1OFCX

Nucleosome recognition module of iswi atpase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
266
Chain Sequence
b'AVDAYFREALKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERENIELEEKERAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ISWI PROTEIN
publication title Crystal Structure and Functional Analysis of a Nucleosome Recognition Module of the Remodeling Factor Iswi
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
total genus 103
structure length 266
sequence length 281
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09110 HAND HAND
X PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1ofcX01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 1ofcX03
4A3EJ 3SJMA 3C2BA 1IC8A 1LFBA 1ZTRA 2DA3A 2M2EA 5F1JA 3CDLA 5F27A 4XRMA 2FJ1A 4X6AJ 1JGGA 2R7ZJ 5K7ZA 3OIOA 2K9QA 2O7OA 3S1QJ 2HXOA 5EEAA 1A6IA 3ZQFA 5FKKA 3BR5A 4MFEA 4A69C 4XIDA 1Q1VA 3VPRA 4UUSA 1WI3A 1APLC 5DS9A 5FKLA 4A3LJ 3QQAA 2E19A 3FK6A 3K2AA 4BXXJ 3BG9A 4B3AA 3PO3J 3JRBA 2R0QC 2PMZN 2IEKA 1ITYA 1MBKA 2M34A 5C44J 1JKPC 2Y0SN 2HQ5A 5C4XJ 1P7JA 5EZGA 3BG5A 4DZJA 3HOZJ 4A3GJ 3Q0UA 1TWCJ 3FISA 1Y1VJ 2QF7A 4FE4A 1MBEA 3D1NI 1F36A 3TW6A 2Y9ZA 5EF6A 4FCYA 1K61A 1MBHA 4FISA 4IHYA 1JT6A 2XB5A 1ZK8A 2D5VA 2EQRA 1H88C 1ETWA 1ZGWA 2JA6J 2MG4A 2ZB9A 3IH4A 2HOTA 3M4OJ 2L9RA 1HCRA 2KT0A 3MN2A 1WGXA 1RPWA 3HM5A 4MLOA 1JUPA 2DA5A 3ZQLA 5FLVA 1RKTA 1ZR2A 2HYJA 4W97A 3RQIA 4D5CA 5IYBJ 3JREA 4RDUA 5EG0B 1GDTA 1NK3P 3S16J 3S17J 1Z77A 3JR9A 1S7EA 2XSDC 1XS9A 4M3GA 2DTZA 1AHDP 2QCOA 3RKQA 1AU7A 2LK2A 1U9NA 3JRIA 1XC5A 1IDYA 4DW6A 1H89C 3HOUJ 1E3OC 3ZQGA 3HKZN 2ECCA 1K83J 3O8GA 1BL0A 1ENHA 1ETVA 1I3QJ 3MVPA 1U78A 2XGEA 2JN6A 2XGDA 2ME6A 1MSEC 2LKXA 3GTMJ 1BJZA 2FD5A 1R9TJ 2LVSA 1VI0A 3MKLA 1BW5A 3LSPA 2WV1A 3JRGA 4DZPA 3HOYJ 5E3NA 4C3JJ 1H8AC 5FJ8J 2JA8J 5K7HA 2MSYA 2DMTA 2VKEA 2YU9J 5EGOA 2I10A 4V2FA 3H0GJ 2R93J 2HXIA 2W48A 3FK7A 5IP6A 2Y9YA 4M3BA 2XGCA 2CRGA 3A01A 3GTPJ 2X9DA 2IBDA 4A3IJ 2O8KA 1GVDA 1FTTA 1MBJA 1VF9A 2E1OA 2HI3A 2VI6A 2N8GA 3CMYA 3GTQJ 2WB1N 5J1YA 1HDDC 1G2HA 2YUSA 1MBFA 2HOAA 3S2DJ 1JUMA 1BA5A 2EZIA 3GTOJ 3A03A 4W1UA 2VPRA 3ZQCA 1POGA 4XICA 4V2GA 5M3MJ 1TC3C 1UMQA 5GP9A 3HBLA 1JKOC 5FLMJ 3BTJA 3UKGA 2OF7A 1DU0A 5F08A 2LTPA 5EZHA 1ORKA 5E3LA 3GBGA 4XRSA 3S15J 3HB9A 1IG7A 1IRZA 1NTCA 1MH3A 2RAEA 2DA4A 3F0CA 2ME0A 4FTHA 1F43A 3OOUA 4DYQA 4D7NA 2X6OA 4BKXA 1MH4A 1EF4A 4HNVA 1FIAA 2R92J 2KDZA 3JRDA 2LLKA 1RKWA 1I50J 1W0UA 1DU6A 1UG2A 1Y1WJ 3LSRA 2M0CA 3B6CA 9ANTA 4C2MJ 4BY7J 5F0HA 1X2NA 2XB0X 1QVUA 2Y2ZA 3BQYA 2LR8A 3BQZA 5F04A 5M5WJ 1JKRC 3HEFA 5E3MA 1ETKA 2CU7A 2LP0A 5IP9J 4IHVA 3S14J 2DMNA 4EEFG 4AUXA 1ETOA 1GV2A 5FKOA 3B6AA 1HLVA 1OCPA 1TWFJ 4IEJA 4D5FA 1HF0A 3ZQHA 5GPCA 2TCTA 2R5ZB 1AKHA 2WAQN 4BBRJ 2FX0A 3I4MJ 1W0TA 3BR6A 2DMPA 3OSGA 5EG0A 2L7MP 1HOMA 4NDLA 2CQXA 3LOCA 2EZHA 3BR1A 2DJNA 3Q3SA 4G12A 3JRCA 1AKHB 4IHWA 4ABZA 2DA7A 3O8HA 4CYCB 1IV6A 3DCFA 2LY9A 4JX6A 4L5EA 1ZR4A 5JLWA 2MGQA 5F0CA 2HDDA 2HOSA 5HODA 3IV5A 1NK2P 2AHQA 4RBOA 5EDNA 2CUFA 1U8BA 5F0FA 3S1NJ 1HDPA 4MO7A 4A3DJ 3ZOBA 4B1RA 5IP7J 3HOXJ 4X1EA 3BR0A 1FJLA 4IHXA 4Y7NJ 1JKQC 1VFCA 2L0KA 2JWTA 2FQ4A 5JLXA 4QTRA 4GFBA 1YRNA 1TWAJ 2DA1A 5GPAA 5J1RA 5J1UA 2CQQA 3K7AJ 1P7IA 3CQZJ 2E2JJ 3M3YJ 4Y52J 1QPIA 3Q0WA 2CUEA 3Q0VA 1B8IB 1QRYA 2G0EA 4LOCA 1YRNB 3TEDA 4JP0A 1SFOJ 3WHBA 1Z0XA 1JJ8C 1RR7A 1OFCX 3E7LA 1TWHJ 3W6VA 3TP0A 1GT0C 3JRFA 3S2HJ 4M6VA 2LFBA 5DTDA 1D5YA 5BNGA 2ID3A 3IH2A 4JX4A 1FEXA 3NAUA 1U9OA 2MW8A 3BR2A 4M3EA 1ETQA 5C4JJ 2XPUA 1IGNA 3HGYA 2JMWA 2GM4A 1BW6A 3TW7A 4J19A 1LE8B 2NVXJ 1RESA 4JYKA 5C3EJ 1WCMJ 4QSHA 4BY1J 3BTCA 3HGGA 2P81A 1MNMC 1T56A 4AC0A 2NS8A 2NVYJ 2JA5J 1X58A 2OPTA 4C3IJ 2NVTJ 1B72A 3SFIA 4AYBN 2XPWA 3GTKJ 3QPLA 2JJ7A 4DYCA 4A3BJ 4XK4A 1B72B 5EYRA 5M5YJ 3DEWA 4A3JJ 4A3CJ 1FIPA 2AO9A 2O9LA 5J3LA 3HOWJ 2EBIA 1CQTA 2K9NA 3WHCA 5M5XJ 3BR3A 2NVQJ 3LNQA 3FKIJ 4DCKA 2M8GX 2TRTA 3LSJA 4B4CA 4D7MA 2R5ZA 3BT9A 1MBGA 1RETA 2DN0A 4MIMA 4UUSB 4JQ0D 1MSFC 1GUUA 1GV5A 3QPSA 4A93J 3JRHA 4CYCA 4XRSG 2GLOA 3IH3A 1OCTC 2EH3A 5FKNA 3HDDA 4A3MJ 2COBA 3RZOJ 3CCYA 2ID6A 2DMQA 1QVTA 2Y30A 1ETXA 4FE7A 3LSGA 3BG3A 5IOYA 2L7ZA 1FTZA 4DYRA 4M3DA 1XG1A 2CJJA 1JTYA 5IYCJ 4OVNF 2NS7A 5IYDJ 2JA7J 2E2HJ 2X48A 1TWGJ 1PUFA 3FIWA 2VUMJ 1ZQ3P 5IPAA 3GTLJ 2H1KA 4MFDA 3PO2J 2EZLA 2B63J 2DA2A 1JJ6C 2L7FP 1IJWC 1WH5A 2YS9A 3S1MJ 1SANA 1WPKA 1PUFB 3PM1A 3I4NJ 1WH7A 4BBSJ 1B8IA 1ETYA 5IOZA 4A3FJ 2JK3A 1A5JA 2R5YA 1ZKGA 4A3KJ 3GTJJ 1UHSA 3BTLA 2NOGA 3OSFA 4JX5A 2R5YB 4UUTA 2EZKA 2ECBA 5E3OA 4I76A 1OJLA 5K7FA 3A02A 3ZQIA 2VKVA 2E2IJ 1LFUP 2GBYA 1JT0A 4I6ZA 3HOVJ 3G1LA 3G1OA 1O4XA 3TP3A 3H3VK 5M3FJ 2H8RA 1IDZA 1X2MA 1VNDA 3BTIA 5FKMA 2ELKA 2K9SA 1I6HJ 1IUFA 2M9HA 4M3FA 1T33A 2DMUA 4QIWN 1JUSA 3RZDJ 1LE8A 4S0HB 2DA6A 2Y31A 2XRLA 3S1RJ 3L1PA 5EGOB 3NARA 2XPVA 2K40A 1JTXA 4JPZB 3GTGJ 2IAIA 3G1MA 3SDGA 3A01B 4C3HJ 3JRAA 2LD5A
chains in the Genus database with same CATH superfamily
1QGKB 4P9FA 2R3CA 3SJMA 4JK1X 3WU1B 3CC4P 4LIUA 1RC9A 2DA3A 3E6MA 4E13A 1S7OA 4PD4D 4ASNA 2UXXA 4HAMA 5BPDA 4M6XA 4NB5A 1XMXA 1F5TA 1KS9A 3BG6A 5F27A 2NZ2A 4XRMA 1FOSF 3LSTA 2X6YA 1VQ6I 4RB0A 4PZCA 4XKBA 2E75C 3PRJA 2ISZA 3CC7P 4X6AJ 2P7CB 4BXUA 5K7ZA 2HLOA 3SZGA 2OZ6A 3OIQA 3DEUA 2Z33A 3LMMA 1GU5A 1LGHB 1FMWA 2K9LA 2Z3YA 1D5VA 1K05A 4WXCA 3OIPA 2Z1DA 4CZCA 3S1QJ 5KJ7D 2K9JA 4MGRA 3C7CB 1ZH5A 1FZBA 3OS2A 4HV6A 1W4MA 1YI2I 3BP8A 1BGYD 1Q1VA 3VPRA 2WTYA 1VQ8P 1VQPI 1MDMA 1DPUA 4PJMA 1ZG3A 4L5JA 2B87A 3GHGC 4H0LB 1T2KA 3LQRA 3P9IA 2R32A 1YRLA 4BH9A 3PO3J 3JRBA 1IFIA 2R0QC 3GF3A 2IEKA 4HQMA 4XSXF 3E5XA 1AQTA 2Y69H 2QM3A 1GW3A 3MD0A 5AVZB 2V1DA 3DU6A 2W8ZA 5E79H 5EZGA 1NKZB 4RKUJ 1TNTA 2MD5A 4YFXF 1KYOI 2QF7A 4D9JA 2C0WA 5APUA 2DOAA 4I0AA 2EK5A 1MV8A 3E6BA 3RQ4A 1BR4A 3D5LA 3HADA 2FYUJ 1RUOA 4ASVA 4EYYQ 2DLLA 4Q48A 1S72I 3USSA 4YRVA 3D6YA 1LWUB 2FFDB 2EQRA 1H88C 2JA6J 1KQ9A 1V5FA 2MG4A 3DTEA 2BW3B 2I8DA 1PGQA 5ICEA 1VF5B 3IH4A 3H1CA 4PJLA 2HOTA 1ULYA 4LG0A 2L9RA 2R7QA 4ZDPA 1RR8C 3MZHA 3BCCE 5CVJA 3WTTC 5LFAA 1IN6A 5HS9A 4BNCA 1LTBC 1RPWA 1WJFA 3AG4H 3HM5A 4MLOA 1EH8A 1RF0C 1QMGA 3ZQLA 1M90Q 1LJ2A 1SQXJ 1D1AA 5TISC 4W97A 4PGHA 3KETA 1SQPE 2KIUA 3DFGA 3J81K 3JW4A 2OTKE 2BVMA 5H20A 4L73A 1IRXA 1MJAA 5FO5A 3HYIA 1QZYA 4M3GA 1AHDP 2PFBA 3FXDA 1DLIA 3HXLA 3HD7C 3KPEA 2ZJQF 2M0BA 2L01A 4GWGA 1EZVI 2IBZE 1XDSA 1VQKI 1Z3YA 4UXNA 1E3OC 5BQTA 5KLIB 3ZQGA 3UNGC 3CWBJ 4Y99C 1WJBA 3RK3D 1I1GA 1NOHA 1EDJA 1K83J 1BL0A 3OYMA 1ENHA 3SWKA 3MVPA 2CW0F 4NC8A 4NQWA 3HRMA 2ME6A 1HBXG 2C0XA 5CBNA 3K6JA 1MSEC 3GTMJ 3J7AO 4OAYA 4R4LA 1Z6TA 3BPVA 3GG2A 2VXDA 2FMYA 3F22A 3S3NA 1T0FA 2E7WA 2MBFA 1J1DC 1L0NG 3L75E 3HOYJ 5LEJA 4MN4C 3V2RA 3QPTA 1ODDA 3ZN0A 3V7CA 2XF6A 3DEEA 1EZVG 4Q4ZF 1IW7F 4XBFA 5E3NA 3OYNA 4DIQA 1H8AC 1M67A 1U7MA 1M1JB 3RBZA 1SQBK 3RK2B 3L00A 3AAFA 2JA8J 3V4GA 4EQQA 5H2FH 3IR9A 1H9TA 1G8XA 5DYMA 3IUOA 5EGOA 3BLYA 3I3LA 4BDZA 1XN7A 5JVTA 2CV2A 1I36A 3FWNA 4F92B 3GF2A 4CCKA 3IRRA 2KIQA 3BJAA 4ZZDA 3A01A 4BE0A 3GTPJ 3L71G 1H89A 2VASA 5F1RA 5HDGA 1FTTA 2HI3A 3KE2A 1RHZB 5C39A 3GTQJ 1VQNP 4R1HA 5J1YA 3GWZA 1SQQE 5AW9B 3B4SA 2WAFA 3H3ZA 4N9IA 3A0BC 3MKWB 4UUVA 1E79H 4LLLA 2WY7Q 1JUMA 1TW2A 1WPQA 3C1DA 3GTOJ 2LXCB 2L3DA 1XDUA 5JVGF 4QMAA 3H9QA 4NNJA 1BIBA 2QLZA 1Z56A 1IAWA 3K5BA 2RREA 3HBLA 1HGVA 1ZRTD 4J0FA 1NTKJ 3TNUA 3BTJA 2IDBA 2JRMA 4UB8H 4GT1A 1P9QC 2HDCA 1SMTA 3BY6A 5F08A 5E3LA 1ORKA 3J80K 1DU0A 3RCOA 4KUHA 5KK1A 5GTIE 4A0ZA 1BE3J 1IG7A 1WT6A 2E75D 1IRZA 3C3WA 1D3YA 1DGRM 3SZPA 1F43A 4FTHA 2GOMA 3B5NA 1L0ND 5E79E 1LDJA 1NHLA 2IGOA 3S93A 1YIOA 1EZVD 2EJRA 1ZYRF 4BKXA 4ZZLA 4HNVA 5LRSA 5APYA 3PSFA 3CX5E 5K5RA 5IY5H 2NNNA 2QSHX 2QQBA 2H6CA 2N1TC 4NBQA 1FZGA 3WGHA 2DOFA 3IRQA 1VQ7I 5IT9Z 1N1EA 4I7HA 1W0UA 1IFMA 1NGMB 2FNPA 3RI4A 3V7RA 1DU6A 1UG2A 1LT9B 5DDGA 4JPZB 3OYJA 3H1IG 4GO1A 1FY7A 3JSOA 4C2MJ 2K3PA 3CI9A 4WCGA 3L71D 3BQYA 2MH9A 2CSOA 3KZIC 4JBAA 4BXFA 2O0YA 2RQQA 1JKRC 1EVYA 2FXMA 4PJ0C 3G73A 1IK7A 3M1EA 3E97A 5M1BA 1OX3A 1EH7A 2J59M 3S14J 1FC2C 2KI7B 3IFMA 3CCEP 2DMNA 4E7LA 1WHUA 4YXWH 4EEFG 5BMZA 1EDKA 2K4BA 1SD6A 1AJYA 1GV2A 1X1CA 1HLVA 2HU9A 4P55A 1FE6A 2IFNA 2WITA 1FMVA 4KT5C 2JSCA 3W6JB 1OCPA 3HSFA 3MEXA 1P84D 2FXAA 2FYUE 1T6SA 1IXRC 4IEJA 1M7LA 2RKLA 2TCTA 4BAYA 2DT6A 2L4AA 4I01A 3S2WA 2R5ZB 4BDYA 4KYWA 1LP1A 1VL2A 2WAQN 5D5WB 3AE9C 4KT0J 1W0TA 1Z21A 2A5WA 2PI0A 2R7FA 2L7MP 3HRTA 5EG0A 1S9KE 1KB9E 3FXUA 2ADUA 4NDLA 3BCBA 4IPAA 4U7JA 2EZHA 3BR1A 2DJNA 4PZDA 2EW2A 4IHWA 3G71P 2P4WA 1HSTA 1IV6A 3ZDMA 4YCAA 1LEBA 1SQXE 1XX5A 2LY9A 3CDIA 5CYVA 5AW6B 1T3UA 1ZELA 3EUHA 3QU6A 3L2RA 2HQAA 4KIGA 2H43A 2PMZA 3JCUH 3AL0B 1NH3A 5HODA 2Q1ZB 3V8JA 4Y28J 3IV5A 4CPGA 4EJWA 3DU5A 5APWA 2PJRB 5EDNA 1MFZA 1KZHA 2Y0SA 1JDJA 1YITI 3G4SI 5KNLA 3ZMVA 3R4YA 3L70J 2IGNA 4P96A 3H1ID 3HD7D 3WFIA 3FHZA 3C1LA 4KUGA 2WY8Q 4RLQA 3X2QH 3ZOBA 4B1RA 4A3DJ 1T8ZA 5H2FE 2E36A 3CWBE 1LT1A 3HTKA 3L37A 4L9JA 2A6EF 2VJ5A 1CZQA 1XB4A 1X1BA 4L0YB 2PP6A 1VFCA 5ICCA 3EWKA 2HDWA 4IQ4A 3WU2E 2JWTA 1EA3A 3KZYA 5A9TA 2R7VA 2QQ9A 2EB7A 1FZPB 1SQBJ 2L7KA 2QJPC 1YRNA 1TWAJ 2BXYA 4ZDOA 5GPAA 2LXBA 5J1UA 2JVGA 3K7AJ 3J7YJ 3CQZJ 3M3YJ 1OCOH 2CUEA 3QOPA 1USEA 1KONA 2QG4A 1IFNA 5E18F 4LOCA 1SVOA 4DQ2A 1NU1D 1RE3C 2AQEA 3IF4A 3V5BA 1Q81Q 1Z0XA 2JP3A 4PJNA 2FNAA 3GFIA 2GXGA 3CCLI 2PJPA 3AE4C 3CCMI 5L3FA 2H27A 2KOGA 1GT0C 4IKFA 2D2CB 3GZNB 3CMEP 4JF7A 1D5YA 5BNGA 4UB8E 2J5PA 3K1PA 2M3BA 2EIKH 3I56P 3M0DA 1VDFA 3DBRB 3IH2A 2OQRA 1B4AA 4JX4A 2E74D 3H5NA 3LA3A 1ERDA 1BGYJ 2RN0A 2YKPA 1TXGA 2QSFX 1L0NK 5B66H 4XKCA 3WTWC 4PD4H 4JBZA 3REOA 2XAJA 3BR2A 4NPEA 3KYDB 1N78A 3LIDA 1I39A 5C4JJ 4BHBA 1MJ9A 1IGNA 3QSGA 2FBHA 3HGYA 1TTYA 1YQ3C 2E34A 2BY0A 2UV1A 2R44A 1H0TA 3H92A 4A0XA 3RK3B 3CLOA 1LTIC 1Z7UA 3I53A 4E12A 1WCMJ 1RIOH 1NTKE 3HGGA 2P81A 4MHGA 2P58A 3U9GA 2NS8A 3NWSA 4G7OF 1BE3E 1RF1A 1FZCB 4C3IJ 3F9KA 2OTJP 1OCCH 4ZYEA 1IF1A 2ZXEB 5CBOA 3RKYA 1RH5B 5FFXA 3V42A 1KILC 3KIOA 2ESNA 1T98A 4XLHA 5D5VB 1NU1G 1B72B 5HS7A 5M5YJ 1X0VA 2OZUA 1XTGB 2N1TD 1FIPA 1W7PD 4XM3A 3OYEA 1ZG1A 3CUQA 3EUKL 1LQ1A 4M73A 3HOWJ 1MMNA 2A45H 1IXSB 3ABKH 4LD5A 4M9ZA 1O3TA 3FX0A 3SFEC 3H1KG 2VXZA 1CQTA 3WHCA 2NVQJ 2YMYA 4IRIA 1Q86Q 3FKIJ 1HH0A 1KYZA 3IKVA 4HSTA 4J00A 1VPCA 2K1AA 4EM2A 4RM3A 2TRTA 3K6GA 1HUCA 2XNDH 4H44C 1ZMEC 1LTSC 3BROA 3V4QA 3GMEA 2JZYA 4L18B 3HN2A 3AE5C 1Z67A 2DN0A 4MIMA 4RMNA 2OAZA 4JQ0D 2HFHA 3OYLA 3I5UA 2IA1A 4EIJA 1GV5A 4A93J 3LAJA 1PVEA 3JRHA 5A9SB 3J81Z 2NPSA 5CJ9A 5HLGA 5EFWB 4A5MA 2DW3A 2AXLA 1GTWA 4FX4A 4PV1C 3CCVI 1K04A 2K3FA 3A0HH 2M3EA 5CHXA 3ISPA 2DBBA 3K70C 1G4DA 3O8ZA 1KGSA 2WTEA 2HDHA 4AYBA 5AYVA 2E75B 3DTIA 1WDMA 2RQPA 1S3JA 2M1BA 1DP7P 3P8CE 3KCCA 4N78D 4WY4A 2CQNA 2IPPA 2XAQA 2OQQA 2RDPA 1U3EM 2M5AB 2G9WA 3QYFA 2ZKZA 2L7ZA 3F89A 4DYRA 3MFKA 2ZXWH 5IYCJ 1JTYA 4OVNF 3RBXA 2NS7A 2F2EA 2LY2A 3AG1H 5LHHA 2R5BA 3PIOF 4H13D 2EINH 3ZXSA 2VUMJ 3PO2J 3GTLJ 3GW6A 2EZLA 4XORA 1MZBA 2A3SA 2GIVA 1JJ6C 1L4AC 1IJWC 3GHGB 3L70E 1K4TA 5DJTB 5APSA 1MMGA 3EDPA 3H1KD 2KHMA 1PUFB 3BJ6A 4MTDA 3I4NJ 2M87A 2Y0EA 4BQNA 2R4GA 1TT0A 4KJZA 4N4NB 5LGNA 1B8IA 1KQFB 3ADPA 4LJZF 2R5YA 3I71A 3CP8A 1KYWA 1SQBE 1WMKA 1SFKA 4G94A 1U2WA 2DAOA 2ZMEA 4HSRA 2R7SA 3U1AA 3Q5SA 1YJWP 3NEUA 2HWVA 2OYHA 4L0ZB 1K73Q 1ZW0A 2MYSA 4HBLA 3F8MA 2K4JA 4OAZA 3I59B 4WK8F 2H88C 4PD4E 1IN8A 1ZCJA 3A02A 3ZQIA 4QPOA 3RL0C 3PQJA 2E2IJ 4L9VA 3CD6I 1T95A 1HKQA 3QHAA 4I6ZA 2E1CA 2JWDA 1U5TA 2Y48A 2ZNZA 2ZJ2A 3L2VA 2GUVA 1M1KQ 5AIQA 4II2A 2QYTA 5APQA 2CG4A 1I6XA 5CVVA 2EPFA 4FT8A 3H3VK 3H1LJ 3MZWB 2FE3A 1ZOYC 1VNDA 1EVZA 2WSSH 2V7FA 2CQ7A 5FKMA 4B43A 1G3TA 1HW2A 3VYRB 4EZBA 4EJUA 3RZDJ 3WGGA 1LE8A 4XOPA 5DCFA 3J80Z 4IX7A 4ENMA 1BGYE 2DA6A 3VMYA 5KKZC 3S1RJ 2KB7P 3ELKA 1PP9G 4YIIA 1REPC 3W6ZA 4HX4A 1JY3N 3HPHA 2OFPA 3HD7B 3L71J 3SDGA 3S1KA 1T2KC 3JRAA 1FOYA 4IXAA 2FQ3A 5E17F 1WRGA 3IAM2 1GHCA 1PYVA 4K2EA 1CF7A 4Y99B 3GYHX 2EFPA 4GYGA 4BEHA 3TSIA 