1OFCX

Nucleosome recognition module of iswi atpase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
266
Chain Sequence
AVDAYFREALKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERENIELEEKERAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ISWI PROTEIN
publication title Crystal Structure and Functional Analysis of a Nucleosome Recognition Module of the Remodeling Factor Iswi
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
total genus 103
structure length 266
sequence length 281
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09110 HAND HAND
X PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1ofcX01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 1ofcX03
2VKVA 1OJLA 1A6IA 3TP0A 1Q1VA 1APLC 4HNVA 2L7MP 1W0UA 4A3LJ 3LSGA 4BXXJ 3SJMA 1D5YA 2LFBA 3NAUA 3Q0VA 4JX6A 2YUSA 3SFIA 5GPCA 1IC8A 2XPUA 2DMQA 2CUEA 1MH3A 1K83J 2G0EA 2JMWA 2B63J 4V2GA 4X6AJ 3D1NI 1RR7A 4A69C 1T33A 2Y9ZA 4MLOA 1HOMA 1Z0XA 1I6HJ 5F04A 3BG5A 3DEWA 1I50J 4XIDA 3JREA 1GUUA 5C4XJ 4M3EA 1JTYA 2DMUA 1QRYA 2JA5J 3GTQJ 3JRGA 1ETOA 2X9DA 3RZOJ 1A5JA 5C3EJ 1BW6A 2ZB9A 5FKOA 3RQIA 1FJLA 1WI3A 2L7FP 1K61A 2L7ZA 2O7OA 2QF7A 1ZGWA 2P81A 5IYBJ 1VF9A 1IV6A 1YRNA 2JA6J 1OCPA 3IH4A 4RDUA 3G1MA 2E2JJ 4FISA 3S14J 3K2AA 1XS9A 2XGEA 3HGGA 5IYDJ 3M3YJ 4BY1J 5EG0A 4DYRA 3JRDA 1Z77A 5IPAA 4FTHA 2O9LA 2Y0SN 1WPKA 2HI3A 1GT0C 3BQZA 4S0HB 2FJ1A 3G1LA 3BR5A 5IP7J 4M3BA 1FTTA 4UUSB 2LVSA 2DA3A 1P7JA 4CYCB 1AKHB 5EYRA 2DA2A 1IG7A 4D5CA 4QSHA 1HDPA 4DZJA 1IRZA 3GTGJ 1MBFA 4C3HJ 2K9QA 3BQYA 1I3QJ 3HOWJ 3LSRA 1SFOJ 4JX5A 1RPWA 4XK4A 2XGDA 3HOVJ 2VKEA 2JJ7A 3SDGA 2CRGA 2M0CA 3JRIA 1OCTC 1H8AC 3MN2A 1U78A 3RKQA 2E1OA 2GBYA 3OOUA 2WAQN 2NVYJ 3BG3A 4BY7J 3K7AJ 2MGQA 1WH5A 5EGOA 2NOGA 1LE8B 2CUFA 1ORKA 1QPIA 4B3AA 3CCYA 3GTKJ 1RETA 2TRTA 5JLXA 2EZIA 1ETXA 2LKXA 2MG4A 2M34A 2I10A 5J1YA 2LK2A 5FLVA 3ZOBA 3BTLA 1MBGA 3O8HA 2KDZA 5E3NA 1NK3P 5FLMJ 3FKIJ 1TC3C 1XG1A 2YS9A 2ELKA 3FISA 3OSGA 4IHVA 1JKQC 1DU6A 3TEDA 1IDYA 2HDDA 3MKLA 1JKOC 4XRSG 3OSFA 2HOSA 2ID3A 5EZGA 3IV5A 2XPVA 1LFBA 2XB5A 5M5XJ 4A3DJ 2IAIA 2LY9A 1JUPA 4QIWN 1R9TJ 1AHDP 3JRFA 1RKWA 1Y1WJ 2ECCA 4W1UA 5M3FJ 4M6VA 2DJNA 5DS9A 1UG2A 4I76A 4M3DA 3A03A 3PO2J 4A3MJ 1ZR4A 3S2HJ 3S1QJ 4D5FA 3M4OJ 1FTZA 3BR1A 3QQAA 4AUXA 1JJ8C 4IHXA 4A3BJ 4FE4A 2OF7A 1BA5A 3QPLA 3GTMJ 5FKNA 4A3CJ 3ZQHA 2IEKA 1ETVA 3IH2A 2E2IJ 3S2DJ 2ME0A 2H1KA 3DCFA 5M5WJ 5J1UA 3NARA 2LTPA 3JRHA 3E7LA 2DN0A 4G12A 4IEJA 9ANTA 1B8IA 5F0HA 4C3IJ 4C3JJ 1F43A 1HCRA 4BKXA 2R5ZA 3HM5A 3VPRA 1O4XA 3HDDA 3BR6A 1XC5A 3HOXJ 4D7NA 2EZLA 3Q0UA 1BJZA 5J3LA 3HB9A 5EF6A 2XRLA 3CQZJ 5GPAA 1F36A 1IGNA 4MFEA 3HEFA 2EBIA 1MBKA 2M8GX 2NVXJ 4A3EJ 4QTRA 1NK2P 2HOTA 2DTZA 1JT0A 1JJ6C 3A01B 3WHBA 3PM1A 3GTOJ 3JRAA 2HYJA 1ZK8A 1JGGA 2DMTA 1E3OC 1WCMJ 4AYBN 3H3VK 3JRBA 1W0TA 2WV1A 2DA7A 1H89C 3BTIA 5IOYA 1U9OA 3UKGA 2VPRA 3MVPA 2AO9A 5E3LA 4A93J 1VI0A 2LLKA 5F08A 4JQ0D 2Y31A 2JN6A 5HODA 5BNGA 4AC0A 5GP9A 2EZKA 2Y9YA 3TW7A 2R0QC 3LSJA 2NS7A 3C2BA 4J19A 1BL0A 1TWGJ 5EEAA 1UHSA 1MSFC 2R7ZJ 1POGA 3ZQLA 1GVDA 4DCKA 1ETQA 4OVNF 1MNMC 1WH7A 3A02A 4MFDA 4JX4A 1LFUP 2FX0A 5F1JA 1IUFA 1P7IA 2DMNA 2DA1A 3BTJA 1X2NA 4D7MA 2EQRA 3CDLA 4L5EA 3H0GJ 4B4CA 4FCYA 4Y7NJ 3BG9A 2R92J 2PMZN 2D5VA 1G2HA 1ITYA 3L1PA 3ZQGA 3BTCA 1NTCA 1VFCA 1RKTA 2XGCA 4UUSA 2M9HA 5FKLA 2LD5A 4CYCA 1AKHA 2Y30A 1BW5A 3HOZJ 4C2MJ 1YRNB 2JA7J 1U8BA 1JKRC 3S17J 4JPZB 1JUMA 3JRCA 1FIAA 2R93J 2L9RA 3A01A 5K7HA 1JTXA 3BR0A 5EG0B 5IP9J 2R5YB 2K9SA 3HOYJ 2W48A 3S1NJ 3IH3A 3I4NJ 4XICA 1WGXA 1TWHJ 2CQQA 2RAEA 3LNQA 2KT0A 1MBJA 2MSYA 1QVTA 1X2MA 2CU7A 5FKMA 1ETKA 1AU7A 4X1EA 2VUMJ 2DA4A 1LE8A 2NVQJ 2HQ5A 3HGYA 1FIPA 2DA6A 1UMQA 1X58A 4UUTA 4A3GJ 5JLWA 2K9NA 1EF4A 4B1RA 4EEFG 1ETWA 2E2HJ 4JP0A 3HKZN 2HOAA 2NS8A 3HBLA 5IYCJ 2HXOA 1TWAJ 1HLVA 1T56A 2JWTA 5E3OA 1B72B 3B6CA 1PUFB 2O8KA 5EGOB 1JUSA 2COBA 4NDLA 2CJJA 5EDNA 2FQ4A 2JK3A 4XRSA 1QVUA 4BBSJ 2X48A 2ECBA 5E3MA 4IHYA 1MH4A 5IOZA 3WHCA 3CMYA 1GV2A 4JYKA 4V2FA 5M3MJ 5C44J 2Y2ZA 3BR2A 4FE7A 1TWFJ 4DW6A 4Y52J 5DTDA 2XSDC 2DMPA 2LP0A 3BR3A 1GV5A 4GFBA 3ZQFA 2CQXA 2R5YA 2K40A 5F0CA 5FJ8J 1MSEC 2EH3A 2VI6A 3B6AA 4M3FA 2GLOA 3LOCA 5K7FA 2XB0X 3FIWA 2M2EA 4A3FJ 3HOUJ 1ZKGA 4A3IJ 3LSPA 1MBEA 1OFCX 2OPTA 1H88C 2MW8A 3G1OA 4DYQA 1RESA 3S1MJ 5F27A 2FD5A 1ZR2A 3GBGA 1FEXA 4DZPA 4IHWA 1SANA 4ABZA 3W6VA 3GTJJ 4A3JJ 4LOCA 1TWCJ 4DYCA 1ZTRA 3Q3SA 2QCOA 4MO7A 4W97A 3TW6A 2L0KA 3Q0WA 5M5YJ 2ID6A 4XRMA 2YU9J 2E19A 1MBHA 2GM4A 2TCTA 1HF0A 3S16J 3GTLJ 1B72A 1S7EA 1PUFA 3QPSA 1VNDA 3S15J 1IDZA 3PO3J 3FK7A 5IP6A 2ME6A 3O8GA 3BT9A 3FK6A 5FKKA 1ZQ3P 4M3GA 4A3KJ 5J1RA 1ETYA 3JR9A 3ZQCA 2NVTJ 5F0FA 1ENHA 2LR8A 5K7ZA 2DA5A 2XPWA 2IBDA 2H8RA 1U9NA 1HDDC 1JKPC 4MIMA 2WB1N 4BBRJ 1IJWC 3I4MJ 1DU0A 1B8IB 3S1RJ 2AHQA 1CQTA 1GDTA 3F0CA 3GTPJ 2R5ZB 3RZDJ 2JA8J 3OIOA 3TP3A 2HXIA 1Y1VJ 5C4JJ 1JT6A 5EZHA 4I6ZA 3ZQIA 2EZHA 2N8GA 4RBOA 2X6OA
chains in the Genus database with same CATH superfamily
1KYWA 5CCGC 3N4MA 3HC7A 4ANJA 3OIQA 3K1NA 1Q1VA 1MFTA 1FZBA 2L7MP 2M87A 1NTMK 4A3LJ 5C39A 3HSRA 2A06E 2EIKH 2ZJSE 3CMMA 1OIPA 2R32A 4C30A 3NAUA 1JGSA 2AXTE 2YUSA 5H2FC 4EJTA 3KP7A 2RREA 5HLIA 4EJUA 4HNUA 3CF5F 1MW7A 3L74D 1MH3A 2G0EA 1NTKE 3GHGC 4V2GA 4X6AJ 2JUGA 3V2PA 1A31A 1KFNA 4A69C 1DP3A 2ITAA 4KUGA 1DD3A 1O7LA 3ZP5A 4PV1D 2F4OB 2PQ8A 1Z0XA 3BOQA 5ERIA 1EZVD 2R44A 4RB0A 2D2CD 4WWIA 1QZEA 4V19K 1Z21A 5LRSA 3DEWA 3VFZA 1O3RA 2IBZE 2E36A 1QGPA 3DTEA 1EDJA 4WXCA 3FMSA 4M3EA 5C4XJ 1JTYA 5DCMA 4WF2A 3F8BA 2JA5J 2QA4I 2P4QA 5L3DA 2V9VA 4D1QA 4KA4A 1FWZA 3GTQJ 1UELB 2X9DA 2JO1A 3CJQB 3PUFA 1A5JA 3BZKA 4FGWA 3N97A 4R1HA 2ICWG 1FJLA 2EK5A 1K61A 2L7ZA 3KEQA 1H88A 1OVUA 2O7OA 1SVMA 2OUMA 1ZGWA 2OYHA 1Z67A 4L5JA 2P81A 5AVZB 1IV6A 4YELA 1U57A 1BI2A 3AL0C 3L72E 3K1MA 3WTSC 3G1MA 3V4QA 3H1HD 3I64A 3ZPLA 3C7AA 3K2AA 4PJNA 2H88C 5IYDJ 5CJ0A 2ZC2A 4U0WA 3FWLA 5B5EC 4RS8A 4H44B 5KKZC 1LEAA 5TISH 2DT6A 5IPAA 4FTHA 2LR2A 4GOEA 2M8EA 4PGHA 2O9LA 4KUEA 2Y0SN 1SD5A 2VC0A 1QHGA 1BCCG 1KONA 1OYYA 1HJBA 3BQZA 4S0HB 3GZ5A 3G1LA 5IP7J 2ELHA 4J0FA 4UUSB 2LVSA 1P7JA 1AKHB 5EJCA 5EYRA 2DA2A 5LGUA 1BE3J 1D7MA 3LFUA 4ZYGA 2JSPA 4I99C 1HDPA 2FQ3A 3H1LJ 3ZN0A 3S8PA 2E1NA 5JVGF 3HE4A 3RL0D 1DPRA 1FYKA 2HVRA 1S4XA 2HKXA 1NO4A 1YS6A 4DZJA 5F64A 1WJAA 1KU3A 2HFHA 2ZSIB 3WTYC 4C3HJ 4ZYEA 1S9HA 1BC7C 3L70E 2I5UA 2M45A 2NAZA 5CMZA 1SQPD 1RPWA 1M66A 2VKEA 3UNGC 3OV8A 3ONQA 2JJ7A 3KP5A 2FNPA 4RA2A 3SDGA 1YJ9I 4KUHA 3IN6A 1FBMA 4O9BA 3LIEA 1JM0A 1R4MB 2HODB 1OCTC 3A0BH 2NPSA 1M56D 1U78A 4GYIA 2E1OA 2YO2A 3L74G 3BG3A 4L75A 1EXJA 1LP1B 2F5DA 1FAVA 1ZRTE 3KPEA 4LGDE 3RK3C 1YQAA 4BY7J 1S8NA 3K7AJ 3KYCB 3V8KA 3X2QH 5EGOA 1LTAC 2NOGA 3EUAA 3AE9C 3L2WA 5J47A 2ACJA 1G2CA 1WRGA 3BATA 4E21A 4XONA 4DOZA 2ESHA 1EZVG 4B3AA 3GTKJ 4UVAA 1VF5C 3WTTC 2QJYB 1YJ9P 4XKWA 4N9HA 1D1AA 5JLXA 2KIKA 2BCCD 2Y0EA 1LQ1A 3NFQA 4Y3OA 1RUNA 1ETXA 1XCBA 2HQRA 5GTHH 1G3TA 4Q5SF 1PV3A 2KL4A 3RJPA 1SD7A 1Z1DA 4QMAA 1BI3A 4II3A 3A0HC 4A6DA 1G6NA 5J1YA 1XDUA 1NTZD 1SLQA 1I27A 2P5KA 3OYKA 1K9MQ 2Z99A 3CCQI 5KLVE 3BTLA 1MBGA 3KP4A 1HW5A 5E20A 3J80K 1IXCA 1CGPA 3ZWAA 1FDMA 1JOCA 3KPHA 3LWFA 2AXLA 3OYLA 5FLMJ 1NK3P 3F9KA 3FKIJ 1YI2I 3MD0A 3I5CA 4KN7X 3MKYB 2YS9A 5HS9A 1R1VA 5IT9Z 4P96A 2E5NA 2Y0SA 2K37A 1QNTA 2VQCA 4Q48A 2BY0A 3H1HG 4YXWH 3Q5PA 1A02F 4CYDA 3O2PE 3LIDA 4IHVA 1FOYA 4HSTA 2PAJA 2CK3H 2ZAEB 2KP6A 1DU6A 1PUEE 3H1JG 2VQLA 3HUSB 2DTRA 3LA3A 1BCCJ 1FOWA 5APWA 4HYEA 2BASA 2E74D 4AQRD 3CCQP 1RNLA 1JKOC 1WWXA 3H1ID 4XE5B 3U2RA 2HOSA 4M71A 2KLVA 2W85A 2CFOA 3AG1H 2Z16A 1SQXE 5M5XJ 1YI2P 2A05A 1K05A 2ZVNB 2R7WA 4IL6H 1QBJA 2N1TB 2DBBA 2RN0A 4CSWA 3BPVA 3JC22 2W7NA 2IBZD 5BU5A 4ZKPA 2FUG2 5KAIC 3OS0A 1RIOH 2AEFA 4O3MA 4QLCU 2WMMA 3VP9A 1UG2A 4I76A 4FHTA 1F4KA 4GWKA 3QPHA 2CMPA 4D3SA 1GD2E 3A03A 3WS7A 1RE3A 2RQQA 1Z91A 1LP1A 1SQPG 4XFJA 1U2WA 4IKFA 2W25A 1EXIA 5ED4A 1FYMA 1JB0J 3OAKA 4CZCA 3VMZA 1R49A 4IHXA 1OW8A 3ZMSA 3LAPA 3Q1MA 1EJ9A 3GTMJ 3L72D 4KHXA 2LYCA 4RB1A 2X6WA 4J00A 2ETHA 2PEXA 4DQ2A 1N7SA 2FBHA 2I8DA 4YIIA 2VRSA 2XU6A 4UVBA 1GW4A 1FOSF 3HD7C 1SVOA 3IH2A 3S2DJ 3DTIA 1WJ5A 2O6GE 4W7ZA 2YMYA 3K70C 1OYWA 5CQGA 2LTPA 5J1UA 1PGPA 1IK7A 2RMZA 2X1EA 1TT0A 3QYBA 2BCCG 2E5YA 3T8RA 