DIP A;  1N73 B;  1EZV G;  3D6Z A;  2D2C D;  2FYU E;  1URQ D;  1SQP E;  5GTI H;  3U1A A;  3O6Q B;  1AQ5 A;  1BDD A;  1GW4 A;  1OW8 A;  3CCU P;  1Y47 A;  2W90 A;  3GLM A;  3H1K E;  3HTK B;  3H1H J;  2OYH C;  3JCU H;  3KZI E;  3CME P;  4H13 B;  4HKZ H;  3ABV C;  3PP5 A;  2AXC A;  3CCS P;  2Q5U A;  3H1H E;  4XE5 B;  2ZAE B;  4KT0 J;  1SQX J;  3EWK A;  2ZXX A;  3CC2 P;  2UWJ E;  1FZB A;  1KQS O;  1AQT A;  2HOD A;  2YNY A;  1X9V A;  3L74 G;  3GW6 A;  1HUC A;  1OW6 A;  1SQX E;  1EXI A;  2GA1 A;  3AE9 C;  2OAR A;  2WPQ A;  1J1D C;  2YXQ B;  2DW3 A;  2V4H A;  1SFC B;  1L0N D;  1JMB A;  4BRY A;  1T3U A;  1VF5 B;  1FJK A;  3AE3 C;  2ZT9 B;  2C0W A;  4WB4 A;  1NTZ K;  1FOS E;  1JUN A;  1KYO D;  1LP1 A;  2I1J A;  1YJ9 P;  3GF3 A;  4R4M A;  1L4A B;  4PD4 D;  5DJT B;  4JQ0 D;  5TIS H;  1RF0 C;  5CCH D;  1JCC A;  1NWQ A;  1Q2N A;  1JY3 O;  3V2N A;  3B5N A;  3ZDM A;  2QEX P;  1SQV G;  1A02 F;  3PRJ A;  1PGQ A;  1KB9 I;  2FXM A;  1WRG A;  2N1T A;  1X0T A;  3KHU A;  2XU6 A;  1YQ4 C;  1S9K E;  3MGN A;  2Y9Y A;  2ZXE B;  1SQB D;  3V4W A;  3IAO A;  4ZKU A;  1RY3 A;  4OVN F;  1OVR A;  3Q1M A;  3TGU D;  4O9B A;  2FYZ A;  3S1K A;  3V2Q A;  3CXH H;  2KS1 B;  1DH3 A;  2QRX A;  2WSF H;  2V7Q J;  5AW2 B;  2QJY C;  1JCD A;  4LLH A;  3HUS A;  1M56 D;  3LW5 J;  4IFD K;  2JDI H;  1HH0 A;  1S72 P;  1RE4 A;  1YTZ T;  1QLE D;  3L71 D;  5APS A;  1SQV K;  4KHX A;  5AVY B;  5AVQ B;  5AW4 B;  4L76 A;  1AVY A;  3WU2 H;  1ZN5 A;  4H44 B;  5AW8 B;  1W2E A;  3CI9 A;  1ZME C;  1LT9 C;  1J1E C;  1LTJ B;  2WT7 B;  4UB8 H;  2W27 A;  1CW5 A;  2QIW A;  1GZL A;  4LC1 A;  3H1L D;  4A7P A;  2LXB A;  2FXP A;  5CBN A;  4JYC A;  3N7N A;  1VPC A;  5AW5 B;  1N7S A;  3H1J J;  2IBZ G;  4EYY Q;  3L75 D;  1NKZ B;  1FZC C;  1G1J A;  1U7J A;  2SPZ A;  4IL6 X;  4WY4 D;  3V4Q A;  3M0A A;  1S4X A;  3CCV P;  1QX8 A;  1M1J B;  2E74 C;  1IFP A;  3TNU B;  1IFI A;  3H1J E;  3JC2 2;  1KQL A;  1S5L E;  3R4Y A;  2JJL A;  3L70 D;  2Q1K A;  1M8O B;  3A5T A;  4WY4 C;  