1V5GA 4UY8I 3CDLA 2MLKA 1XSVA 1EJ9A 2QVAA 1QQIA 2OC6A 1FBMA 2VIXA 2FJ1A 2QBYB 2ZYAA 3I83A 4HPQA 1D1CA 4WWCA 3OY9A 1JGGA 1J1DB 3AG3H 4P9UA 2OARA 2WSFH 3G6EP 2VKHA 5HVQC 1LTTC 1RI7A 3U59A 2DFIA 2STWA 2K9QA 1A35A 1JI8A 1BCCJ 1V55H 1E5WA 5J47A 5CCGA 5EEAA 1A6IA 2M4KA 2CGPA 2E5YA 3ZQFA 3CC4I 3B73A 4PGGA 3O6BB 4RAGA 3ADOA 1IO2A 2RMZA 1JGSA 3BR5A 4MFEA 1O3SA 4UUSA 2W7NA 4A3LJ 6PAXA 5AVVB 3TOAA 3IQDB 3CC7I 2EWNA 2ZJPF 2E19A 3FK6A 3WS7A 1NYHA 4XN0A 4B3AA 2BV6A 3E6CC 1P84H 1X19A 4R79A 2FMLA 1A02F 4C46A 4GOFA 1MBKA 3GUDA 3VDXA 1EDIA 1AVOA 1P7JA 4IRGA 1QHGA 1PP9D 3BZ6A 3GFJA 3TO6A 3H1IJ 4DZJA 3HOZJ 1B9NA 1X3WB 4BRYB 2E5NA 3Q0UA 1Y1VJ 2QE7H 1MBEA 3BRTB 1VQ8I 1LWUA 1F36A 3TW6A 2Y9ZA 2LKMA 2FXPA 5AW2B 4FISA 3G0OA 4RGSA 1RQUA 2RH0A 2IXSA 1A36A 1ACIA 2BW3A 1SC7A 5DV5A 5AW8B 4AIHA 2FYZA 3I9V2 1SQPG 5TISH 3CCQP 2D5VA 1N7SA 2HR3A 5CLSA 4PV1D 5ILSA 2DOEA 1ZGWA 1LDKB 2M5WA 3OYHA 3AKZA 2RC4A 3ZMUA 3K70D 3VYIA 1IJDB 1FC3A 1TBXA 2M30A 3M4OJ 2KLVA 3RK3E 4GIFA 1HCRA 1S8NA 1JM0A 3H32B 2QQ8A 1KFNA 1WGXA 1NU1J 1V54H 1G1JA 1T3JA 1FPQA 1JUPA 2H8WA 5FLVA 4UV9A 1ZR2A 3DOJA 4KIFA 2ZJRF 5HWSA 2COMA 5IYBJ 3EQ2A 2K9YA 3JC22 5KLVG 4M9XA 4A5NA 1W7PB 5A2QK 4RDUA 3S16J 2N1TB 5J4VA 3S17J 3FHNA 4BYYA 4E7KA 4IQJA 1YX5A 3BRVB 1KYOE 3HG9A 5LD2C 2DTZA 2KL4A 3TGUJ 4EM1A 5HNHA 5E20A 4DJGA 1U9NA 1FNNA 3ZGKA 4ANJA 1L4AD 2XASA 2F6CA 2WADA 1FBUA 1IDYA 3HRSA 4HV5A 3QP6A 1H89C 1FAVA 2LY1A 3HOUJ 4X0GA 4ENKA 3FMQA 4WBAA 3BC8A 1ZGJA 3R0AA 4YEJA 1SS1A 2UZKA 4YXDC 4CXFA 2LKSA 1R1UA 2KFDA 3CUOA 2XF7A 1ETVA 2R7OA 2XGDA 2H09A 2OBPA 4II3A 1M1EB 3UR3C 1JMBA 2VBZA 1ZREA 3A5TA 2FD5A 2LVSA 3MKLA 1SQVG 4IL6X 2WV1A 1M1JA 4F91B 3H2ZA 2A45I 2OCEA 3FMRA 3ABMH 3H5AA 3LSKA 3RL0D 5FJ8J 3C2GA 2WPRA 4EI2A 3LWFA 1ZP0C 4XN3A 2LREA 3HE5B 1YHQP 1BSHA 2KLOA 5K7HA 1R4MB 2MSYA 2DMTA 2VKEA 3H1LE 1PUEE 2I10A 2R93J 3I54A 1K78A 1EZVE 4IVNA 5K5QA 1FS0E 3FK7A 4RB3C 1RE4A 2R7TA 1S1CX 4S05A 1N1GA 1IC2A 3B5NC 2YSRA 3WTZA 4JQFA 3OYAA 1BSNA 2BYVE 3HRNA 3HUSA 2M0MA 3F8BA 1VQLP 2OTLP 4Q5SF 1MBJA 1VF9A 2Y0CA 5KLVD 2VI6A 2N8GA 2W27A 1HDDC 1G2HA 1SMYF 2K85A 5HOOA 3GEZA 1YFHA 2PRRA 4Y15A 1N8RQ 1MBFA 4I2LC 3FF5A 2ISYA 1BA5A 1UCRA 2H1LA 1WJAA 4HLXA 3L71E 2W83C 5J40A 5D8KB 4D6TG 4RM2A 1B59A 4W1UA 2ZXJA 2XAHA 4AVZA 3KHUA 1T2KD 4B44A 4M6YA 3QU3A 4V2GA 4HNTA 1B6AA 3MP7B 2L9VA 1SD5A 3C7JA 1KU7A 1OW6A 1FWZA 1Y8RB 1JKOC 3L73J 1Q2NA 3UKGA 4CCNA 1BOBA 2CPSA 2AXTC 2JQ7A 2HPIA 1VQNI 1U0JA 2LTPA 5EZHA 2XSJC 4XRSA 4BACA 3S15J 2XDJA 1PFIA 2QJPB 4ZNCA 1NAFA 4GWKA 1YTYA 2B9BA 1NTCA 2AQFA 1SQVD 1D1BA 3AE7C 1TQMA 4PK4A 1VQ9P 3DV8A 3OOUA 3LFKA 4DLLA 3Q5PA 1BCCE 3VTPC 3CTVA 1LT9A 3QP5A 3KZIH 2VB6A 1TL8A 4S04A 1UAAA 3JRDA 2JSPA 1Z1DA 2HQNA 4GDFA 2LLKA 1Q82Q 2IA0A 2RNGA 4XNFA 3A7OA 1UG0A 4PJ0H 4C7RA 2DYRH 2QIWA 3NRVA 1DEBA 5CCHA 4LC1A 2C9LY 5TISE 1E2XA 3H9JA 2L4MA 4BY7J 2VONA 3CXHD 4HRIA 2O1KA 1R5GA 1QVUA 2Y2ZA 4O6JA 4C7NB 4GDOA 4Y13A 3AEAC 5E3MA 4I09A 2CU7A 4AIKA 2LP0A 5IP9J 3FWEA 1BC8C 2WV0A 4IHVA 1PV3A 3H1IE 2ITAA 4ZC3A 4E7SA 1O7LA 1S5LH 1KC8Q 1ETOA 5E1ZB 1LTJA 2XAGA 4D6TD 1DD3A 2W24A 3RSNA 5ERIA 3HWRA 4B3HA 3TDZC 2ZYGA 2CW8A 4D5FA 3DBHB 2JUCA 5KAFE 1HF0A 2DU9A 3ZQHA 1G2CB 3AEEC 4IFDK 1BDCA 2DCEA 2YMKA 4NPDA 3BOQA 3Q1MA 3K9TA 3OSGA 3S32A 2VJIA 4CHUA 3HUGB 1HOMA 3K4NA 1UELB 2W85A 4PSXA 3CCEI 2DYSH 2VBYA 5FB2A 3JRCA 1Q7YQ 2H6BA 2VN2A 1PIXA 1NU1E 1FX7A 3ZCOA 4RO0A 2GIZA 3DCFA 1KILB 3IAS2 4XA4A 4Z1MH 5HDKA 1T38A 2PJRA 4L5EA 1NG6A 3K1MA 4D0PA 3EUAA 5JLWA 1S29A 5AW5B 2HDDA 2Q5UA 3KP7A 1V3FA 2ZXHA 1PPJG 1ZXGA 4RBOA 2W6AA 3LIEA 2KSJA 4HH2A 3TGUE 5DCMB 5B5EE 4BQAA 5FWNA 2CUFA 2F4MB 3V6IA 3DP7A 4MQ9F 1X1PA 3RYPA 5JHUA 1N73C 3G71I 1U8BA 2BEZF 3TGNA 2V9VA 1OW7A 3ERMA 1DPRA 2HODB 2I76A 1FDIA 3HIFA 4EJVA 2XV4S 5IP7J 1JY2N 2QM8A 5AVTB 4H44B 1YTZI 4FETA 3VOEA 4PCQA 3IL2A 1FJLA 4Y7NJ 4IHXA 3TO7A 1IRGA 1TQIA 2W90A 2EV0A 2L0KA 3TDKA 4U3FG 2O61A 4QTRA 5J8FA 1USDA 1YW8A 4I98B 4HB1A 3KYCB 5KLVK 1GMJA 3U1KA 1M75A 1FDOA 1WSUA 1YTZT 4H13C 4WVZA 5J1RA 2NYXA 4HLYA 2D1HA 4BQQA 1Y0NA 5CJ0A 1LJ9A 4U0WA 5APVA 4RESB 1BR2A 3Q0WA 1K8AQ 1WJ5A 1DX7A 2G8YA 2IGKA 4PV1B 2O3FA 3PNVA 2LNBA 4GKGA 2KIMA 3CMAP 4F3QA 4C2TA 3IN6A 4EGZA 1P84I 3M06A 1ZV8A 3B71A 4AM3A 4C30A 1OFCX 1J2JB 4GRIA 2P2UA 3FWLA 4F52A 1YJNP 1RF1C 3ULQB 1TWHJ 3KP5A 1MNEA 3OR2C 2J58A 2PAJA 4WB4A 3S2HJ 1SD7A 2E74C 4KHXA 2B89A 1YB4A 3B5ND 3O2PE 3LL7A 4YIFA 3H1JG 4BGDA 4HF2A 1LJ8A 2X58A 2JO1A 4XLCA 1YJ9I 2E7XA 3T8RA 1FEXA 1SQVK 2RKHA 4DJAA 4ESFA 1PPJD 3NAUA 3HKZA 1U9OA 2D2WA 3D70A 2A6HF 4M3EA 4AD9A 1L4AB 2WBMA 4UVBA 5HLIA 2HGCA 2V26A 2VT3A 1UIIA 1KFMA 2JMWA 3O3KA 4O3MA 3KZIE 3N4XA 3HTUA 2PN6A 3CMEI 3FR7A 5D4RA 3ABLH 2E76C 2X1EA 3F3SA 3TW7A 2V4HA 4W7ZA 3I56I 3J7ZI 1R5HA 1RESA 1PP9J 2DO7A 1NTMG 1QVFO 4A6DA 1LTGC 3L73E 4BY1J 4QSHA 2PGDA 2CW7A 1R36A 2C6YA 3H6PA 4U3FD 3ROUA 4AC0A 2O03A 1J59A 1N77A 2JA5J 2UWJE 2OPTA 2XAUA 1XCVA 3H5RA 1B72A 1XGNA 1WQ2A 4LLNA 2DDBA 1YI2P 2FF4A 1FBSA 3VWBA 2YR2A 5GADJ 1L3LA 5J8CA 3OW2O 3RL0B 5B3SH 4DYCA 5B1BH 4XK4A 4FX0A 4G7HF 2Q9IA 1KA8A 5EYRA 2B88A 1I1SA 1OCZH 1YLFA 4N78E 2DT7B 5EEGA 1XD7A 2MJZA 3PHLA 2LYCA 2WB1A 1AOYA 3GF7A 2HKOA 2P5VA 4YELA 5D6FA 3PUFA 1R00A 2HVSA 1J9IA 2OTJI 3VB2A 1QLED 4UVAA 1J09A 1UHMA 3FR8A 1OR7A 5CQGA 2K02A 5KAIC 3TBIA 1HW5A 2M8GX 1DD4A 1URQA 4DCKA 2DK8A 3H3UA 2K9JB 3H1JD 5KKZB 2BCCJ 1P4XA 3LSJA 4ITVA 1KQ8A 1RETA 4KIBA 2LH9A 5JFRA 1X4PA 4RS8A 1GUUA 2VC0A 2IVMA 3C7DB 2IFMA 2YKOA 2VT2A 2LDUA 1X8YA 2HTSA 4FHTA 4KN4X 4PFOA 4LGWA 3CP2A 4CYCA 1NTZG 1MMDA 1S5LC 2GQQA 5A2QZ 2F48A 2VJJA 3OMYA 1NTMD 1R71A 5GTIC 1OCTC 2E43A 3COAC 3HDDA 1RUNA 2MKVA 3K4KA 3KYLA 2WSEJ 3BCCG 3WE3A 4XKVA 2CMPA 4ZDLA 1CSBA 1QZEA 2QKMB 2CPBA 3L2WA 4EJTA 4DYDA 1ZAOA 2OYHC 1QVTA 1U6GA 1X4OA 2GA1A 2Y30A 1AA7A 1EXIA 4FE7A 2Q3IA 2X1DA 1KZUB 4B8XA 1LKXA 1EV7A 3R61A 5IOYA 4I2OA 1XSXA 4HJGH 2K3RA 3GZ5A 4M3DA 1XG1A 2CJJA 3MIWA 3DTKA 4XLEA 5IYDJ 3GHGA 3P9KA 4HYEA 5MGBA 1R8EA 2KZJA 3BJOA 1PUFA 4E70A 2BVLA 4OIOF 1KN7A 5CVIA 1BN5A 5IPAA 2H1KA 4MFDA 3J7AY 2VPLA 1D0ZA 3DPUA 4OWRB 2L7FP 1MGTA 4YFNF 2YS9A 1SANA 1C0WA 2QGUA 5KLVJ 2WSEH 1O57A 3PM1A 5CVUA 3U21A 2I1KA 1WH7A 2OYIC 2WWWA 3RPUA 4BBSJ 4YG2F 1PZQA 5CKTA 3O6QB 4MNUA 3W2AA 4A3FJ 1ZN2A 1OQYA 3H9GA 1Z82A 3NWTA 1XGOA 4M9SA 2NRAC 3GTJJ 2DQLA 1BDDA 1UHSA 2RN7A 1JXSA 1S2EA 2Q0OA 1W2EA 1KU2A 1M8OB 3N97A 5AIPA 4JX5A 2LMDA 2R3SA 1OIPA 2HS5A 1IN4A 1T39A 1SFCA 1LUJB 5ILVA 2M8RA 1GU4A 4XSZF 1NTZD 3BVHA 2ECBA 2P10A 5E3OA 2KZIA 3MZ8A 4RGXA 3PLNA 5K7FA 1UJ8A 2VKVA 4BHPA 2XNXA 1LFUP 2GBYA 1RF0A 1W5CE 2A6TA 1JT0A 2VQCA 1ZLJA 3IP4B 4NQWB 5BS6A 3BCCD 4MEYF 3NXSA 3FX3A 1SQPD 3ABUA 2IX7C 3ZP5A 3TP3A 5JI6A 1IDZA 1KILE 3DBLB 3BTIA 1X3ZB 3JSPA 2B9SA 1YJWI 2ZXIA 1YBKA 3FGAD 1I3AA 1N75A 1P92A 2BGCA 3ABVC 4M3FA 1T33A 2CO5A 1JUSA 2KS1A 1VZ0A 4BE1A 1F12A 3U2RA 4S0HB 3WTVC 4EGYA 3HD7A 4IL6C 2VODA 1FZAA 5EGOB 3L2UA 3NARA 2IJLA 2XPVA 3N05A 4A12A 2XIGA 2E35A 2FEZA 3OBBA 4FGWA 3F5HA 2IAIA 3M9AA 4BHCA 2IBZD 4ETSA 3PUBA 2JEEA 3V2QA 3A01B 4C3HJ 1UIXA 2QQAA 4RB1A 1GVJA 2Q3EA 1KQSO 2LD5A 2NXNB 3OL4A 4A3EJ 1NO4A 2H8PD 2OYOA 3LAPA 4PFPA 3ZGYA 1TT5B 1PP9E 1GK6A 2E76D 1IC8A 3DKXA 3WU2C 1LFBA 1ZTRA 3A3YB 3CCSP 1AQ5A 3M8EA 1NKNA 3T8TA 5CVRA 5F1JA 2VE9A 2E60A 2P8TA 2VKDA 1ZGAA 3MKZA 3PP5A 2WT7B 2PBIA 2AEJA 3OAKA 3SEZA 3L75D 1BI2A 3TOBA 3WU0A 3BWGA 3OIOA 5ILUA 3ERED 1U7JA 3MWMA 1CGPA 2NPSD 1XTAA 3TMOA 3F6OA 3CXHH 2O7OA 2CWEA 3K10A 3TNUB 1N7SC 2HXOA 4Y17A 3LW5J 2WVRA 3U1CA 4C9YA 1JHFA 4M71A 3GFMA 4Z2YA 4AQRD 2KZGA 2ZBKA 3G9RA 4XIDA 2DODA 1TP4A 3SYTA 4DBRA 1APLC 1NTMK 5DS9A 5FKLA 2BASA 3B5NB 3SWFA 3E3VA 3QQAA 4GODA 2Y0DA 3OYKA 1RNLA 1SEUA 3G6EI 3QRFF 2O01N 2PMZN 3D1LA 1KQLA 3KXDA 1BI1A 2HPCA 2DFEA 3HSEA 1ITYA 2M34A 5C44J 1GL2C 3HDHA 2BCCE 1CI6B 1A31A 3R2PA 1JKPC 3KFWX 1WDKA 2Y0SN 3JCUE 2HQ5A 5C4XJ 4UB6C 3CO7C 2DPUA 3BG5A 2L2OA 3LSHA 4E4HA 1X22A 1TWCJ 3FISA 4IJAA 1D8JA 2HG5D 1GW4A 3LW5H 3D1NI 1OYIA 2B7EA 3KEYA 4DOJA 1MBHA 2BXZA 2J5OA 5EEHA 1S7AA 4IHYA 1K7AA 4ZMDA 1Z91A 4XMYA 1FBQA 2QEXP 4IHTA 2ESHA 1E3PA 4BJTA 2FBWC 1D0YA 3AEGC 2VJ4A 2OU2A 2KLUA 3EYYA 1SQXG 2KT0A 4V19K 1LDDA 2FUG2 3MN2A 5DUIA 3CCUP 1K6YA 4I0BA 1YITP 2DA5A 1M66A 2HYJA 3GZ6A 3CX5D 3RQIA 3I58A 2QJKC 2ZT9D 2EFOA 3JREA 3G3ZA 3PL8A 5FD6A 2VLAA 5EG0B 3NFQA 4YPCA 3HL2A 2YO3A 1NH4A 5AVXB 5AW4B 3VMAA 2VC1A 1Z77A 3R4KA 3GCMA 1S7EA 3JR9A 3CCQI 1NTZK 3QPHA 2XSDC 1XS9A 2A69F 1X0TA 5AVWB 3W68A 4LIVA 4ZH4F 4B09A 1HVVA 1G6NA 1F4KA 1XGMA 2R7XA 2ZVOB 4ESBA 5CJ4A 2IS1A 3F8CA 1RE4C 2M8EA 4LGDE 5KLVE 1IFDA 5AVYB 3HUSC 2LSOA 4HDUA 2ZVNB 1ZHFA 2Z5HA 5CQEA 1DLJA 1SQPK 1YIJP 3PJSK 2A06G 4KN7X 1VQMP 4RAYA 1Z05A 1X79B 1WJEA 3ML6A 1YVEI 2ECCA 3CCJP 2J5UA 2X4HA 1GLNA 2DJIA 1I3QJ 4R8HA 1R23A 2XGEA 2Z5UA 5B66E 2JN6A 3VYUB 3RKWA 3GXOA 2LKXA 3CESA 1BJZA 2WWYA 3OYIA 4ENJA 1ON2A 1USTA 2R5DA 2QA4I 1BW5A 4OGQC 3JRGA 3HE5A 3HTKB 4ZTFA 4G6TB 2Y75A 1ZRCA 1PGJA 1X9VA 3OA7A 1L0NJ 2V7QH 5L3DA 1KB9D 4RGUA 3BATA 2X6WA 1FT9A 3AE2C 2BY2A 3L2QA 3CKYA 4J01A 3FM3A 5HLHA 2N9YB 1SQXD 3H0GJ 2VBXA 1JNMA 2HXIA 2W48A 2FA5A 1IRFA 3KDPB 2WSFJ 4HDVA 4M3BA 5LGTA 2XGCA 2CRGA 1NWQA 4BJ5C 2X9DA 1W5TA 2ZFUA 4HF0A 3DWLE 4A3IJ 2O8KA 1USSA 2F5FA 2E1OA 2VOOA 1VTNC 1OVVA 3R6SA 3ZN1A 2PMHA 3AEBC 1GZLA 3T5XA 2HYFA 2YUSA 3Q9SA 2AXTH 2XGXA 1YHQI 4O9BA 3S2DJ 5L3GA 2EZIA 5DUKA 3OV8A 1N73B 4DOZA 3H1JJ 2VPRA 3ZQCA 2O01J 2OGUA 1OLTA 1T08B 4XICA 5M3MJ 4CCLA 2R7WA 1TC3C 1NTKG 4I7ZC 4B86A 1UMQA 2RNJA 1VQLI 2A5YB 4Y33A 4GGGA 2A06D 4OIPF 2OTLI 2ZYDA 2NOJB 3PH0A 2W25A 3W6KB 3W67A 4HA8A 2ETHA 4AU7A 1ONVA 1H9GA 2DDAA 3M7GA 3GBGA 1TW3A 4H13B 4KDPA 1LTJC 3H35A 1KU3A 1E17A 3BZCA 1T8IA 1D7MA 3PIDA 4KNYA 3ZMZA 1QL1A 1GXQA 1MH3A 1J0RA 4A2UA 2DA4A 1NTMJ 3PTZA 2O1JA 4AWXB 1IN5A 2MLGA 4LK0F 5KTBA 1UHWA 4DYQA 2CFOA 1Z9CA 2X6OA 1BIAA 3OWTA 3HOTA 3N4MA 1MH4A 2IP2A 2GXAA 1VF5D 4WWIA 1FIAA 1N7SD 2KJBA 2O01H 3A0HE 1RF1B 1RKWA 3ONQA 1HKSA 1I50J 3EFFK 3L74G 3EYIA 1WWXA 4FASD 1PP7U 3AECC 2E74B 3M0AA 1YQAA 4EATA 3LSRA 1K4SA 2M0CA 3B6CA 1Y0UA 5DD4A 2ZCWA 3TK1A 4G9YA 2E71A 2P7VB 4MEXF 3HE4B 2XB0X 4PJJA 2KNCB 4U87A 3QYEA 4XKWA 1VQ9I 1F0YA 4CA0A 1B9MA 1J1EC 2LR8A 3BQZA 2YIUC 1WI9A 2X6XA 4IZZA 2H94A 3DPLC 1GL2D 4CZZA 2QM7A 4J0EA 3ZHBA 3FXOA 3BCAA 3JTHA 3OL3A 2FFDA 4XE5B 3ITKA 5BU5A 5FKOA 2PEXA 3B6AA 3CC2P 3D71A 4EDFA 3AEDC 4Y3OA 2E76B 3CCRP 1J2XA 2KRHA 1IXCA 1NTKD 1FSEA 3QODA 4L74A 4DNCA 5GPCA 4NHJA 2E5TA 3HC7A 1FYMA 1YJ8A 1WJCA 2F4IA 1YX3A 2FX0A 4FQGA 3I4MJ 1E0EA 5IT3A 2XVCA 1T0FC 1EH6A 1KILA 1HF9A 2CQXA 4HYTB 3LOCA 3MOGA 2E1NA 4LB6B 1NTZJ 3CPWO 1D8KA 4XRFA 1AKHB 4ABZA 2DA7A 3M91A 5J4YA 5AVUB 5KVRA 1PDNC 2QRXA 4CCOA 3CJRB 2CS3A 3GLXA 3RKXA 3RIRA 2MABA 4JX6A 3ZMSA 5DCMA 1ZR4A 3V4WA 4Z6YA 2MGQA 2M7BA 2HOSA 3LSMA 3GO5A 2P6SA 3WMM0 1HC8A 4RLFA 4BUPA 2AHQA 4HX7A 1Y47A 3L70G 1FZEA 2HODA 3L74D 1SFEA 2EV5A 3WGIA 2ZJSE 5LEKA 4YIRX 2JKVA 3DFUA 2XKPA 1FOXA 1FDMA 4ZYDA 3I0TA 3OYBA 4CO8A 5F0FA 3MKYB 3S1NJ 2IRFG 4MO7A 4OOIA 4U7BA 3C18A 3V2PA 4ZTJA 1SQXK 4KUMA 3HOXJ 4AVPA 2TDXA 2QVOA 3C9IA 4CICA 2RVCA 1JKQC 1JEKA 3CXHI 1ZRTE 3WUUA 2IZ1A 2W6JH 5AW1B 3VP9A 3G2BA 3QOEA 2DA1A 3CF5F 4Y52J 3PEFA 4GXOA 3W2WA 1G3YA 2ELHA 1QPIA 2QYOA 4K35A 3Q0VA 2FYNC 4IRHA 4OGQD 1QVGO 4D1QA 2ZNYA 1QRYA 3P7NA 4G7ZF 1B8IB 2AXTE 1KTMA 2FBIA 1L0NE 2WQYC 1SFOJ 3ZWBA 2WMMA 2Z4EA 2KJCA 1ZN5A 3AE3C 5FLXK 4OQZA 1RR7A 3CJTB 1J75A 3E7LA 1V4RA 2B0LA 3P8CD 1ZARA 2OCCH 3PNTA 1HJ0A 4B3IA 4OH8B 2OYHB 4IM7A 2D1VA 3W6VA 4A7PA 3SXYA 3JRFA 1F9NA 4M6VA 2LFBA 3KYQA 3OS1A 5DTDA 3I55P 1LTAC 2XDVA 4A6EA 2EIMH 1BOAA 2ID3A 1YONA 2JVHA 3L2CA 3LA7A 3RYRA 1L4AA 2W84A 2K9MA 2LOOA 2BHYA 4ASWA 3CMAI 3L72G 1XCBA 4RA2A 3L70D 3H25A 3MGNA 1FP2A 3KX2A 5D5UB 2EFWA 1ETQA 1YYVA 2XPUA 1YJNI 4TLFA 2WPQA 1UZCA 4L9TA 4L76A 3H1JE 4TT3H 2KP6A 5ICGA 1N25A 3TQNA 2OYIB 1URQC 2OJED 3E5UA 1BW6A 2P5LC 1JUNA 2NVXJ 1PL5A 1LE8B 2JPBA 1JY3O 1P84E 2FBKA 3L36A 4JYKA 1FOWA 2UUZA 1X0XA 3BTCA 1KD1Q 1PGOA 3A1YA 5GTHC 5APTA 1X58A 1DP3A 3AFHA 3MUDA 1NTME 3TF5A 3QPLA 2MC4A 