2KZIA 4LIVA 3S1KA 1TQMA 2YIUB 3Q9SA 1TW2A 4BKXA 2F5VA 1RE4A 2A45I 1USTA 1ZP0C 2EV5A 2V4JC 1O4XA 1NTZG 5KKZB 4KT6A 3AEEC 5DUIA 2VBWA 1D1CA 1XC5A 2DQRA 3HOXJ 1FYLA 2E7XA 2PMZA 2EZLA 2RV8A 3Q0UA 1BJZA 4D7NA 4MHGA 2G8YA 4HF0A 1ON2A 2HFED 3IF4A 3CQZJ 1W7PB 2I1JA 3L70D 3NMDA 3H1HJ 1IGNA 4IVNA 3DF8A 2W27A 3LMMA 3PNVA 2EBIA 4GRIA 2ZJPF 4A3EJ 4L18B 3ZQ7A 3H1JJ 4L73A 1NK2P 1U5TC 2KJBA 2A06G 1KYOE 1BIAA 2A45H 2L54A 5E8IA 1R00A 1PPJE 3J7AY 2YXRB 3CP2A 4B3HA 3L9FA 3A01B 5GTIH 4E7JA 3PM1A 4NC8A 3GTOJ 2HYJA 1NTKG 2WADA 5AIPA 1ZRTD 1ZK8A 3H3ZA 2V7QJ 1ZRDA 2OU2A 5E79C 3H1IG 3L71E 4C7NB 4D0PA 4E13A 5KTBA 1BOBA 3PUBA 3L75E 2FBKA 1W0TA 5IOYA 3I56I 1IAWA 1J5YA 1U9OA 3BG6A 4BYYA 2Y48A 4XA4A 1K78A 1I5ZA 1VZ0A 2VPRA 3MVPA 3PQKA 1K6OA 2TDXA 2QZ8A 3HUGA 3ZXSA 2IBZG 2V7QH 2LLKA 3G73A 1K04A 2R7RA 1YJWI 1VQ9I 2G7UA 2OCEA 2JR8A 4I7HA 5LFAA 2EFWA 1SQPJ 4YFXF 1R5SA 2EIMH 2RGVA 5D8LB 2R3SA 3CD6I 2L91A 3IWZA 1IZ1A 3TW7A 2XDVA 3L4FA 2DFEA 4I98B 1CI6B 2R7ZJ 2Q9IA 3MWMA 4KUMA 1RH5B 1W5CC 3I56P 4GCVA 4IL6X 2CGPA 4RGUA 4E4HA 1FDIA 3JCUH 1SFCB 4HW0A 4NUBA 1YTYA 3L72G 2NPSD 1YJWP 1VQ9P 3A02A 3RYRA 1FZCB 2OARA 5D5VB 1KB9I 3CD6P 1K6YA 4B09A 3RK2C 3BTJA 3VMAA 3L36A 1X2NA 2F5FA 3JSVC 3IR9A 1FBQA 4N4NB 3ADOA 1LJ2A 1SQXD 4B4CA 5AVQB 1YHQI 3BG9A 3QU6A 2YR2A 4S3MA 2P1JA 3PDUA 1ITYA 4M6XA 2J5UA 1FP2A 5AVVB 3OYAA 3F8FA 1VFCA 1P84I 4FQGA 2VJ4A 2CFXA 5FKLA 1OCZH 3BCCJ 3S4RA 4CYCA 1BW5A 4B3JA 4AVPA 1NHAA 3RKXA 2KI7B 1U8BA 2LNBA 1DUXC 3S17J 2CVZA 1RQVA 1MMAA 3L70G 2CSOA 2L9RA 3A01A 2K9YA 2K88A 3AE1C 4U7DA 1DD4A 2R5YB 1KMIZ 4BNCA 4ZNCA 1IJDB 3BPXA 2IPQX 3IH3A 4EM2A 4HDUA 3I4NJ 1NTKJ 4ITVA 3TGUE 3CCSP 1GU4A 3V42A 4PZDA 2HGCA 2CQQA 3MEXA 1MIJA 2VJ5A 2WSFJ 4KISA 3JSPA 4BQAA 3I0TA 1G1IA 1OQYA 2EFOA 4IM7A 1F9NA 5BOXA 4OIQF 1QVTA 1ETKA 4XM3A 4X1EA 3ESWB 5CVRA 1ZW0A 2E1MC 4TT3H 3SZTA 3CJRB 1FT9A 2HQ5A 1FIPA 2E5TA 4GT1A 2K3RA 2DU9A 2XC7A 4CHUA 2WSFH 3IAOA 3FX0A 1ZGAA 5E1ZB 3IKVA 2XV5A 2ZT9C 5L8RJ 4JP0A 2LY1A 1NH3A 2KS1B 1SFCA 2K9LA 5IYCJ 1DIPA 4CCNA 5D4RA 5KLVG 3F6VA 5E3OA 1B72B 1FZCA 3ZRGA 3MZ8A 1M1JA 3L72J 3EWKA 3GLLA 1GZLA 4NPEA 2R7FA 4D6TE 3MKWB 2E42A 1JUSA 4NDLA 1DGRM 2E76B 2Y0CA 2KKOA 1KYOD 2FFDB 3K6JA 1L3LA 2KUBA 2Z9OA 2PRRA 3KP2A 1PPJD 2M0MA 1PP8F 2QQ9A 1SQVE 2X48A 3HOTA 4BRYB 1N7SD 4DYDA 2WT7B 2P58A 4IHYA 3I3LA 5TRDA 5IOZA 1URQC 3CMYA 3HRMA 3L71D 4V2FA 2Z3YA 5M3MJ 2B89A 4UNOA 4AU7A 3L75D 1HW1A 4CH7A 1SQXG 4L0ZB 2XSDC 1X1AA 5DD8A 1T3JA 3E5XA 1J7KA 3P7KA 1PYVA 3CMEP 5LHHA 3BR3A 1GV5A 1JE8A 3ABVC 4C2UA 3GHGB 2CQXA 2R5YA 1BGYE 1Y8QB 2H94A 1KU2A 3MMYB 5F0CA 4LLLA 1V3FA 5FJ8J 3L70J 1YW8A 4M3FA 3B6AA 3GLXA 2MLGA 2K9MA 3OOPA 3OYGA 3J7AO 2UUZA 1NH4A 5KLVJ 2XB0X 3GZNB 1X22A 5KJ7C 3F21A 3Q5FA 3HOUJ 3QRFF 4C9YA 1YVEI 1UHMA 3GWZA 1WVRA 3GXOA 3SFZA 3G1OA 1X4OA 1IW7F 4LK0F 2YPRA 3S1MJ 1P6RA 4YIFA 1UIXA 2WZ7A 1V55H 2FYZA 2KNCB 1QGKB 2KLUA 1NU1D 2DW4A 2F48A 2XAGA 3AKZA 5AVXB 1XDSA 1Y56A 4MTEA 3HOSA 4ABZA 4FETA 1USDA 4PJ0C 3CC7I 2QM7A 2Z33A 5AVRB 1ZTRA 3VDXA 4BACA 2ISZA 2QKLB 2QCOA 3LL7A 2ZMEC 4XRMA 5M5YJ 1CF7A 2E19A 1SP4A 1V5GA 3CO7C 3L6DA 2NRGA 2GM4A 3AL0B 2O61A 2HDHA 1JY3O 1HF0A 3GTLJ 2IYOA 1B72A 2H1LA 5B66C 1LJ9A 2L5QA 3VB2A 1VNDA 3CX5I 2B0LA 1IDZA 1I6XA 4WXHA 2G9WA 3B5NA 1PGQA 3AG4H 1YLFA 2HOEA 3IAS2 2ME6A 5FD6A 4ZDOA 1PL5A 2GA1A 1JY3P 4TLFA 1OR7A 1TQPA 5K5GB 3VN0A 1B4AA 3SHFA 1KV4A 3IP4B 1SQQD 1O7FA 4HRIA 4TV7A 3FX3A 3CESA 4UV9A 4LIUA 2NVTJ 5CCGA 1ZMEC 1OX3A 3EFFK 2LR8A 2IS4A 2DA5A 3P9CA 4LG0B 4B8XA 3O6QB 2XPWA 4I0BA 2IBDA 2V1NA 4EZBA 3FM5A 1OMIA 1H0MA 1PPJG 2HZDA 2OTLI 2M5AA 2FBWC 3TGUD 1YS7A 2RKHA 3HADA 4B43A 5JFRA 4F92B 1IJWC 1DU0A 1SQXJ 1YYCA 3L71G 3F89A 3AE6C 3GHGA 4K3AA 3F0CA 2OYOA 3DTKA 1LDDA 3K4JA 2BV6A 3M1EA 5LD2C 3L75G 1T2KC 3OIOA 3TP3A 3WTWC 1ZG3A 2X6YA 3C8VA 2XGXA 2WWWA 3KX2A 1LVKA 3KZIE 1OVRA 1FDOA 1VPCA 4OIOF 4IL6E 3HTKA 3H9GA 1O57A 2EZHA 3RK3B 2N8GA 4M72A 3M07A 1E79H 4RBOA 4AIKA 1GK4A 1T8IA 2VKVA 3MZWB 4OGQC 4H4KC 4M73A 1APLC 1N2DC 3PHLA 1TTYA 4OAZA 1L0LJ 3FXQA 3PSIA 3VSLA 2W8ZA 2KNCA 3LSGA 4BXXJ 1BJAA 1NG7A 3SJMA 1N78A 1JMBA 3VTPC 1RF1C 1ZELA 3WFIA 4YFNF 2LFBA 2P5VA 1YO5C 2XV4S 4JX6A 1QQIA 3PJRA 2RKLA 4KIFA 1FMVA 1K83J 2JMWA 4W80A 4HKZH 2QM3A 2B63J 3GYHX 4L74A 3Q3DA 1BOAA 4X0GA 2EA4A 2Y9ZA 4A6EA 4MLOA 5A2QK 1HOMA 3A5TA 4RLFA 2HDCA 3M8FA 3NRVA 1SQVD 1KD1Q 1IFJA 1KILE 4LJZF 3C1DA 4BE2A 2O01J 2BW3B 2B87B 3M1CA 3DKYA 4IX7A 2HZTA 2EFNA 2DMUA 4LFUA 4ZDLA 3EUKL 3WE2A 1SEUA 2ZFWA 1E2XA 1SQPK 3M8JA 2KRFA 2M5WA 3W6ZA 3SSUA 2VOOA 2XAQA 5FKOA 1WI3A 2L7FP 1HKSA 1RI7A 2GQQA 3K6GA 3HIFA 3KP3A 3BP8A 4LITA 4ASNA 5LGTA 1BGYD 1LTJC 4JOMA 2R4GA 1S72I 1P9QC 2LF8A 1SFCD 2DOFA 1SAUA 2IJLA 1SQBJ 2W82A 5IYBJ 2LRDA 4H13D 1MMNA 1MMDA 2DYSH 3MZYA 2R7OA 1OCPA 5IT3A 3W2AA 3IFMA 3VMXA 3HHGA 3LA2A 3HYIA 2E2JJ 2QRXA 4WBAA 3IRRA 4CO8A 3M0AA 4EYYQ 2H7HA 3H5AA 3HGGA 3E6CC 5A9RA 1NJIQ 1ZG5A 4RAFA 3GFIA 4BY1J 3SFEC 4BXLA 3LW5H 4PFOA 3U9GA 4DYRA 4EM1A 5EG0A 1PP9E 4I6MC 1Z77A 2X6XA 3TMOA 3L71J 3SZPA 3TGUG 2P8TA 1UG0A 2GIZA 1ERDA 2STWA 3R4KA 1WPKA 1WP4A 2UV1A 5AONA 1S72P 1GT0C 3E6BA 3BR5A 1T0FC 3REOA 3S32A 1DGWY 3VYUB 3ZN1A 2W6JH 3HRNA 2WV0A 3PRJA 4ASWA 1KQ0A 2P7VB 3PSFA 2AS5F 1FZAA 4NC6A 3NTNA 1TBXA 4QSHA 5K5QA 3U1KA 5FGMA 3M9AA 1IRZA 3VYIA 4CXFA 2V4HA 4QPQA 5FLXZ 1CZQA 2IXSA 1MBFA 3D0SA 2K9QA 3BQYA 2CQKA 2LREA 3M7GA 3HOWJ 1J1EB 3H92A 1WQ2A 1R22A 4XK4A 2LKPA 4KMUX 4F91B 3AE5C 1N73C 3RKYA 1UB9A 4BH9A 5HNHA 2XIGA 2IFMA 2K7LA 2PN6A 1P2FA 3D5SC 5CQEA 3A0BC 2GIVA 3JRIA 1X0XA 1NTKK 2BHZA 1S3JA 2VKDA 3H5RA 3ZWCA 2E1CA 1KZUB 5HDGA 2WAQN 3SEZA 5LEKA 4U88A 2ZSHB 2BW3A 4DLLA 2LXCB 3E97A 2JTVA 3CF2A 3JCUE 3FGAD 2QVOA 1LT9A 1X3WB 2CUFA 4OQYA 5MGBA 1EV7A 3I4PA 1SQVG 2QJPC 1Y0UA 1RETA 3GLMA 2TRTA 2MLKA 4OAYA 1IFNA 4WY4D 3V8JA 2PJPA 1JTHA 5GTHC 2DCEA 3RKWA 2ZXEB 2LKXA 1T6SA 4KJZA 1U5TB 4B3IA 4I02A 3OY9A 2XKOA 1ZCJA 2M34A 2I10A 1KQ9A 3GZ6A 1N25A 4F55A 2LK2A 2O3JA 1MMGA 3WGIA 2D3TA 3O8HA 2CPBA 2W00A 3B5ND 1BGYG 4PK4A 1KB9E 1HWTC 2A6TA 2E76D 4OMZA 2ELJA 1FY7A 2XF7A 3GFLA 1WZ2A 2VB6A 2JPBA 4E7LA 1NHLA 1R5LA 2K86A 2MABA 3OYMA 4G9YA 1B9MA 3CO6C 1HA8A 2NZ2A 2A68F 3U21A 3WG7H 3TGUJ 3TEDA 1ZYRF 1YJNI 1JY3N 5A2QZ 1P84E 3MKLA 2DJIA 4XOPA 5BPIA 3BRTB 4GKGA 3LFKA 3MKZA 1L4AB 2N9BA 2ID3A 1FX7A 2JRTA 1PIXA 1ZXGA 4FT8A 2V7FA 1UCRA 3WODF 2IAIA 2WC2A 3VP8A 1IZNB 2QYTA 1R58A 4OM8A 1F17A 1KILD 5IT9K 4KT0J 3HD7A 4DZOA 4WX9A 1YJ8A 2YX7A 2QIWA 3GX4X 1R4NB 4BGDA 5M3FJ 3AE2C 1SD4A 4LMYA 5CJ9A 3UR3C 3H1IE 5APUA 2DK8A 1YJNP 2XVCA 1PVEA 1A36A 4HSRA 4LB5A 1OZHA 4YIRX 2OBPA 4AYCA 1ZH5A 2WAQA 1ZR4A 4BJTA 3S2HJ 5LEJA 3RK2B 1FBSA 1N1GA 1WRJA 4D5FA 1L0NE 1FTZA 3Q3CA 4M9SA 3BR1A 3QQAA 1FOSE 4AUXA 1JJ8C 3ULKA 1R36A 4LC1A 4D6TJ 3K4BA 2OF7A 1YQ4C 2Y0MA 3WU2H 4CCMA 2HPCB 4BL0B 2YMKA 4NHJA 1IUYA 1XSDA 2XAUA 4LB6B 2YXQB 2H09A 4HJGH 1SQVJ 2EPFA 2VPLA 2OGUA 4EI2A 2NOJB 1U5TA 3AE7C 2ME0A 2WAFA 1PP9D 1QVFO 1IN4A 3DCFA 3I59B 1XPXA 1KU7A 3NARA 4IF4A 4Y15A 4HDVA 4IOAF 1RQUA 4G12A 4KNYA 4RGRA 4PV1C 3WUUA 2JEEA 2VASA 2ZYGA 2NVUB 3K4LA 1GXQA 1Z05A 4C3IJ 4F93B 2BEQD 1WPQA 2QA4P 3CDHA 4YFKF 4BHPA 2YKPA 1VQOI 2QEXI 2R5ZA 1QL1A 2PP6A 5KLVK 1CSBA 3DBLB 1HSTA 1R6RA 3QU3A 5FFZA 3HDDA 1BGYJ 3DXJF 4UHTA 3C1LA 1Z6RA 2MA3A 4FX4A 4M9ZA 5GAGJ 3O8ZA 2KP8A 4B86A 1AFOA 1MNDA 3GCMA 4BE1A 4ZDPA 3QWLA 4XKVA 3KYQA 1PGOA 1WDMA 4MFEA 4PJLA 3HEFA 3COAC 4UB8E 2M8GX 2E1MB 4Y17A 4Y28J 3ABLH 1W1WE 3KETA 1ZARA 4ZYHA 1JT0A 1VQOP 1AWCA 5BU8B 2UWMA 2QEXP 4N78D 1HSJA 5LBQA 1SVFA 2FYUE 5GTIC 1YFHA 3TSIA 2CWEA 2M7AA 3DFUA 1IFDA 3JRAA 1SQXK 2ZT9B 4ENKA 3AG3H 4WXDA 3ZW8A 1WCMJ 2FXPA 1S9KE 2NNYA 2POHA 3BWGA 1LSJA 2KFDA 4B47A 4Z6YA 1Q2NA 2J59M 2DA7A 3OS1A 1H89C 1QHHD 3BTIA 1ZRFA 2VQGA 2HPMA 2AEJA 3PIOF 3UKGA 2ZNYA 2OZUA 1W2BO 2J5OA 4A93J 3M91A 2XASA 3FZVA 3CLQA 4JQ0D 1GVJA 4C7RA 3FDYA 5HODA 4CGZA 1Z9CA 3EGOA 4O6JA 1I3AA 5GP9A 1L0LK 1VF5D 2HPCA 5GADJ 2NS7A 3L2RA 1XGSA 1IXSB 1SMTA 4J19A 1D0YA 5EEAA 3CCEI 1URQB 5KAFE 3D6ZA 1KB9D 1OLTA 1Q7YQ 3KXDA 4YTPC 3J81K 5GAHJ 3BCAA 4HOBA 2A5YB 4PUSA 5AVYB 1NWQA 4NBQA 2FEZA 2M8RA 3LQRA 1IRGA 1Q81Q 1MNMC 2V1UA 4IFMA 3G3ZA 1AA7A 2BBYA 1W5CE 4MFDA 2XF6A 4JX4A 2FX0A 1LFUP 4PD4D 3TO6A 3CUQC 1P7IA 3CX5E 5APVA 5EEGA 2DA1A 1LJ8A 1PP9G 5LHIA 1P84D 3D70A 1H9GA 4D7MA 2H6CA 4Q47A 