1KZU B;  5B66 H;  4Y99 C;  1FAV A;  5CCG A;  1IFN A;  1EDL A;  1H88 A;  2P67 A;  5KLV J;  2WSF J;  3IN6 A;  4PV1 C;  2IX7 C;  2Y0C A;  2OYH A;  4N6J A;  2QJP C;  1L0N E;  1NTK J;  3EQ2 A;  4OGQ B;  1JM0 A;  1ZV8 A;  2B87 B;  4OWF A;  1L0L K;  3GMA A;  3I55 P;  1HF9 A;  2FYU D;  1LJ2 A;  2Y9Z A;  1SQP D;  4XA4 A;  4TT3 H;  1M90 Q;  3AE7 C;  1X22 A;  1LTS C;  3H1K D;  3B8E B;  3G6E P;  3WMM 0;  2K88 A;  3OAK A;  2Z5I A;  3AEA C;  5KKZ B;  2FYN B;  2I1K A;  3H1H D;  1LTA C;  1SQQ J;  2CPB A;  3H25 A;  4K35 A;  2QM7 A;  3PTZ A;  5KLV G;  5KAI E;  1K8A Q;  5APY A;  2XDJ A;  1RF1 C;  2QSI A;  3CC4 P;  4I2L C;  1SQQ E;  2N9Y B;  5AW3 B;  3B71 A;  2IFM A;  1SQX D;  2E75 D;  3CX5 E;  1VQ6 P;  1VQO P;  3WUV A;  1RE3 A;  1PGJ A;  3RL0 D;  5BU8 B;  2M5A A;  1VQL P;  2HG5 D;  1PP9 G;  1RF0 A;  2WIT A;  4AQR D;  2WPR A;  1PPJ G;  3CX5 I;  4M3L A;  1EDI A;  1BGY G;  2PFX A;  3A3Y B;  2R5B A;  3RL0 C;  2JO1 A;  4Z1M H;  2NPS C;  3RK3 D;  3A7O A;  4UB6 H;  1KB9 D;  3EFF K;  1NU1 K;  3L71 E;  4L74 A;  1BCC J;  5L8R J;  5EFW B;  2OYI C;  3I56 P;  1GTW A;  1DX7 A;  2FFD C;  1JMM A;  4I7Z B;  1FE6 A;  1KN7 A;  3CC7 P;  2OTL P;  3HUS C;  3L73 G;  2KLV A;  3CWB J;  2XZR A;  1OW7 A;  3KZI H;  3H32 A;  2YMK A;  1GL2 C;  4IFM A;  1JTH A;  1P84 D;  4BRY B;  3H1I G;  2KNC A;  5KAF E;  1S9K D;  1VQ7 P;  5KJ7 D;  1NKN A;  3VMY A;  3II6 A;  1IK7 A;  1N7L A;  3NXS A;  2YKO A;  1N73 C;  2KSJ A;  1LP1 B;  2M0B A;  2KP8 A;  3VMX A;  1KIL B;  3CCQ P;  2XND H;  3B5N B;  3VN0 A;  4H13 C;  1LT9 A;  2YKQ A;  1H0T A;  2JR8 A;  2AEJ A;  1BCC G;  1NTZ J;  2JEE A;  2KIK A;  1FBM A;  2P58 A;  3IFM A;  3L70 E;  1FDM A;  3PJS K;  4HB1 A;  1W2B O;  2LR2 A;  1NVO A;  4RO0 A;  3H6P A;  3Q5P A;  1ZRT E;  1MV8 A;  4GIF A;  2KZI A;  3RBX A;  1QVF O;  1HGZ A;  2G8Y A;  1EDJ A;  2KB7 P;  1SFC D;  2YXR B;  1CI6 A;  3IR9 A;  1HJB A;  1EC5 A;  1EZV I;  1SQB K;  1NOH A;  2Z4E A;  1VF5 D;  1G2C B;  2ZT9 D;  1FZC A;  3HE5 B;  1SFC C;  3A0B E;  1RQU A;  1L4A