1CF7B 1K9MQ 3PIPF 1ZLLA 3WE2A 4BEHB 4A3BJ 5KAIH 1R7JA 2ELJA 4G6QA 1LPQA 1XMAA 3VOPA 3DEWA 4A3JJ 4KFCA 4A3CJ 4R4MA 4ENNA 1OXZA 3HZJA 1NTKK 1MKMA 2AO9A 3EUHC 2IYPA 3KPHA 4O5VA 2JJLA 5J3LA 2O6GE 1DQUA 2PX9A 5M5XJ 2XKOA 3LNQA 1FSHA 1W1WE 2W1OA 5D4SA 1F17A 1Y8AA 2IT0A 3WUTA 2IBZI 2KIFA 3PDUA 2WPSA 3H1KJ 2MH2A 4B4CA 2WPVB 4KJMA 2OQGA 3FKJA 2R5ZA 2PFXA 3BT9A 3L72D 5GTIH 1MBGA 1YOVB 4UUSB 1FYKA 4LLHA 2HNHA 3G17A 1L0LG 3PJGA 1MSFC 4IFMA 3OR1C 4N0BA 3IWZA 3QYBA 1OKRA 2HEOA 1QO0D 2IW5A 1LVKA 3VMXA 5E1WA 1LEAA 2QKLB 2DTRA 3WG9A 1VQ4P 4KICA 4E7JA 3CX5H 3IH3A 2LBFB 3RJPA 5KJ7A 5FKNA 5GAHJ 1SVFA 4A3MJ 3S3MA 2K86A 1IUYA 2POHA 3EGOA 2F5DA 1NTZE 2N9BA 1BJAA 3IHUA 2QJYC 3A0BH 4I02A 2DPDA 1W5SA 1SFCC 2BY3A 2H89C 3LSGA 1PGPA 3BG3A 1JMMA 2CH0A 1KMIZ 1YE9A 4PSWA 1N7SB 1FTZA 3ASNH 2A07F 4LB5A 1WRJA 2LC2A 2W57A 2CFXA 2PMUA 2PQ8A 3MMYB 2JA7J 1JTHB 2D2CD 2QSIA 4HKZH 1VQOP 2WC2A 2JR8A 1HBWA 2X48A 1TWGJ 3ECHA 2LKPA 1ZQ3P 3M0DC 1ZRFA 4IOAF 1G1IA 1GK4A 1D0XA 2DA2A 1O7FA 1NVOA 3FXJA 3KLOA 1WH5A 3O6QA 2GWRA 3JAMK 5DM7F 5TJHA 2V6CA 3V7SA 3A0BE 1WPKA 3LFUA 4BJ6C 1U8RA 5H6RA 1GL2B 2VOPA 2Z99A 3II6A 3JSVC 3HJEA 2I5UA 4HW0A 4E7ZA 1R5LA 2VBWA 4BL0B 2QENA 3FBNB 2VQHA 3KEQA 4XLAA 1A5JA 1KB9H 4IOIH 3C2HA 1ZKGA 1IV8A 2BBYA 1BG6A 2WAQA 3DLAA 1MD0A 4E6KG 1OYYA 4OL9A 1L0LD 1HSJA 2HKXA 2Q2EB 3BTLA 4BS9A 1YS6A 1RRJA 2XKMA 5KAFC 3OSFA 4HNUA 4OIRF 5J6XA 3MCZA 3D5SC 4N3YB 4NUBA 3T97B 3H1HG 5TJJA 4I76A 1OJLA 3K4JA 3A2AA 4EMSA 2AEMA 3ZRGA 2R7RA 1SVLA 3F6VA 4H4KC 3H1LG 2G3AA 2RV8A 2HYGD 3HOVJ 3G1LA 4IL6H 1ON1A 1QZZA 3WODF 3OS0A 4XR6A 3M07A 5M3FJ 1O4XA 3IWFA 1O3QA 1X2MA 2CV0A 2FU4A 2OD5A 4W80A 3D0SA 1CW5A 3M9HA 2K9SA 3MZYA 4ZYAA 3GHYA 4M72A 2PLAA 1TU3F 3CUQC 2QJKB 2P0WA 2DMUA 2W4SA 2QUFA 4QIWN 2DK5A 2RGVA 3GX4X 1KYOD 4TV7A 5B5EC 5JR3A 3PLRA 5AVQB 4KMUX 5BVZA 1PGNA 3WU2H 1VQ6P 4DGWB 3L1PA 1S4XA 2BY1A 5APXA 1PP8F 1K78B 4RGRA 1QL2A 2YXRB 2GUSA 4L75A 4PJ0E 3Q2YA 1LFPA 1JTXA 1YW7A 2K40A 5ICFA 2MC3A 3TKYA 5K5OA 1HXDA 3F72A 1YJQA 3HUSB 5KAIE 2IS4A 1FZCA 1RY3A 1URQD 3E1IA 1R4NB 1L0OC 4B3JA 3E1RA 2WT7A 3C2BA 2STTA 5LHIA 2DT5A 2MFZA 3AE6C 2IS2A 2EFQA 3U1DA 1G3SA 4YFKF 2UWMA 1OYWA 2M2EA 3HTSB 3OOPA 3LSIA 1Q90D 1Z3XA 2NPSC 1VQPP 1IO4A 1Y8QB 2VQLA 1W36C 3WFJA 2XHKA 3L9FA 1S5LE 2R7ZJ 5FD5A 3WTYC 4HF1A 2W6BA 3E7KA 3FXKA 2YKQA 4OGQB 2X51A 1Q1HA 4BE2A 1BCCG 4M74A 1OVUA 2HQRA 1F14A 3FZVA 3H1HD 4LMYA 1MFTA 3Q3DA 2HZTA 5E8IA 2DFHA 4WF2A 2L54A 4WY4C 1HWTC 2KKOA 1NHAA 1IFJA 3H1LD 3FMSA 2BEQD 3CCSI 2P4QA 2KSEA 4HG2A 2KIKA 2VRSA 5AW7B 5FKKA 3M8FA 1LSOA 2K88A 4A69C 3RQSA 4UB6H 1WI3A 5HS8A 2YNYA 4PDKA 2CV1A 3K2AA 1CI6A 4Y4RA 4BXXJ 3BG9A 1S72P 2L5GB 2YU3A 1YYCA 2UYYA 3H1KE 4HOBA 5A9SA 3DXJF 4KISA 1MDMB 2QSGX 2B87B 3L74J 3HPGA 5HDNA 2FOWA 1SLQA 2O8XA 3HRUA 4XONA 2CUZA 2KZVA 4A3GJ 3VEPA 2I9PA 4FE4A 2O5RA 5GAGJ 4D3DA 2D3TA 1JE8A 1K61A 5EF6A 4FCYA 1Y9BA 4I7ZB 2V6EA 2NS0A 2VQGA 1KORA 4F7ZA 4BWNA 3H36A 3RPUD 1A04A 1JT6A 3FBIB 4G8XA 2ZMEC 4LITA 2XB5A 3WTUC 1ZK8A 1BBYA 4GBJA 5E79C 2KDOA 2M5AA 1ETWA 4P1WA 1FOSE 3GMAA 2BZTA 5BPIA 2BOLA 1FZFA 5GAEJ 1LTJB 2ZB9A 2UXNA 4LLGF 5EJCA 4QLCU 1RQVA 2EIJH 1QNTA 5L3CA 1DDNA 2ZT9C 3S9OA 2XC7A 2K7LA 1VQKP 1SFCD 3CF2A 3LA2A 1BCCD 1U5TC 2M3AA 1RKTA 5D6EA 2V1UA 1AVYA 1WJDA 4D5CA 4LG0B 1DUXC 1L0LK 1MMAA 1R49A 1H0MA 1N86A 3SSUA 1FLIA 1J7KA 2Q6QA 2GA2A 1GDTA 1BM9A 2F5EA 3P5JA 4CH7A 2QEXI 1NK3P 4OINF 3L6DA 4S3MA 2IBZG 3N7NA 3P7KA 3TGUG 3KLNA 4XLFA 2CYYA 2BE5F 2QCOA 3RKQA 3C8VA 2E42A 1P2FA 2LK2A 4ZJZA 3JRIA 1AU7A 3R60A 4AIDA 4Q47A 1HW1A 2M7AA 4CGZA 1XC5A 4UHTA 1MNDA 3CCUI 4DW6A 3H0DA 1J1EB 3ZMTA 2YIUB 4HZFA 4JYCA 4IL6E 3S3OA 2FRHA 3AE8C 3I59A 2LF7A 2JPCA 5FLXZ 3ABTA 2MD0A 4EV0A 4OMYA 2IYOA 3HKZN 3DLLF 2P7JA 2KQRA 3L75G 4M3LA 1FJPA 1WP4A 3FDYA 2ZO4A 1H88A 3O8GA 2DI3A 1U57A 4CDGA 3EPZA 4U0VA 3P9CA 1U78A 1JY2O 3MQ0A 2KP8A 1T6AA 1XMKA 3PSIA 2YX7A 5LRRA 3ZQQA 4LG3A 4XL9A 5L8RJ 1R9TJ 2A06E 1VI0A 3LSPA 2WAEA 1S6LA 2EA4A 1MW7A 4DZPA 5FROA 1SQVJ 3VSLA 3L35A 1YIJI 4C3JJ 1JHHA 3W3CA 3NMDA 1DIPA 3L4FA 1MJBA 3T1BA 1VQMI 3CCJI 5D5XB 2Q1KA 1EKEA 1YJ9P 1ZG5A 2YU9J 5DM6F 1YQ4C 4V2FA 3A2KA 2A68F 2W00A 3ZMDA 4ZYHA 5LHGA 4C2UA 1SQQG 5CCGC 5IP6A 4DT0A 1R5ID 3K4MA 1M76A 4ZKUA 3WTXC 2Y9YA 4H0LC 1R22A 1L2PA 2IBDA 2KPMA 5LGUA 2PLYA 4HX8A 1GVDA 3D5RC 4PZJA 1SFUA 1K6OA 1N73A 3CMYA 1QPMA 3TGUD 2WB1N 3NQOA 5H2FC 1X1DA 4OQYA 1HGZA 1G59A 3CX5I 2R7DA 3CO6C 2HOAA 3E5QA 2JA2A 4EJOA 4DBQA 2HYNA 3RPQA 3VYSB 4E7HA 3B02A 3A03A 1QEXA 2QBYA 4XLNF 3FXEA 4XLPF 1POGA 3IC7A 3L73G 2F5CA 4D6TJ 4OIQF 2YX4A 5GP9A 2L91A 3L72J 5BU8B 2E1MB 1OMIA 4UB6E 5FLMJ 2DW4A 2ZC2A 2K27A 1LWUC 1VQ7P 1MIJA 2OF7A 4CYDA 1H8AA 2FFDC 3I64A 4PUSA 4IFFA 3MTUE 3S8PA 2V9KA 1HA8A 1EC5A 3DF8A 3HB9A 1VF5C 1W36D 3F21A 3HHHA 2RAEA 4L9NA 3VP8A 3F0CA 1YW9A 2ME0A 5KCMA 1O3RA 2FYNB 3FXRA 2C9NY 4PZEA 3FM5A 4D7NA 1W5CC 2V1NA 3ULKA 2BEOA 1NAYA 4K3AA 4UB8C 5DJUB 1EF4A 3QWLA 2R92J 3DQVC 3ESWB 3M1CA 2KDZA 4WY4D 3K2ZA 3K4LA 1OCRH 1QGPA 3F23A 2K37A 3HE4A 4QWQA 3HOSA 3RTRA 2IZ0A 1WKMA 2CQKA 1KB9I 2KNCA 4B47A 1Y1WJ 3BDDA 1SQQD 2AEFA 3QWOC 4BRYA 2X1CA 4BQOA 2ZXXA 1BI3A 3KQGA 9ANTA 1BI0A 2WTBA 5DEQA 3OYGA 2F5VA 1VQ5I 5F0HA 1X2NA 2WZ7A 1HKTA 4XOTA 3SHFA 1P4WA 2IA2A 4OWFA 5LBQA 4IF4A 3JTGA 2M45A 3K69A 5F04A 3L74E 5M5WJ 5KLIC 2A61A 3HEFA 3W2VA 2FYUG 3OJAB 1ETKA 5L3EA 4RB2C 5FFZA 1JY3P 4OM8A 3M9BA 3K1NA 4AUXA 3QH9A 3KP6A 2JRTA 1IK9A 2YPRA 4NPFX 1SFXA 4R1NA 1URQB 1OZHA 3H32A 1TWFJ 4YTPC 1LNWA 2HVRA 3KP4A 3PFYA 3L73D 2CUJA 3K0LA 1E3HA 3SZTA 1DH3A 4L5IA 1AKHA 1L0LJ 4BBRJ 1QBJA 2XAFA 2DMPA 3BR6A 4BU2A 1FU1A 2N1TA 1W7PA 1V5EA 1M1JC 2X0LA 3RK2C 2XU6A 3G4SP 4XFJA 1WDLA 3JAMZ 1OISA 3Q3SA 4G12A 3KZZA 3WTSC 1LP1B 3SFDC 1Z6RA 3O8HA 4CYCB 4JOMA 1FYLA 1IZ1A 3CC2I 4CCMA 1FP1D 3F8NA 1R1TA 4OMZA 1QX8A 3CCRI 2Z9OA 3EQLF 1BC7C 2P6TA 5F0CA 1IZNB 1OVRA 4F55A 1VPDA 5FRMA 2V7QJ 1NK2P 3WG7H 3ASOH 3GLLA 2FXOA 2P67A 3CWBG 2JT1A 5AW3B 4ESJA 3QAHA 2GAUA 1IFPA 3AEFC 3Q5RA 1VQ5P 3A4CA 2VE8A 4WXDA 2ICWG 1XPXA 2KISA 1W2BO 2EFNA 3VSKA 3VYTB 4HQEA 1LSJA 1HDPA 3L7WA 1NU1K 1XTCC 2YXQB 1EXJA 3JCUC 1DGWY 4W7YA 3TL4X 3L09A 2JTVA 2XZRA 4X1EA 2V9PA 1TQPA 3BR0A 4GYIA 1M56D 2FYUD 2FOKA 2ZAEB 3CCLP 4D3FA 1FJKA 3CCMP 1HJBA 2FQ4A 5JLXA 2GOXB 3CJNA 2FY8A 1TLHB 4NC6A 4GFBA 1MZ9A 1G3WA 2EV6A 1S9HA 2F4OB 3P32A 3CMMA 2LG4A 4U3FJ 1S9KD 3VMZA 2CQQA 2E2JJ 1P7IA 5E1XA 4E7IA 2YO2A 3VN0A 3PFIA 5CPRB 3CJQB 1OW8A 1LVAA 2Z16A 1XSDA 2G0EA 3KP3A 1SAXA 1YRNB 1SQVE 2AXCA 3TEDA 4JP0A 2ZFWA 2IS6A 3KP2A 2MA3A 1M2WA 1AFOA 3DKYA 1SVMA 1J5YA 3WHBA 3ZW9A 2XF5A 1JJ8C 3RDIA 1KYOH 2W82A 2Z2SB 3EFGA 1FOKA 3ZQ7A 2QJYB 3WUVA 1ZLKA 4EOTA 4IOCF 2E5ZA 3TP0A 2EILH 1Y6IA 4B48A 1LT9C 1SFCB 2ZFCA 3H1HJ 3MUDC 5CCGD 3SDBA 1UB9A 1B1BA 1A6QA 3AG2H 3AE1C 4H0LD 2KUBA 4HEA2 4N4OB 4I99C 1AV1A 3NTNA 3PQKA 5CCHC 3CXHE 5HNFA 3CZ6A 1N7LA 3W6UA 3RGUA 2A05A 4CCJA 3V2NA 2Y0MA 2L9SA 2OYIA 2HZDA 2LR2A 3CWBD 4U7DA 4ON0A 2MW8A 4LFUA 2QZ8A 2NNYA 5GTHH 2LRDA 1EDLA 2V79A 2XV5A 3CDHA 2KYVA 2Z5IA 1R6RA 2O3JA 2GM4A 1WZ2A 4N9HA 2XUBA 1LNQA 1BE3G 2NRGA 3I55I 4D6TE 2KK7A 1DEEG 1SP4A 3K4CA 1EQ7A 2KS1B 5D8LB 4J19A 3L72E 2G7HA 2BHZA 2DXIA 1RE3A 5C3EJ 1SQQK 5B66C 2R7UA 3Q3CA 1Y39A 1M57D 2KXPB 4I6MC 2LF8A 5A9RA 5TGTA 1MNMC 4NC7A 2GF2A 1H0TB 1T56A 3T0YA 1RZ4A 4P5OA 2NVUB 5JE8A 2NVYJ 2JWAA 2X85A 3SEQA 1QU3A 2NVTJ 4RJTA 3SFIA 4AYBN 3ZR8X 1OPCA 3PJRA 1WFXA 2KMUA 3ZPLA 3MHVA 2XPWA 3TO9A 3HSRA 1K79A 3GTKJ 2SPZA 3BASA 3ZWAA 1KV4A 1JCCA 3RL0g 1UFMA 2JJ7A 2HPMA 5KJ7C 1WVRA 4OU0A 2P1JA 3FXMA 4C7NA 1MUUA 4BXLA 3F3XA 3M8JA 3K96A 5K1YA 1F1ZA 1OWAA 5FGMA 4EVIA 4UV8A 3AL0C 1KILD 2CVZA 1BR1A 4UVCA 2OUMA 3SWYA 2L02A 3GFLA 2O9LA 3BZKA 2PG4A 2Q8KA 4KUEA 2EBIA 2KRCA 2WA0A 2G7UA 2K9NA 1S5LX 3BR3A 2BCCG 3CUQB 2VL8A 1P6RA 4WXHA 2AS5F 2XRNA 4F93B 3ZW8A 3CCVP 4E21A 3SQNA 4UNOA 1IL0A 3TYYA 4AUWA 3DKWA 3VFZA 5HLTA 4D7MA 1G2CA 1SD4A 3MD2A 1P4AA 1YG2A 4RAFA 3BPXA 5JHFA 3MAJA 1N2DC 3CTAA 5IT9K 1AA0A 2ACJA 3HUGA 1TNSA 1I27A 1XGSA 3Q5FA 3B8EB 3V8LA 4H44D 2Q7CA 3QPSA 2LBFA 5K5GB 4AYCA 4U88A 3TDUC 3FXLA 4KITB 4IO9F 5CMZA 2NAZA 1BE3D 2HPCB 3OYCA 5TRDA 3UIAA 4XRSG 2GLOA 1TZLA 1L0LE 3CLQA 5ED4A 4IHSA 2EH3A 1YS7A 2V4JC 2V1XA 2OA4A 5DD8A 2JUGA 4B3XA 2NPSB 2COBA 3RZOJ 3M9QA 3E0JB 3CCYA 2ID6A 3FXQA 3I4PA 3LQQA 2DMQA 2FKWB 5AVRB 3RK2D 4ZYGA 1JB0J 1JO5A 2DFFA 4D3SA 3BCCJ 4JYBA 1ETXA 2FYUK 3SFZA 3IKTA 1SQPJ 2D2CC 3GVAA 1JTHA 4KT6A 5LLQA 5B1AH 2JDIH 2KRFA 2D45A 3A0HC 1ZRDA 3ECOA 4PD4I 4WY4B 1VQ4I 1QA6A 4DZOA 2ZSHB 3DPTA 3F8FA 2HTJA 1R1VA 2E2HJ 1JCDA 3FIWA 5BOXA 1NG7A 3PNYA 2B63J 5AONA 1STZA 3BG7A 3C7AA 1GL2A 1PPJE 4CUGA 3VODA 3S1MJ 3I5CA 1KU9A 2HVQA 5H6QA 2E1MC 4I1LA 1R5SA 1SQBG 3GLMA 5KAFH 2BCCD 2XROA 1A02J 1Z7LA 2DQRA 2WSCJ 2QA4P 3CD6P 2H7HA 1R58A 2Q2EA 1ETYA 1X3UA 1X1AA 5IOZA 3RK3C 2JK3A 3EETA 2IGMA 4GCVA 5KHDA 3V8KA 4A3KJ 4G6DA 1VQOI 3CL3D 3OYDA 3S4RA 3D6ZA 1LB2A 3T97A 5FRNA 4A0YA 3ZWCA 3E1SA 2NOGA 4U3FE 1I5ZA 3K4BA 1FZCC 4CSWA 2FSWA 4WX9A 2R5YB 4UUTA 2P5KA 4RAZA 5L3BA 1PJRA 2EZKA 3L75J 4KMFA 3GW2A 2ZMEB 5GTHE 1HQCA 4QPQA 4U0YA 3OYFA 3E6DA 1AWCA 3IAOA 2I1JA 2HOEA 1YO5C 1MMSA 1KQ0A 5B5EH 2EA2A 2WSCH 3G1OA 4AIJA 2QWWA 2ZT9B 1BGYG 2HFED 2K5CA 4H0EA 2H8RA 3H1HE 5AW0B 4XQFA 1HTLC 2IPQX 4MQVA 1IN7A 4MTEA 1U5TB 4N6JA 5AVSB 2ELKA 4ZKPA 2L5QA 2L9NA 1I6HJ 1KQGB 1IUFA 3R0JA 2M9HA 3KEOA 1GD2E 1SAUA 5F64A 4KA4A 5CCHD 4GOEA 4EM0B 5E8GA 1QHHD 2Y31A 3Q9VA 1SQQJ 2XRLA 3P8MC 1JOCA 1NJIQ 1OR7C 2OV7A 2ZSIB 2CK3H 4LK1F 2A45G 1GXPA 3GTGJ 3HHGA 1Y56A 3G1MA 2GXBA 2GZWA 1SQBD 1JY2P 5F6FA 2M4GA
chains in the Genus database with same CATH topology
4A3EJ 3SJMA 3ZGYA 4B3JA 3C2BA 1IC8A 1LFBA 1ZTRA 2DA3A 4E13A 2M2EA 5F1JA 1KS9A 3CDLA 5F27A 4XRMA 4PZCA 2FJ1A 2ZYAA 3I83A 3WFJA 4X6AJ 1JGGA 2R7ZJ 5K7ZA 3OIOA 1F14A 2K9QA 2O7OA 3S1QJ 2HXOA 5EEAA 1A6IA 3C7CB 3ZQFA 2P4QA 3ADOA 5FKKA 1LSOA 3BR5A 4MFEA 4A69C 4XIDA 1Q1VA 3VPRA 4UUSA 1WI3A 1APLC 5DS9A 5FKLA 4A3LJ 3IQDB 3QQAA 3WS7A 2E19A 3FK6A 3K2AA 4BXXJ 3BG9A 4B3AA 1YRLA 3PO3J 3JRBA 2R0QC 2PMZN 2UYYA 5A9SA 2IEKA 1ITYA 1MBKA 2M34A 5C44J 3HDHA 1JKPC 1WDKA 2Y0SN 2W8ZA 2HQ5A 5C4XJ 1P7JA 5EZGA 3BG5A 4DZJA 3HOZJ 2I9PA 4A3GJ 3Q0UA 1TWCJ 3FISA 1Y1VJ 2QF7A 4FE4A 1MBEA 4D3DA 3D1NI 2D3TA 1F36A 3TW6A 2Y9ZA 5EF6A 4FCYA 1K61A 1MBHA 4FISA 4IHYA 3HADA 3G0OA 1JT6A 2XB5A 1ZK8A 4GBJA 2D5VA 2EQRA 1H88C 1ETWA 1ZGWA 2JA6J 2MG4A 1PGQA 2ZB9A 3IH4A 2HOTA 3M4OJ 2L9RA 1HCRA 2KT0A 3MN2A 1WGXA 1RPWA 3HM5A 4MLOA 1JUPA 1QMGA 2DA5A 3ZQLA 5FLVA 1M66A 1RKTA 1ZR2A 3DOJA 2HYJA 4W97A 3RQIA 4D5CA 5HWSA 5IYBJ 3JREA 4RDUA 5EG0B 1GDTA 1NK3P 3S16J 3L6DA 4S3MA 3S17J 1Z77A 3JR9A 1S7EA 2XSDC 1XS9A 4M3GA 2DTZA 1AHDP 2QCOA 3RKQA 1AU7A 2LK2A 1U9NA 3JRIA 1DLIA 1XC5A 1IDYA 4GWGA 4DW6A 1H89C 1DLJA 3HOUJ 1E3OC 3ZQGA 2IYOA 3HKZN 1YVEI 2ECCA 1WP4A 1K83J 3O8GA 1BL0A 1ENHA 1ETVA 1I3QJ 3MVPA 1U78A 2XGEA 2JN6A 2XGDA 2ME6A 3K6JA 1MSEC 2LKXA 3GTMJ 1BJZA 2FD5A 1R9TJ 2LVSA 1VI0A 3MKLA 1BW5A 3LSPA 2WV1A 3JRGA 4DZPA 3HOYJ 3H2ZA 5E3NA 1PGJA 4C3JJ 1H8AC 5FJ8J 1M67A 2JA8J 5K7HA 2MSYA 3CKYA 2DMTA 2VKEA 2YU9J 5EGOA 2I10A 4V2FA 3H0GJ 2R93J 2HXIA 2W48A 3FK7A 5IP6A 1I36A 1M76A 3FWNA 1N1GA 2Y9YA 4M3BA 2XGCA 2CRGA 3A01A 3GTPJ 2X9DA 2IBDA 4A3IJ 2O8KA 1GVDA 1FTTA 1MBJA 1VF9A 2E1OA 2HI3A 2VI6A 2N8GA 3CMYA 3GTQJ 2WB1N 5J1YA 1HDDC 4OQYA 1G2HA 4PZDA 3RQSA 2YUSA 1MBFA 2HOAA 3S2DJ 1JUMA 1WPQA 1BA5A 2EZIA 3GTOJ 3A03A 4W1UA 2VPRA 3ZQCA 1POGA 4XICA 4V2GA 5M3MJ 1TC3C 1UMQA 5GP9A 3HBLA 1JKOC 5FLMJ 2ZYDA 4J0FA 3BTJA 3UKGA 2OF7A 1DU0A 5F08A 2LTPA 5EZHA 1ORKA 5E3LA 3GBGA 4XRSA 3S15J 4KUHA 3HB9A 1IG7A 1IRZA 4GWKA 3PIDA 1NTCA 1MH3A 2RAEA 2DA4A 3F0CA 2ME0A 4FTHA 1F43A 3OOUA 4DLLA 4PZEA 4DYQA 4D7NA 2X6OA 3ULKA 4BKXA 1MH4A 1EF4A 4HNVA 3CTVA 1FIAA 2R92J 2KDZA 3JRDA 2LLKA 1N1EA 1RKWA 1I50J 1W0UA 1DU6A 2IZ0A 1UG2A 1Y1WJ 3LSRA 2M0CA 3B6CA 9ANTA 2WTBA 4C2MJ 4BY7J 5F0HA 1X2NA 2XB0X 1QVUA 2Y2ZA 3BQYA 1F0YA 2LR8A 3BQZA 5F04A 5M5WJ 1EVYA 1JKRC 3HEFA 5E3MA 1ETKA 2CU7A 4J0EA 2LP0A 3ZHBA 5IP9J 4IHVA 3S14J 2DMNA 4OM8A 4EEFG 4AUXA 1ETOA 