2A45G 1MMSA 3H1KE 1JNMA 2ISYA 1JCCA 1R8EA 4OMYA 3CCEP 2XHKA 2K85A 5DJTB 2KPMA 3H0GJ 4L5EA 3EPZA 3TDZC 1FSHA 1LNQA 4OWRB 5FO5A 2PMZN 3ITKA 1EKEA 2HDWA 1YE9A 3VSKA 4YRVA 2XRNA 3L1PA 1W4MA 2QYOA 3L2UA 2B9SA 2C9NY 4H0LD 1NVOA 5J40A 3MFKA 4UUSA 2M9HA 3H1CA 4P55A 3RTRA 2D1VA 3GUDA 1J0RA 1AKHA 2P5LC 2WSEJ 3HOZJ 3GVAA 2MC4A 1YRNB 1HKTA 1H0TB 4R4MA 1I39A 2PFBA 3ERMA 1SQBK 2BEZF 2VT3A 3IWFA 3L2QA 1SFKA 3KZIH 4BHCA 3BC8A 4Y99C 2ZMEB 2OQRA 3HPHA 1L0ND 2WSEH 2QVAA 4GODA 2OCCH 3S1NJ 1I1GA 2IGMA 1WDKA 1Q86Q 2O5RA 2FA5A 1V54H 3KYDB 4KT5C 1U0JA 4XICA 2OJED 2HODA 2CW8A 3ROUA 1B59A 3JAMK 3R0JA 3DOJA 1X0TA 2RAEA 3OYNA 2LKMA 2F2EA 2KT0A 2AXTC 2C9LY 2KK7A 3CXHD 3EFGA 3V8LA 1W36D 1YRLA 5FKMA 2F4MB 3K4NA 3CC2I 2E74C 2DK5A 2VUMJ 3L74J 2DA4A 1PDNC 3AEAC 2JWAA 3HGYA 1DH3A 2EILH 1WMKA 4OOIA 3HE5B 4U3FD 5H2FH 2K9NA 2PMHA 4ZZDA 3W6UA 3RBXA 1TNTA 3ECOA 3N05A 2L9SA 5E18F 2E75C 2J58A 1A04A 1ETWA 2V79A 3FWEA 1T6AA 4HPQA 5F1RA 2ZFUA 1J1EC 2JQ7A 5CBOA 2HVQA 3ISPA 3H2ZA 1Y47A 2NS8A 3BCBA 3HBLA 3ABKH 1TL8A 4IRHA 4EJOA 2NRAC 3KIOA 2JDIH 3BZ6A 1JEKA 3CC2P 3B6CA 4ZH4F 2O8KA 3SWYA 3D6YA 1KS9A 4IPAA 4DBRA 2CH0A 3H5NA 4UB6C 4XL9A 5F6FA 3CCVI 1X0VA 3II6A 1MGTA 3WU0A 4J01A 4L76A 1MJAA 2CG4A 4IOCF 2H89C 4KMFA 4XRSA 4NQWB 3PTZA 2MBFA 4A2UA 2CV0A 1OW6A 5IY5H 1WDLA 2K3FA 4BQOA 2FYUD 5LRRA 2ECBA 5E3MA 3T97B 1J09A 1J1DC 4OGQB 2QG4A 2X4HA 3WHCA 4HNTA 2P10A 3HUSA 5JHFA 4JYKA 1UFMA 2K5CA 1VL2A 2XDJA 1S9KD 4EMSA 4G6DA 1MJBA 2JRMA 1ZN2A 3PIPF 1H0TA 1AA0A 4FE7A 1IN6A 1RF1B 1LVAA 2RNJA 4DIQA 3TOBA 5DTDA 4BWNA 4YCAA 3CCVP 1OCCH 1KQFB 1LEBA 4RJTA 2N1TA 4ESFA 3HRTA 3C9IA 4II2A 1MSEC 3FXKA 2A69F 4E12A 1LB2A 3WGHA 2IFNA 4KJMA 1W5SA 4BHBA 2M30A 5JI6A 5HDNA 1GL2C 1BBYA 3H9QA 3WG9A 3J81Z 4A3FJ 5M1BA 4A3IJ 4IQ4A 2VQHA 1WJEA 2EFQA 3B8EB 1VQLI 4HF1A 1MBEA 1OFCX 2EFPA 4F3QA 1L0NG 1H88C 5B3SH 2MW8A 3RQ4A 3RQSA 3P8MC 4DYQA 1JMMA 1DEBA 5F27A 4FASD 2LKSA 3GBGA 3F23A 4I2OA 2COMA 4DZPA 5JHUA 5K5OA 4XLNF 1R71A 1L4AC 1YTZT 3GTJJ 3HE5A 1USSA 2RC4A 4LOCA 1KQLA 3S9OA 2LSOA 2GWRA 2XZRA 2R5DA 4JBZA 1AVOA 3DEEA 2ZVOB 3Q0WA 3ZGKA 1LTJB 3CX5D 3FWNA 3MZHA 1VQLP 3Q9VA 3H1KD 2QENA 1NU1E 4U3FG 1KU9A 2M3AA 2IVMA 2PMUA 1S7EA 1UZCA 3U59A 1X9VA 3QPSA 3S15J 4R1NA 4RAYA 2EA2A 2KXPB 2IGOA 3PO3J 3RK2D 3EQLF 1T2KA 3FK7A 3D1LA 1A02J 3O8GA 2FXAA 3FBNB 3BT9A 3FK6A 1FOKA 2BCCJ 5FKKA 2XNDH 1W5TA 3F72A 3SFDC 2ZFCA 4M3GA 5HS7A 4PD4I 1E3PA 1Q1HA 3CP8A 3TGNA 1VQKI 3NXSA 1NYHA 5DM7F 3T97A 4KN4X 3OYDA 2K02A 3QP6A 1W7PA 2FBIA 1ENHA 5F0FA 5K7ZA 3ZWBA 1NTZJ 4BEHB 1WJDA 2N9YB 1TW3A 3JAMZ 2WY7Q 1BG6A 1IC2A 5BPDA 2H8RA 2EWNA 2IS1A 1QZYA 1KB9H 1SQVK 4GOFA 4RO0A 5AW2B 1MJ9A 1F1ZA 4OL9A 4IJAA 3TDUC 3A0HH 1JKPC 2L5GB 1SQQE 2X85A 2NPSC 2FYUG 4IXAA 3BVHA 2DI3A 3I4MJ 3L00A 1B8IB 3S1RJ 1HTLC 1JY2O 3I71A 4PD4H 4YXDC 2KHMA 3DPTA 2ZXWH 1YHQP 3RZDJ 2IYPA 3AEBC 1N73B 4H44D 1DLIA 4C7NA 4P1WA 2VJIA 5AVSB 1VQKP 1P84H 4EGYA 2KZGA 4W7YA 3CPWO 1JY2P 2WVRA 1XCVA 1JT6A 3DEUA 3H1IJ 4U0VA 1YG2A 3ZQIA 5HOOA 2BVMA 3DLLF 1SFEA 2X6OA 2W90A 1V5EA 2XUBA 3FXRA 1A6IA 3TP0A 5KHDA 2R7UA 2O8XA 2OQGA 3DWLE 4HNVA 4ZTFA 4FX0A 2ADUA 1L0NJ 3M06A 1D5YA 2QJPB 4P9UA 1JCDA 3VYSB 5CLSA 1GTWA 3D71A 3Q0VA 2GXGA 4U7BA 3SFIA 2DPDA 1XD7A 2ZT9D 3CXHI 1CI6A 2XPUA 2BY1A 1Z3YA 2H8WA 1OPCA 2GAUA 2IGNA 1LTJA 4GDOA 3OR1C 5KAIH 3D1NI 1RR7A 2PGDA 3WU2E 3ASOH 4A0ZA 4I7ZC 1B9NA 1FZPB 2A6HF 4ZKUA 5EEHA 3EUHC 1I6HJ 3D5RC 1YB4A 5F04A 3BG5A 4UVCA 1I50J 2HVSA 4IQJA 3PNYA 1G1JA 3CXHH 3H1KG 1GUUA 1XMAA 4PCQA 5KCMA 3CC4I 3ZMDA 5AVUB 1QRYA 2C0WA 1RZ4A 3P7NA 3BG7A 3JRGA 1ETOA 1N8RQ 1P92A 3DBHB 2ZXXA 1T0FA 3DPUA 5C3EJ 1BW6A 2CUZA 2ZB9A 4HF2A 3RQIA 2KZVA 1V4RA 2Q0OA 2WA0A 4BJ5C 4BUPA 3CTAA 2AEMA 4BEHA 1BM9A 3R2PA 3FF5A 4WCGA 1U3EM 4PJMA 2JWDA 3HSFA 3QH9A 3FMRA 2F4IA 4XN3A 1HW2A 3F3SA 2JA6J 2MH2A 3IH4A 1NAYA 4FISA 3KDPB 2KSJA 2HS5A 3S3NA 1XS9A 3CC4P 3E5QA 4F7ZA 3Q2YA 1IXRC 4NPDA 2FOWA 5B1BH 2FYUJ 3OMYA 2RN7A 3VEPA 4DNCA 2KIQA 3RPUA 3JRDA 4BXFA 2A61A 4UB8H 2MH9A 2R7SA 3K9TA 5APQA 1BIBA 1S6LA 2FU4A 2FJ1A 3OYFA 2R7TA 2IZ0A 1ZLKA 3AE3C 2Q2EB 1FTTA 5CVJA 3HDHA 1N7SC 3ZR8X 2PI0A 3ML6A 1IG7A 1K4TA 2R7DA 2WAEA 2K3PA 1SAXA 1LTIC 1D0ZA 3HTUA 2GUVA 1DQUA 5AW9B 1EQ7A 2FE3A 1E0EA 2H27A 2N1TD 3ZMUA 5FD5A 2JKVA 2L3DA 2RQPA 4AIDA 4E7IA 5D5UB 1SFOJ 2XGDA 3ZDMA 1BSNA 2CQNA 3NWSA 2NYXA 4KICA 3S3MA 4MEYF 4CDGA 3L37A 3GF7A 2KS1A 1FZFA 2M0CA 2Y0DA 3KFWX 1H8AC 2W6AA 4PV1B 3KLNA 3PIDA 1ACIA 2A07F 2NVYJ 2WTEA 4OWFA 2MGQA 5KAFH 1LDJA 2IDBA 4HB1A 3CC7P 1LE8B 3OR2C 1LTBC 2XKMA 2QWWA 3F8NA 3OYIA 5FLXK 4OH8B 2KIFA 1QPIA 2FFDA 4BQNA 3H1KJ 5APTA 2GF2A 2VC1A 1OCOH 2W24A 2WTBA 4XLHA 2BGCA 3LSMA 4PSWA 1SD6A 2WT7A 2EZIA 1VQ7I 1CW5A 2XAFA 4H0EA 2FXOA 2M0BA 3OIPA 4CPGA 3CX5H 3P9KA 4EJWA 2MG4A 1UJ8A 5DV5A 2V1XA 3DQVC 2CQ7A 2V6EA 1FZGA 3GFJA 1SFXA 3I9V2 4HX8A 3ZOBA 5FLVA 3N7NA 1I1SA 2HTJA 2A6EF 2FYNC 4EM0B 1TXGA 2KDZA 1T2KD 1IN7A 5E3NA 5LLQA 4BS9A 1LNWA 1T08B 4ZYDA 2LC2A 4A5MA 1TC3C 2RVCA 4XKCA 3DBRB 3FISA 3C7CB 4MQ9F 1VQ7P 1M76A 4XOTA 4KDPA 1OW7A 2Q3IA 3MP7B 3HTSB 3KZYA 5L3EA 3OSGA 1Z7UA 1RF0C 3A3YB 3HZJA 1O3QA 1JKQC 1W7PD 2Q2EA 4ZJZA 3ERED 2KB7P 4LK1F 5CCHC 4L9JA 2OTLP 2HDDA 3TBIA 3OYHA 2G7HA 1ZREA 1LKXA 4MQVA 4XRSG 3CCLI 1QMGA 4KYWA 1HBWA 4R8HA 3RL0B 3IV5A 5KLIB 2XPVA 1LFBA 5ILSA 2XB5A 1SMYF 3WE3A 4A3DJ 2EV0A 1JUPA 3IQDB 1Z6TA 2K1AA 1EDLA 3MGNA 2ESNA 2PJRB 1LPQA 2KLOA 2LBFB 3HWRA 3AE8C 4EQQA 3ASNH 5DS9A 2IPPA 4MEXF 2A5WA 3HXLA 1NU1G 1ZN5A 2WSSH 4WVZA 1R1UA 3Q5RA 2DT7B 1WJBA 4M3DA 2FSWA 3GMEA 5H2FE 3CCLP 2IS2A 1G8XA 3LQQA 4A3MJ 3CUQB 4OIPF 2I9PA 2LH9A 4BU2A 3S1QJ 1UIIA 4GO1A 1QEXA 3EYIA 1N1EA 1JY2N 1X3ZB 2FXMA 2VE9A 2OC6A 3QPLA 5L3CA 4DJAA 1IRFA 3WTXC 4IFFA 1N75A 2IEKA 3OL4A 2WPSA 4LG0A 3O6QA 1ON1A 1JDJA 1JO5A 3FXUA 5E1WA 3ZMZA 2H1KA 3LW5J 3M0DC 1MZ9A 4WK8F 1AVYA 4EATA 5M5WJ 3JRHA 1SQQG 1AJYA 2NXNB 4R79A 2V9KA 4ASVA 1R7JA 1IFIA 2DN0A 2O1JA 5AVTB 3FXDA 4IEJA 1ZOYC 1M2WA 1NAFA 4Y99B 2WTYA 1P4AA 4XRFA 9ANTA 5CVUA 2M1BA 2CO5A 4Y4RA 5F0HA 2EB7A 2DT5A 1HCRA 5CBNA 1MKMA 3CUOA 3IUOA 1MDMB 3HM5A 3CDIA 3QODA 5TISC 3I83A 2W4SA 1QA6A 1O3SA 5FRMA 4R4LA 1Z3XA 5AVWB 1S29A 3CL3D 3AFHA 2P0WA 2M3EA 5J3LA 4HQMA 2JUCA 5TGTA 3HRSA 4ON0A 4CICA 5EF6A 2XRLA 2VONA 3L75J 2OTJI 4EIJA 4HG2A 3ZGYA 5B5EE 1OCRH 3F6OA 1SFUA 3L35A 5J4VA 1NTZK 1ULYA 3WTUC 2E74B 1DX7A 2VL8A 2NVXJ 4QTRA 1FNNA 2W57A 5AIQA 2Q7CA 3GO5A 2HOTA 2P7JA 4G6QA 4H13C 1U6GA 1VQ5I 4BXUA 3SWFA 1JJ6C 1T3UA 2NNNA 3KCCA 3WHBA 2E75B 5AW1B 2CPSA 1M1JC 1UHWA 4XN0A 1WKMA 1JGGA 1TLHB 3CWBE 1E3OC 3R4YA 3RPUD 1XGNA 2X51A 4HEA2 1G59A 2OTJP 1S5LC 3TO9A 3H3VK 5L3GA 3JRBA 3QYFA 2GOMA 3IHUA 1USEA 2UXXA 4L9TA 4DOJA 2VXZA 4N78E 3N4XA 3CUQA 1F5TA 1NU1J 3DKXA 5E3LA 3JSOA 5F08A 3H3UA 4DGWB 3PH0A 1VQ5P 2Y31A 2B87A 1KA8A 2JN6A 1LTSC 2WY8Q 1E5WA 1GLNA 5BNGA 4AC0A 3CCMI 3HPGA 3MIWA 3QWOC 1FJKA 3P8CE 2EZKA 1L0NK 1VQMI 2E71A 1D3YA 3PLNA 4PJ0H 3RK3E 1IF1A 1J1DB 1TWGJ 4IO9F 4G8XA 1UHSA 2UZKA 2C6YA 1ZHFA 2IT0A 2ZNZA 2ZJRF 1HC8A 5CVVA 3E5UA 1MFZA 2O1KA 3AEDC 5AW0B 4YEJA 3ZQLA 5JE8A 3IC7A 3VOEA 4XNFA 1ETQA 2FMLA 4E7HA 4GDFA 1QVGO 2EINH 1NG6A 1KC8Q 3B02A 3MAJA 5B66H 5DD4A 3T8TA 1SQQJ 4HV6A 1IUFA 1OWAA 2HG5D 1VQMP 5J4YA 3W2WA 5APYA 1MDMA 2ZXJA 5DCMB 3CDLA 2QSHX 3A0HE 3GG2A 3QP5A 5BS6A 2A3SA 2HPIA 4HV5A 1GL2B 2HNHA 1LTTC 2IP2A 4P5OA 4HQEA 2D5VA 3FHZA 1EVYA 3PEFA 1HUCA 4PD4E 1M90Q 3ZQGA 3BTCA 1U7MA 5CCGD 5FROA 5APXA 4CCJA 4WY4C 2VBYA 2LD5A 2OA4A 4WB4A 1WI9A 2ZJ2A 2OV7A 2Y30A 3FXLA 2WPRA 3P32A 5APSA 4WWCA 2O3FA 2JA7J 1FJPA 1JKRC 1YONA 2GA2A 2JVGA 3KZIC 4EDFA 2E43A 4IL6C 3M9HA 3TL4X 2HWVA 2W1OA 2H6BA 1SS1A 4IRGA 1JTXA 2X0LA 3BR0A 5K7HA 3B5NC 5IP9J 4ZYAA 1XB4A 3FKJA 2J5PA 1OR7C 1XGOA 2JSCA 2W48A 3K2ZA 4KIGA 3J7ZI 3HOYJ 2FYUK 2M3BA 3RBZA 3C7JA 1PJRA 2LF7A 3PQJA 4HZFA 3KHUA 1TWHJ 1OISA 4HX4A 3BCCE 2QQAA 1YQ3C 2FRHA 1MBJA 1K7AA 2BEOA 4PSXA 4ZTJA 5KAIE 1X2MA 2CU7A 3RGUA 2KISA 1AU7A 4KFCA 3WU1B 3H32B 3HE4B 2NVQJ 1B6AA 2KRHA 1QLED 3Q5SA 4MGRA 1UMQA 4UUTA 4A3GJ 4IOIH 5JLWA 2MJZA 3G6EI 3PJSK 2YU3A 1HGZA 1LWUC 1EH7A 4EEFG 3ABTA 3SXYA 1STZA 2B9BA 1KILC 1XX5A 3CXHE 3V7CA 3ECHA 5CKTA 2WPVB 3HKZN 2YSRA 4KIBA 2HOAA 4XMYA 5ICEA 1T39A 2QSGX 5FFXA 2AQFA 5E1XA 1HLVA 2NPSB 2QM8A 2VIXA 1V5FA 2E34A 4JQFA 3DV8A 1QO0D 3WTVC 1PUFB 2RH0A 3MUDA 3K4CA 4U3FE 