D;  2KYV A;  1VF5 C;  2ZT9 C;  3G71 P;  5H2F E;  4WY4 A;  3D70 A;  3L74 E;  1LGH B;  1YJN P;  4D6T G;  4JF7 A;  1NTZ G;  1L4A C;  2XNX A;  1Y9B A;  2D2C C;  3H1J D;  4ZMD A;  2KI7 B;  1URQ C;  2H89 C;  3MHV A;  2C0X A;  2E76 B;  2RH0 A;  4W7Z A;  1RHZ B;  2YO2 A;  3M06 A;  1FZE A;  1YI2 P;  3UIA A;  1QVG O;  1OZH A;  1KD1 Q;  1EDK A;  1PGO A;  3L72 G;  2NZ2 A;  1OVU A;  3VMZ A;  3SFE C;  2A06 D;  1UIX A;  5AVV B;  1SQV J;  2OTJ P;  1KIL E;  1VQ9 P;  3CCE P;  1N7S B;  2WPS A;  4B86 A;  3HD7 D;  2K9J A;  1IFD A;  4L75 A;  3FXD A;  4TLF A;  5KLV D;  1KQG B;  3A0H H;  5BVZ A;  2CK3 H;  1AFO A;  1FS0 E;  1WMK A;  3L36 A;  2O01 J;  1KTM A;  3HE4 B;  4U3F G;  3O8Z A;  1USE A;  1VQM P;  1NTK D;  3Q2Y A;  1K05 A;  3GHG B;  3SWF A;  4H44 D;  1RF1 A;  3VP9 A;  3RK3 E;  4BWN A;  1RE3 C;  1J2J B;  4GT1 A;  2WZ7 A;  1KB9 E;  1LWU B;  1KV4 A;  1NTM K;  4OH8 B;  1MKM A;  1H8A A;  4H44 C;  2W6J H;  2WMM A;  5B5E E;  2Q9I A;  3P32 A;  3MUD C;  1AA0 A;  1P84 E;  5CCH C;  2GM4 A;  3CCM P;  2Y0D A;  1SQQ D;  2OQQ A;  1NGM B;  1T8Z A;  1S2E A;  4EI2 A;  1NO4 A;  3CX5 D;  2FYU K;  2A45 H;  1SQP K;  1YIT P;  1CSB A;  3N4X A;  1NAF A;  2NPS A;  3Q5R A;  1P84 I;  3AE1 C;  5GTI E;  2AEF A;  4I6M C;  2W8Z A;  2YIU C;  2FY8 A;  2OYI A;  3U59 A;  3W67 A;  2FFD A;  2MJZ A;  1PZQ A;  1HWT C;  3JCU E;  3HD7 B;  3T97 B;  2HPC A;  2JKV A;  4ZKP A;  1USD A;  1J1D B;  1L0L J;  3C1L A;  4N3Y B;  1GL2 A;  3E1R A;  3L35 A;  1LTT C;  3FWL A;  3WUT A;  5AVX B;  4L73 A;  3OJA B;  5APW A;  3BCC G;  1N73 A;  1YJW P;  1KYO H;  2R3S A;  5CBO A;  4OGQ D;  5E79 H;  1SQX K;  2P10 A;  4PD4 H;  1DD3 A;  3O6Q A;  2IBZ I;  1BCC D;  3OA7 A;  2Q7C A;  2M5A B;  2IDB A;  3KXD A;  5BU5 A;  2Q6Q A;  1MFT A;  3HTK A;  2AXT H;  2H7H A;  4YXW H;  3CWB D;  1L2P A;  1PV3 A;  2R3C A;  1K73 Q;  3AE8 C;  3CMA P;  5APV A;  4XFJ A;  3D6Y A;  2Q3I A;  2IFN A;  1L0L G;  1U7M A;  1R5S A;  4C7N B;  5AW6 B;  1FZA A;  2XKM A;  1LT1 A;  2R44 A;  3EFG A;  5TIS E;  1XTC