1GV2A 5FKOA 3B6AA 1HLVA 4R1NA 1OCPA 3HWRA 4B3HA 1TWFJ 2ZYGA 4IEJA 4D5FA 1HF0A 3ZQHA 5GPCA 2TCTA 2R5ZB 1YJ8A 1AKHA 2WAQN 4BBRJ 2FX0A 3I4MJ 1W0TA 3BR6A 2DMPA 3OSGA 5EG0A 2L7MP 1HOMA 4NDLA 2CQXA 3LOCA 2EZHA 3BR1A 2DJNA 1WDLA 3MOGA 3Q3SA 4G12A 3JRCA 2EW2A 1AKHB 4IHWA 4ABZA 2DA7A 3O8HA 4CYCB 1IV6A 4YCAA 3DCFA 2LY9A 4JX6A 4L5EA 1ZR4A 5JLWA 2MGQA 5F0CA 2HDDA 2HOSA 5HODA 1VPDA 3IV5A 1NK2P 2AHQA 4RBOA 5EDNA 1JDJA 2CUFA 5FWNA 2JKVA 3DFUA 1U8BA 5F0FA 3S1NJ 3WFIA 1LSJA 1HDPA 4KUGA 4MO7A 4A3DJ 3ZOBA 4B1RA 5IP7J 3HOXJ 4X1EA 3BR0A 1FJLA 4IHXA 4Y7NJ 1JKQC 1VFCA 4D3FA 2W90A 2L0KA 2JWTA 2FQ4A 5JLXA 4QTRA 5A9TA 2IZ1A 4GFBA 1M75A 1YRNA 1TWAJ 2DA1A 5GPAA 5J1RA 5J1UA 2CQQA 3K7AJ 1P7IA 3CQZJ 2E2JJ 3M3YJ 4Y52J 3PEFA 1QPIA 3Q0WA 2CUEA 3Q0VA 1B8IB 1QRYA 2G0EA 4LOCA 1YRNB 3TEDA 4JP0A 1SFOJ 3ZWBA 1M2WA 3WHBA 3ZW9A 1Z0XA 1JJ8C 4OQZA 1RR7A 1OFCX 3E7LA 4B3IA 4IM7A 1TWHJ 3W6VA 3TP0A 1GT0C 3JRFA 3S2HJ 4M6VA 2LFBA 5DTDA 1D5YA 5BNGA 1YB4A 2ID3A 1YONA 3IH2A 4JX4A 1LJ8A 2X58A 3W6UA 1FEXA 1TXGA 3NAUA 1U9OA 2MW8A 3BR2A 4M3EA 1ETQA 5C4JJ 2XPUA 1IGNA 3QSGA 3HGYA 2JMWA 2GM4A 3FR7A 1BW6A 3F3SA 3TW7A 4J19A 1LE8B 2NVXJ 1RESA 4JYKA 5C3EJ 4E12A 1WCMJ 4QSHA 4BY1J 1X0XA 3BTCA 3HGGA 2P81A 2PGDA 3Q3CA 5A9RA 1PGOA 1MNMC 2GF2A 1T56A 4AC0A 2NS8A 5JE8A 2NVYJ 2JA5J 1X58A 2OPTA 4C3IJ 2NVTJ 1B72A 3SFIA 4AYBN 2XPWA 3GTKJ 3QPLA 3ZWAA 2JJ7A 4DYCA 4A3BJ 4XK4A 1B72B 5EYRA 5M5YJ 1X0VA 3K96A 3DEWA 4A3JJ 4A3CJ 1FIPA 2CVZA 2AO9A 2IYPA 2O9LA 5J3LA 3HOWJ 4KUEA 2EBIA 1CQTA 2K9NA 3WHCA 5M5XJ 3BR3A 2NVQJ 3LNQA 3FR8A 3FKIJ 1F17A 4DCKA 2M8GX 3ZW8A 3PDUA 4E21A 1IL0A 2TRTA 3LSJA 4B4CA 4D7MA 2R5ZA 3BT9A 1MBGA 3HN2A 1RETA 2DN0A 4MIMA 4UUSB 4JQ0D 3G17A 3PJGA 1MSFC 1GUUA 3C7DB 1GV5A 3QPSA 4A93J 3JRHA 5A9SB 4CYCA 4XRSG 2GLOA 3IH3A 1OCTC 2EH3A 5FKNA 3HDDA 4A3MJ 2HDHA 2COBA 3RZOJ 5AYVA 3CCYA 2ID6A 3EGOA 1WDMA 2DMQA 4DYDA 1QVTA 4D3SA 2Y30A 1ETXA 4FE7A 3LSGA 1PGPA 3BG3A 5IOYA 2L7ZA 1FTZA 4DYRA 4M3DA 1XG1A 2CJJA 1JTYA 5IYCJ 4OVNF 2NS7A 5IYDJ 2JA7J 2E2HJ 5MGBA 2X48A 1TWGJ 1PUFA 3FIWA 2VUMJ 1ZQ3P 5IPAA 3GTLJ 2H1KA 4MFDA 3PO2J 2EZLA 2B63J 3C7AA 2DA2A 1JJ6C 2L7FP 1IJWC 1WH5A 2YS9A 3S1MJ 1SANA 1WPKA 1PUFB 3PM1A 3I4NJ 1WH7A 4BBSJ 1B8IA 1ETYA 5IOZA 4A3FJ 3ADPA 2JK3A 1A5JA 1Z82A 2R5YA 1BG6A 1ZKGA 4A3KJ 3GTJJ 1UHSA 4OL9A 3BTLA 3ZWCA 2NOGA 3OSFA 4JX5A 2R5YB 4UUTA 2EZKA 2ECBA 5E3OA 4I76A 1ZCJA 1OJLA 5K7FA 3A02A 3ZQIA 2VKVA 2E2IJ 1LFUP 3QHAA 2GBYA 1JT0A 4I6ZA 3HOVJ 3G1LA 3G1OA 2QYTA 1O4XA 3TP3A 3H3VK 5M3FJ 2H8RA 1IDZA 1X2MA 1VNDA 1EVZA 3BTIA 5FKMA 2ELKA 2K9SA 3GHYA 1I6HJ 2PLAA 1IUFA 2M9HA 4M3FA 1T33A 2DMUA 4EZBA 4QIWN 1JUSA 3RZDJ 1F12A 1LE8A 3PLRA 4S0HB 2DA6A 2Y31A 1PGNA 2XRLA 3S1RJ 3L1PA 5EGOB 3W6ZA 3NARA 2XPVA 2K40A 1JTXA 2OFPA 3OBBA 4FGWA 3GTGJ 2IAIA 4JPZB 1YJQA 3G1MA 3SDGA 3A01B 4C3HJ 3JRAA 2LD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E J;  3SJM A;  3C2B A;  1IC8 A;  1LFB A;  1ZTR A;  2DA3 A;  2M2E A;  5F1J A;  3CDL A;  5F27 A;  4XRM A;  2FJ1 A;  4X6A J;  1JGG A;  2R7Z J;  5K7Z A;  3OIO A;  2K9Q A;  2O7O A;  3S1Q J;  2HXO A;  5EEA A;  1A6I A;  3ZQF A;  5FKK A;  3BR5 A;  4MFE A;  4A69 C;  4XID A;  1Q1V A;  3VPR A;  4UUS A;  1WI3 A;  1APL C;  5DS9 A;  5FKL A;  4A3L J;  3QQA A;  2E19 A;  3FK6 A;  3K2A A;  4BXX J;  3BG9 A;  4B3A A;  3PO3 J;  3JRB A;  2R0Q C;  2PMZ N;  2IEK A;  1ITY A;  1MBK A;  2M34 A;  5C44 J;  1JKP C;  2Y0S N;  2HQ5 A;  5C4X J;  1P7J A;  5EZG A;  3BG5 A;  4DZJ A;  3HOZ J;  4A3G J;  3Q0U A;  1TWC J;  3FIS A;  1Y1V J;  2QF7 A;  4FE4 A;  1MBE A;  3D1N I;  1F36 A;  3TW6 A;  2Y9Z A;  5EF6 A;  4FCY A;  1K61 A;  1MBH A;  4FIS A;  4IHY A;  1JT6 A;  2XB5 A;  1ZK8 A;  2D5V A;  2EQR A;  1H88 C;  1ETW A;  1ZGW A;  2JA6 J;  2MG4 A;  2ZB9 A;  3IH4 A;  2HOT A;  3M4O J;  2L9R A;  1HCR A;  2KT0 A;  3MN2 A;  1WGX A;  1RPW A;  3HM5 A;  4MLO A;  1JUP A;  2DA5 A;  3ZQL A;  5FLV A;  1RKT A;  1ZR2 A;  2HYJ A;  4W97 A;  3RQI A;  4D5C A;  5IYB J;  3JRE A;  4RDU A;  5EG0 B;  1GDT A;  1NK3 P;  3S16 J;  3S17 J;  1Z77 A;  3JR9 A;  1S7E A;  2XSD C;  1XS9 A;  4M3G A;  2DTZ A;  1AHD P;  2QCO A;  3RKQ A;  1AU7 A;  2LK2 A;  1U9N A;  3JRI A;  1XC5 A;  1IDY A;  4DW6 A;  1H89 C;  3HOU J;  1E3O C;  3ZQG A;  3HKZ N;  2ECC A;  1K83 J;  3O8G A;  1BL0 A;  1ENH A;  1ETV A;  1I3Q J;  3MVP A;  1U78 A;  2XGE A;  2JN6 A;  2XGD A;  2ME6 A;  1MSE C;  2LKX A;  3GTM J;  1BJZ A;  2FD5 A;  1R9T J;  2LVS A;  1VI0 A;  3MKL A;  1BW5 A;  3LSP A;  2WV1 A;  3JRG A;  4DZP A;  3HOY J;  5E3N A;  4C3J J;  1H8A C;  5FJ8 J;  2JA8 J;  5K7H A;  2MSY A;  2DMT A;  2VKE A;  2YU9 J;  5EGO A;  2I10 A;  4V2F A;  3H0G J;  2R93 J;  2HXI A;  2W48 A;  3FK7 A;  5IP6 A;  2Y9Y A;  4M3B A;  2XGC A;  2CRG A;  3A01 A;  3GTP J;  2X9D A;  2IBD A;  4A3I J;  2O8K A;  1GVD A;  1FTT A;  1MBJ A;  1VF9 A;  2E1O A;  2HI3 A;  2VI6 A;  2N8G A;  3CMY A;  3GTQ J;  2WB1 N;  5J1Y A;  1HDD C;  1G2H A;  2YUS A;  1MBF A;  2HOA A;  3S2D J;  1JUM A;  1BA5 A;  2EZI A;  3GTO J;  3A03 A;  4W1U A;  2VPR A;  3ZQC A;  1POG A;  4XIC A;  4V2G A;  5M3M J;  1TC3 C;  1UMQ A;  5GP9 A;  3HBL A;  1JKO C;  5FLM J;  3BTJ A;  3UKG A;  2OF7 A;  1DU0 A;  5F08 A;  2LTP A;  5EZH A;  1ORK A;  5E3L A;  3GBG A;  4XRS A;  3S15 J;  3HB9 A;  1IG7 A;  1IRZ A;  1NTC A;  1MH3 A;  2RAE A;  2DA4 A;  3F0C A;  2ME0 A;  4FTH A;  1F43 A;  3OOU A;  4DYQ A;  4D7N A;  2X6O A;  4BKX A;  1MH4 A;  1EF4 A;  4HNV A;  1FIA A;  2R92 J;  2KDZ A;  3JRD A;  2LLK A;  1RKW A;  1I50 J;  1W0U A;  1DU6 A;  1UG2 A;  1Y1W J;  3LSR A;  2M0C A;  3B6C A;  9ANT A;  4C2M J;  4BY7 J;  5F0H A;  1X2N A;  2XB0 X;  1QVU A;  2Y2Z A;  3BQY A;  2LR8 A;  3BQZ A;  5F04 A;  5M5W J;  1JKR C;  3HEF A;  5E3M A;  1ETK A;  2CU7 A;  2LP0 A;  5IP9 J;  4IHV A;  3S14 J;  2DMN A;  4EEF G;  4AUX A;  1ETO A;  1GV2 A;  5FKO A;  3B6A A;  1HLV A;  1OCP A;  1TWF J;  4IEJ A;  4D5F A;  1HF0 A;  3ZQH A;  5GPC A;  2TCT A;  2R5Z B;  1AKH A;  2WAQ N;  4BBR J;  2FX0 A;  3I4M J;  1W0T A;  3BR6 A;  2DMP A;  3OSG A;  5EG0 A;  2L7M P;  1HOM A;  4NDL A;  2CQX A;  3LOC A;  2EZH A;  3BR1 A;  2DJN A;  3Q3S A;  4G12 A;  3JRC A;  1AKH B;  4IHW A;  4ABZ A;  2DA7 A;  3O8H A;  4CYC B;  1IV6 A;  3DCF A;  2LY9 A;  4JX6 A;  4L5E A;  1ZR4 A;  5JLW A;  2MGQ A;  5F0C A;  2HDD A;  2HOS A;  5HOD A;  3IV5 A;  1NK2 P;  2AHQ A;  4RBO A;  5EDN A;  2CUF A;  1U8B A;  5F0F A;  3S1N J;  1HDP A;  4MO7 A;  4A3D J;  3ZOB A;  4B1R A;  5IP7 J;  3HOX J;  4X1E A;  3BR0 A;  1FJL A;  4IHX A;  4Y7N J;  1JKQ C;  1VFC A;  2L0K A;  2JWT A;  2FQ4 A;  5JLX A;  4QTR A;  4GFB A;  1YRN A;  1TWA J;  2DA1 A;  5GPA A;  5J1R A;  5J1U A;  2CQQ A;  3K7A J;  1P7I A;  3CQZ J;  2E2J J;  3M3Y J;  4Y52 J;  1QPI A;  3Q0W A;  2CUE A;  3Q0V A;  1B8I B;  1QRY A;  2G0E A;  4LOC A;  1YRN B;  3TED A;  4JP0 A;  1SFO J;  3WHB A;  1Z0X A;  1JJ8 C;  1RR7 A;  1OFC X;  3E7L A;  1TWH J;  3W6V A;  3TP0 A;  1GT0 C;  3JRF A;  3S2H J;  4M6V A;  2LFB A;  5DTD A;  1D5Y A;  5BNG A;  2ID3 A;  3IH2 A;  4JX4 A;  1FEX A;  3NAU A;  1U9O A;  2MW8 A;  3BR2 A;  4M3E A;  1ETQ A;  5C4J J;  2XPU A;  1IGN A;  3HGY A;  2JMW A;  2GM4 A;  1BW6 A;  3TW7 A;  4J19 A;  1LE8 B;  2NVX J;  1RES A;  4JYK A;  5C3E J;  1WCM J;  4QSH A;  4BY1 J;  3BTC A;  3HGG A;  2P81 A;  1MNM C;  1T56 A;  4AC0 A;  2NS8 A;  2NVY J;  2JA5 J;  1X58 A;  2OPT A;  4C3I J;  2NVT J;  1B72 A;  3SFI A;  4AYB N;  2XPW A;  3GTK J;  3QPL A;  2JJ7 A;  4DYC A;  4A3B J;  4XK4 A;  1B72 B;  5EYR A;  5M5Y J;  3DEW A;  4A3J J;  4A3C J;  1FIP A;  2AO9 A;  2O9L A;  5J3L A;  3HOW J;  2EBI A;  1CQT A;  2K9N A;  3WHC A;  5M5X J;  3BR3 A;  2NVQ J;  3LNQ A;  3FKI J;  4DCK A;  2M8G X;  2TRT A;  3LSJ A;  4B4C A;  4D7M A;  2R5Z A;  3BT9 A;  1MBG A;  1RET A;  2DN0 A;  4MIM A;  4UUS B;  4JQ0 D;  1MSF C;  1GUU A;  1GV5 A;  3QPS A;  4A93 J;  3JRH A;  4CYC A;  4XRS G;  2GLO A;  3IH3 A;  1OCT C;  2EH3 A;  5FKN A;  3HDD A;  4A3M J;  2COB A;  3RZO J;  3CCY A;  2ID6 A;  2DMQ A;  1QVT A;  2Y30 A;  1ETX A;  4FE7 A;  3LSG A;  3BG3 A;  5IOY A;  2L7Z A;  1FTZ A;  4DYR A;  4M3D A;  1XG1 A;  2CJJ A;  1JTY A;  5IYC J;  4OVN F;  2NS7 A;  5IYD J;  2JA7 J;  2E2H J;  2X48 A;  1TWG J;  1PUF A;  3FIW A;  2VUM J;  1ZQ3 P;  5IPA A;  3GTL J;  2H1K A;  4MFD A;  3PO2 J;  2EZL A;  2B63 J;  2DA2 A;  1JJ6 C;  2L7F P;  1IJW C;  1WH5 A;  2YS9 A;  3S1M J;  1SAN A;  1WPK A;  1PUF B;  3PM1 A;  3I4N J;  1WH7 A;  4BBS J;  1B8I A;  1ETY A;  5IOZ A;  4A3F J;  2JK3 A;  1A5J A;  2R5Y A;  1ZKG A;  4A3K J;  3GTJ J;  1UHS A;  3BTL A;  2NOG A;  3OSF A;  4JX5 A;  2R5Y B;  4UUT A;  2EZK A;  2ECB A;  5E3O A;  4I76 A;  1OJL A;  5K7F A;  3A02 A;  3ZQI A;  2VKV A;  2E2I J;  1LFU P;  2GBY A;  1JT0 A;  4I6Z A;  3HOV J;  3G1L A;  3G1O A;  1O4X A;  3TP3 A;  3H3V K;  5M3F J;  2H8R A;  1IDZ A;  1X2M A;  1VND A;  3BTI A;  5FKM A;  2ELK A;  2K9S A;  1I6H J;  1IUF A;  2M9H A;  4M3F A;  1T33 A;  2DMU A;  4QIW N;  1JUS A;  3RZD J;  1LE8 A;  4S0H B;  2DA6 A;  2Y31 A;  2XRL A;  3S1R J;  3L1P A;  5EGO B;  3NAR A;  2XPV A;  2K40 A;  1JTX A;  4JPZ B;  3GTG J;  2IAI A;  3G1M A;  3SDG A;  3A01 B;  4C3H J;  3JRA A;  2LD5 A; 
#chains in the Genus database with same CATH topology
 1QGK B;  4P9F A;  2R3C A;  3SJM A;  4JK1 X;  3WU1 B;  3CC4 P;  4LIU A;  1RC9 A;  2DA3 A;  3E6M A;  4E13 A;  1S7O A;  4PD4 D;  4ASN A;  2UXX A;  4HAM A;  5BPD A;  4M6X A;  4NB5 A;  1XMX A;  1F5T A;  1KS9 A;  3BG6 A;  5F27 A;  2NZ2 A;  4XRM A;  1FOS F;  3LST A;  2X6Y A;  1VQ6 I;  4RB0 A;  4PZC A;  4XKB A;  2E75 C;  3PRJ A;  2ISZ A;  3CC7 P;  4X6A J;  2P7C B;  4BXU A;  5K7Z A;  2HLO A;  3SZG A;  2OZ6 A;  3OIQ A;  3DEU A;  2Z33 A;  3LMM A;  1GU5 A;  1LGH B;  1FMW A;  2K9L A;  2Z3Y A;  1D5V A;  1K05 A;  4WXC A;  3OIP A;  2Z1D A;  4CZC A;  3S1Q J;  5KJ7 D;  2K9J A;  4MGR A;  3C7C B;  1ZH5 A;  1FZB A;  3OS2 A;  4HV6 A;  1W4M A;  1YI2 I;  3BP8 A;  1BGY D;  1Q1V A;  3VPR A;  2WTY A;  1VQ8 P;  1VQP I;  1MDM A;  1DPU A;  4PJM A;  1ZG3 A;  4L5J A;  2B87 A;  3GHG C;  4H0L B;  1T2K A;  3LQR A;  3P9I A;  2R32 A;  1YRL A;  4BH9 A;  3PO3 J;  3JRB A;  1IFI A;  2R0Q C;  3GF3 A;  2IEK A;  4HQM A;  4XSX F;  3E5X A;  1AQT A;  2Y69 H;  2QM3 A;  1GW3 A;  3MD0 A;  5AVZ B;  2V1D A;  3DU6 A;  2W8Z A;  5E79 H;  5EZG A;  1NKZ B;  4RKU J;  1TNT A;  2MD5 A;  4YFX F;  1KYO I;  2QF7 A;  4D9J A;  2C0W A;  5APU A;  2DOA A;  4I0A A;  2EK5 A;  1MV8 A;  3E6B A;  3RQ4 A;  1BR4 A;  3D5L A;  3HAD A;  2FYU J;  1RUO A;  4ASV A;  4EYY Q;  2DLL A;  4Q48 A;  1S72 I;  3USS A;  4YRV A;  3D6Y A;  1LWU B;  2FFD B;  2EQR A;  1H88 C;  2JA6 J;  1KQ9 A;  1V5F A;  2MG4 A;  3DTE A;  2BW3 B;  2I8D A;  1PGQ A;  5ICE A;  1VF5 B;  3IH4 A;  3H1C A;  4PJL A;  2HOT A;  1ULY A;  4LG0 A;  2L9R A;  2R7Q A;  4ZDP A;  1RR8 C;  3MZH A;  3BCC E;  5CVJ A;  3WTT C;  5LFA A;  1IN6 A;  5HS9 A;  4BNC A;  1LTB C;  1RPW A;  1WJF A;  3AG4 H;  3HM5 A;  4MLO A;  1EH8 A;  1RF0 C;  1QMG A;  3ZQL A;  1M90 Q;  1LJ2 A;  1SQX J;  1D1A A;  5TIS C;  4W97 A;  4PGH A;  3KET A;  1SQP E;  2KIU A;  3DFG A;  3J81 K;  3JW4 A;  2OTK E;  2BVM A;  5H20 A;  4L73 A;  1IRX A;  1MJA A;  5FO5 A;  3HYI A;  1QZY A;  4M3G A;  1AHD P;  2PFB A;  3FXD A;  1DLI A;  3HXL A;  3HD7 C;  3KPE A;  2ZJQ F;  2M0B A;  2L01 A;  4GWG A;  1EZV I;  2IBZ E;  1XDS A;  1VQK I;  1Z3Y A;  4UXN A;  1E3O C;  5BQT A;  5KLI B;  3ZQG A;  3UNG C;  3CWB J;  4Y99 C;  1WJB A;  3RK3 D;  1I1G A;  1NOH A;  1EDJ A;  1K83 J;  1BL0 A;  3OYM A;  1ENH A;  3SWK A;  3MVP A;  2CW0 F;  4NC8 A;  4NQW A;  3HRM A;  2ME6 A;  1HBX G;  2C0X A;  5CBN A;  3K6J A;  1MSE C;  3GTM J;  3J7A O;  4OAY A;  4R4L A;  1Z6T A;  3BPV A;  3GG2 A;  2VXD A;  2FMY A;  3F22 A;  3S3N A;  1T0F A;  2E7W A;  2MBF A;  1J1D C;  1L0N G;  3L75 E;  3HOY J;  5LEJ A;  4MN4 C;  3V2R A;  3QPT A;  1ODD A;  3ZN0 A;  3V7C A;  2XF6 A;  3DEE A;  1EZV G;  4Q4Z F;  1IW7 F;  4XBF A;  5E3N A;  3OYN A;  4DIQ A;  1H8A C;  1M67 