3BY6A 3F8CA 3OYEA 3GEZA 5EGOB 1B1BA 3QPTA 3T0YA 3VODA 2D2CC 2COBA 4XLPF 3CCUI 3GMAA 3G6EP 1G2CB 2FQ4A 4K35A 2OYIC 1WFXA 2EV6A 1IN5A 1GL2A 2STTA 1Y8AA 2M7BA 3IAM2 3IRQA 1QVUA 4BBSJ 2IS6A 1WHUA 1G3WA 4NC7A 4UB6E 4XLEA 1T95A 1X19A 3S2WA 1F12A 1DP7P 4PJJA 2XAHA 1GV2A 1Y0NA 2KDOA 3CWBD 5C44J 1R5ID 3H9JA 1C0WA 2OZ6A 1FOXA 4Y52J 5H6QA 1L4AA 3CJNA 2HQNA 2WB1A 2OQQA 1X1CA 5D5XB 3TNUB 3CCUP 4ZC3A 3PP5A 2BY2A 2VBZA 5DEQA 2O0YA 2ZXHA 3VWBA 3H1JD 3R6SA 2HYGD 4GFBA 4GWGA 3ZQFA 2KSEA 2W84A 2WSCJ 2I76A 2M4KA 4BRYA 4HX7A 3BLYA 2VI6A 4XKBA 3FR8A 1TT5B 3LOCA 4XSXF 4I7ZB 3F3XA 1BDCA 1LUJB 3P8CD 1JHFA 3L2CA 1ZKGA 5D8KB 3LSPA 1NTME 3RK3D 4CUGA 5K1YA 4L5IA 5A9SB 3KP6A 2L01A 4G6TB 3CMAI 2WSCH 3A1YA 5E79E 1EDIA 3S3OA 1FPQA 1RESA 3KEOA 2PFXA 2FD5A 3H32A 5J6XA 1L2PA 1WJFA 3E3VA 1FEXA 3HHHA 2W6BA 4N9IA 2F5EA 3F22A 5BVZA 1HBXG 3P9IA 1SANA 3A4CA 1DLJA 1YTZI 3W6VA 4A3JJ 5KLIC 3I54A 2O01N 3RL0C 2LDUA 1TWCJ 4DYCA 4E7SA 3Q3SA 5ICCA 1F14A 4MO7A 3G2BA 2YU9J 1KQ8A 2ID6A 1M75A 1MBHA 3HKZA 4RAZA 3HL2A 3CCJI 3CMAP 3V7RA 3JCUC 4PFPA 4ENJA 1KGSA 3SYTA 3I59A 3PL8A 3VYRB 2Q1KA 4MTDA 1JHHA 3G71I 2XSJC 3S16J 1IFPA 1ZAOA 1G4DA 3HD7D 3L73E 1KTMA 5CHXA 1PUFA 2Q5UA 5DUKA 2QQ8A 3C7DB 4ENMA 1AV1A 2BXZA 4A0XA 3K5BA 3V4WA 2L02A 1ZQ3P 4PZJA 4RLQA 3ADPA 1X8YA 5J1RA 1U7JA 2FKWB 3CCJP 1ETYA 1N7SB 1X79B 1AQ5A 3JR9A 2LY2A 3DU6A 3O6BB 3ZMTA 4UUVA 3IKTA 3G71P 2JJLA 2KIMA 5L3FA 5CVIA 5BQTA 3WFJA 1W2EA 2XNXA 1U9NA 1HDDC 3GW2A 3CTVA 2F6CA 3CJTB 4D9JA 2PLAA 3TNUA 1WJCA 3G4SI 3RSNA 4BBRJ 1YIJI 2HLOA 1FMWA 3BCCD 3JW4A 3JTGA 3KQGA 3I58A 4C2TA 1YITP 1CQTA 3CWBG 2YX4A 1IRXA 4RGXA 3V2NA 5ILVA 5D5WB 3V7SA 3QHAA 1LT9C 2VXDA 3DP7A 3LSIA 5HS8A 1VQPI 4AD9A 2P4WA 2HXIA 2A06D 5H6RA 1Y1VJ 1AOYA 3MTUE 1MD0A 2XROA 1BI1A 4IFDK 2DQLA 3NEUA 5EZHA 4OQZA 4G7ZF 3EUHA 3T1BA 4EGZA 4S04A 2Z1DA 5JR3A 2VJJA 1YOVB 4RB2C 5A9SA 4JF7A 1OJLA 1NTKD 4H0LC 4QWQA 2VKHA 4B44A 5JVTA 1HVVA 3G4SP 1YIJP 3QSGA 3K0LA 1W0UA 3V6IA 2XKPA 1NOHA 1EA3A 5KK1A 5CJ4A 5ICGA 2KQRA 1SVLA 5D4SA 2E75D 4BE0A 1VQPP 5GPCA 2QLZA 1IC8A 1LTGC 2DMQA 4A0YA 2CUEA 1URQA 2YO3A 3TK1A 4N0BA 2SPZA 2K4BA 3MUDC 3K70D 1XN7A 1T33A 4XSZF 3H25A 5DYMA 2G3AA 3M9QA 1K78B 4HLXA 5HNFA 2DXIA 4IRIA 2FYNB 3HUGB 2AXCA 1U8RA 2QSFX 5GAEJ 1YBKA 3BRVB 1L0LE 1TP4A 3LSHA 1X1DA 4ENNA 4XIDA 1NU1K 1IO2A 3EDPA 3JREA 2VN2A 1W36C 3OW2O 3RYPA 3SZGA 1X1BA 2LOOA 3K4KA 5FRNA 1VQNI 1TNSA 4UV8A 3OJAB 5CYVA 1EZVI 5KJ7A 3RZOJ 1PP9J 4BDZA 3QAHA 3PNTA 3BDDA 4HBLA 4OU0A 3AEFC 2QE7H 5DJUB 3E0JB 4PGGA 4LD5A 3DPLC 2QF7A 2R7XA 2MD0A 2HEOA 1VF9A 1YRNA 1FC2C 2KOGA 1S7OA 4RDUA 2R7VA 2ZXIA 3S14J 1NTMD 2XGEA 1VQNP 4XORA 2AQEA 5DDGA 3M3YJ 2PLYA 2ZMEA 2FY8A 4CCLA 3AE4C 3ZW9A 1SQQK 5B5EH 5HLTA 2JT1A 4CA0A 3TDKA 1RUOA 5DM6F 4UB8C 3W67A 1GL2D 3ZQQA 3CWBJ 1M67A 3TYYA 4M3LA 3WUVA 4M9XA 4Y33A 1F0YA 5E8GA 4S05A 3BCCG 2HI3A 4EVIA 3RCOA 4XBFA 1REPC 1S2EA 1RC9A 4M3BA 1XMXA 1EH6A 2OD5A 1SQBE 1JI8A 1FE6A 1K8AQ 2KJCA 2BVLA 2DA3A 4CYCB 1J59A 1DDNA 3LAJA 3BJOA 1JXSA 2E60A 4D5CA 1L4AD 3TOAA 2OYHC 4G94A 3ZMVA 2GOXB 2BY3A 3OYCA 3L73D 3AEGC 3GTGJ 3FHNA 4HA8A 1FSEA 1I3QJ 3ZCOA 1XTGB 3LSRA 1HKQA 5HDKA 1X4PA 4JX5A 4BDYA 1I36A 3HOVJ 2FF4A 1D5VA 1RY3A 4YG2F 5BMZA 2H43A 2C0XA 2CRGA 4UXNA 5TJJA 3L7WA 4RB3C 3OS2A 3MN2A 3A2KA 3RKQA 4PJ0E 3M9BA 2GBYA 4A7PA 3OOUA 1HF9A 1E3HA 2ZKZA 4XQFA 5KAFC 3AAFA 1WH5A 4I1LA 2EJRA 5E17F 2MC3A 3J80Z 4Z1MH 1S1CX 4JK1X 5H20A 1M7LA 3SDBA 2DDBA 1RF0A 1ORKA 3CCYA 4NQWA 2BOLA 3TKYA 3F8MA 5KLVD 5B66E 4JBAA 5CCHA 2ZO4A 1RRJA 1PFIA 1VQ6I 3KZZA 3SQNA 2I1KA 5ILUA 2UYYA 2OTKE 4H13B 4XLAA 3V4GA 4E6KG 3DFGA 1RF1A 3M8EA 1QL2A 4U87A 2R3CA 4I0AA 1M1JB 3OA7A 1ODDA 2K9JB 2Z5IA 5J8FA 1BC8C 4LGWA 3E1RA 2DLLA 1XG1A 1GHCA 3A2AA 3W3CA 2ELKA 1UAAA 4KITB 2HU9A 2L7KA 4DJGA 1VQ6P 1PGNA 5L3BA 1VQ8I 1J9IA 1NTMG 4IZZA 3GF3A 4JYBA 4I01A 1D8KA 4HAMA 4M74A 5LGNA 3K96A 1BI0A 2E35A 3CCSI 1XSXA 3W6KB 1P4XA 1IDYA 4XLCA 2MD5A 4HLYA 2H8PD 5HWSA 1MUUA 1QPMA 5HLGA 2BHYA 2XAJA 1GW3A 2QKMB 3OSFA 1QU3A 3EYYA 3I55I 5EZGA 4RKUJ 5FB2A 4GYGA 3RPQA 2Z5UA 2LY9A 4QIWN 4ESJA 1R9TJ 1AHDP 1HXDA 3JRFA 3E1IA 1RKWA 5K5RA 1Y1WJ 3R0AA 1L0LD 3H6PA 1VQ8P 1IN8A 2ECCA 4W1UA 2DO7A 2Q6QA 4CCOA 5HLHA 1J75A 3M0DA 4M6VA 4H44C 4E7ZA 2DJNA 2IZ1A 3L73G 1T38A 1OVVA 1Z56A 1M1KQ 2CW7A 5AYVA 3PO2J 4EJVA 3I55P 1X3UA 1DPUA 1Q82Q 4I09A 1D8JA 2AXTH 1E17A 2IBZI 4U3FJ 3M4OJ 3KLOA 2DOAA 1WSUA 2UXNA 4BJ6C 3R61A 2WQYC 1YYVA 5EFWB 2X58A 3V2QA 4E70A 2K27A 4A3BJ 4FE4A 4BAYA 1BA5A 2W83C 4YPCA 3USSA 1EVZA 5FKNA 4A3CJ 2FMYA 2UWJE 4WY4B 3ZQHA 1RHZB 1ETVA 1URQD 5B1AH 1CF7B 4RGSA 4AM3A 4MN4C 2XF5A 4K2EA 1R5HA 2BE5F 4B48A 2E2IJ 1H8AA 3PFIA 2L9NA 5AW5B 1XTAA 4C46A 3E7LA 1IK9A 5KVRA 2QJKB 3B5NB 2K9JA 1B8IA 1K79A 1RE3C 4C3JJ 1SQBD 1F43A 1HQCA 2MFZA 4E7KA 1LGHB 1YJQA 3FXEA 1FBUA 2VOPA 4UB6H 4MNUA 4A5NA 3CMEI 1T98A 3ABMH 3VPRA 4ZZLA 2DFIA 4LLNA 1N73A 3BR6A 1HJ0A 3W68A 1KQSO 1FLIA 1XTCC 5KJ7D 1KN7A 1MV8A 3CCRI 3HB9A 2Z2SB 3W2VA 3BJAA 4U7JA 2QJYC 2LXBA 3V2RA 5GPAA 5A9TA 1F36A 3BZCA 3HSEA 1VPDA 1NTMJ 4G7HF 2JPCA 4RAGA 5TISE 2KRCA 3DKWA 1MBKA 1YW7A 1A6QA 3I5UA 4CZZA 2B7EA 2EIJH 5TJHA 2M5AB 2DTZA 1XMKA 2PG4A 3K1PA 1M57D 3HG9A 3B73A 2JVHA 3BJ6A 4OIRF 2CV1A 1AQTA 3H1LG 2X1CA 3S93A 1LWUB 3I53A 1SC7A 1PGJA 2GUSA 1KILB 1N7LA 2JZYA 3CCRP 3G0OA 2LG4A 2DMTA 2M4GA 1OYIA 1XGMA 2O03A 5E79H 2FNAA 3C2HA 4AYBN 1RE4C 2WV1A 1Y6IA 3PLRA 1Y9BA 2MYSA 2BYVE 1MZBA 4F52A 2B88A 3HTKB 2BZTA 1A35A 2ZYAA 1L0LG 4XR6A 1K4SA 2AO9A 3L73J 5AW7B 1BE3E 1VI0A 3W6JB 2D2CB 1BN5A 1J2XA 1S5LE 3HUSC 3H1LE 1BR4A 3FMQA 3WGGA 1R23A 2Q8KA 1LFPA 3RIRA 3SEQA 2OYIB 3OWTA 2Y75A 3L09A 3E6DA 3ULQB 4D3FA 4O5VA 3A0BE 1S5LH 2R0QC 2Y9YA 2IX7C 2WITA 3LSJA 1J2JB 3B4SA 5DCFA 3C2BA 1TZLA 4CCKA 1H9TA 1BL0A 1PZQA 1X1PA 2N1TC 3U1AA 1BSHA 1YX5A 4WY4A 1MSFC 3ZHBA 1T8ZA 2WWYA 1POGA 3K4MA 1RR8C 2E5ZA 2OFPA 2WPQA 1L0OC 1GVDA 1Y39A 3WMM0 1ZGJA 3EETA 4DCKA 4OVNF 1OKRA 1ZG1A 3V5BA 2E7WA 4ZMDA 2KYVA 1WH7A 2ZCWA 3GF2A 2VODA 4P9FA 2QSIA 3BROA 5F1JA 1YW9A 2CW0F 2ZBKA 5AW8B 5GTHE 2DMNA 2Z5HA 1GU5A 1NKNA 2DAOA 2EQRA 1D0XA 2NS0A 3MHVA 4GIFA 1S7AA 4G7OF 3D5LA 1IV8A 1QZZA 4FCYA 1FU1A 4Y7NJ 2R92J 5ICFA 2IW5A 2IRFG 4N3YB 5CCHD 1P4WA 1G2HA 1SQBG 3O3KA 1NTCA 3GHYA 4OGQD 1RKTA 2XGCA 4DBQA 1ZLLA 3DLAA 4Z2YA 4AWXB 4DT0A 4C2MJ 4UY8I 3VYTB 3U1CA 4HH2A 2GXAA 2L9VA 1BR2A 1QX8A 4JPZB 1JUMA 2CS3A 1FIAA 3AG2H 3JRCA 3K69A 2QGUA 3T5XA 4A12A 2R93J 1LWUA 2CUJA 2MKVA 1S5LX 1Q90D 1KILA 3GFMA 2DFFA 3H0DA 5EG0B 2DW3A 3G9RA 3QYEA 2YIUC 4GGGA 1YX3A 2K9SA 4AYBA 2GZWA 2DOEA 3FXMA 1D1BA 1WGXA 4AVZA 2KMUA 2VLAA 2Z4EA 3MQ0A 1KYZA 3E6MA 1O3TA 1BCCE 2L4MA 2DYRH 1ZV8A 3LNQA 4NB5A 2JP3A 3RL0g 3KEYA 2EW2A 3OBBA 1HGVA 1LT1A 2MSYA 1BR1A 2HYFA 2IA0A 2OYIA 1M1EB 3RI4A 3FBIB 3WUTA 1FZEA 3FR7A 1LE8A 3FXJA 1VF5B 1N86A 3WU2C 3NQOA 2DA6A 3MOGA 1X58A 2YKQA 2Q3EA 2L4AA 1PP7U 3BASA 1EF4A 4B1RA 2DODA 2R5BA 3C3WA 3G17A 2QUFA 3CI9A 4D6TD 3PJGA 4J0EA 5J8CA 2E2HJ 2YKOA 3IL2A 3DU5A 5HVQC 1KFMA 5D6EA 2HXOA 1TWAJ 1NKZB 4RM2A 3TO7A 2DPUA 1YIOA 1T56A 2JWTA 1BDDA 4GBJA 4BQQA 1DEEG 5AW4B 3VMYA 1IFMA 1G3SA 3L2VA 4L0YB 4GXOA 3KYLA 1YITI 1ONVA 2P6TA 1GK6A 2JA2A 1N77A 3L74E 1NGMB 2D1HA 2OAZA 2PBIA 2ZJQF 5FWNA 1HH0A 2CJJA 5EDNA 1KORA 1EDKA 1LT9B 1G3YA 2JK3A 3TF5A 1TU3F 1H89A 3UIAA 2GXBA 4RMNA 3VOPA 3LA7A 4PZCA 1EZVE 2O01H 1LDKB 4U0YA 1JTHB 1MH4A 2HTSA 4IHTA 1GXPA 4H0LB 1OXZA 3ABUA 3OYJA 2HYNA 2Y2ZA 4L9VA 1KYOI 3RDIA 2FOKA 2P6SA 1TWFJ 2PX9A 3BR2A 4LLGF 3CZ6A 4DW6A 1M8OB 1WT6A 3H36A 1SFCC 2HQAA 5AW6B 2KIUA 3AECC 4B3XA 2DMPA 2LP0A 2QQBA 4RM3A 3F5HA 1FZCC 4D3DA 4AUWA 4AIHA 1BE3D 3C2GA 3U1DA 2PJRA 1VDFA 2K40A 1EC5A 3H1LD 4L9NA 4EV0A 2EH3A 3OL3A 2LBFA 3MCZA 4ETSA 2Q1ZB 2QBYB 2GLOA 4XLFA 5K7FA 3OYBA 1ZRCA 3LSKA 1KYOH 3FIWA 3J7YJ 2M2EA 3EQ2A 2K4JA 3H1HE 1ZLJA 5GTIE 2L2OA 1JUNA 1EH8A 3QOPA 2OPTA 3H35A 2WBMA 3H1JE 5CPRB 4RESB 6PAXA 1ZR2A 3PFYA 2VT2A 2HR3A 4IHWA 4NPFX 3MD2A 4IHSA 3A7OA 4N4OB 2CYYA 1IO4A 3HD7B 4LG3A 4W97A 3TW6A 2L0KA 3TQNA 5LHGA 4EOTA 1Y8RB 3CKYA 3ELKA 2TCTA 3K10A 4I2LC 2R7QA 4M6YA 1IL0A 4D6TG 4AIJA 3HRUA 2IA1A 3CCMP 4LLHA 2RNGA 2BXYA 2IA2A 2RDPA 5IP6A 1SQPE 2HKOA 2YNYA 3SWKA 4Y13A 1FC3A 3JTHA 3CLOA 1LSOA 4QPOA 1FS0E 3FM3A 3WTZA 1FP1D 1GMJA 4A3KJ 1MNEA 1TQIA 2VBXA 3HJEA 1VQ4I 2CV2A 2D45A 3NWTA 3ZQCA 2P2UA 2D2WA 3E1SA 2V6CA 2LMDA 3P5JA 2Y69H 5D6FA 2P7CB 4N6JA 2OYHB 3E7KA 2VE8A 4ESBA 5KNLA 2V9PA 1K73Q 3C18A 3KE2A 2KZJA 3HN2A 2IGKA 4MIMA 2WB1N 4PDKA 3FXOA 1BCCD 3B71A 4NNJA 4JYCA 2AHQA 2V26A 1Z82A 1GDTA 2BCCE 2QJKC 3GTPJ 1KZHA 2DDAA 2F5CA 2R5ZB 3QOEA 2JA8J 2QBYA 1VQ4P 2X1DA 3LSTA 4PZEA 2E76C 1XSVA 4OINF 4Q4ZF 1Z7LA 2V1DA 5C4JJ 1NTZE 3GW6A 2FFDC 1VTNC 4I6ZA 4HYTB 2DFHA 2ZYDA 2P67A 5AW3B 3R60A 1BE3G 1R5GA 1KQGB 1R1TA