C;  1JEK A;  1NHL A;  2QVA A;  1EZV D;  5KKZ C;  1DEB A;  1ZXG A;  2HFE D;  3H32 B;  2FYN C;  1BDC A;  1JTH B;  2IZ1 A;  2KNC B;  3V2P A;  1HGV A;  1SFC A;  2QJY B;  1Q7Y Q;  1ZRT D;  3P7K A;  3RBZ A;  5CJ4 A;  1NTZ D;  3AEF C;  2A06 E;  1NU1 J;  3M0D C;  2ZYG A;  1GW3 A;  2ZVO B;  5TJH A;  1OFC X;  5AVT B;  1IO4 A;  2BEZ F;  3KQG A;  3RGU A;  1L4A A;  3L4F A;  2PAJ A;  1JOC A;  3TDK A;  1URQ A;  5KLV E;  1XTG B;  1RQV A;  2KOG A;  1PGP A;  1JB0 J;  1OVV A;  1QEX A;  3VTP C;  3CXH E;  1LT9 B;  1H0T B;  1J1E B;  5C39 A;  1DEE G;  1MUU A;  3L74 D;  5KAF H;  4AYC A;  1PP9 J;  1NTK E;  3OW2 O;  1BSN A;  3MZW B;  3SSU A;  2K9Y A;  3CXH I;  1BGY J;  3VOP A;  2JWA A;  1KFM A;  2KUB A;  4MN4 C;  2A45 G;  3LIE A;  4I7Z C;  3WU2 E;  1FU1 A;  1FZC B;  3SFD C;  1BGY E;  1NU1 G;  3AED C;  3VP8 A;  2E74 B;  2IPP A;  2IYP A;  4CPG A;  1Q86 Q;  1DD4 A;  3F5H A;  4UB8 E;  1LTG C;  3L73 J;  2M3E A;  1KIL D;  1JY3 N;  1NH4 A;  2CPS A;  3H1I J;  1L0N G;  1SQB J;  3AE6 C;  3B5N D;  3QWO C;  4Y99 B;  4DZO A;  1SQV D;  1ZR2 A;  3L73 E;  1PFI A;  2J5U A;  3TSI A;  3P8C D;  1EXJ A;  1KIL C;  2BCC J;  4GOF A;  1MFZ A;  1LTI C;  3AEB C;  1VQK P;  2E75 C;  2QJK B;  4PV1 B;  1HTL C;  2OTK E;  2KLU A;  2QJP B;  2OGU A;  3MUD A;  2FKW B;  5KLI B;  1BE3 J;  4IL6 H;  5CCH A;  4HJG H;  1ZOY C;  1JY3 P;  2WVR A;  4C7R A;  2QM8 A;  4IOI H;  3NFQ A;  2HOD B;  3MP7 B;  5B66 E;  2POH A;  2K37 A;  2WSE H;  2WTY A;  2K9J B;  2H88 C;  3RK3 C;  4RJT A;  1BCC E;  1N8R Q;  5DJU B;  1N86 A;  1SQB G;  1L0N K;  2O1J A;  2M8R A;  1VQ5 P;  3TGU G;  2H8P D;  3CWB E;  2PP6 A;  3R2P A;  1KMI Z;  2BCC G;  1W5C E;  4DCK A;  1T2K D;  1NJI Q;  3AE5 C;  1Y8A A;  2E76 D;  2IZ0 A;  1OIP A;  3G4S P;  2BAS A;  3KYQ A;  3PLN A;  4HYT B;  5KJ7 C;  1NYH A;  1K04 A;  3G9R A;  1T2K C;  1BE3 G;  2XV5 A;  1VQ8 P;  3L37 A;  3FWN A;  2E76 C;  1SS1 A;  4D6T J;  4N78 D;  2QA4 P;  1GK6 A;  3L71 G;  1EZV E;  2KK7 A;  2N1T B;  2BEQ D;  3I5C A;  1N7S D;  2IBZ D;  4Y28 