A;  1U7M A;  1M1J B;  3RBZ A;  1SQB K;  3RK2 B;  3L00 A;  3AAF A;  2JA8 J;  3V4G A;  4EQQ A;  5H2F H;  3IR9 A;  1H9T A;  1G8X A;  5DYM A;  3IUO A;  5EGO A;  3BLY A;  3I3L A;  4BDZ A;  1XN7 A;  5JVT A;  2CV2 A;  1I36 A;  3FWN A;  4F92 B;  3GF2 A;  4CCK A;  3IRR A;  2KIQ A;  3BJA A;  4ZZD A;  3A01 A;  4BE0 A;  3GTP J;  3L71 G;  1H89 A;  2VAS A;  5F1R A;  5HDG A;  1FTT A;  2HI3 A;  3KE2 A;  1RHZ B;  5C39 A;  3GTQ J;  1VQN P;  4R1H A;  5J1Y A;  3GWZ A;  1SQQ E;  5AW9 B;  3B4S A;  2WAF A;  3H3Z A;  4N9I A;  3A0B C;  3MKW B;  4UUV A;  1E79 H;  4LLL A;  2WY7 Q;  1JUM A;  1TW2 A;  1WPQ A;  3C1D A;  3GTO J;  2LXC B;  2L3D A;  1XDU A;  5JVG F;  4QMA A;  3H9Q A;  4NNJ A;  1BIB A;  2QLZ A;  1Z56 A;  1IAW A;  3K5B A;  2RRE A;  3HBL A;  1HGV A;  1ZRT D;  4J0F A;  1NTK J;  3TNU A;  3BTJ A;  2IDB A;  2JRM A;  4UB8 H;  4GT1 A;  1P9Q C;  2HDC A;  1SMT A;  3BY6 A;  5F08 A;  5E3L A;  1ORK A;  3J80 K;  1DU0 A;  3RCO A;  4KUH A;  5KK1 A;  5GTI E;  4A0Z A;  1BE3 J;  1IG7 A;  1WT6 A;  2E75 D;  1IRZ A;  3C3W A;  1D3Y A;  1DGR M;  3SZP A;  1F43 A;  4FTH A;  2GOM A;  3B5N A;  1L0N D;  5E79 E;  1LDJ A;  1NHL A;  2IGO A;  3S93 A;  1YIO A;  1EZV D;  2EJR A;  1ZYR F;  4BKX A;  4ZZL A;  4HNV A;  5LRS A;  5APY A;  3PSF A;  3CX5 E;  5K5R A;  5IY5 H;  2NNN A;  2QSH X;  2QQB A;  2H6C A;  2N1T C;  4NBQ A;  1FZG A;  3WGH A;  2DOF A;  3IRQ A;  1VQ7 I;  5IT9 Z;  1N1E A;  4I7H A;  1W0U A;  1IFM A;  1NGM B;  2FNP A;  3RI4 A;  3V7R A;  1DU6 A;  1UG2 A;  1LT9 B;  5DDG A;  4JPZ B;  3OYJ A;  3H1I G;  4GO1 A;  1FY7 A;  3JSO A;  4C2M J;  2K3P A;  3CI9 A;  4WCG A;  3L71 D;  3BQY A;  2MH9 A;  2CSO A;  3KZI C;  4JBA A;  4BXF A;  2O0Y A;  2RQQ A;  1JKR C;  1EVY A;  2FXM A;  4PJ0 C;  3G73 A;  1IK7 A;  3M1E A;  3E97 A;  5M1B A;  1OX3 A;  1EH7 A;  2J59 M;  3S14 J;  1FC2 C;  2KI7 B;  3IFM A;  3CCE P;  2DMN A;  4E7L A;  1WHU A;  4YXW H;  4EEF G;  5BMZ A;  1EDK A;  2K4B A;  1SD6 A;  1AJY A;  1GV2 A;  1X1C A;  1HLV A;  2HU9 A;  4P55 A;  1FE6 A;  2IFN A;  2WIT A;  1FMV A;  4KT5 C;  2JSC A;  3W6J B;  1OCP A;  3HSF A;  3MEX A;  1P84 D;  2FXA A;  2FYU E;  1T6S A;  1IXR C;  4IEJ A;  1M7L A;  2RKL A;  2TCT A;  4BAY A;  2DT6 A;  2L4A A;  4I01 A;  3S2W A;  2R5Z B;  4BDY A;  4KYW A;  1LP1 A;  1VL2 A;  2WAQ N;  5D5W B;  3AE9 C;  4KT0 J;  1W0T A;  1Z21 A;  2A5W A;  2PI0 A;  2R7F A;  2L7M P;  3HRT A;  5EG0 A;  1S9K E;  1KB9 E;  3FXU A;  2ADU A;  4NDL A;  3BCB A;  4IPA A;  4U7J A;  2EZH A;  3BR1 A;  2DJN A;  4PZD A;  2EW2 A;  4IHW A;  3G71 P;  2P4W A;  1HST A;  1IV6 A;  3ZDM A;  4YCA A;  1LEB A;  1SQX E;  1XX5 A;  2LY9 A;  3CDI A;  5CYV A;  5AW6 B;  1T3U A;  1ZEL A;  3EUH A;  3QU6 A;  3L2R A;  2HQA A;  4KIG A;  2H43 A;  2PMZ A;  3JCU H;  3AL0 B;  1NH3 A;  5HOD A;  2Q1Z B;  3V8J A;  4Y28 J;  3IV5 A;  4CPG A;  4EJW A;  3DU5 A;  5APW A;  2PJR B;  5EDN A;  1MFZ A;  1KZH A;  2Y0S A;  1JDJ A;  1YIT I;  3G4S I;  5KNL A;  3ZMV A;  3R4Y A;  3L70 J;  2IGN A;  4P96 A;  3H1I D;  3HD7 D;  3WFI A;  3FHZ A;  3C1L A;  4KUG A;  2WY8 Q;  4RLQ A;  3X2Q H;  3ZOB A;  4B1R A;  4A3D J;  1T8Z A;  5H2F E;  2E36 A;  3CWB E;  1LT1 A;  3HTK A;  3L37 A;  4L9J A;  2A6E F;  2VJ5 A;  1CZQ A;  1XB4 A;  1X1B A;  4L0Y B;  2PP6 A;  1VFC A;  5ICC A;  3EWK A;  2HDW A;  4IQ4 A;  3WU2 E;  2JWT A;  1EA3 A;  3KZY A;  5A9T A;  2R7V A;  2QQ9 A;  2EB7 A;  1FZP B;  1SQB J;  2L7K A;  2QJP C;  1YRN A;  1TWA J;  2BXY A;  4ZDO A;  5GPA A;  2LXB A;  5J1U A;  2JVG A;  3K7A J;  3J7Y J;  3CQZ J;  3M3Y J;  1OCO H;  2CUE A;  3QOP A;  1USE A;  1KON A;  2QG4 A;  1IFN A;  5E18 F;  4LOC A;  1SVO A;  4DQ2 A;  1NU1 D;  1RE3 C;  2AQE A;  3IF4 A;  3V5B A;  1Q81 Q;  1Z0X A;  2JP3 A;  4PJN A;  2FNA A;  3GFI A;  2GXG A;  3CCL I;  2PJP A;  3AE4 C;  3CCM I;  5L3F A;  2H27 A;  2KOG A;  1GT0 C;  4IKF A;  2D2C B;  3GZN B;  3CME P;  4JF7 A;  1D5Y A;  5BNG A;  4UB8 E;  2J5P A;  3K1P A;  2M3B A;  2EIK H;  3I56 P;  3M0D A;  1VDF A;  3DBR B;  3IH2 A;  2OQR A;  1B4A A;  4JX4 A;  2E74 D;  3H5N A;  3LA3 A;  1ERD A;  1BGY J;  2RN0 A;  2YKP A;  1TXG A;  2QSF X;  1L0N K;  5B66 H;  4XKC A;  3WTW C;  4PD4 H;  4JBZ A;  3REO A;  2XAJ A;  3BR2 A;  4NPE A;  3KYD B;  1N78 A;  3LID A;  1I39 A;  5C4J J;  4BHB A;  1MJ9 A;  1IGN A;  3QSG A;  2FBH A;  3HGY A;  1TTY A;  1YQ3 C;  2E34 A;  2BY0 A;  2UV1 A;  2R44 A;  1H0T A;  3H92 A;  4A0X A;  3RK3 B;  3CLO A;  1LTI C;  1Z7U A;  3I53 A;  4E12 A;  1WCM J;  1RIO H;  1NTK E;  3HGG A;  2P81 A;  4MHG A;  2P58 A;  3U9G A;  2NS8 A;  3NWS A;  4G7O F;  1BE3 E;  1RF1 A;  1FZC B;  4C3I J;  3F9K A;  2OTJ P;  1OCC H;  4ZYE A;  1IF1 A;  2ZXE B;  5CBO A;  3RKY A;  1RH5 B;  5FFX A;  3V42 A;  1KIL C;  3KIO A;  2ESN A;  1T98 A;  4XLH A;  5D5V B;  1NU1 G;  1B72 B;  5HS7 A;  5M5Y J;  1X0V A;  2OZU A;  1XTG B;  2N1T D;  1FIP A;  1W7P D;  4XM3 A;  3OYE A;  1ZG1 A;  3CUQ A;  3EUK L;  1LQ1 A;  4M73 A;  3HOW J;  1MMN A;  2A45 H;  1IXS B;  3ABK H;  4LD5 A;  4M9Z A;  1O3T A;  3FX0 A;  3SFE C;  3H1K G;  2VXZ A;  1CQT A;  3WHC A;  2NVQ J;  2YMY A;  4IRI A;  1Q86 Q;  3FKI J;  1HH0 A;  1KYZ A;  3IKV A;  4HST A;  4J00 A;  1VPC A;  2K1A A;  4EM2 A;  4RM3 A;  2TRT A;  3K6G A;  1HUC A;  2XND H;  4H44 C;  1ZME C;  1LTS C;  3BRO A;  3V4Q A;  3GME A;  2JZY A;  4L18 B;  3HN2 A;  3AE5 C;  1Z67 A;  2DN0 A;  4MIM A;  4RMN A;  2OAZ A;  4JQ0 D;  2HFH A;  3OYL A;  3I5U A;  2IA1 A;  4EIJ A;  1GV5 A;  4A93 J;  3LAJ A;  1PVE A;  3JRH A;  5A9S B;  3J81 Z;  2NPS A;  5CJ9 A;  5HLG A;  5EFW B;  4A5M A;  2DW3 A;  2AXL A;  1GTW A;  4FX4 A;  4PV1 C;  3CCV I;  1K04 A;  2K3F A;  3A0H H;  2M3E A;  5CHX A;  3ISP A;  2DBB A;  3K70 C;  1G4D A;  3O8Z A;  1KGS A;  2WTE A;  2HDH A;  4AYB A;  5AYV A;  2E75 B;  3DTI A;  1WDM A;  2RQP A;  1S3J A;  2M1B A;  1DP7 P;  3P8C E;  3KCC A;  4N78 D;  4WY4 A;  2CQN A;  2IPP A;  2XAQ A;  2OQQ A;  2RDP A;  1U3E M;  2M5A B;  2G9W A;  3QYF A;  2ZKZ A;  2L7Z A;  3F89 A;  4DYR A;  3MFK A;  2ZXW H;  5IYC J;  1JTY A;  4OVN F;  3RBX A;  2NS7 A;  2F2E A;  2LY2 A;  3AG1 H;  5LHH A;  2R5B A;  3PIO F;  4H13 D;  2EIN H;  3ZXS A;  2VUM J;  3PO2 J;  3GTL J;  3GW6 A;  2EZL A;  4XOR A;  1MZB A;  2A3S A;  2GIV A;  1JJ6 C;  1L4A C;  1IJW C;  3GHG B;  3L70 E;  1K4T A;  5DJT B;  5APS A;  1MMG A;  3EDP A;  3H1K D;  2KHM A;  1PUF B;  3BJ6 A;  4MTD A;  3I4N J;  2M87 A;  2Y0E A;  4BQN A;  2R4G A;  1TT0 A;  4KJZ A;  4N4N B;  5LGN A;  1B8I A;  1KQF B;  3ADP A;  4LJZ F;  2R5Y A;  3I71 A;  3CP8 A;  1KYW A;  1SQB E;  1WMK A;  1SFK A;  4G94 A;  1U2W A;  2DAO A;  2ZME A;  4HSR A;  2R7S A;  3U1A A;  3Q5S A;  1YJW P;  3NEU A;  2HWV A;  2OYH A;  4L0Z B;  1K73 Q;  1ZW0 A;  2MYS A;  4HBL A;  3F8M A;  2K4J A;  4OAZ A;  3I59 B;  4WK8 F;  2H88 C;  4PD4 E;  1IN8 A;  1ZCJ A;  3A02 A;  3ZQI A;  4QPO A;  3RL0 C;  3PQJ A;  2E2I J;  4L9V A;  3CD6 I;  1T95 A;  1HKQ A;  3QHA A;  4I6Z A;  2E1C A;  2JWD A;  1U5T A;  2Y48 A;  2ZNZ A;  2ZJ2 A;  3L2V A;  2GUV A;  1M1K Q;  5AIQ A;  4II2 A;  2QYT A;  5APQ A;  2CG4 A;  1I6X A;  5CVV A;  2EPF A;  4FT8 A;  3H3V K;  3H1L J;  3MZW B;  2FE3 A;  1ZOY C;  1VND A;  1EVZ A;  2WSS H;  2V7F A;  2CQ7 A;  5FKM A;  4B43 A;  1G3T A;  1HW2 A;  3VYR B;  4EZB A;  4EJU A;  3RZD J;  3WGG A;  1LE8 A;  4XOP A;  5DCF A;  3J80 Z;  4IX7 A;  4ENM A;  1BGY E;  2DA6 A;  3VMY A;  5KKZ C;  3S1R J;  2KB7 P;  3ELK A;  1PP9 G;  4YII A;  1REP C;  3W6Z A;  4HX4 A;  1JY3 N;  3HPH A;  2OFP A;  3HD7 B;  3L71 J;  3SDG A;  3S1K A;  1T2K C;  3JRA A;  1FOY A;  4IXA A;  2FQ3 A;  5E17 F;  1WRG A;  3IAM 2;  1GHC A;  1PYV A;  4K2E A;  1CF7 A;  4Y99 B;  3GYH X;  2EFP A;  4GYG A;  4BEH A;  3TSI A;  1V5G A;  4UY8 I;  3CDL A;  2MLK A;  1XSV A;  1EJ9 A;  2QVA A;  1QQI A;  2OC6 A;  1FBM A;  2VIX A;  2FJ1 A;  2QBY B;  2ZYA A;  3I83 A;  4HPQ A;  1D1C A;  4WWC A;  3OY9 A;  1JGG A;  1J1D B;  3AG3 H;  4P9U A;  2OAR A;  2WSF H;  3G6E P;  2VKH A;  5HVQ C;  1LTT C;  1RI7 A;  3U59 A;  2DFI A;  2STW A;  2K9Q A;  1A35 A;  1JI8 A;  1BCC J;  1V55 H;  1E5W A;  5J47 A;  5CCG A;  5EEA A;  1A6I A;  2M4K A;  2CGP A;  2E5Y A;  3ZQF A;  3CC4 I;  3B73 A;  4PGG A;  3O6B B;  4RAG A;  3ADO A;  1IO2 A;  2RMZ A;  1JGS A;  3BR5 A;  4MFE A;  1O3S A;  4UUS A;  2W7N A;  4A3L J;  6PAX A;  5AVV B;  3TOA A;  3IQD B;  3CC7 I;  2EWN A;  2ZJP F;  2E19 A;  3FK6 A;  3WS7 A;  1NYH A;  4XN0 A;  4B3A A;  2BV6 A;  3E6C C;  1P84 H;  1X19 A;  4R79 A;  2FML A;  1A02 F;  4C46 A;  4GOF A;  1MBK A;  3GUD A;  3VDX A;  1EDI A;  1AVO A;  1P7J A;  4IRG A;  1QHG A;  1PP9 D;  3BZ6 A;  3GFJ A;  3TO6 A;  3H1I J;  4DZJ A;  3HOZ J;  1B9N A;  1X3W B;  4BRY B;  2E5N A;  3Q0U A;  1Y1V J;  2QE7 H;  1MBE A;  3BRT B;  1VQ8 I;  1LWU A;  1F36 A;  3TW6 A;  2Y9Z A;  2LKM A;  2FXP A;  5AW2 B;  4FIS A;  3G0O A;  4RGS A;  1RQU A;  2RH0 A;  2IXS A;  1A36 A;  1ACI A;  2BW3 A;  1SC7 A;  5DV5 A;  5AW8 B;  4AIH A;  2FYZ A;  3I9V 2;  1SQP G;  5TIS H;  3CCQ P;  2D5V A;  1N7S A;  2HR3 A;  5CLS A;  4PV1 D;  5ILS A;  2DOE A;  1ZGW A;  1LDK B;  2M5W A;  3OYH A;  3AKZ A;  2RC4 A;  3ZMU A;  3K70 D;  3VYI A;  1IJD B;  1FC3 A;  1TBX A;  2M30 A;  3M4O J;  2KLV A;  3RK3 E;  4GIF A;  1HCR A;  1S8N A;  1JM0 A;  3H32 B;  2QQ8 A;  1KFN A;  1WGX A;  1NU1 J;  1V54 H;  1G1J A;  1T3J A;  1FPQ A;  1JUP A;  2H8W A;  5FLV A;  4UV9 A;  1ZR2 A;  3DOJ A;  4KIF A;  2ZJR F;  5HWS A;  2COM A;  5IYB J;  3EQ2 A;  2K9Y A;  3JC2 2;  5KLV G;  4M9X A;  4A5N A;  1W7P B;  5A2Q K;  4RDU A;  3S16 J;  2N1T B;  5J4V A;  3S17 J;  3FHN A;  4BYY A;  4E7K A;  4IQJ A;  1YX5 A;  3BRV B;  1KYO E;  3HG9 A;  5LD2 C;  2DTZ A;  2KL4 A;  3TGU J;  4EM1 A;  5HNH A;  5E20 A;  4DJG A;  1U9N A;  1FNN A;  3ZGK A;  4ANJ A;  1L4A D;  2XAS A;  2F6C A;  2WAD A;  1FBU A;  1IDY A;  3HRS A;  4HV5 A;  3QP6 A;  1H89 C;  1FAV A;  2LY1 A;  3HOU J;  4X0G A;  4ENK A;  3FMQ A;  4WBA A;  3BC8 A;  1ZGJ A;  3R0A A;  4YEJ A;  1SS1 A;  2UZK A;  4YXD C;  4CXF A;  2LKS A;  1R1U A;  2KFD A;  3CUO A;  2XF7 A;  1ETV A;  2R7O A;  2XGD A;  2H09 A;  2OBP A;  4II3 A;  1M1E B;  3UR3 C;  1JMB A;  2VBZ A;  1ZRE A;  3A5T A;  2FD5 A;  2LVS A;  3MKL A;  1SQV G;  4IL6 X;  2WV1 A;  1M1J A;  4F91 B;  3H2Z A;  2A45 I;  2OCE A;  3FMR A;  3ABM H;  3H5A A;  3LSK A;  3RL0 D;  5FJ8 J;  3C2G A;  2WPR A;  4EI2 A;  3LWF A;  1ZP0 C;  4XN3 A;  2LRE A;  3HE5 B;  1YHQ P;  1BSH A;  2KLO A;  5K7H A;  1R4M B;  2MSY A;  2DMT A;  2VKE A;  3H1L E;  1PUE E;  2I10 A;  2R93 J;  3I54 A;  1K78 A;  1EZV E;  4IVN A;  5K5Q A;  1FS0 E;  3FK7 A;  4RB3 C;  1RE4 A;  2R7T A;  1S1C X;  4S05 A;  1N1G A;  1IC2 A;  3B5N C;  2YSR A;  3WTZ A;  4JQF A;  3OYA A;  1BSN A;  2BYV E;  3HRN A;  3HUS A;  2M0M A;  3F8B A;  1VQL P;  2OTL P;  4Q5S F;  1MBJ A;  1VF9 A;  2Y0C A;  5KLV D;  2VI6 A;  2N8G A;  2W27 A;  1HDD C;  1G2H A;  1SMY F;  2K85 A;  5HOO A;  3GEZ A;  1YFH A;  2PRR A;  4Y15 A;  1N8R Q;  1MBF A;  4I2L C;  3FF5 A;  2ISY A;  1BA5 A;  1UCR A;  2H1L A;  1WJA A;  4HLX A;  3L71 E;  2W83 C;  5J40 A;  5D8K B;  4D6T G;  4RM2 A;  1B59 A;  4W1U A;  2ZXJ A;  2XAH A;  4AVZ A;  3KHU A;  1T2K D;  4B44 A;  4M6Y A;  3QU3 A;  4V2G A;  4HNT A;  1B6A A;  3MP7 B;  2L9V A;  1SD5 A;  3C7J A;  1KU7 A;  1OW6 A;  1FWZ A;  1Y8R B;  1JKO C;  3L73 J;  1Q2N A;  3UKG A;  4CCN A;  1BOB A;  2CPS A;  2AXT C;  2JQ7 A;  2HPI A;  1VQN I;  1U0J A;  2LTP A;  5EZH A;  2XSJ C;  4XRS A;  4BAC A;  3S15 J;  2XDJ A;  1PFI A;  2QJP B;  4ZNC A;  1NAF A;  4GWK A;  1YTY A;  2B9B A;  1NTC A;  2AQF A;  1SQV D;  1D1B A;  3AE7 C;  1TQM A;  4PK4 A;  1VQ9 P;  3DV8 A;  3OOU A;  3LFK A;  4DLL A;  3Q5P A;  1BCC E;  3VTP C;  3CTV A;  1LT9 A;  3QP5 A;  3KZI H;  2VB6 A;  1TL8 A;  4S04 A;  1UAA A;  3JRD A;  2JSP A;  1Z1D A;  2HQN A;  4GDF A;  2LLK A;  1Q82 Q;  2IA0 A;  2RNG A;  4XNF A;  3A7O A;  1UG0 A;  4PJ0 H;  4C7R A;  2DYR H;  2QIW A;  3NRV A;  1DEB A;  5CCH A;  4LC1 A;  2C9L Y;  5TIS E;  