chains in the Genus database with same CATH topology
2VKVA 1OJLA 1A6IA 3TP0A 1Q1VA 1APLC 4HNVA 3QSGA 2L7MP 1W0UA 4A3LJ 2W8ZA 3LSGA 4BXXJ 3SJMA 1D5YA 3WFIA 2LFBA 3NAUA 3Q0VA 4JX6A 2YUSA 3SFIA 5GPCA 1IC8A 2XPUA 2DMQA 2CUEA 1MH3A 1K83J 2G0EA 2JMWA 2B63J 4V2GA 4X6AJ 3D1NI 1RR7A 2PGDA 4A69C 1T33A 2Y9ZA 4MLOA 1HOMA 4KUGA 1Z0XA 1I6HJ 1YB4A 5F04A 3BG5A 3DEWA 1I50J 4XIDA 3JREA 1GUUA 5C4XJ 4M3EA 1JTYA 2DMUA 1QRYA 2JA5J 2P4QA 3GTQJ 3JRGA 1ETOA 2X9DA 3RZOJ 3W6ZA 1A5JA 4FGWA 5C3EJ 1BW6A 2ZB9A 5FKOA 3RQIA 1FJLA 1WI3A 2L7FP 1K61A 2L7ZA 2O7OA 2QF7A 1ZGWA 2P81A 5IYBJ 1VF9A 1IV6A 1YRNA 2JA6J 3F3SA 1OCPA 3IH4A 4RDUA 3G1MA 2E2JJ 4FISA 3C7AA 3S14J 3K2AA 1XS9A 2XGEA 3HGGA 5IYDJ 5A9RA 3M3YJ 4BY1J 3ZW9A 5EG0A 4DYRA 3JRDA 1Z77A 5IPAA 4FTHA 2O9LA 1M67A 4KUEA 2Y0SN 1F0YA 1WPKA 1WP4A 2HI3A 1GT0C 3BQZA 4S0HB 2FJ1A 3G1LA 2IZ0A 3BR5A 5IP7J 3HDHA 4M3BA 1FTTA 4UUSB 4J0FA 2LVSA 2DA3A 1P7JA 4CYCB 1AKHB 5EYRA 2DA2A 1IG7A 4D5CA 4QSHA 1HDPA 4DZJA 1IRZA 3GTGJ 2JKVA 1MBFA 4C3HJ 2K9QA 3BQYA 1I3QJ 3HOWJ 3LSRA 1SFOJ 4JX5A 1RPWA 4XK4A 2XGDA 3HOVJ 2VKEA 1I36A 1M66A 4KUHA 2JJ7A 3SDGA 2CRGA 2M0CA 3JRIA 1OCTC 1H8AC 1X0XA 3MN2A 1U78A 3RKQA 2E1OA 3PIDA 2GBYA 3ZWCA 3OOUA 2WAQN 2NVYJ 3BG3A 4DLLA 4BY7J 3K7AJ 2MGQA 1WH5A 5EGOA 2NOGA 1LE8B 2CUFA 4OQYA 5MGBA 4E21A 1ORKA 1QPIA 4B3AA 3CCYA 3GTKJ 1RETA 2GF2A 2TRTA 2WTBA 5JLXA 2EZIA 1ETXA 2LKXA 2UYYA 4B3IA 2MG4A 1ZCJA 2M34A 2I10A 5J1YA 2LK2A 5FLVA 3ZOBA 2D3TA 3BTLA 1MBGA 3O8HA 1TXGA 2KDZA 3ZWAA 5E3NA 1NK3P 5FLMJ 3FKIJ 1TC3C 1XG1A 2YS9A 2ELKA 3FISA 3C7CB 1M76A 1PGNA 3OSGA 4IHVA 1JKQC 3K96A 1DU6A 3TEDA 1IDYA 2HDDA 5HWSA 3MKLA 1JKOC 4XRSG 3OSFA 1QMGA 2HOSA 2ID3A 5EZGA 3IV5A 2XPVA 1LFBA 2XB5A 5M5XJ 4A3DJ 2IAIA 2LY9A 1JUPA 4QIWN 1R9TJ 2QYTA 1AHDP 3IQDB 4OM8A 3JRFA 1F17A 1RKWA 1Y1WJ 2ECCA 4W1UA 1YJ8A 3HWRA 5M3FJ 4M6VA 2IZ1A 2DJNA 5DS9A 1UG2A 4I76A 4GWKA 4M3DA 5AYVA 4D3SA 3A03A 3PO2J 3WS7A 4A3MJ 1ZR4A 3S2HJ 2I9PA 3S1QJ 1N1GA 4D5FA 3M4OJ 1FTZA 3Q3CA 3BR1A 3QQAA 1N1EA 4AUXA 1JJ8C 2X58A 3ULKA 4IHXA 4A3BJ 4FE4A 2OF7A 1BA5A 3QPLA 3GTMJ 1EVZA 5FKNA 4A3CJ 3ZQHA 2IEKA 1ETVA 3IH2A 1JDJA 2E2IJ 3S2DJ 2ME0A 2H1KA 3DCFA 5M5WJ 5J1UA 3NARA 2LTPA 3JRHA 1PGPA 3E7LA 2DN0A 4G12A 4IEJA 1M2WA 2ZYGA 9ANTA 1B8IA 5F0HA 4C3IJ 4C3JJ 1F43A 1HCRA 1WPQA 1YJQA 4BKXA 2R5ZA 3HM5A 3VPRA 1O4XA 3HDDA 3I83A 3BR6A 1XC5A 3HOXJ 4D7NA 2EZLA 3Q0UA 1BJZA 5J3LA 3HB9A 5EF6A 2XRLA 3CQZJ 3ZGYA 5GPAA 5A9TA 1F36A 1PGOA 1IGNA 1WDMA 1VPDA 4MFEA 3HEFA 2EBIA 1MBKA 2M8GX 2NVXJ 4A3EJ 4QTRA 1NK2P 2HOTA 2DTZA 1JT0A 1JJ6C 4B3HA 3A01B 3WHBA 3PM1A 3DFUA 1PGJA 3GTOJ 3JRAA 2HYJA 1ZK8A 1JGGA 3G0OA 2DMTA 1E3OC 3ZW8A 1WCMJ 4E13A 1LSJA 4AYBN 3H3VK 3JRBA 1W0TA 2WV1A 2DA7A 3PLRA 1H89C 3BTIA 5IOYA 1U9OA 3UKGA 2ZYAA 2VPRA 3MVPA 2AO9A 5E3LA 4A93J 1VI0A 2LLKA 5F08A 4JQ0D 2Y31A 2JN6A 5HODA 3EGOA 5BNGA 4AC0A 4D3FA 5GP9A 2EZKA 2Y9YA 3TW7A 2R0QC 3LSJA 2NS7A 3C2BA 4J19A 1BL0A 1TWGJ 5EEAA 1UHSA 1MSFC 2R7ZJ 3ZHBA 1POGA 5JE8A 3ZQLA 2OFPA 1GVDA 4DCKA 1ETQA 4OVNF 1MNMC 1WH7A 3A02A 4MFDA 4JX4A 1LFUP 2FX0A 5F1JA 1IUFA 1P7IA 2DMNA 1LJ8A 2DA1A 3BTJA 1X2NA 4D7MA 2EQRA 3CDLA 3ADOA 4L5EA 3H0GJ 4B4CA 4FCYA 4Y7NJ 3BG9A 2R92J 4S3MA 3PDUA 2PMZN 2D5VA 1G2HA 1EVYA 3PEFA 1ITYA 3L1PA 3ZQGA 3BTCA 1NTCA 1VFCA 3GHYA 1RKTA 2XGCA 4UUSA 2M9HA 5FKLA 2LD5A 4CYCA 1AKHA 2Y30A 1BW5A 4B3JA 3HOZJ 4C2MJ 1YRNB 2JA7J 1U8BA 1JKRC 3S17J 1YONA 2CVZA 4JPZB 1JUMA 3JRCA 1FIAA 2R93J 2L9RA 3A01A 5K7HA 1JTXA 3BR0A 5EG0B 5IP9J 2R5YB 2K9SA 3HOYJ 2W48A 3S1NJ 1WDKA 3IH3A 3I4NJ 4XICA 1WGXA 1TWHJ 4PZDA 2CQQA 3DOJA 2RAEA 3LNQA 2KT0A 1MBJA 2EW2A 3OBBA 4IM7A 2MSYA 1QVTA 1X2MA 1YRLA 2CU7A 5FKMA 1ETKA 1AU7A 4X1EA 2VUMJ 2DA4A 1LE8A 2NVQJ 3FR7A 2HQ5A 3HGYA 1FIPA 2DA6A 3MOGA 1UMQA 1X58A 4UUTA 4A3GJ 5JLWA 2K9NA 3W6UA 1EF4A 4B1RA 3G17A 4EEFG 1ETWA 3PJGA 4J0EA 2E2HJ 4JP0A 3HKZN 3H2ZA 2HOAA 2NS8A 3HBLA 5IYCJ 2HXOA 1TWAJ 1HLVA 1T56A 2JWTA 4GBJA 5E3OA 1B72B 3B6CA 1PUFB 2O8KA 1KS9A 5EGOB 1X0VA 1JUSA 2COBA 4NDLA 5FWNA 2CJJA 5EDNA 2FQ4A 2JK3A 3K6JA 4XRSA 1QVUA 4BBSJ 4PZCA 2X48A 1WDLA 4DYDA 2ECBA 5E3MA 4IHYA 1MH4A 5IOZA 1F12A 3WHCA 3CMYA 1GV2A 4JYKA 4V2FA 5M3MJ 5C44J 2Y2ZA 3BR2A 4FE7A 1TWFJ 4DW6A 4Y52J 5DTDA 2XSDC 4YCAA 2DMPA 2LP0A 3BR3A 1GV5A 4D3DA 4GFBA 4GWGA 3ZQFA 2CQXA 2R5YA 2K40A 5F0CA 5FJ8J 1MSEC 2EH3A 3FR8A 2VI6A 3B6AA 4M3FA 4E12A 2GLOA 3LOCA 5K7FA 2XB0X 3FIWA 2M2EA 4A3FJ 3HOUJ 1ZKGA 4A3IJ 3LSPA 1YVEI 1MBEA 1OFCX 2OPTA 5A9SB 1H88C 2MW8A 3RQSA 3G1OA 4DYQA 1RESA 3S1MJ 5F27A 2FD5A 1ZR2A 3GBGA 1FEXA 4DZPA 4IHWA 1SANA 1DLJA 4ABZA 3W6VA 3GTJJ 4A3JJ 4LOCA 1TWCJ 4DYCA 1ZTRA 3Q3SA 1F14A 2QCOA 4MO7A 4W97A 3TW6A 2L0KA 3Q0WA 5M5YJ 2ID6A 4XRMA 2YU9J 2E19A 1M75A 3FWNA 1MBHA 3CKYA 3L6DA 2GM4A 2TCTA 2HDHA 1HF0A 3S16J 3GTLJ 2IYOA 1B72A 1S7EA 1PUFA 1IL0A 3QPSA 1VNDA 3S15J 4R1NA 1IDZA 3PO3J 1PGQA 3FK7A 5IP6A 2ME6A 3C7DB 3O8GA 3BT9A 3FK6A 5FKKA 1LSOA 1ZQ3P 4M3GA 4A3KJ 3ADPA 5J1RA 1ETYA 3JR9A 3ZQCA 2NVTJ 5F0FA 1ENHA 2LR8A 5K7ZA 3ZWBA 2DA5A 2XPWA 1BG6A 3WFJA 2IBDA 2H8RA 1U9NA 1HDDC 4EZBA 3CTVA 4OL9A 1JKPC 2PLAA 3HN2A 4MIMA 2WB1N 3HADA 4BBRJ 1IJWC 3I4MJ 1DU0A 1B8IB 3S1RJ 2AHQA 1Z82A 1CQTA 1GDTA 3F0CA 3GTPJ 2R5ZB 3RZDJ 2IYPA 2JA8J 3OIOA 1DLIA 3TP3A 3QHAA 4PZEA 2HXIA 1Y1VJ 5C4JJ 1JT6A 5EZHA 4I6ZA 4OQZA 2ZYDA 3ZQIA 2EZHA 2N8GA 5A9SA 4RBOA 2X6OA 2W90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKV A;  1OJL A;  1A6I A;  3TP0 A;  1Q1V A;  1APL C;  4HNV A;  2L7M P;  1W0U A;  4A3L J;  3LSG A;  4BXX J;  3SJM A;  1D5Y A;  2LFB A;  3NAU A;  3Q0V A;  4JX6 A;  2YUS A;  3SFI A;  5GPC A;  1IC8 A;  2XPU A;  2DMQ A;  2CUE A;  1MH3 A;  1K83 J;  2G0E A;  2JMW A;  2B63 J;  4V2G A;  4X6A J;  3D1N I;  1RR7 A;  4A69 C;  1T33 A;  2Y9Z A;  4MLO A;  1HOM A;  1Z0X A;  1I6H J;  5F04 A;  3BG5 A;  3DEW A;  1I50 J;  4XID A;  3JRE A;  1GUU A;  5C4X J;  4M3E A;  1JTY A;  2DMU A;  1QRY A;  2JA5 J;  3GTQ J;  3JRG A;  1ETO A;  2X9D A;  3RZO J;  1A5J A;  5C3E J;  1BW6 A;  2ZB9 A;  5FKO A;  3RQI A;  1FJL A;  1WI3 A;  2L7F P;  1K61 A;  2L7Z A;  2O7O A;  2QF7 A;  1ZGW A;  2P81 A;  5IYB J;  1VF9 A;  1IV6 A;  1YRN A;  2JA6 J;  1OCP A;  3IH4 A;  4RDU A;  3G1M A;  2E2J J;  4FIS A;  3S14 J;  3K2A A;  1XS9 A;  2XGE A;  3HGG A;  5IYD J;  3M3Y J;  4BY1 J;  5EG0 A;  4DYR A;  3JRD A;  1Z77 A;  5IPA A;  4FTH A;  2O9L A;  2Y0S N;  1WPK A;  2HI3 A;  1GT0 C;  3BQZ A;  4S0H B;  2FJ1 A;  3G1L A;  3BR5 A;  5IP7 J;  4M3B A;  1FTT A;  4UUS B;  2LVS A;  2DA3 A;  1P7J A;  4CYC B;  1AKH B;  5EYR A;  2DA2 A;  1IG7 A;  4D5C A;  4QSH A;  1HDP A;  4DZJ A;  1IRZ A;  3GTG J;  1MBF A;  4C3H J;  2K9Q A;  3BQY A;  1I3Q J;  3HOW J;  3LSR A;  1SFO J;  4JX5 A;  1RPW A;  4XK4 A;  2XGD A;  3HOV J;  2VKE A;  2JJ7 A;  3SDG A;  2CRG A;  2M0C A;  3JRI A;  1OCT C;  1H8A C;  3MN2 A;  1U78 A;  3RKQ A;  2E1O A;  2GBY A;  3OOU A;  2WAQ N;  2NVY J;  3BG3 A;  4BY7 J;  3K7A J;  2MGQ A;  1WH5 A;  5EGO A;  2NOG A;  1LE8 B;  2CUF A;  1ORK A;  1QPI A;  4B3A A;  3CCY A;  3GTK J;  1RET A;  2TRT A;  5JLX A;  2EZI A;  1ETX A;  2LKX A;  2MG4 A;  2M34 A;  2I10 A;  5J1Y A;  2LK2 A;  5FLV A;  3ZOB A;  3BTL A;  1MBG A;  3O8H A;  2KDZ A;  5E3N A;  1NK3 P;  5FLM J;  3FKI J;  1TC3 C;  1XG1 A;  2YS9 A;  2ELK A;  3FIS A;  3OSG A;  4IHV A;  1JKQ C;  1DU6 A;  3TED A;  1IDY A;  2HDD A;  3MKL A;  1JKO C;  4XRS G;  3OSF A;  2HOS A;  2ID3 A;  5EZG A;  3IV5 A;  2XPV A;  1LFB A;  2XB5 A;  5M5X J;  4A3D J;  2IAI A;  2LY9 A;  1JUP A;  4QIW N;  1R9T J;  1AHD P;  3JRF A;  1RKW A;  1Y1W J;  2ECC A;  4W1U A;  5M3F J;  4M6V A;  2DJN A;  5DS9 A;  1UG2 A;  4I76 A;  4M3D A;  3A03 A;  3PO2 J;  4A3M J;  1ZR4 A;  3S2H J;  3S1Q J;  4D5F A;  3M4O J;  1FTZ A;  3BR1 A;  3QQA A;  4AUX A;  1JJ8 C;  4IHX A;  4A3B J;  4FE4 A;  2OF7 A;  1BA5 A;  3QPL A;  3GTM J;  5FKN A;  4A3C J;  3ZQH A;  2IEK A;  1ETV A;  3IH2 A;  2E2I