J;  5CJ0 A;  2JWD A;  1GD2 E;  1IC2 A;  1L0L D;  2LKM A;  2KZJ A;  1S5L X;  1NTZ E;  2B87 A;  1SQQ K;  2W83 C;  2QE7 H;  1X79 B;  3CCR P;  1FJP A;  2R32 A;  2NPS B;  2ZFC A;  3L72 J;  1NTM J;  4PJ0 E;  3E7K A;  1QGK B;  3CCL P;  1KB9 H;  3H1L G;  3Q5S A;  2WQY C;  3LID A;  1ZLL A;  1QL2 A;  2FFD B;  3AEG C;  3BAT A;  4ASV A;  3TK1 A;  3HUS B;  2HPC B;  3L72 E;  4GDO A;  1GU5 A;  3PH0 A;  5CCG D;  4LGD E;  3L75 G;  1IZN B;  2FXO A;  1GL2 B;  4JBZ A;  1IFJ A;  3M91 A;  1N2D C;  5AVS B;  3GHG C;  4HH2 A;  2GUS A;  2O01 N;  4NPD A;  1PIX A;  4JPZ B;  4UB6 E;  3B4S A;  4U3F J;  3M0D A;  2P2U A;  4WBA A;  1LWU C;  4ZNC A;  3L70 G;  2PGD A;  1AV1 A;  1NAY A;  2IYO A;  1R8E A;  5APT A;  1VQ4 P;  1K9M Q;  4U3F E;  3M9Q A;  1SP4 A;  4QMA A;  4W7Y A;  3NMD A;  2KSE A;  3RK2 B;  1NTM G;  4GKG A;  2ZVN B;  3AE4 C;  2E43 A;  3CPW O;  2V7Q H;  3P8M C;  4H0L B;  5GTH E;  5K5G B;  3LW5 H;  1HBW A;  3VYI A;  1GDT A;  1SLQ A; 
#chains in the Genus database with same CATH homology
 2B87 A;  5CBN A;  5CBO A;  1OVV A;  4HKZ H;  1X0T A;  4HJG H;  1H0T B;  5C39 A;  1DEE G;  4EYY Q;  4IOI H;  2M5A B;  1MFT A;  1U7J A;  2SPZ A;  2ZAE B;  4NPE A;  4K3A A;  4ASV A;  4K35 A;  1OVR A;  3MZW B;  4BXL A;  2UWJ E;  2WMM A;  1LP1 B;  4ZMD A;  2I8D A;  3S1K A;  2KI7 B;  2K3R A;  4KJM A;  2B88 A;  3MHV A;  3PH0 A;  2M0B A;  2KUB A;  4MN4 C;  5DJU B;  4JBZ A;  2Q1K A;  2KS1 B;  2QRX A;  1U7M A;  4NPD A;  1EDK A;  1ZW0 A;  1LT1 A;  1OVU A;  4GOE A;  2R44 A;  1EDL A;  1FC2 C;  1H0T A;  1JMB A;  4CPG A;  4ZNC A;  2M5A A;  2KIK A;  2QVA A;  2P58 A;  1ZXG A;  4HB1 A;  1BDC A;  2RKL A;  2LR2 A;  1NVO A;  1EDI A;  4GOD A;  2B89 A;  2KZI A;  1LP1 A;  3FXD A;  1EDJ A;  3QWO C;  3FXE A;  4NPF X;  5DJT B;  1EC5 A;  1SS1 A;  1JM0 A;  2B87 B;  2HR3 A;  1S3J A;  4GOF A;  4ASW A;  4WWI A;  5EFW B;  1BDD A;  1Q2N A;  3ZDM A;  5K5G B;  2JWD A;  3RGU A;  1Y47 A;  2KZJ A;  2LXB A;  2OTK E;  2LXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...