1E2X A;  3H9J A;  2L4M A;  4BY7 J;  2VON A;  3CXH D;  4HRI A;  2O1K A;  1R5G A;  1QVU A;  2Y2Z A;  4O6J A;  4C7N B;  4GDO A;  4Y13 A;  3AEA C;  5E3M A;  4I09 A;  2CU7 A;  4AIK A;  2LP0 A;  5IP9 J;  3FWE A;  1BC8 C;  2WV0 A;  4IHV A;  1PV3 A;  3H1I E;  2ITA A;  4ZC3 A;  4E7S A;  1O7L A;  1S5L H;  1KC8 Q;  1ETO A;  5E1Z B;  1LTJ A;  2XAG A;  4D6T D;  1DD3 A;  2W24 A;  3RSN A;  5ERI A;  3HWR A;  4B3H A;  3TDZ C;  2ZYG A;  2CW8 A;  4D5F A;  3DBH B;  2JUC A;  5KAF E;  1HF0 A;  2DU9 A;  3ZQH A;  1G2C B;  3AEE C;  4IFD K;  1BDC A;  2DCE A;  2YMK A;  4NPD A;  3BOQ A;  3Q1M A;  3K9T A;  3OSG A;  3S32 A;  2VJI A;  4CHU A;  3HUG B;  1HOM A;  3K4N A;  1UEL B;  2W85 A;  4PSX A;  3CCE I;  2DYS H;  2VBY A;  5FB2 A;  3JRC A;  1Q7Y Q;  2H6B A;  2VN2 A;  1PIX A;  1NU1 E;  1FX7 A;  3ZCO A;  4RO0 A;  2GIZ A;  3DCF A;  1KIL B;  3IAS 2;  4XA4 A;  4Z1M H;  5HDK A;  1T38 A;  2PJR A;  4L5E A;  1NG6 A;  3K1M A;  4D0P A;  3EUA A;  5JLW A;  1S29 A;  5AW5 B;  2HDD A;  2Q5U A;  3KP7 A;  1V3F A;  2ZXH A;  1PPJ G;  1ZXG A;  4RBO A;  2W6A A;  3LIE A;  2KSJ A;  4HH2 A;  3TGU E;  5DCM B;  5B5E E;  4BQA A;  5FWN A;  2CUF A;  2F4M B;  3V6I A;  3DP7 A;  4MQ9 F;  1X1P A;  3RYP A;  5JHU A;  1N73 C;  3G71 I;  1U8B A;  2BEZ F;  3TGN A;  2V9V A;  1OW7 A;  3ERM A;  1DPR A;  2HOD B;  2I76 A;  1FDI A;  3HIF A;  4EJV A;  2XV4 S;  5IP7 J;  1JY2 N;  2QM8 A;  5AVT B;  4H44 B;  1YTZ I;  4FET A;  3VOE A;  4PCQ A;  3IL2 A;  1FJL A;  4Y7N J;  4IHX A;  3TO7 A;  1IRG A;  1TQI A;  2W90 A;  2EV0 A;  2L0K A;  3TDK A;  4U3F G;  2O61 A;  4QTR A;  5J8F A;  1USD A;  1YW8 A;  4I98 B;  4HB1 A;  3KYC B;  5KLV K;  1GMJ A;  3U1K A;  1M75 A;  1FDO A;  1WSU A;  1YTZ T;  4H13 C;  4WVZ A;  5J1R A;  2NYX A;  4HLY A;  2D1H A;  4BQQ A;  1Y0N A;  5CJ0 A;  1LJ9 A;  4U0W A;  5APV A;  4RES B;  1BR2 A;  3Q0W A;  1K8A Q;  1WJ5 A;  1DX7 A;  2G8Y A;  2IGK A;  4PV1 B;  2O3F A;  3PNV A;  2LNB A;  4GKG A;  2KIM A;  3CMA P;  4F3Q A;  4C2T A;  3IN6 A;  4EGZ A;  1P84 I;  3M06 A;  1ZV8 A;  3B71 A;  4AM3 A;  4C30 A;  1OFC X;  1J2J B;  4GRI A;  2P2U A;  3FWL A;  4F52 A;  1YJN P;  1RF1 C;  3ULQ B;  1TWH J;  3KP5 A;  1MNE A;  3OR2 C;  2J58 A;  2PAJ A;  4WB4 A;  3S2H J;  1SD7 A;  2E74 C;  4KHX A;  2B89 A;  1YB4 A;  3B5N D;  3O2P E;  3LL7 A;  4YIF A;  3H1J G;  4BGD A;  4HF2 A;  1LJ8 A;  2X58 A;  2JO1 A;  4XLC A;  1YJ9 I;  2E7X A;  3T8R A;  1FEX A;  1SQV K;  2RKH A;  4DJA A;  4ESF A;  1PPJ D;  3NAU A;  3HKZ A;  1U9O A;  2D2W A;  3D70 A;  2A6H F;  4M3E A;  4AD9 A;  1L4A B;  2WBM A;  4UVB A;  5HLI A;  2HGC A;  2V26 A;  2VT3 A;  1UII A;  1KFM A;  2JMW A;  3O3K A;  4O3M A;  3KZI E;  3N4X A;  3HTU A;  2PN6 A;  3CME I;  3FR7 A;  5D4R A;  3ABL H;  2E76 C;  2X1E A;  3F3S A;  3TW7 A;  2V4H A;  4W7Z A;  3I56 I;  3J7Z I;  1R5H A;  1RES A;  1PP9 J;  2DO7 A;  1NTM G;  1QVF O;  4A6D A;  1LTG C;  3L73 E;  4BY1 J;  4QSH A;  2PGD A;  2CW7 A;  1R36 A;  2C6Y A;  3H6P A;  4U3F D;  3ROU A;  4AC0 A;  2O03 A;  1J59 A;  1N77 A;  2JA5 J;  2UWJ E;  2OPT A;  2XAU A;  1XCV A;  3H5R A;  1B72 A;  1XGN A;  1WQ2 A;  4LLN A;  2DDB A;  1YI2 P;  2FF4 A;  1FBS A;  3VWB A;  2YR2 A;  5GAD J;  1L3L A;  5J8C A;  3OW2 O;  3RL0 B;  5B3S H;  4DYC A;  5B1B H;  4XK4 A;  4FX0 A;  4G7H F;  2Q9I A;  1KA8 A;  5EYR A;  2B88 A;  1I1S A;  1OCZ H;  1YLF A;  4N78 E;  2DT7 B;  5EEG A;  1XD7 A;  2MJZ A;  3PHL A;  2LYC A;  2WB1 A;  1AOY A;  3GF7 A;  2HKO A;  2P5V A;  4YEL A;  5D6F A;  3PUF A;  1R00 A;  2HVS A;  1J9I A;  2OTJ I;  3VB2 A;  1QLE D;  4UVA A;  1J09 A;  1UHM A;  3FR8 A;  1OR7 A;  5CQG A;  2K02 A;  5KAI C;  3TBI A;  1HW5 A;  2M8G X;  1DD4 A;  1URQ A;  4DCK A;  2DK8 A;  3H3U A;  2K9J B;  3H1J D;  5KKZ B;  2BCC J;  1P4X A;  3LSJ A;  4ITV A;  1KQ8 A;  1RET A;  4KIB A;  2LH9 A;  5JFR A;  1X4P A;  4RS8 A;  1GUU A;  2VC0 A;  2IVM A;  3C7D B;  2IFM A;  2YKO A;  2VT2 A;  2LDU A;  1X8Y A;  2HTS A;  4FHT A;  4KN4 X;  4PFO A;  4LGW A;  3CP2 A;  4CYC A;  1NTZ G;  1MMD A;  1S5L C;  2GQQ A;  5A2Q Z;  2F48 A;  2VJJ A;  3OMY A;  1NTM D;  1R71 A;  5GTI C;  1OCT C;  2E43 A;  3COA C;  3HDD A;  1RUN A;  2MKV A;  3K4K A;  3KYL A;  2WSE J;  3BCC G;  3WE3 A;  4XKV A;  2CMP A;  4ZDL A;  1CSB A;  1QZE A;  2QKM B;  2CPB A;  3L2W A;  4EJT A;  4DYD A;  1ZAO A;  2OYH C;  1QVT A;  1U6G A;  1X4O A;  2GA1 A;  2Y30 A;  1AA7 A;  1EXI A;  4FE7 A;  2Q3I A;  2X1D A;  1KZU B;  4B8X A;  1LKX A;  1EV7 A;  3R61 A;  5IOY A;  4I2O A;  1XSX A;  4HJG H;  2K3R A;  3GZ5 A;  4M3D A;  1XG1 A;  2CJJ A;  3MIW A;  3DTK A;  4XLE A;  5IYD J;  3GHG A;  3P9K A;  4HYE A;  5MGB A;  1R8E A;  2KZJ A;  3BJO A;  1PUF A;  4E70 A;  2BVL A;  4OIO F;  1KN7 A;  5CVI A;  1BN5 A;  5IPA A;  2H1K A;  4MFD A;  3J7A Y;  2VPL A;  1D0Z A;  3DPU A;  4OWR B;  2L7F P;  1MGT A;  4YFN F;  2YS9 A;  1SAN A;  1C0W A;  2QGU A;  5KLV J;  2WSE H;  1O57 A;  3PM1 A;  5CVU A;  3U21 A;  2I1K A;  1WH7 A;  2OYI C;  2WWW A;  3RPU A;  4BBS J;  4YG2 F;  1PZQ A;  5CKT A;  3O6Q B;  4MNU A;  3W2A A;  4A3F J;  1ZN2 A;  1OQY A;  3H9G A;  1Z82 A;  3NWT A;  1XGO A;  4M9S A;  2NRA C;  3GTJ J;  2DQL A;  1BDD A;  1UHS A;  2RN7 A;  1JXS A;  1S2E A;  2Q0O A;  1W2E A;  1KU2 A;  1M8O B;  3N97 A;  5AIP A;  4JX5 A;  2LMD A;  2R3S A;  1OIP A;  2HS5 A;  1IN4 A;  1T39 A;  1SFC A;  1LUJ B;  5ILV A;  2M8R A;  1GU4 A;  4XSZ F;  1NTZ D;  3BVH A;  2ECB A;  2P10 A;  5E3O A;  2KZI A;  3MZ8 A;  4RGX A;  3PLN A;  5K7F A;  1UJ8 A;  2VKV A;  4BHP A;  2XNX A;  1LFU P;  2GBY A;  1RF0 A;  1W5C E;  2A6T A;  1JT0 A;  2VQC A;  1ZLJ A;  3IP4 B;  4NQW B;  5BS6 A;  3BCC D;  4MEY F;  3NXS A;  3FX3 A;  1SQP D;  3ABU A;  2IX7 C;  3ZP5 A;  3TP3 A;  5JI6 A;  1IDZ A;  1KIL E;  3DBL B;  3BTI A;  1X3Z B;  3JSP A;  2B9S A;  1YJW I;  2ZXI A;  1YBK A;  3FGA D;  1I3A A;  1N75 A;  1P92 A;  2BGC A;  3ABV C;  4M3F A;  1T33 A;  2CO5 A;  1JUS A;  2KS1 A;  1VZ0 A;  4BE1 A;  1F12 A;  3U2R A;  4S0H B;  3WTV C;  4EGY A;  3HD7 A;  4IL6 C;  2VOD A;  1FZA A;  5EGO B;  3L2U A;  3NAR A;  2IJL A;  2XPV A;  3N05 A;  4A12 A;  2XIG A;  2E35 A;  2FEZ A;  3OBB A;  4FGW A;  3F5H A;  2IAI A;  3M9A A;  4BHC A;  2IBZ D;  4ETS A;  3PUB A;  2JEE A;  3V2Q A;  3A01 B;  4C3H J;  1UIX A;  2QQA A;  4RB1 A;  1GVJ A;  2Q3E A;  1KQS O;  2LD5 A;  2NXN B;  3OL4 A;  4A3E J;  1NO4 A;  2H8P D;  2OYO A;  3LAP A;  4PFP A;  3ZGY A;  1TT5 B;  1PP9 E;  1GK6 A;  2E76 D;  1IC8 A;  3DKX A;  3WU2 C;  1LFB A;  1ZTR A;  3A3Y B;  3CCS P;  1AQ5 A;  3M8E A;  1NKN A;  3T8T A;  5CVR A;  5F1J A;  2VE9 A;  2E60 A;  2P8T A;  2VKD A;  1ZGA A;  3MKZ A;  3PP5 A;  2WT7 B;  2PBI A;  2AEJ A;  3OAK A;  3SEZ A;  3L75 D;  1BI2 A;  3TOB A;  3WU0 A;  3BWG A;  3OIO A;  5ILU A;  3ERE D;  1U7J A;  3MWM A;  1CGP A;  2NPS D;  1XTA A;  3TMO A;  3F6O A;  3CXH H;  2O7O A;  2CWE A;  3K10 A;  3TNU B;  1N7S C;  2HXO A;  4Y17 A;  3LW5 J;  2WVR A;  3U1C A;  4C9Y A;  1JHF A;  4M71 A;  3GFM A;  4Z2Y A;  4AQR D;  2KZG A;  2ZBK A;  3G9R A;  4XID A;  2DOD A;  1TP4 A;  3SYT A;  4DBR A;  1APL C;  1NTM K;  5DS9 A;  5FKL A;  2BAS A;  3B5N B;  3SWF A;  3E3V A;  3QQA A;  4GOD A;  2Y0D A;  3OYK A;  1RNL A;  1SEU A;  3G6E I;  3QRF F;  2O01 N;  2PMZ N;  3D1L A;  1KQL A;  3KXD A;  1BI1 A;  2HPC A;  2DFE A;  3HSE A;  1ITY A;  2M34 A;  5C44 J;  1GL2 C;  3HDH A;  2BCC E;  1CI6 B;  1A31 A;  3R2P A;  1JKP C;  3KFW X;  1WDK A;  2Y0S N;  3JCU E;  2HQ5 A;  5C4X J;  4UB6 C;  3CO7 C;  2DPU A;  3BG5 A;  2L2O A;  3LSH A;  4E4H A;  1X22 A;  1TWC J;  3FIS A;  4IJA A;  1D8J A;  2HG5 D;  1GW4 A;  3LW5 H;  3D1N I;  1OYI A;  2B7E A;  3KEY A;  4DOJ A;  1MBH A;  2BXZ A;  2J5O A;  5EEH A;  1S7A A;  4IHY A;  1K7A A;  4ZMD A;  1Z91 A;  4XMY A;  1FBQ A;  2QEX P;  4IHT A;  2ESH A;  1E3P A;  4BJT A;  2FBW C;  1D0Y A;  3AEG C;  2VJ4 A;  2OU2 A;  2KLU A;  3EYY A;  1SQX G;  2KT0 A;  4V19 K;  1LDD A;  2FUG 2;  3MN2 A;  5DUI A;  3CCU P;  1K6Y A;  4I0B A;  1YIT P;  2DA5 A;  1M66 A;  2HYJ A;  3GZ6 A;  3CX5 D;  3RQI A;  3I58 A;  2QJK C;  2ZT9 D;  2EFO A;  3JRE A;  3G3Z A;  3PL8 A;  5FD6 A;  2VLA A;  5EG0 B;  3NFQ A;  4YPC A;  3HL2 A;  2YO3 A;  1NH4 A;  5AVX B;  5AW4 B;  3VMA A;  2VC1 A;  1Z77 A;  3R4K A;  3GCM A;  1S7E A;  3JR9 A;  3CCQ I;  1NTZ K;  3QPH A;  2XSD C;  1XS9 A;  2A69 F;  1X0T A;  5AVW B;  3W68 A;  4LIV A;  4ZH4 F;  4B09 A;  1HVV A;  1G6N A;  1F4K A;  1XGM A;  2R7X A;  2ZVO B;  4ESB A;  5CJ4 A;  2IS1 A;  3F8C A;  1RE4 C;  2M8E A;  4LGD E;  5KLV E;  1IFD A;  5AVY B;  3HUS C;  2LSO A;  4HDU A;  2ZVN B;  1ZHF A;  2Z5H A;  5CQE A;  1DLJ A;  1SQP K;  1YIJ P;  3PJS K;  2A06 G;  4KN7 X;  1VQM P;  4RAY A;  1Z05 A;  1X79 B;  1WJE A;  3ML6 A;  1YVE I;  2ECC A;  3CCJ P;  2J5U A;  2X4H A;  1GLN A;  2DJI A;  1I3Q J;  4R8H A;  1R23 A;  2XGE A;  2Z5U A;  5B66 E;  2JN6 A;  3VYU B;  3RKW A;  3GXO A;  2LKX A;  3CES A;  1BJZ A;  2WWY A;  3OYI A;  4ENJ A;  1ON2 A;  1UST A;  2R5D A;  2QA4 I;  1BW5 A;  4OGQ C;  3JRG A;  3HE5 A;  3HTK B;  4ZTF A;  4G6T B;  2Y75 A;  1ZRC A;  1PGJ A;  1X9V A;  3OA7 A;  1L0N J;  2V7Q H;  5L3D A;  1KB9 D;  4RGU A;  3BAT A;  2X6W A;  1FT9 A;  3AE2 C;  2BY2 A;  3L2Q A;  3CKY A;  4J01 A;  3FM3 A;  5HLH A;  2N9Y B;  1SQX D;  3H0G J;  2VBX A;  1JNM A;  2HXI A;  2W48 A;  2FA5 A;  1IRF A;  3KDP B;  2WSF J;  4HDV A;  4M3B A;  5LGT A;  2XGC A;  2CRG A;  1NWQ A;  4BJ5 C;  2X9D A;  1W5T A;  2ZFU A;  4HF0 A;  3DWL E;  4A3I J;  2O8K A;  1USS A;  2F5F A;  2E1O A;  2VOO A;  1VTN C;  1OVV A;  3R6S A;  3ZN1 A;  2PMH A;  3AEB C;  1GZL A;  3T5X A;  2HYF A;  2YUS A;  3Q9S A;  2AXT H;  2XGX A;  1YHQ I;  4O9B A;  3S2D J;  5L3G A;  2EZI A;  5DUK A;  3OV8 A;  1N73 B;  4DOZ A;  3H1J J;  2VPR A;  3ZQC A;  2O01 J;  2OGU A;  1OLT A;  1T08 B;  4XIC A;  5M3M J;  4CCL A;  2R7W A;  1TC3 C;  1NTK G;  4I7Z C;  4B86 A;  1UMQ A;  2RNJ A;  1VQL I;  2A5Y B;  4Y33 A;  4GGG A;  2A06 D;  4OIP F;  2OTL I;  2ZYD A;  2NOJ B;  3PH0 A;  2W25 A;  3W6K B;  3W67 A;  4HA8 A;  2ETH A;  4AU7 A;  1ONV A;  1H9G A;  2DDA A;  3M7G A;  3GBG A;  1TW3 A;  4H13 B;  4KDP A;  1LTJ C;  3H35 A;  1KU3 A;  1E17 A;  3BZC A;  1T8I A;  1D7M A;  3PID A;  4KNY A;  3ZMZ A;  1QL1 A;  1GXQ A;  1MH3 A;  1J0R A;  4A2U A;  2DA4 A;  1NTM J;  3PTZ A;  2O1J A;  4AWX B;  1IN5 A;  2MLG A;  4LK0 F;  5KTB A;  1UHW A;  4DYQ A;  2CFO A;  1Z9C A;  2X6O A;  1BIA A;  3OWT A;  3HOT A;  3N4M A;  1MH4 A;  2IP2 A;  2GXA A;  1VF5 D;  4WWI A;  1FIA A;  1N7S D;  2KJB A;  2O01 H;  3A0H E;  1RF1 B;  1RKW A;  3ONQ A;  1HKS A;  1I50 J;  3EFF K;  3L74 G;  3EYI A;  1WWX A;  4FAS D;  1PP7 U;  3AEC C;  2E74 B;  3M0A A;  1YQA A;  4EAT A;  3LSR A;  1K4S A;  2M0C A;  3B6C A;  1Y0U A;  5DD4 A;  2ZCW A;  3TK1 A;  4G9Y A;  2E71 A;  2P7V B;  4MEX F;  3HE4 B;  2XB0 X;  4PJJ A;  2KNC B;  4U87 A;  3QYE A;  4XKW A;  1VQ9 I;  1F0Y A;  4CA0 A;  1B9M A;  1J1E C;  2LR8 A;  3BQZ A;  2YIU C;  1WI9 A;  2X6X A;  4IZZ A;  2H94 A;  3DPL C;  1GL2 D;  4CZZ A;  2QM7 A;  4J0E A;  3ZHB A;  3FXO A;  3BCA A;  3JTH A;  3OL3 A;  2FFD A;  4XE5 B;  3ITK A;  5BU5 A;  5FKO A;  2PEX A;  3B6A A;  3CC2 P;  3D71 A;  4EDF A;  3AED C;  4Y3O A;  2E76 B;  3CCR P;  1J2X A;  2KRH A;  1IXC A;  1NTK D;  1FSE A;  3QOD A;  4L74 A;  4DNC A;  5GPC A;  4NHJ A;  2E5T A;  3HC7 A;  1FYM A;  1YJ8 A;  1WJC A;  2F4I A;  1YX3 A;  2FX0 A;  4FQG A;  3I4M J;  1E0E A;  5IT3 A;  2XVC A;  1T0F C;  1EH6 A;  1KIL A;  1HF9 A;  2CQX A;  4HYT B;  3LOC A;  3MOG A;  2E1N A;  4LB6 B;  1NTZ J;  3CPW O;  1D8K A;  4XRF A;  1AKH B;  4ABZ A;  2DA7 A;  3M91 A;  5J4Y A;  5AVU B;  5KVR A;  1PDN C;  2QRX A;  4CCO A;  3CJR B;  2CS3 A;  3GLX A;  3RKX A;  3RIR A;  2MAB A;  4JX6 A;  3ZMS A;  5DCM A;  1ZR4 A;  3V4W A;  4Z6Y A;  2MGQ A;  2M7B A;  2HOS A;  3LSM A;  3GO5 A;  2P6S A;  3WMM 0;  1HC8 A;  4RLF A;  4BUP A;  2AHQ A;  4HX7 A;  1Y47 A;  3L70 G;  1FZE A;  2HOD A;  3L74 D;  1SFE A;  2EV5 A;  3WGI A;  2ZJS