J;  3S2D J;  2ME0 A;  2H1K A;  3DCF A;  5M5W J;  5J1U A;  3NAR A;  2LTP A;  3JRH A;  3E7L A;  2DN0 A;  4G12 A;  4IEJ A;  9ANT A;  1B8I A;  5F0H A;  4C3I J;  4C3J J;  1F43 A;  1HCR A;  4BKX A;  2R5Z A;  3HM5 A;  3VPR A;  1O4X A;  3HDD A;  3BR6 A;  1XC5 A;  3HOX J;  4D7N A;  2EZL A;  3Q0U A;  1BJZ A;  5J3L A;  3HB9 A;  5EF6 A;  2XRL A;  3CQZ J;  5GPA A;  1F36 A;  1IGN A;  4MFE A;  3HEF A;  2EBI A;  1MBK A;  2M8G X;  2NVX J;  4A3E J;  4QTR A;  1NK2 P;  2HOT A;  2DTZ A;  1JT0 A;  1JJ6 C;  3A01 B;  3WHB A;  3PM1 A;  3GTO J;  3JRA A;  2HYJ A;  1ZK8 A;  1JGG A;  2DMT A;  1E3O C;  1WCM J;  4AYB N;  3H3V K;  3JRB A;  1W0T A;  2WV1 A;  2DA7 A;  1H89 C;  3BTI A;  5IOY A;  1U9O A;  3UKG A;  2VPR A;  3MVP A;  2AO9 A;  5E3L A;  4A93 J;  1VI0 A;  2LLK A;  5F08 A;  4JQ0 D;  2Y31 A;  2JN6 A;  5HOD A;  5BNG A;  4AC0 A;  5GP9 A;  2EZK A;  2Y9Y A;  3TW7 A;  2R0Q C;  3LSJ A;  2NS7 A;  3C2B A;  4J19 A;  1BL0 A;  1TWG J;  5EEA A;  1UHS A;  1MSF C;  2R7Z J;  1POG A;  3ZQL A;  1GVD A;  4DCK A;  1ETQ A;  4OVN F;  1MNM C;  1WH7 A;  3A02 A;  4MFD A;  4JX4 A;  1LFU P;  2FX0 A;  5F1J A;  1IUF A;  1P7I A;  2DMN A;  2DA1 A;  3BTJ A;  1X2N A;  4D7M A;  2EQR A;  3CDL A;  4L5E A;  3H0G J;  4B4C A;  4FCY A;  4Y7N J;  3BG9 A;  2R92 J;  2PMZ N;  2D5V A;  1G2H A;  1ITY A;  3L1P A;  3ZQG A;  3BTC A;  1NTC A;  1VFC A;  1RKT A;  2XGC A;  4UUS A;  2M9H A;  5FKL A;  2LD5 A;  4CYC A;  1AKH A;  2Y30 A;  1BW5 A;  3HOZ J;  4C2M J;  1YRN B;  2JA7 J;  1U8B A;  1JKR C;  3S17 J;  4JPZ B;  1JUM A;  3JRC A;  1FIA A;  2R93 J;  2L9R A;  3A01 A;  5K7H A;  1JTX A;  3BR0 A;  5EG0 B;  5IP9 J;  2R5Y B;  2K9S A;  3HOY J;  2W48 A;  3S1N J;  3IH3 A;  3I4N J;  4XIC A;  1WGX A;  1TWH J;  2CQQ A;  2RAE A;  3LNQ A;  2KT0 A;  1MBJ A;  2MSY A;  1QVT A;  1X2M A;  2CU7 A;  5FKM A;  1ETK A;  1AU7 A;  4X1E A;  2VUM J;  2DA4 A;  1LE8 A;  2NVQ J;  2HQ5 A;  3HGY A;  1FIP A;  2DA6 A;  1UMQ A;  1X58 A;  4UUT A;  4A3G J;  5JLW A;  2K9N A;  1EF4 A;  4B1R A;  4EEF G;  1ETW A;  2E2H J;  4JP0 A;  3HKZ N;  2HOA A;  2NS8 A;  3HBL A;  5IYC J;  2HXO A;  1TWA J;  1HLV A;  1T56 A;  2JWT A;  5E3O A;  1B72 B;  3B6C A;  1PUF B;  2O8K A;  5EGO B;  1JUS A;  2COB A;  4NDL A;  2CJJ A;  5EDN A;  2FQ4 A;  2JK3 A;  4XRS A;  1QVU A;  4BBS J;  2X48 A;  2ECB A;  5E3M A;  4IHY A;  1MH4 A;  5IOZ A;  3WHC A;  3CMY A;  1GV2 A;  4JYK A;  4V2F A;  5M3M J;  5C44 J;  2Y2Z A;  3BR2 A;  4FE7 A;  1TWF J;  4DW6 A;  4Y52 J;  5DTD A;  2XSD C;  2DMP A;  2LP0 A;  3BR3 A;  1GV5 A;  4GFB A;  3ZQF A;  2CQX A;  2R5Y A;  2K40 A;  5F0C A;  5FJ8 J;  1MSE C;  2EH3 A;  2VI6 A;  3B6A A;  4M3F A;  2GLO A;  3LOC A;  5K7F A;  2XB0 X;  3FIW A;  2M2E A;  4A3F J;  3HOU J;  1ZKG A;  4A3I J;  3LSP A;  1MBE A;  1OFC X;  2OPT A;  1H88 C;  2MW8 A;  3G1O A;  4DYQ A;  1RES A;  3S1M J;  5F27 A;  2FD5 A;  1ZR2 A;  3GBG A;  1FEX A;  4DZP A;  4IHW A;  1SAN A;  4ABZ A;  3W6V A;  3GTJ J;  4A3J J;  4LOC A;  1TWC J;  4DYC A;  1ZTR A;  3Q3S A;  2QCO A;  4MO7 A;  4W97 A;  3TW6 A;  2L0K A;  3Q0W A;  5M5Y J;  2ID6 A;  4XRM A;  2YU9 J;  2E19 A;  1MBH A;  2GM4 A;  2TCT A;  1HF0 A;  3S16 J;  3GTL J;  1B72 A;  1S7E A;  1PUF A;  3QPS A;  1VND A;  3S15 J;  1IDZ A;  3PO3 J;  3FK7 A;  5IP6 A;  2ME6 A;  3O8G A;  3BT9 A;  3FK6 A;  5FKK A;  1ZQ3 P;  4M3G A;  4A3K J;  5J1R A;  1ETY A;  3JR9 A;  3ZQC A;  2NVT J;  5F0F A;  1ENH A;  2LR8 A;  5K7Z A;  2DA5 A;  2XPW A;  2IBD A;  2H8R A;  1U9N A;  1HDD C;  1JKP C;  4MIM A;  2WB1 N;  4BBR J;  1IJW C;  3I4M J;  1DU0 A;  1B8I B;  3S1R J;  2AHQ A;  1CQT A;  1GDT A;  3F0C A;  3GTP J;  2R5Z B;  3RZD J;  2JA8 J;  3OIO A;  3TP3 A;  2HXI A;  1Y1V J;  5C4J J;  1JT6 A;  5EZH A;  4I6Z A;  3ZQI A;  2EZH A;  2N8G A;  4RBO A;  2X6O A; 
#chains in the Genus database with same CATH topology
 1KYW A;  5CCG C;  3N4M A;  3HC7 A;  4ANJ A;  3OIQ A;  3K1N A;  1Q1V A;  1MFT A;  1FZB A;  2L7M P;  2M87 A;  1NTM K;  4A3L J;  5C39 A;  3HSR A;  2A06 E;  2EIK H;  2ZJS E;  3CMM A;  1OIP A;  2R32 A;  4C30 A;  3NAU A;  1JGS A;  2AXT E;  2YUS A;  5H2F C;  4EJT A;  3KP7 A;  2RRE A;  5HLI A;  4EJU A;  4HNU A;  3CF5 F;  1MW7 A;  3L74 D;  1MH3 A;  2G0E A;  1NTK E;  3GHG C;  4V2G A;  4X6A J;  2JUG A;  3V2P A;  1A31 A;  1KFN A;  4A69 C;  1DP3 A;  2ITA A;  4KUG A;  1DD3 A;  1O7L A;  3ZP5 A;  4PV1 D;  2F4O B;  2PQ8 A;  1Z0X A;  3BOQ A;  5ERI A;  1EZV D;  2R44 A;  4RB0 A;  2D2C D;  4WWI A;  1QZE A;  4V19 K;  1Z21 A;  5LRS A;  3DEW A;  3VFZ A;  1O3R A;  2IBZ E;  2E36 A;  1QGP A;  3DTE A;  1EDJ A;  4WXC A;  3FMS A;  4M3E A;  5C4X J;  1JTY A;  5DCM A;  4WF2 A;  3F8B A;  2JA5 J;  2QA4 I;  2P4Q A;  5L3D A;  2V9V A;  4D1Q A;  4KA4 A;  1FWZ A;  3GTQ J;  1UEL B;  2X9D A;  2JO1 A;  3CJQ B;  3PUF A;  1A5J A;  3BZK A;  4FGW A;  3N97 A;  4R1H A;  2ICW G;  1FJL A;  2EK5 A;  1K61 A;  2L7Z A;  3KEQ A;  1H88 A;  1OVU A;  2O7O A;  1SVM A;  2OUM A;  1ZGW A;  2OYH A;  1Z67 A;  4L5J A;  2P81 A;  5AVZ B;  1IV6 A;  4YEL A;  1U57 A;  1BI2 A;  3AL0 C;  3L72 E;  3K1M A;  3WTS C;  3G1M A;  3V4Q A;  3H1H D;  3I64 A;  3ZPL A;  3C7A A;  3K2A A;  4PJN A;  2H88 C;  5IYD J;  5CJ0 A;  2ZC2 A;  4U0W A;  3FWL A;  5B5E C;  4RS8 A;  4H44 B;  5KKZ C;  1LEA A;  5TIS H;  2DT6 A;  5IPA A;  4FTH A;  2LR2 A;  4GOE A;  2M8E A;  4PGH A;  2O9L A;  4KUE A;  2Y0S N;  1SD5 A;  2VC0 A;  1QHG A;  1BCC G;  1KON A;  1OYY A;  1HJB A;  3BQZ A;  4S0H B;  3GZ5 A;  3G1L A;  5IP7 J;  2ELH A;  4J0F A;  4UUS B;  2LVS A;  1P7J A;  1AKH B;  5EJC A;  5EYR A;  2DA2 A;  5LGU A;  1BE3 J;  1D7M A;  3LFU A;  4ZYG A;  2JSP A;  4I99 C;  1HDP A;  2FQ3 A;  3H1L J;  3ZN0 A;  3S8P A;  2E1N A;  5JVG F;  3HE4 A;  3RL0 D;  1DPR A;  1FYK A;  2HVR A;  1S4X A;  2HKX A;  1NO4 A;  1YS6 A;  4DZJ A;  5F64 A;  1WJA A;  1KU3 A;  2HFH A;  2ZSI B;  3WTY C;  4C3H J;  4ZYE A;  1S9H A;  1BC7 C;  3L70 E;  2I5U A;  2M45 A;  2NAZ A;  5CMZ A;  1SQP D;  1RPW A;  1M66 A;  2VKE A;  3UNG C;  3OV8 A;  3ONQ A;  2JJ7 A;  3KP5 A;  2FNP A;  4RA2 A;  3SDG A;  1YJ9 I;  4KUH A;  3IN6 A;  1FBM A;  4O9B A;  3LIE A;  1JM0 A;  1R4M B;  2HOD B;  1OCT C;  3A0B H;  2NPS A;  1M56 D;  1U78 A;  4GYI A;  2E1O A;  2YO2 A;  3L74 G;  3BG3 A;  4L75 A;  1EXJ A;  1LP1 B;  2F5D A;  1FAV A;  1ZRT E;  3KPE A;  4LGD E;  3RK3 C;  1YQA A;  4BY7 J;  1S8N A;  3K7A J;  3KYC B;  3V8K A;  3X2Q H;  5EGO A;  1LTA C;  2NOG A;  3EUA A;  3AE9 C;  3L2W A;  5J47 A;  2ACJ A;  1G2C A;  1WRG A;  3BAT A;  4E21 A;  4XON A;  4DOZ A;  2ESH A;  1EZV G;  4B3A A;  3GTK J;  4UVA A;  1VF5 C;  3WTT C;  2QJY B;  1YJ9 P;  4XKW A;  4N9H A;  1D1A A;  5JLX A;  2KIK A;  2BCC D;  2Y0E A;  1LQ1 A;  3NFQ A;  4Y3O A;  1RUN A;  1ETX A;  1XCB A;  2HQR A;  5GTH H;  1G3T A;  4Q5S F;  1PV3 A;  2KL4 A;  3RJP A;  1SD7 A;  1Z1D A;  4QMA A;  1BI3 A;  4II3 A;  3A0H C;  4A6D A;  1G6N A;  5J1Y A;  1XDU A;  1NTZ D;  1SLQ A;  1I27 A;  2P5K A;  3OYK A;  1K9M Q;  2Z99 A;  3CCQ I;  5KLV E;  3BTL A;  1MBG A;  3KP4 A;  1HW5 A;  5E20 A;  3J80 K;  1IXC A;  1CGP A;  3ZWA A;  1FDM A;  1JOC A;  3KPH A;  3LWF A;  2AXL A;  3OYL A;  5FLM J;  1NK3 P;  3F9K A;  3FKI J;  1YI2 I;  3MD0 A;  3I5C A;  4KN7 X;  3MKY B;  2YS9 A;  5HS9 A;  1R1V A;  5IT9 Z;  4P96 A;  2E5N A;  2Y0S A;  2K37 A;  1QNT A;  2VQC A;  4Q48 A;  2BY0 A;  3H1H G;  4YXW H;  3Q5P A;  1A02 F;  4CYD A;  3O2P E;  3LID A;  4IHV A;  1FOY A;  4HST A;  2PAJ A;  2CK3 H;  2ZAE B;  2KP6 A;  1DU6 A;  1PUE E;  3H1J G;  2VQL A;  3HUS B;  2DTR A;  3LA3 A;  1BCC J;  1FOW A;  5APW A;  4HYE A;  2BAS A;  2E74 D;  4AQR D;  3CCQ P;  1RNL A;  1JKO C;  1WWX A;  3H1I D;  4XE5 B;  3U2R A;  2HOS A;  4M71 A;  2KLV A;  2W85 A;  2CFO A;  3AG1 H;  2Z16 A;  1SQX E;  5M5X J;  1YI2 P;  2A05 A;  1K05 A;  2ZVN B;  2R7W A;  4IL6 H;  1QBJ A;  2N1T B;  2DBB A;  2RN0 A;  4CSW A;  3BPV A;  3JC2 2;  2W7N A;  2IBZ D;  5BU5 A;  4ZKP A;  2FUG 2;  5KAI C;  3OS0 A;  1RIO H;  2AEF A;  4O3M A;  4QLC U;  2WMM A;  3VP9 A;  1UG2 A;  4I76 A;  4FHT A;  1F4K A;  4GWK A;  3QPH A;  2CMP A;  4D3S A;  1GD2 E;  3A03 A;  3WS7 A;  1RE3 A;  2RQQ A;  1Z91 A;  1LP1 A;  1SQP G;  4XFJ A;  1U2W A;  4IKF A;  2W25 A;  1EXI A;  5ED4 A;  1FYM A;  1JB0 J;  3OAK A;  4CZC A;  3VMZ A;  1R49 A;  4IHX A;  1OW8 A;  3ZMS A;  3LAP A;  3Q1M A;  1EJ9 A;  3GTM J;  3L72 D;  4KHX A;  2LYC A;  4RB1 A;  2X6W A;  4J00 A;  2ETH A;  2PEX A;  4DQ2 A;  1N7S A;  2FBH A;  2I8D A;  4YII A;  2VRS A;  2XU6 A;  4UVB A;  1GW4 A;  1FOS F;  3HD7 C;  1SVO A;  3IH2 A;  3S2D J;  3DTI A;  1WJ5 A;  2O6G E;  4W7Z A;  2YMY A;  3K70 C;  1OYW A;  5CQG A;  2LTP A;  5J1U A;  1PGP A;  1IK7 A;  2RMZ A;  2X1E A;  1TT0 A;  3QYB A;  2BCC G;  2E5Y A;  3T8R A;  2KZI A;  4LIV A;  3S1K A;  1TQM A;  2YIU B;  3Q9S A;  1TW2 A;  4BKX A;  2F5V A;  1RE4 A;  2A45 I;  1UST A;  1ZP0 C;  2EV5 A;  2V4J C;  1O4X A;  1NTZ G;  5KKZ B;  4KT6 A;  3AEE C;  5DUI A;  2VBW A;  1D1C A;  1XC5 A;  2DQR A;  3HOX J;  1FYL A;  2E7X A;  2PMZ A;  2EZL A;  2RV8 A;  3Q0U A;  1BJZ A;  4D7N A;  4MHG A;  2G8Y A;  4HF0 A;  1ON2 A;  2HFE D;  3IF4 A;  3CQZ J;  1W7P B;  2I1J A;  3L70 D;  3NMD A;  3H1H J;  1IGN A;  4IVN A;  3DF8 A;  2W27 A;  3LMM A;  3PNV A;  2EBI A;  4GRI A;  2ZJP F;  4A3E J;  4L18 B;  3ZQ7 A;  3H1J J;  4L73 A;  1NK2 P;  1U5T C;  2KJB A;  2A06 G;  1KYO E;  1BIA A;  2A45 H;  2L54 A;  5E8I A;  1R00 A;  1PPJ E;  3J7A Y;  2YXR B;  3CP2 A;  4B3H A;  3L9F A;  3A01 B;  5GTI H;  4E7J A;  3PM1 A;  4NC8 A;  3GTO J;  2HYJ A;  1NTK G;  2WAD A;  5AIP A;  1ZRT D;  1ZK8 A;  3H3Z A;  2V7Q J;  1ZRD A;  2OU2 A;  5E79 C;  3H1I G;  3L71 E;  4C7N B;  4D0P A;  4E13 A;  5KTB A;  1BOB A;  3PUB A;  3L75 E;  2FBK A;  1W0T A;  5IOY A;  3I56 I;  1IAW A;  1J5Y A;  1U9O A;  3BG6 A;  4BYY A;  2Y48 A;  4XA4 A;  1K78 A;  1I5Z A;  1VZ0 A;  2VPR A;  3MVP A;  3PQK A;  1K6O A;  2TDX A;  2QZ8 A;  3HUG A;  3ZXS A;  2IBZ G;  2V7Q H;  2LLK A;  3G73 A;  1K04 A;  2R7R A;  1YJW I;  1VQ9 I;  2G7U A;  2OCE A;  2JR8 A;  4I7H A;  5LFA A;  2EFW A;  1SQP J;  4YFX F;  1R5S A;  2EIM H;  2RGV A;  5D8L B;  2R3S A;  3CD6 I;  2L91 A;  3IWZ A;  1IZ1 A;  3TW7 A;  2XDV A;  3L4F A;  2DFE A;  4I98 B;  1CI6 B;  2R7Z J;  2Q9I A;  3MWM A;  4KUM A;  1RH5 B;  1W5C C;  3I56 P;  4GCV A;  4IL6 X;  2CGP A;  4RGU A;  4E4H A;  1FDI A;  3JCU H;  1SFC B;  4HW0 A;  4NUB A;  1YTY A;  3L72 G;  2NPS D;  1YJW P;  1VQ9 P;  3A02 A;  3RYR A;  1FZC B;  2OAR A;  5D5V B;  1KB9 I;  3CD6 P;  1K6Y A;  4B09 A;  3RK2 C;  3BTJ A;  3VMA A;  3L36 A;  1X2N A;  2F5F A;  3JSV C;  3IR9 A;  1FBQ A;  4N4N B;  3ADO A;  1LJ2 A;  1SQX D;  4B4C A;  5AVQ B;  1YHQ I;  3BG9 A;  3QU6 A;  2YR2 A;  4S3M A;  2P1J A;  3PDU A;  1ITY A;  4M6X A;  2J5U A;  1FP2 A;  5AVV B;  3OYA A;  3F8F A;  1VFC A;  1P84 I;  4FQG A;  2VJ4 A;  2CFX A;  5FKL A;  1OCZ H;  3BCC J;  3S4R A;  4CYC A;  1BW5 A;  4B3J A;  4AVP A;  1NHA A;  3RKX A;  2KI7 B;  1U8B A;  2LNB A;  1DUX C;  3S17 J;  2CVZ A;  1RQV A;  1MMA A;  3L70 G;  2CSO A;  2L9R A;  3A01 A;  2K9Y A;  2K88 A;  3AE1 C;  4U7D A;  1DD4 A;  2R5Y B;  1KMI Z;  4BNC A;  4ZNC A;  1IJD B;  3BPX A;  2IPQ X;  3IH3 A;  4EM2 A;  4HDU A;  3I4N J;  1NTK J;  4ITV A;  3TGU E;  3CCS P;  1GU4 A;  3V42 A;  4PZD A;  2HGC A;  2CQQ A;  3MEX A;  1MIJ A;  2VJ5 A;  2WSF J;  4KIS A;  3JSP A;  4BQA A;  3I0T A;  1G1I A;  1OQY A;  2EFO A;  4IM7 A;  1F9N A;  5BOX A;  4OIQ F;  1QVT A;  1ETK A;  4XM3 A;  4X1E A;  3ESW B;  5CVR A;  1ZW0 A;  2E1M C;  4TT3 H;  3SZT A;  3CJR B;  1FT9 A;  2HQ5 A;  1FIP A;  2E5T A;  4GT1 A;  2K3R A;  2DU9 A;  2XC7 A;  4CHU A;  2WSF H;  3IAO A;  3FX0 A;  1ZGA A;  5E1Z B;  3IKV A;  2XV5 A;  2ZT9 C;  5L8R J;  4JP0 A;  2LY1 A;  1NH3 A;  2KS1 B;  1SFC A;  2K9L A;  5IYC J;  1DIP A;  4CCN A;  5D4R A;  5KLV G;  3F6V A;  5E3O A;  1B72 B;  1FZC A;  3ZRG A;  3MZ8 A;  1M1J A;  3L72 J;  3EWK A;  3GLL A;  1GZL A;  4NPE A;  2R7F A;  4D6T E;  3MKW B;  2E42 A;  1JUS A;  4NDL A;  1DGR M;  2E76 B;  2Y0C A;  2KKO A;  1KYO D;  2FFD B;  3K6J A;  1L3L A;  2KUB A;  2Z9O A;  2PRR A;  3KP2 A;  1PPJ D;  2M0M A;  1PP8 F;  2QQ9 A;  1SQV E;  2X48 A;  3HOT A;  4BRY B;  1N7S D;  4DYD A;  2WT7 B;  2P58 A;  4IHY A;  3I3L A;  5TRD A;  5IOZ A;  1URQ C;  3CMY A;  3HRM A;  3L71 D;  4V2F A;  2Z3Y A;  5M3M J;  2B89 A;  4UNO A;  4AU7 A;  3L75 D;  1HW1 A;  4CH7 A;  1SQX G;  4L0Z B;  2XSD C;  1X1A A;  5DD8 A;  1T3J A;  3E5X A;  1J7K A;  3P7K A;  1PYV A;  3CME P;  5LHH A;  3BR3 A;  1GV5 A;  1JE8 A;  3ABV C;  4C2U A;  3GHG B;  2CQX A;  2R5Y A;  1BGY E;  1Y8Q B;  2H94 A;  1KU2 A;  3MMY B;  5F0C A;  4LLL A;  1V3F A;  5FJ8 J;  3L70 J;  1YW8 A;  4M3F A;  3B6A A;  3GLX A;  2MLG A;  2K9M A;  3OOP A;  3OYG A;  3J7A O;  2UUZ A;  1NH4 A;  5KLV J;  2XB0 X;  3GZN B;  1X22 A;  5KJ7 C;  3F21 A;  3Q5F A;  3HOU J;  3QRF F;  4C9Y A;  1YVE I;  1UHM A;  3GWZ A;  1WVR A;  3GXO A;  3SFZ A;  3G1O A;  1X4O A;  1IW7 F;  4LK0 F;  2YPR A;  3S1M J;  1P6R A;  4YIF A;  1UIX A;  2WZ7 A;  1V55 H;  2FYZ A;  2KNC B;  1QGK B;  2KLU A;  1NU1 D;  2DW4 A;  2F48 A;  2XAG A;  3AKZ A;  5AVX B;  1XDS A;  1Y56 A;  4MTE A;  3HOS A;  4ABZ A;  4FET A;  1USD A;  4PJ0 C;  3CC7 I;  2QM7 A;  2Z33 A;  5AVR B;  1ZTR A;  3VDX A;  4BAC A;  2ISZ A;  2QKL B;  2QCO A;  3LL7 A;  2ZME C;  4XRM A;  5M5Y J;  1CF7 A;  2E19 A;  1SP4 A;  1V5G A;  3CO7 C;  3L6D A;  2NRG A;  2GM4 A;  3AL0 B;  2O61 A;  2HDH A;  1JY3 O;  1HF0 A;  3GTL J;  2IYO A;  1B72 A;  2H1L A;  5B66 C;  1LJ9 A;  2L5Q A;  3VB2 A;  1VND A;  3CX5 I;  2B0L A;  1IDZ A;  1I6X A;  4WXH A;  2G9W A;  3B5N A;  1PGQ A;  3AG4 H;  1YLF A;  2HOE A;  3IAS 2;  2ME6 A;  5FD6 A;  4ZDO A;  1PL5 A;  2GA1 A;  1JY3 P;  4TLF A;  1OR7 A;  1TQP A;  5K5G B;  3VN0 A;  1B4A A;  3SHF A;  1KV4 A;  3IP4 B;  1SQQ D;  1O7F A;  4HRI A;  4TV7 A;  3FX3 A;  3CES A;  4UV9 A;  4LIU A;  2NVT J;  5CCG A;  1ZME C;  1OX3 A;  3EFF K;  2LR8 A;  2IS4 A;  2DA5 A;  3P9C A;  4LG0 B;  4B8X A;  3O6Q B;  2XPW A;  4I0B A;  2IBD A;  2V1N A;  4EZB A;  3FM5 A;  1OMI A;  1H0M A;  1PPJ G;  2HZD A;  2OTL I;  2M5A A;  2FBW C;  3TGU D;  1YS7 A;  2RKH A;  3HAD A;  4B43 A;  5JFR A;  4F92 B;  1IJW C;  1DU0 A;  1SQX J;  1YYC A;  3L71 G;  3F89 A;  3AE6 C;  3GHG A;  4K3A A;  3F0C A;  2OYO A;  3DTK A;  1LDD A;  3K4J A;  2BV6 A;  3M1E A;  5LD2 C;  3L75 G;  1T2K C;  3OIO A;  3TP3 A;  3WTW C;  1ZG3 A;  2X6Y A;  3C8V A;  2XGX A;  2WWW A;  3KX2 A;  1LVK A;  3KZI E;  1OVR A;  1FDO A;  1VPC A;  4OIO F;  4IL6 E;  3HTK A;  3H9G A;  1O57 A;  2EZH A;  3RK3 B;  2N8G A;  4M72 A;  3M07 A;  1E79 H;  4RBO A;  4AIK A;  1GK4 A;  1T8I A;  2VKV A;  3MZW B;  4OGQ C;  4H4K C;  4M73 A;  1APL C;  1N2D C;  3PHL A;  1TTY A;  4OAZ A;  1L0L J;  3FXQ A;  3PSI A;  3VSL A;  2W8Z A;  2KNC A;  3LSG A;  4BXX J;  1BJA A;  1NG7 A;  3SJM A;  1N78 A;  1JMB A;  3VTP C;  1RF1 C;  1ZEL A;  3WFI A;  4YFN F;  2LFB A;  2P5V A;  1YO5 C;  2XV4 S;  4JX6 A;  1QQI A;  3PJR A;  2RKL A;  4KIF A;  1FMV A;  1K83 J;  2JMW A;  4W80 A;  4HKZ H;  2QM3 A;  2B63 J;  3GYH X;  4L74 A;  3Q3D A;  1BOA A;  4X0G A;  2EA4 A;  2Y9Z A;  4A6E A;  4MLO A;  5A2Q K;  1HOM A;  3A5T A;  4RLF A;  2HDC A;  3M8F A;  3NRV A;  1SQV D;  1KD1 Q;  1IFJ A;  1KIL E;  4LJZ F;  3C1D A;  4BE2 A;  2O01 J;  2BW3 B;  2B87 B;  3M1C A;  3DKY A;  4IX7 A;  2HZT A;  2EFN A;  2DMU A;  4LFU A;  4ZDL A;  3EUK L;  3WE2 A;  1SEU A;  2ZFW A;  1E2X A;  1SQP K;  3M8J A;  2KRF A;  2M5W A;  3W6Z A;  3SSU A;  2VOO A;  2XAQ A;  5FKO A;  1WI3 A;  2L7F P;  1HKS A;  1RI7 A;  2GQQ A;  3K6G A;  3HIF A;  3KP3 A;  3BP8 A;  4LIT A;  4ASN A;  5LGT A;  1BGY D;  1LTJ C;  4JOM A;  2R4G A;  1S72 I;  1P9Q C;  2LF8 A;  1SFC D;  2DOF A;  1SAU A;  2IJL A;  1SQB J;  2W82 A;  5IYB J;  2LRD A;  4H13 D;  1MMN A;  1MMD A;  2DYS H;  3MZY A;  2R7O A;  1OCP A;  5IT3 A;  3W2A A;  3IFM A;  3VMX A;  3HHG A;  3LA2 A;  3HYI A;  2E2J J;  2QRX A;  4WBA A;  3IRR A;  4CO8 A;  3M0A A;  4EYY Q;  2H7H A;  3H5A A;  3HGG A;  3E6C C;  5A9R A;  1NJI Q;  1ZG5 A;  4RAF A;  3GFI A;  4BY1 J;  3SFE C;  4BXL A;  3LW5 H;  4PFO A;  3U9G A;  4DYR A;  4EM1 A;  5EG0 A;  1PP9 E;  4I6M C;  1Z77 A;  2X6X A;  3TMO A;  3L71 J;  3SZP A;  3TGU G;  2P8T A;  1UG0 A;  2GIZ A;  1ERD A;  2STW A;  3R4K A;  1WPK A;  1WP4 A;  2UV1 A;  5AON A;  1S72 P;  1GT0 C;  3E6B A;  3BR5 A;  1T0F C;  3REO A;  3S32 A;  1DGW Y;  3VYU B;  3ZN1 A;  2W6J H;  3HRN A;  2WV0 A;  3PRJ A;  4ASW A;  1KQ0 A;  2P7V