E;  5LEK A;  4YIR X;  2JKV A;  3DFU A;  2XKP A;  1FOX A;  1FDM A;  4ZYD A;  3I0T A;  3OYB A;  4CO8 A;  5F0F A;  3MKY B;  3S1N J;  2IRF G;  4MO7 A;  4OOI A;  4U7B A;  3C18 A;  3V2P A;  4ZTJ A;  1SQX K;  4KUM A;  3HOX J;  4AVP A;  2TDX A;  2QVO A;  3C9I A;  4CIC A;  2RVC A;  1JKQ C;  1JEK A;  3CXH I;  1ZRT E;  3WUU A;  2IZ1 A;  2W6J H;  5AW1 B;  3VP9 A;  3G2B A;  3QOE A;  2DA1 A;  3CF5 F;  4Y52 J;  3PEF A;  4GXO A;  3W2W A;  1G3Y A;  2ELH A;  1QPI A;  2QYO A;  4K35 A;  3Q0V A;  2FYN C;  4IRH A;  4OGQ D;  1QVG O;  4D1Q A;  2ZNY A;  1QRY A;  3P7N A;  4G7Z F;  1B8I B;  2AXT E;  1KTM A;  2FBI A;  1L0N E;  2WQY C;  1SFO J;  3ZWB A;  2WMM A;  2Z4E A;  2KJC A;  1ZN5 A;  3AE3 C;  5FLX K;  4OQZ A;  1RR7 A;  3CJT B;  1J75 A;  3E7L A;  1V4R A;  2B0L A;  3P8C D;  1ZAR A;  2OCC H;  3PNT A;  1HJ0 A;  4B3I A;  4OH8 B;  2OYH B;  4IM7 A;  2D1V A;  3W6V A;  4A7P A;  3SXY A;  3JRF A;  1F9N A;  4M6V A;  2LFB A;  3KYQ A;  3OS1 A;  5DTD A;  3I55 P;  1LTA C;  2XDV A;  4A6E A;  2EIM H;  1BOA A;  2ID3 A;  1YON A;  2JVH A;  3L2C A;  3LA7 A;  3RYR A;  1L4A A;  2W84 A;  2K9M A;  2LOO A;  2BHY A;  4ASW A;  3CMA I;  3L72 G;  1XCB A;  4RA2 A;  3L70 D;  3H25 A;  3MGN A;  1FP2 A;  3KX2 A;  5D5U B;  2EFW A;  1ETQ A;  1YYV A;  2XPU A;  1YJN I;  4TLF A;  2WPQ A;  1UZC A;  4L9T A;  4L76 A;  3H1J E;  4TT3 H;  2KP6 A;  5ICG A;  1N25 A;  3TQN A;  2OYI B;  1URQ C;  2OJE D;  3E5U A;  1BW6 A;  2P5L C;  1JUN A;  2NVX J;  1PL5 A;  1LE8 B;  2JPB A;  1JY3 O;  1P84 E;  2FBK A;  3L36 A;  4JYK A;  1FOW A;  2UUZ A;  1X0X A;  3BTC A;  1KD1 Q;  1PGO A;  3A1Y A;  5GTH C;  5APT A;  1X58 A;  1DP3 A;  3AFH A;  3MUD A;  1NTM E;  3TF5 A;  3QPL A;  2MC4 A;  1CF7 B;  1K9M Q;  3PIP F;  1ZLL A;  3WE2 A;  4BEH B;  4A3B J;  5KAI H;  1R7J A;  2ELJ A;  4G6Q A;  1LPQ A;  1XMA A;  3VOP A;  3DEW A;  4A3J J;  4KFC A;  4A3C J;  4R4M A;  4ENN A;  1OXZ A;  3HZJ A;  1NTK K;  1MKM A;  2AO9 A;  3EUH C;  2IYP A;  3KPH A;  4O5V A;  2JJL A;  5J3L A;  2O6G E;  1DQU A;  2PX9 A;  5M5X J;  2XKO A;  3LNQ A;  1FSH A;  1W1W E;  2W1O A;  5D4S A;  1F17 A;  1Y8A A;  2IT0 A;  3WUT A;  2IBZ I;  2KIF A;  3PDU A;  2WPS A;  3H1K J;  2MH2 A;  4B4C A;  2WPV B;  4KJM A;  2OQG A;  3FKJ A;  2R5Z A;  2PFX A;  3BT9 A;  3L72 D;  5GTI H;  1MBG A;  1YOV B;  4UUS B;  1FYK A;  4LLH A;  2HNH A;  3G17 A;  1L0L G;  3PJG A;  1MSF C;  4IFM A;  3OR1 C;  4N0B A;  3IWZ A;  3QYB A;  1OKR A;  2HEO A;  1QO0 D;  2IW5 A;  1LVK A;  3VMX A;  5E1W A;  1LEA A;  2QKL B;  2DTR A;  3WG9 A;  1VQ4 P;  4KIC A;  4E7J A;  3CX5 H;  3IH3 A;  2LBF B;  3RJP A;  5KJ7 A;  5FKN A;  5GAH J;  1SVF A;  4A3M J;  3S3M A;  2K86 A;  1IUY A;  2POH A;  3EGO A;  2F5D A;  1NTZ E;  2N9B A;  1BJA A;  3IHU A;  2QJY C;  3A0B H;  4I02 A;  2DPD A;  1W5S A;  1SFC C;  2BY3 A;  2H89 C;  3LSG A;  1PGP A;  3BG3 A;  1JMM A;  2CH0 A;  1KMI Z;  1YE9 A;  4PSW A;  1N7S B;  1FTZ A;  3ASN H;  2A07 F;  4LB5 A;  1WRJ A;  2LC2 A;  2W57 A;  2CFX A;  2PMU A;  2PQ8 A;  3MMY B;  2JA7 J;  1JTH B;  2D2C D;  2QSI A;  4HKZ H;  1VQO P;  2WC2 A;  2JR8 A;  1HBW A;  2X48 A;  1TWG J;  3ECH A;  2LKP A;  1ZQ3 P;  3M0D C;  1ZRF A;  4IOA F;  1G1I A;  1GK4 A;  1D0X A;  2DA2 A;  1O7F A;  1NVO A;  3FXJ A;  3KLO A;  1WH5 A;  3O6Q A;  2GWR A;  3JAM K;  5DM7 F;  5TJH A;  2V6C A;  3V7S A;  3A0B E;  1WPK A;  3LFU A;  4BJ6 C;  1U8R A;  5H6R A;  1GL2 B;  2VOP A;  2Z99 A;  3II6 A;  3JSV C;  3HJE A;  2I5U A;  4HW0 A;  4E7Z A;  1R5L A;  2VBW A;  4BL0 B;  2QEN A;  3FBN B;  2VQH A;  3KEQ A;  4XLA A;  1A5J A;  1KB9 H;  4IOI H;  3C2H A;  1ZKG A;  1IV8 A;  2BBY A;  1BG6 A;  2WAQ A;  3DLA A;  1MD0 A;  4E6K G;  1OYY A;  4OL9 A;  1L0L D;  1HSJ A;  2HKX A;  2Q2E B;  3BTL A;  4BS9 A;  1YS6 A;  1RRJ A;  2XKM A;  5KAF C;  3OSF A;  4HNU A;  4OIR F;  5J6X A;  3MCZ A;  3D5S C;  4N3Y B;  4NUB A;  3T97 B;  3H1H G;  5TJJ A;  4I76 A;  1OJL A;  3K4J A;  3A2A A;  4EMS A;  2AEM A;  3ZRG A;  2R7R A;  1SVL A;  3F6V A;  4H4K C;  3H1L G;  2G3A A;  2RV8 A;  2HYG D;  3HOV J;  3G1L A;  4IL6 H;  1ON1 A;  1QZZ A;  3WOD F;  3OS0 A;  4XR6 A;  3M07 A;  5M3F J;  1O4X A;  3IWF A;  1O3Q A;  1X2M A;  2CV0 A;  2FU4 A;  2OD5 A;  4W80 A;  3D0S A;  1CW5 A;  3M9H A;  2K9S A;  3MZY A;  4ZYA A;  3GHY A;  4M72 A;  2PLA A;  1TU3 F;  3CUQ C;  2QJK B;  2P0W A;  2DMU A;  2W4S A;  2QUF A;  4QIW N;  2DK5 A;  2RGV A;  3GX4 X;  1KYO D;  4TV7 A;  5B5E C;  5JR3 A;  3PLR A;  5AVQ B;  4KMU X;  5BVZ A;  1PGN A;  3WU2 H;  1VQ6 P;  4DGW B;  3L1P A;  1S4X A;  2BY1 A;  5APX A;  1PP8 F;  1K78 B;  4RGR A;  1QL2 A;  2YXR B;  2GUS A;  4L75 A;  4PJ0 E;  3Q2Y A;  1LFP A;  1JTX A;  1YW7 A;  2K40 A;  5ICF A;  2MC3 A;  3TKY A;  5K5O A;  1HXD A;  3F72 A;  1YJQ A;  3HUS B;  5KAI E;  2IS4 A;  1FZC A;  1RY3 A;  1URQ D;  3E1I A;  1R4N B;  1L0O C;  4B3J A;  3E1R A;  2WT7 A;  3C2B A;  2STT A;  5LHI A;  2DT5 A;  2MFZ A;  3AE6 C;  2IS2 A;  2EFQ A;  3U1D A;  1G3S A;  4YFK F;  2UWM A;  1OYW A;  2M2E A;  3HTS B;  3OOP A;  3LSI A;  1Q90 D;  1Z3X A;  2NPS C;  1VQP P;  1IO4 A;  1Y8Q B;  2VQL A;  1W36 C;  3WFJ A;  2XHK A;  3L9F A;  1S5L E;  2R7Z J;  5FD5 A;  3WTY C;  4HF1 A;  2W6B A;  3E7K A;  3FXK A;  2YKQ A;  4OGQ B;  2X51 A;  1Q1H A;  4BE2 A;  1BCC G;  4M74 A;  1OVU A;  2HQR A;  1F14 A;  3FZV A;  3H1H D;  4LMY A;  1MFT A;  3Q3D A;  2HZT A;  5E8I A;  2DFH A;  4WF2 A;  2L54 A;  4WY4 C;  1HWT C;  2KKO A;  1NHA A;  1IFJ A;  3H1L D;  3FMS A;  2BEQ D;  3CCS I;  2P4Q A;  2KSE A;  4HG2 A;  2KIK A;  2VRS A;  5AW7 B;  5FKK A;  3M8F A;  1LSO A;  2K88 A;  4A69 C;  3RQS A;  4UB6 H;  1WI3 A;  5HS8 A;  2YNY A;  4PDK A;  2CV1 A;  3K2A A;  1CI6 A;  4Y4R A;  4BXX J;  3BG9 A;  1S72 P;  2L5G B;  2YU3 A;  1YYC A;  2UYY A;  3H1K E;  4HOB A;  5A9S A;  3DXJ F;  4KIS A;  1MDM B;  2QSG X;  2B87 B;  3L74 J;  3HPG A;  5HDN A;  2FOW A;  1SLQ A;  2O8X A;  3HRU A;  4XON A;  2CUZ A;  2KZV A;  4A3G J;  3VEP A;  2I9P A;  4FE4 A;  2O5R A;  5GAG J;  4D3D A;  2D3T A;  1JE8 A;  1K61 A;  5EF6 A;  4FCY A;  1Y9B A;  4I7Z B;  2V6E A;  2NS0 A;  2VQG A;  1KOR A;  4F7Z A;  4BWN A;  3H36 A;  3RPU D;  1A04 A;  1JT6 A;  3FBI B;  4G8X A;  2ZME C;  4LIT A;  2XB5 A;  3WTU C;  1ZK8 A;  1BBY A;  4GBJ A;  5E79 C;  2KDO A;  2M5A A;  1ETW A;  4P1W A;  1FOS E;  3GMA A;  2BZT A;  5BPI A;  2BOL A;  1FZF A;  5GAE J;  1LTJ B;  2ZB9 A;  2UXN A;  4LLG F;  5EJC A;  4QLC U;  1RQV A;  2EIJ H;  1QNT A;  5L3C A;  1DDN A;  2ZT9 C;  3S9O A;  2XC7 A;  2K7L A;  1VQK P;  1SFC D;  3CF2 A;  3LA2 A;  1BCC D;  1U5T C;  2M3A A;  1RKT A;  5D6E A;  2V1U A;  1AVY A;  1WJD A;  4D5C A;  4LG0 B;  1DUX C;  1L0L K;  1MMA A;  1R49 A;  1H0M A;  1N86 A;  3SSU A;  1FLI A;  1J7K A;  2Q6Q A;  2GA2 A;  1GDT A;  1BM9 A;  2F5E A;  3P5J A;  4CH7 A;  2QEX I;  1NK3 P;  4OIN F;  3L6D A;  4S3M A;  2IBZ G;  3N7N A;  3P7K A;  3TGU G;  3KLN A;  4XLF A;  2CYY A;  2BE5 F;  2QCO A;  3RKQ A;  3C8V A;  2E42 A;  1P2F A;  2LK2 A;  4ZJZ A;  3JRI A;  1AU7 A;  3R60 A;  4AID A;  4Q47 A;  1HW1 A;  2M7A A;  4CGZ A;  1XC5 A;  4UHT A;  1MND A;  3CCU I;  4DW6 A;  3H0D A;  1J1E B;  3ZMT A;  2YIU B;  4HZF A;  4JYC A;  4IL6 E;  3S3O A;  2FRH A;  3AE8 C;  3I59 A;  2LF7 A;  2JPC A;  5FLX Z;  3ABT A;  2MD0 A;  4EV0 A;  4OMY A;  2IYO A;  3HKZ N;  3DLL F;  2P7J A;  2KQR A;  3L75 G;  4M3L A;  1FJP A;  1WP4 A;  3FDY A;  2ZO4 A;  1H88 A;  3O8G A;  2DI3 A;  1U57 A;  4CDG A;  3EPZ A;  4U0V A;  3P9C A;  1U78 A;  1JY2 O;  3MQ0 A;  2KP8 A;  1T6A A;  1XMK A;  3PSI A;  2YX7 A;  5LRR A;  3ZQQ A;  4LG3 A;  4XL9 A;  5L8R J;  1R9T J;  2A06 E;  1VI0 A;  3LSP A;  2WAE A;  1S6L A;  2EA4 A;  1MW7 A;  4DZP A;  5FRO A;  1SQV J;  3VSL A;  3L35 A;  1YIJ I;  4C3J J;  1JHH A;  3W3C A;  3NMD A;  1DIP A;  3L4F A;  1MJB A;  3T1B A;  1VQM I;  3CCJ I;  5D5X B;  2Q1K A;  1EKE A;  1YJ9 P;  1ZG5 A;  2YU9 J;  5DM6 F;  1YQ4 C;  4V2F A;  3A2K A;  2A68 F;  2W00 A;  3ZMD A;  4ZYH A;  5LHG A;  4C2U A;  1SQQ G;  5CCG C;  5IP6 A;  4DT0 A;  1R5I D;  3K4M A;  1M76 A;  4ZKU A;  3WTX C;  2Y9Y A;  4H0L C;  1R22 A;  1L2P A;  2IBD A;  2KPM A;  5LGU A;  2PLY A;  4HX8 A;  1GVD A;  3D5R C;  4PZJ A;  1SFU A;  1K6O A;  1N73 A;  3CMY A;  1QPM A;  3TGU D;  2WB1 N;  3NQO A;  5H2F C;  1X1D A;  4OQY A;  1HGZ A;  1G59 A;  3CX5 I;  2R7D A;  3CO6 C;  2HOA A;  3E5Q A;  2JA2 A;  4EJO A;  4DBQ A;  2HYN A;  3RPQ A;  3VYS B;  4E7H A;  3B02 A;  3A03 A;  1QEX A;  2QBY A;  4XLN F;  3FXE A;  4XLP F;  1POG A;  3IC7 A;  3L73 G;  2F5C A;  4D6T J;  4OIQ F;  2YX4 A;  5GP9 A;  2L91 A;  3L72 J;  5BU8 B;  2E1M B;  1OMI A;  4UB6 E;  5FLM J;  2DW4 A;  2ZC2 A;  2K27 A;  1LWU C;  1VQ7 P;  1MIJ A;  2OF7 A;  4CYD A;  1H8A A;  2FFD C;  3I64 A;  4PUS A;  4IFF A;  3MTU E;  3S8P A;  2V9K A;  1HA8 A;  1EC5 A;  3DF8 A;  3HB9 A;  1VF5 C;  1W36 D;  3F21 A;  3HHH A;  2RAE A;  4L9N A;  3VP8 A;  3F0C A;  1YW9 A;  2ME0 A;  5KCM A;  1O3R A;  2FYN B;  3FXR A;  2C9N Y;  4PZE A;  3FM5 A;  4D7N A;  1W5C C;  2V1N A;  3ULK A;  2BEO A;  1NAY A;  4K3A A;  4UB8 C;  5DJU B;  1EF4 A;  3QWL A;  2R92 J;  3DQV C;  3ESW B;  3M1C A;  2KDZ A;  4WY4 D;  3K2Z A;  3K4L A;  1OCR H;  1QGP A;  3F23 A;  2K37 A;  3HE4 A;  4QWQ A;  3HOS A;  3RTR A;  2IZ0 A;  1WKM A;  2CQK A;  1KB9 I;  2KNC A;  4B47 A;  1Y1W J;  3BDD A;  1SQQ D;  2AEF A;  3QWO C;  4BRY A;  2X1C A;  4BQO A;  2ZXX A;  1BI3 A;  3KQG A;  9ANT A;  1BI0 A;  2WTB A;  5DEQ A;  3OYG A;  2F5V A;  1VQ5 I;  5F0H A;  1X2N A;  2WZ7 A;  1HKT A;  4XOT A;  3SHF A;  1P4W A;  2IA2 A;  4OWF A;  5LBQ A;  4IF4 A;  3JTG A;  2M45 A;  3K69 A;  5F04 A;  3L74 E;  5M5W J;  5KLI C;  2A61 A;  3HEF A;  3W2V A;  2FYU G;  3OJA B;  1ETK A;  5L3E A;  4RB2 C;  5FFZ A;  1JY3 P;  4OM8 A;  3M9B A;  3K1N A;  4AUX A;  3QH9 A;  3KP6 A;  2JRT A;  1IK9 A;  2YPR A;  4NPF X;  1SFX A;  4R1N A;  1URQ B;  1OZH A;  3H32 A;  1TWF J;  4YTP C;  1LNW A;  2HVR A;  3KP4 A;  3PFY A;  3L73 D;  2CUJ A;  3K0L A;  1E3H A;  3SZT A;  1DH3 A;  4L5I A;  1AKH A;  1L0L J;  4BBR J;  1QBJ A;  2XAF A;  2DMP A;  3BR6 A;  4BU2 A;  1FU1 A;  2N1T A;  1W7P A;  1V5E A;  1M1J C;  2X0L A;  3RK2 C;  2XU6 A;  3G4S P;  4XFJ A;  1WDL A;  3JAM Z;  1OIS A;  3Q3S A;  4G12 A;  3KZZ A;  3WTS C;  1LP1 B;  3SFD C;  1Z6R A;  3O8H A;  4CYC B;  4JOM A;  1FYL A;  1IZ1 A;  3CC2 I;  4CCM A;  1FP1 D;  3F8N A;  1R1T A;  4OMZ A;  1QX8 A;  3CCR I;  2Z9O A;  3EQL F;  1BC7 C;  2P6T A;  5F0C A;  1IZN B;  1OVR A;  4F55 A;  1VPD A;  5FRM A;  2V7Q J;  1NK2 P;  3WG7 H;  3ASO H;  3GLL A;  2FXO A;  2P67 A;  3CWB G;  2JT1 A;  5AW3 B;  4ESJ A;  3QAH A;  2GAU A;  1IFP A;  3AEF C;  3Q5R A;  1VQ5 P;  3A4C A;  2VE8 A;  4WXD A;  2ICW G;  1XPX A;  2KIS A;  1W2B O;  2EFN A;  3VSK A;  3VYT B;  4HQE A;  1LSJ A;  1HDP A;  3L7W A;  1NU1 K;  1XTC C;  2YXQ B;  1EXJ A;  3JCU C;  1DGW Y;  4W7Y A;  3TL4 X;  3L09 A;  2JTV A;  2XZR A;  4X1E A;  2V9P A;  1TQP A;  3BR0 A;  4GYI A;  1M56 D;  2FYU D;  2FOK A;  2ZAE B;  3CCL P;  4D3F A;  1FJK A;  3CCM P;  1HJB A;  2FQ4 A;  5JLX A;  2GOX B;  3CJN A;  2FY8 A;  1TLH B;  4NC6 A;  4GFB A;  1MZ9 A;  1G3W A;  2EV6 A;  1S9H A;  2F4O B;  3P32 A;  3CMM A;  2LG4 A;  4U3F J;  1S9K D;  3VMZ A;  2CQQ A;  2E2J J;  1P7I A;  5E1X A;  4E7I A;  2YO2 A;  3VN0 A;  3PFI A;  5CPR B;  3CJQ B;  1OW8 A;  1LVA A;  2Z16 A;  1XSD A;  2G0E A;  3KP3 A;  1SAX A;  1YRN B;  1SQV E;  2AXC A;  3TED A;  4JP0 A;  2ZFW A;  2IS6 A;  3KP2 A;  2MA3 A;  1M2W A;  1AFO A;  3DKY A;  1SVM A;  1J5Y A;  3WHB A;  3ZW9 A;  2XF5 A;  1JJ8 C;  3RDI A;  1KYO H;  2W82 A;  2Z2S B;  3EFG A;  1FOK A;  3ZQ7 A;  2QJY B;  3WUV A;  1ZLK A;  4EOT A;  4IOC F;  2E5Z A;  3TP0 A;  2EIL H;  1Y6I A;  4B48 A;  1LT9 C;  1SFC B;  2ZFC A;  3H1H J;  3MUD C;  5CCG D;  3SDB A;  1UB9 A;  1B1B A;  1A6Q A;  3AG2 H;  3AE1 C;  4H0L D;  2KUB A;  4HEA 2;  4N4O B;  4I99 C;  1AV1 A;  3NTN A;  3PQK A;  5CCH C;  3CXH E;  5HNF A;  3CZ6 A;  1N7L A;  3W6U A;  3RGU A;  2A05 A;  4CCJ A;  3V2N A;  2Y0M A;  2L9S A;  2OYI A;  2HZD A;  2LR2 A;  3CWB D;  4U7D A;  4ON0 A;  2MW8 A;  4LFU A;  2QZ8 A;  2NNY A;  5GTH H;  2LRD A;  1EDL A;  2V79 A;  2XV5 A;  3CDH A;  2KYV A;  2Z5I A;  1R6R A;  2O3J A;  2GM4 A;  1WZ2 A;  4N9H A;  2XUB A;  1LNQ A;  1BE3 G;  2NRG A;  3I55 I;  4D6T E;  2KK7 A;  1DEE G;  1SP4 A;  3K4C A;  1EQ7 A;  2KS1 B;  5D8L B;  4J19 A;  3L72 E;  2G7H A;  2BHZ A;  2DXI A;  1RE3 A;  5C3E J;  1SQQ K;  5B66 C;  2R7U A;  3Q3C A;  1Y39 A;  1M57 D;  2KXP B;  4I6M C;  2LF8 A;  5A9R A;  5TGT A;  1MNM C;  4NC7 A;  2GF2 A;  1H0T B;  1T56 A;  3T0Y A;  1RZ4 A;  4P5O A;  2NVU B;  5JE8 A;  2NVY J;  2JWA A;  2X85 A;  3SEQ A;  1QU3 A;  2NVT J;  4RJT A;  3SFI A;  4AYB N;  3ZR8 X;  1OPC A;  3PJR A;  1WFX A;  2KMU A;  3ZPL A;  3MHV A;  2XPW A;  3TO9 A;  3HSR A;  1K79 A;  3GTK J;  2SPZ A;  3BAS A;  3ZWA A;  1KV4 A;  1JCC A;  3RL0 g;  1UFM A;  2JJ7 A;  2HPM A;  5KJ7 C;  1WVR A;  4OU0 A;  2P1J A;  3FXM A;  4C7N A;  1MUU A;  4BXL A;  3F3X A;  3M8J A;  3K96 A;  5K1Y A;  1F1Z A;  1OWA A;  5FGM A;  4EVI A;  4UV8 A;  3AL0 C;  1KIL D;  2CVZ A;  1BR1 A;  4UVC A;  2OUM A;  3SWY A;  2L02 A;  3GFL A;  2O9L A;  3BZK A;  2PG4 A;  2Q8K A;  4KUE A;  2EBI A;  2KRC A;  2WA0 A;  2G7U A;  2K9N A;  1S5L X;  3BR3 A;  2BCC G;  3CUQ B;  2VL8 A;  1P6R A;  4WXH A;  2AS5 F;  2XRN A;  4F93 B;  3ZW8 A;  3CCV P;  4E21 A;  3SQN A;  4UNO A;  1IL0 A;  3TYY A;  4AUW A;  3DKW A;  3VFZ A;  5HLT A;  4D7M A;  1G2C A;  1SD4 A;  3MD2 A;  1P4A A;  1YG2 A;  4RAF A;  3BPX A;  5JHF A;  3MAJ A;  1N2D C;  3CTA A;  5IT9 K;  1AA0 A;  2ACJ A;  3HUG A;  1TNS A;  1I27 A;  1XGS A;  3Q5F A;  3B8E B;  3V8L A;  4H44 D;  2Q7C A;  3QPS A;  2LBF A;  5K5G B;  4AYC A;  4U88 A;  3TDU C;  3FXL A;  4KIT B;  4IO9 F;  5CMZ A;  2NAZ A;  1BE3 D;  2HPC B;  3OYC A;  5TRD A;  3UIA A;  4XRS G;  2GLO A;  1TZL A;  1L0L E;  3CLQ A;  5ED4 A;  4IHS A;  2EH3 A;  1YS7 A;  2V4J C;  2V1X A;  2OA4 A;  5DD8 A;  2JUG A;  4B3X A;  2NPS B;  2COB A;  3RZO J;  3M9Q A;  3E0J B;  3CCY A;  2ID6 A;  3FXQ A;  3I4P A;  3LQQ A;  2DMQ A;  2FKW B;  5AVR B;  3RK2 D;  4ZYG A;  1JB0 J;  1JO5 A;  2DFF A;  4D3S A;  3BCC J;  4JYB A;  1ETX A;  2FYU K;  3SFZ A;  3IKT A;  1SQP J;  2D2C C;  3GVA A;  1JTH A;  4KT6 A;  5LLQ A;  5B1A H;  2JDI H;  2KRF A;  2D45 A;  3A0H C;  1ZRD A;  3ECO A;  4PD4 I;  4WY4 B;  1VQ4 I;  1QA6 A;  4DZO A;  2ZSH B;  3DPT A;  3F8F A;  2HTJ A;  1R1V A;  2E2H J;  1JCD A;  3FIW A;  5BOX A;  1NG7 A;  3PNY A;  2B63 J;  5AON A;  1STZ A;  3BG7 A;  3C7A A;  1GL2 A;  1PPJ E;  4CUG A;  3VOD A;  3S1M J;  3I5C A;  1KU9 A;  2HVQ A;  5H6Q A;  2E1M C;  4I1L A;  1R5S A;  1SQB G;  3GLM A;  5KAF H;  2BCC D;  2XRO A;  1A02 J;  1Z7L A;  2DQR A;  2WSC J;  2QA4 P;  3CD6 P;  2H7H A;  1R58 A;  2Q2E A;  1ETY A;  1X3U A;  1X1A A;  5IOZ A;  3RK3 C;  2JK3 A;  3EET A;  2IGM A;  4GCV A;  5KHD A;  3V8K A;  4A3K J;  4G6D A;  1VQO I;  3CL3 D;  3OYD A;  3S4R A;  3D6Z A;  1LB2 A;  3T97 A;  5FRN A;  4A0Y A;  3ZWC A;  3E1S A;  2NOG A;  4U3F E;  1I5Z A;  3K4B A;  1FZC C;  4CSW A;  2FSW A;  4WX9 A;  2R5Y B;  4UUT A;  2P5K A;  4RAZ A;  5L3B A;  1PJR A;  2EZK A;  3L75 J;  4KMF A;  3GW2 A;  2ZME B;  5GTH E;  1HQC A;  4QPQ A;  4U0Y A;  3OYF A;  3E6D A;  1AWC A;  3IAO A;  2I1J A;  2HOE A;  1YO5 C;  1MMS A;  1KQ0 A;  5B5E H;  2EA2 A;  2WSC H;  3G1O A;  4AIJ A;  2QWW A;  2ZT9 B;  1BGY G;  2HFE D;  2K5C A;  4H0E A;  2H8R A;  3H1H E;  5AW0 B;  4XQF A;  1HTL C;  2IPQ X;  4MQV A;  1IN7 A;  4MTE A;  1U5T B;  4N6J A;  5AVS B;  2ELK A;  4ZKP A;  2L5Q A;  2L9N A;  1I6H J;  1KQG B;  1IUF A;  3R0J A;  2M9H A;  3KEO A;  1GD2 E;  1SAU A;  5F64 A;  4KA4 A;  5CCH D;  4GOE A;  4EM0 B;  5E8G A;  1QHH D;  2Y31 A;  3Q9V A;  1SQQ J;  2XRL A;  3P8M C;  1JOC A;  1NJI Q;  1OR7 C;  2OV7 A;  2ZSI B;  2CK3 H;  4LK1 F;  2A45 G;  1GXP A;  3GTG J;  3HHG A;  1Y56 A;  3G1M A;  2GXB A;  2GZW A;  1SQB D;  1JY2 P;  5F6F A;  2M4G A; 
#chains in the Genus database with same CATH homology
 4A3E J;  3SJM A;  3ZGY A;  4B3J A;  3C2B A;  1IC8 A;  1LFB A;  1ZTR A;  2DA3 A;  4E13 A;  2M2E A;  5F1J A;  1KS9 A;  3CDL A;  5F27 A;  4XRM A;  4PZC A;  2FJ1 A;  2ZYA A;  3I83 A;  3WFJ A;  4X6A J;  1JGG A;  2R7Z J;  5K7Z A;  3OIO A;  1F14 A;  2K9Q A;  2O7O A;  3S1Q J;  2HXO A;  5EEA A;  1A6I A;  3C7C B;  3ZQF A;  2P4Q A;  3ADO A;  5FKK A;  1LSO A;  3BR5 A;  4MFE A;  4A69 C;  4XID A;  1Q1V A;  3VPR A;  4UUS A;  1WI3 A;  1APL C;  5DS9 A;  5FKL A;  4A3L J;  3IQD B;  3QQA A;  3WS7 A;  2E19 A;  3FK6 A;  3K2A A;  4BXX J;  3BG9 A;  4B3A A;  1YRL A;  3PO3 J;  3JRB A;  2R0Q C;  2PMZ N;  2UYY A;  5A9S A;  2IEK A;  1ITY A;  1MBK A;  2M34 A;  5C44 J;  3HDH A;  1JKP C;  1WDK A;  2Y0S N;  2W8Z A;  2HQ5 A;  5C4X J;  1P7J A;  5EZG A;  3BG5 A;  4DZJ A;  3HOZ J;  2I9P A;  4A3G J;  3Q0U A;  1TWC J;  3FIS A;  1Y1V J;  2QF7 A;  4FE4 A;  1MBE A;  4D3D A;  3D1N I;  2D3T A;  1F36 A;  3TW6 A;  2Y9Z A;  5EF6 A;  4FCY A;  1K61 A;  1MBH A;  4FIS A;  4IHY A;  3HAD A;  3G0O A;  1JT6 A;  2XB5 A;  1ZK8 A;  4GBJ A;  2D5V A;  2EQR A;  1H88 C;  1ETW A;  1ZGW A;  2JA6 J;  2MG4 A;  1PGQ A;  2ZB9 A;  3IH4 A;  2HOT A;  3M4O J;  2L9R A;  1HCR A;  2KT0 A;  3MN2 A;  1WGX A;  1RPW A;  3HM5 A;  4MLO A;  1JUP A;  1QMG A;  2DA5 A;  3ZQL A;  5FLV A;  1M66 A;  1RKT A;  1ZR2 A;  3DOJ A;  2HYJ A;  4W97 A;  3RQI A;  4D5C A;  5HWS A;  5IYB J;  3JRE A;  4RDU A;  5EG0 B;  1GDT A;  1NK3 P;  3S16 J;  3L6D A;  4S3M A;  3S17 J;  1Z77 A;  3JR9 A;  1S7E A;  2XSD C;  1XS9 A;  4M3G A;  2DTZ A;  1AHD P;  2QCO A;  3RKQ A;  1AU7 A;  2LK2 A;  1U9N A;  3JRI A;  1DLI A;  1XC5 A;  1IDY A;  4GWG A;  4DW6 A;  1H89 C;  1DLJ A;  3HOU J;  1E3O C;  3ZQG A;  2IYO A;  3HKZ N;  1YVE I;  2ECC A;  1WP4 A;  1K83 J;  3O8G A;  1BL0 A;  1ENH A;  1ETV A;  1I3Q J;  3MVP A;  1U78 A;  2XGE A;  2JN6 A;  2XGD A;  2ME6 A;  3K6J A;  1MSE C;  2LKX A;  3GTM J;  1BJZ A;  2FD5 A;  1R9T J;  2LVS A;  1VI0 A;  3MKL A;  1BW5 A;  3LSP A;  2WV1 A;  3JRG A;  4DZP A;  3HOY J;  3H2Z A;  5E3N A;  1PGJ A;  4C3J J;  1H8A C;  5FJ8 J;  1M67 A;  2JA8 J;  5K7H A;  2MSY A;  3CKY A;  2DMT A;  2VKE A;  2YU9 J;  5EGO A;  2I10 A;  4V2F A;  3H0G J;  2R93 J;  2HXI A;  2W48 A;  3FK7 A;  5IP6 A;  1I36 A;  1M76 A;  3FWN A;  1N1G A;  2Y9Y A;  4M3B A;  2XGC A;  2CRG A;  3A01 A;  3GTP J;  2X9D A;  2IBD A;  4A3I J;  2O8K A;  1GVD A;  1FTT A;  1MBJ A;  1VF9 A;  2E1O A;  2HI3 A;  2VI6 A;  2N8G A;  3CMY A;  3GTQ J;  2WB1 N;  5J1Y A;  1HDD C;  4OQY A;  1G2H A;  4PZD A;  3RQS A;  2YUS A;  1MBF A;  2HOA A;  3S2D J;  1JUM A;  1WPQ A;  1BA5 A;  2EZI A;  3GTO J;  3A03 A;  4W1U A;  2VPR A;  3ZQC A;  1POG A;  4XIC A;  4V2G A;  5M3M J;  1TC3 C;  1UMQ A;  5GP9 A;  3HBL A;  1JKO C;  5FLM J;  2ZYD A;  4J0F A;  3BTJ A;  3UKG A;  2OF7 A;  1DU0 A;  5F08 A;  2LTP A;  5EZH A;  1ORK A;  5E3L A;  3GBG A;  4XRS A;  3S15 J;  4KUH A;  3HB9 A;  1IG7 A;  1IRZ A;  4GWK A;  3PID A;  1NTC A;  1MH3 A;  2RAE A;  2DA4 A;  3F0C A;  2ME0 A;  4FTH A;  1F43 A;  3OOU A;  4DLL A;  4PZE A;  4DYQ A;  4D7N A;  2X6O A;  3ULK A;  4BKX A;  1MH4 A;  1EF4 A;  4HNV A;  3CTV A;  1FIA A;  2R92 J;  2KDZ A;  3JRD A;  2LLK A;  1N1E A;  1RKW A;  1I50 J;  1W0U A;  1DU6 A;  2IZ0 A;  1UG2 A;  1Y1W J;  3LSR A;  2M0C A;  3B6C A;  9ANT A;  2WTB A;  4C2M J;  4BY7 J;  5F0H A;  1X2N A;  2XB0 X;  1QVU A;  2Y2Z A;  3BQY A;  1F0Y A;  2LR8 A;  3BQZ A;  5F04 A;  5M5W J;  1EVY A;  1JKR C;  3HEF A;  5E3M A;  1ETK A;  2CU7 A;  4J0E A;  2LP0 A;  3ZHB A;  5IP9 J;  4IHV A;  3S14 J;  2DMN A;  4OM8 A;  4EEF G;  4AUX A;  1ETO A;  1GV2 A;  5FKO A;  3B6A A;  1HLV A;  4R1N A;  1OCP A;  3HWR A;  4B3H A;  1TWF J;  2ZYG A;  4IEJ A;  4D5F A;  1HF0 A;  3ZQH A;  5GPC A;  2TCT A;  2R5Z B;  1YJ8 A;  1AKH A;  2WAQ N;  4BBR J;  2FX0 A;  3I4M J;  1W0T A;  3BR6 A;  2DMP A;  3OSG A;  5EG0 A;  2L7M P;  1HOM A;  4NDL A;  2CQX A;  3LOC A;  2EZH A;  3BR1 A;  2DJN A;  1WDL A;  3MOG A;  3Q3S A;  4G12 A;  3JRC A;  2EW2 A;  1AKH B;  4IHW A;  4ABZ A;  2DA7 A;  3O8H A;  4CYC B;  1IV6 A;  4YCA A;  3DCF A;  2LY9 A;  4JX6 A;  4L5E A;  1ZR4 A;  5JLW A;  2MGQ A;  5F0C A;  2HDD A;  2HOS A;  5HOD A;  1VPD A;  3IV5 A;  1NK2 P;  2AHQ A;  4RBO A;  5EDN A;  1JDJ A;  2CUF A;  5FWN A;  2JKV A;  3DFU A;  1U8B A;  5F0F A;  3S1N J;  3WFI A;  1LSJ A;  1HDP A;  4KUG A;  4MO7 A;  4A3D J;  3ZOB A;  4B1R A;  5IP7 J;  3HOX J;  4X1E A;  3BR0 A;  1FJL A;  4IHX A;  4Y7N J;  1JKQ C;  1VFC A;  4D3F A;  2W90 A;  2L0K A;  2JWT A;  2FQ4 A;  5JLX A;  4QTR A;  5A9T A;  2IZ1 A;  4GFB A;  1M75 A;  1YRN A;  1TWA J;  2DA1 A;  5GPA A;  5J1R A;  5J1U A;  2CQQ A;  3K7A J;  1P7I A;  3CQZ J;  2E2J J;  3M3Y J;  4Y52 J;  3PEF A;  1QPI A;  3Q0W A;  2CUE A;  3Q0V A;  1B8I B;  1QRY A;  2G0E A;  4LOC A;  1YRN B;  3TED A;  4JP0 A;  1SFO J;  3ZWB A;  1M2W A;  3WHB A;  3ZW9 A;  1Z0X A;  1JJ8 C;  4OQZ A;  1RR7 A;  1OFC X;  3E7L A;  4B3I A;  4IM7 A;  1TWH J;  3W6V A;  3TP0 A;  1GT0 C;  3JRF A;  3S2H J;  4M6V A;  2LFB A;  5DTD A;  1D5Y A;  5BNG A;  1YB4 A;  2ID3 A;  1YON A;  3IH2 A;  4JX4 A;  1LJ8 A;  2X58 A;  3W6U A;  1FEX A;  1TXG A;  3NAU A;  1U9O A;  2MW8 A;  3BR2 A;  4M3E A;  1ETQ A;  5C4J J;  2XPU A;  1IGN A;  3QSG A;  3HGY A;  2JMW A;  2GM4 A;  3FR7 A;  1BW6 A;  3F3S A;  3TW7 A;  4J19 A;  1LE8 B;  2NVX J;  1RES A;  4JYK A;  5C3E J;  4E12 A;  1WCM J;  4QSH A;  4BY1 J;  1X0X A;  3BTC A;  3HGG A;  2P81 A;  2PGD A;  3Q3C A;  5A9R A;  1PGO A;  1MNM C;  2GF2 A;  1T56 A;  4AC0 A;  2NS8 A;  5JE8 A;  2NVY J;  2JA5 J;  1X58 A;  2OPT A;  4C3I J;  2NVT J;  1B72 A;  3SFI A;  4AYB N;  2XPW A;  3GTK J;  3QPL A;  3ZWA A;  2JJ7 A;  4DYC A;  4A3B J;  4XK4 A;  1B72 B;  5EYR A;  5M5Y J;  1X0V A;  3K96 A;  3DEW A;  4A3J J;  4A3C J;  1FIP A;  2CVZ A;  2AO9 A;  2IYP A;  2O9L A;  5J3L A;  3HOW J;  4KUE A;  2EBI A;  1CQT A;  2K9N A;  3WHC A;  5M5X J;  3BR3 A;  2NVQ J;  3LNQ A;  3FR8 A;  3FKI J;  1F17 A;  4DCK A;  2M8G X;  3ZW8 A;  3PDU A;  4E21 A;  1IL0 A;  2TRT A;  3LSJ A;  4B4C A;  4D7M A;  2R5Z A;  3BT9 A;  1MBG A;  3HN2 A;  1RET A;  2DN0 A;  4MIM A;  4UUS B;  4JQ0 D;  3G17 A;  3PJG A;  1MSF C;  1GUU A;  3C7D B;  1GV5 A;  3QPS A;  4A93 J;  3JRH A;  5A9S B;  4CYC A;  4XRS G;  2GLO A;  3IH3 A;  1OCT C;  2EH3 A;  5FKN A;  3HDD A;  4A3M J;  2HDH A;  2COB A;  3RZO J;  5AYV A;  3CCY A;  2ID6 A;  3EGO A;  1WDM A;  2DMQ A;  4DYD A;  1QVT A;  4D3S A;  2Y30 A;  1ETX A;  4FE7 A;  3LSG A;  1PGP A;  3BG3 A;  5IOY A;  2L7Z A;  1FTZ A;  4DYR A;  4M3D A;  1XG1 A;  2CJJ A;  1JTY A;  5IYC J;  4OVN F;  2NS7 A;  5IYD J;  2JA7 J;  2E2H J;  5MGB A;  2X48 A;  1TWG J;  1PUF A;  3FIW A;  2VUM J;  1ZQ3 P;  5IPA A;  3GTL J;  2H1K A;  4MFD A;  3PO2 J;  2EZL A;  2B63 J;  3C7A A;  2DA2 A;  1JJ6 C;  2L7F P;  1IJW C;  1WH5 A;  2YS9 A;  3S1M J;  1SAN A;  1WPK A;  1PUF B;  3PM1 A;  3I4N J;  1WH7 A;  4BBS J;  1B8I A;  1ETY A;  5IOZ A;  4A3F J;  3ADP A;  2JK3 A;  1A5J A;  1Z82 A;  2R5Y A;  1BG6 A;  1ZKG A;  4A3K J;  3GTJ J;  1UHS A;  4OL9 A;  3BTL A;  3ZWC A;  2NOG A;  3OSF A;  4JX5 A;  2R5Y B;  4UUT A;  2EZK A;  2ECB A;  5E3O A;  4I76 A;  1ZCJ A;  1OJL A;  5K7F A;  3A02 A;  3ZQI A;  2VKV A;  2E2I J;  1LFU P;  3QHA A;  2GBY A;  1JT0 A;  4I6Z A;  3HOV J;  3G1L A;  3G1O A;  2QYT A;  1O4X A;  3TP3 A;  3H3V K;  5M3F J;  2H8R A;  1IDZ A;  1X2M A;  1VND A;  1EVZ A;  3BTI A;  5FKM A;  2ELK A;  2K9S A;  3GHY A;  1I6H J;  2PLA A;  1IUF A;  2M9H A;  4M3F A;  1T33 A;  2DMU A;  4EZB A;  4QIW N;  1JUS A;  3RZD J;  1F12 A;  1LE8 A;  3PLR A;  4S0H B;  2DA6 A;  2Y31 A;  1PGN A;  2XRL A;  3S1R J;  3L1P A;  5EGO B;  3W6Z A;  3NAR A;  2XPV A;  2K40 A;  1JTX A;  2OFP A;  3OBB A;  4FGW A;  3GTG J;  2IAI A;  4JPZ B;  1YJQ A;  3G1M A;  3SDG A;  3A01 B;  4C3H J;  3JRA A;  2LD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...