B;  3PSF A;  2AS5 F;  1FZA A;  4NC6 A;  3NTN A;  1TBX A;  4QSH A;  5K5Q A;  3U1K A;  5FGM A;  3M9A A;  1IRZ A;  3VYI A;  4CXF A;  2V4H A;  4QPQ A;  5FLX Z;  1CZQ A;  2IXS A;  1MBF A;  3D0S A;  2K9Q A;  3BQY A;  2CQK A;  2LRE A;  3M7G A;  3HOW J;  1J1E B;  3H92 A;  1WQ2 A;  1R22 A;  4XK4 A;  2LKP A;  4KMU X;  4F91 B;  3AE5 C;  1N73 C;  3RKY A;  1UB9 A;  4BH9 A;  5HNH A;  2XIG A;  2IFM A;  2K7L A;  2PN6 A;  1P2F A;  3D5S C;  5CQE A;  3A0B C;  2GIV A;  3JRI A;  1X0X A;  1NTK K;  2BHZ A;  1S3J A;  2VKD A;  3H5R A;  3ZWC A;  2E1C A;  1KZU B;  5HDG A;  2WAQ N;  3SEZ A;  5LEK A;  4U88 A;  2ZSH B;  2BW3 A;  4DLL A;  2LXC B;  3E97 A;  2JTV A;  3CF2 A;  3JCU E;  3FGA D;  2QVO A;  1LT9 A;  1X3W B;  2CUF A;  4OQY A;  5MGB A;  1EV7 A;  3I4P A;  1SQV G;  2QJP C;  1Y0U A;  1RET A;  3GLM A;  2TRT A;  2MLK A;  4OAY A;  1IFN A;  4WY4 D;  3V8J A;  2PJP A;  1JTH A;  5GTH C;  2DCE A;  3RKW A;  2ZXE B;  2LKX A;  1T6S A;  4KJZ A;  1U5T B;  4B3I A;  4I02 A;  3OY9 A;  2XKO A;  1ZCJ A;  2M34 A;  2I10 A;  1KQ9 A;  3GZ6 A;  1N25 A;  4F55 A;  2LK2 A;  2O3J A;  1MMG A;  3WGI A;  2D3T A;  3O8H A;  2CPB A;  2W00 A;  3B5N D;  1BGY G;  4PK4 A;  1KB9 E;  1HWT C;  2A6T A;  2E76 D;  4OMZ A;  2ELJ A;  1FY7 A;  2XF7 A;  3GFL A;  1WZ2 A;  2VB6 A;  2JPB A;  4E7L A;  1NHL A;  1R5L A;  2K86 A;  2MAB A;  3OYM A;  4G9Y A;  1B9M A;  3CO6 C;  1HA8 A;  2NZ2 A;  2A68 F;  3U21 A;  3WG7 H;  3TGU J;  3TED A;  1ZYR F;  1YJN I;  1JY3 N;  5A2Q Z;  1P84 E;  3MKL A;  2DJI A;  4XOP A;  5BPI A;  3BRT B;  4GKG A;  3LFK A;  3MKZ A;  1L4A B;  2N9B A;  2ID3 A;  1FX7 A;  2JRT A;  1PIX A;  1ZXG A;  4FT8 A;  2V7F A;  1UCR A;  3WOD F;  2IAI A;  2WC2 A;  3VP8 A;  1IZN B;  2QYT A;  1R58 A;  4OM8 A;  1F17 A;  1KIL D;  5IT9 K;  4KT0 J;  3HD7 A;  4DZO A;  4WX9 A;  1YJ8 A;  2YX7 A;  2QIW A;  3GX4 X;  1R4N B;  4BGD A;  5M3F J;  3AE2 C;  1SD4 A;  4LMY A;  5CJ9 A;  3UR3 C;  3H1I E;  5APU A;  2DK8 A;  1YJN P;  2XVC A;  1PVE A;  1A36 A;  4HSR A;  4LB5 A;  1OZH A;  4YIR X;  2OBP A;  4AYC A;  1ZH5 A;  2WAQ A;  1ZR4 A;  4BJT A;  3S2H J;  5LEJ A;  3RK2 B;  1FBS A;  1N1G A;  1WRJ A;  4D5F A;  1L0N E;  1FTZ A;  3Q3C A;  4M9S A;  3BR1 A;  3QQA A;  1FOS E;  4AUX A;  1JJ8 C;  3ULK A;  1R36 A;  4LC1 A;  4D6T J;  3K4B A;  2OF7 A;  1YQ4 C;  2Y0M A;  3WU2 H;  4CCM A;  2HPC B;  4BL0 B;  2YMK A;  4NHJ A;  1IUY A;  1XSD A;  2XAU A;  4LB6 B;  2YXQ B;  2H09 A;  4HJG H;  1SQV J;  2EPF A;  2VPL A;  2OGU A;  4EI2 A;  2NOJ B;  1U5T A;  3AE7 C;  2ME0 A;  2WAF A;  1PP9 D;  1QVF O;  1IN4 A;  3DCF A;  3I59 B;  1XPX A;  1KU7 A;  3NAR A;  4IF4 A;  4Y15 A;  4HDV A;  4IOA F;  1RQU A;  4G12 A;  4KNY A;  4RGR A;  4PV1 C;  3WUU A;  2JEE A;  2VAS A;  2ZYG A;  2NVU B;  3K4L A;  1GXQ A;  1Z05 A;  4C3I J;  4F93 B;  2BEQ D;  1WPQ A;  2QA4 P;  3CDH A;  4YFK F;  4BHP A;  2YKP A;  1VQO I;  2QEX I;  2R5Z A;  1QL1 A;  2PP6 A;  5KLV K;  1CSB A;  3DBL B;  1HST A;  1R6R A;  3QU3 A;  5FFZ A;  3HDD A;  1BGY J;  3DXJ F;  4UHT A;  3C1L A;  1Z6R A;  2MA3 A;  4FX4 A;  4M9Z A;  5GAG J;  3O8Z A;  2KP8 A;  4B86 A;  1AFO A;  1MND A;  3GCM A;  4BE1 A;  4ZDP A;  3QWL A;  4XKV A;  3KYQ A;  1PGO A;  1WDM A;  4MFE A;  4PJL A;  3HEF A;  3COA C;  4UB8 E;  2M8G X;  2E1M B;  4Y17 A;  4Y28 J;  3ABL H;  1W1W E;  3KET A;  1ZAR A;  4ZYH A;  1JT0 A;  1VQO P;  1AWC A;  5BU8 B;  2UWM A;  2QEX P;  4N78 D;  1HSJ A;  5LBQ A;  1SVF A;  2FYU E;  5GTI C;  1YFH A;  3TSI A;  2CWE A;  2M7A A;  3DFU A;  1IFD A;  3JRA A;  1SQX K;  2ZT9 B;  4ENK A;  3AG3 H;  4WXD A;  3ZW8 A;  1WCM J;  2FXP A;  1S9K E;  2NNY A;  2POH A;  3BWG A;  1LSJ A;  2KFD A;  4B47 A;  4Z6Y A;  1Q2N A;  2J59 M;  2DA7 A;  3OS1 A;  1H89 C;  1QHH D;  3BTI A;  1ZRF A;  2VQG A;  2HPM A;  2AEJ A;  3PIO F;  3UKG A;  2ZNY A;  2OZU A;  1W2B O;  2J5O A;  4A93 J;  3M91 A;  2XAS A;  3FZV A;  3CLQ A;  4JQ0 D;  1GVJ A;  4C7R A;  3FDY A;  5HOD A;  4CGZ A;  1Z9C A;  3EGO A;  4O6J A;  1I3A A;  5GP9 A;  1L0L K;  1VF5 D;  2HPC A;  5GAD J;  2NS7 A;  3L2R A;  1XGS A;  1IXS B;  1SMT A;  4J19 A;  1D0Y A;  5EEA A;  3CCE I;  1URQ B;  5KAF E;  3D6Z A;  1KB9 D;  1OLT A;  1Q7Y Q;  3KXD A;  4YTP C;  3J81 K;  5GAH J;  3BCA A;  4HOB A;  2A5Y B;  4PUS A;  5AVY B;  1NWQ A;  4NBQ A;  2FEZ A;  2M8R A;  3LQR A;  1IRG A;  1Q81 Q;  1MNM C;  2V1U A;  4IFM A;  3G3Z A;  1AA7 A;  2BBY A;  1W5C E;  4MFD A;  2XF6 A;  4JX4 A;  2FX0 A;  1LFU P;  4PD4 D;  3TO6 A;  3CUQ C;  1P7I A;  3CX5 E;  5APV A;  5EEG A;  2DA1 A;  1LJ8 A;  1PP9 G;  5LHI A;  1P84 D;  3D70 A;  1H9G A;  4D7M A;  2H6C A;  4Q47 A;  2A45 G;  1MMS A;  3H1K E;  1JNM A;  2ISY A;  1JCC A;  1R8E A;  4OMY A;  3CCE P;  2XHK A;  2K85 A;  5DJT B;  2KPM A;  3H0G J;  4L5E A;  3EPZ A;  3TDZ C;  1FSH A;  1LNQ A;  4OWR B;  5FO5 A;  2PMZ N;  3ITK A;  1EKE A;  2HDW A;  1YE9 A;  3VSK A;  4YRV A;  2XRN A;  3L1P A;  1W4M A;  2QYO A;  3L2U A;  2B9S A;  2C9N Y;  4H0L D;  1NVO A;  5J40 A;  3MFK A;  4UUS A;  2M9H A;  3H1C A;  4P55 A;  3RTR A;  2D1V A;  3GUD A;  1J0R A;  1AKH A;  2P5L C;  2WSE J;  3HOZ J;  3GVA A;  2MC4 A;  1YRN B;  1HKT A;  1H0T B;  4R4M A;  1I39 A;  2PFB A;  3ERM A;  1SQB K;  2BEZ F;  2VT3 A;  3IWF A;  3L2Q A;  1SFK A;  3KZI H;  4BHC A;  3BC8 A;  4Y99 C;  2ZME B;  2OQR A;  3HPH A;  1L0N D;  2WSE H;  2QVA A;  4GOD A;  2OCC H;  3S1N J;  1I1G A;  2IGM A;  1WDK A;  1Q86 Q;  2O5R A;  2FA5 A;  1V54 H;  3KYD B;  4KT5 C;  1U0J A;  4XIC A;  2OJE D;  2HOD A;  2CW8 A;  3ROU A;  1B59 A;  3JAM K;  3R0J A;  3DOJ A;  1X0T A;  2RAE A;  3OYN A;  2LKM A;  2F2E A;  2KT0 A;  2AXT C;  2C9L Y;  2KK7 A;  3CXH D;  3EFG A;  3V8L A;  1W36 D;  1YRL A;  5FKM A;  2F4M B;  3K4N A;  3CC2 I;  2E74 C;  2DK5 A;  2VUM J;  3L74 J;  2DA4 A;  1PDN C;  3AEA C;  2JWA A;  3HGY A;  1DH3 A;  2EIL H;  1WMK A;  4OOI A;  3HE5 B;  4U3F D;  5H2F H;  2K9N A;  2PMH A;  4ZZD A;  3W6U A;  3RBX A;  1TNT A;  3ECO A;  3N05 A;  2L9S A;  5E18 F;  2E75 C;  2J58 A;  1A04 A;  1ETW A;  2V79 A;  3FWE A;  1T6A A;  4HPQ A;  5F1R A;  2ZFU A;  1J1E C;  2JQ7 A;  5CBO A;  2HVQ A;  3ISP A;  3H2Z A;  1Y47 A;  2NS8 A;  3BCB A;  3HBL A;  3ABK H;  1TL8 A;  4IRH A;  4EJO A;  2NRA C;  3KIO A;  2JDI H;  3BZ6 A;  1JEK A;  3CC2 P;  3B6C A;  4ZH4 F;  2O8K A;  3SWY A;  3D6Y A;  1KS9 A;  4IPA A;  4DBR A;  2CH0 A;  3H5N A;  4UB6 C;  4XL9 A;  5F6F A;  3CCV I;  1X0V A;  3II6 A;  1MGT A;  3WU0 A;  4J01 A;  4L76 A;  1MJA A;  2CG4 A;  4IOC F;  2H89 C;  4KMF A;  4XRS A;  4NQW B;  3PTZ A;  2MBF A;  4A2U A;  2CV0 A;  1OW6 A;  5IY5 H;  1WDL A;  2K3F A;  4BQO A;  2FYU D;  5LRR A;  2ECB A;  5E3M A;  3T97 B;  1J09 A;  1J1D C;  4OGQ B;  2QG4 A;  2X4H A;  3WHC A;  4HNT A;  2P10 A;  3HUS A;  5JHF A;  4JYK A;  1UFM A;  2K5C A;  1VL2 A;  2XDJ A;  1S9K D;  4EMS A;  4G6D A;  1MJB A;  2JRM A;  1ZN2 A;  3PIP F;  1H0T A;  1AA0 A;  4FE7 A;  1IN6 A;  1RF1 B;  1LVA A;  2RNJ A;  4DIQ A;  3TOB A;  5DTD A;  4BWN A;  4YCA A;  3CCV P;  1OCC H;  1KQF B;  1LEB A;  4RJT A;  2N1T A;  4ESF A;  3HRT A;  3C9I A;  4II2 A;  1MSE C;  3FXK A;  2A69 F;  4E12 A;  1LB2 A;  3WGH A;  2IFN A;  4KJM A;  1W5S A;  4BHB A;  2M30 A;  5JI6 A;  5HDN A;  1GL2 C;  1BBY A;  3H9Q A;  3WG9 A;  3J81 Z;  4A3F J;  5M1B A;  4A3I J;  4IQ4 A;  2VQH A;  1WJE A;  2EFQ A;  3B8E B;  1VQL I;  4HF1 A;  1MBE A;  1OFC X;  2EFP A;  4F3Q A;  1L0N G;  1H88 C;  5B3S H;  2MW8 A;  3RQ4 A;  3RQS A;  3P8M C;  4DYQ A;  1JMM A;  1DEB A;  5F27 A;  4FAS D;  2LKS A;  3GBG A;  3F23 A;  4I2O A;  2COM A;  4DZP A;  5JHU A;  5K5O A;  4XLN F;  1R71 A;  1L4A C;  1YTZ T;  3GTJ J;  3HE5 A;  1USS A;  2RC4 A;  4LOC A;  1KQL A;  3S9O A;  2LSO A;  2GWR A;  2XZR A;  2R5D A;  4JBZ A;  1AVO A;  3DEE A;  2ZVO B;  3Q0W A;  3ZGK A;  1LTJ B;  3CX5 D;  3FWN A;  3MZH A;  1VQL P;  3Q9V A;  3H1K D;  2QEN A;  1NU1 E;  4U3F G;  1KU9 A;  2M3A A;  2IVM A;  2PMU A;  1S7E A;  1UZC A;  3U59 A;  1X9V A;  3QPS A;  3S15 J;  4R1N A;  4RAY A;  2EA2 A;  2KXP B;  2IGO A;  3PO3 J;  3RK2 D;  3EQL F;  1T2K A;  3FK7 A;  3D1L A;  1A02 J;  3O8G A;  2FXA A;  3FBN B;  3BT9 A;  3FK6 A;  1FOK A;  2BCC J;  5FKK A;  2XND H;  1W5T A;  3F72 A;  3SFD C;  2ZFC A;  4M3G A;  5HS7 A;  4PD4 I;  1E3P A;  1Q1H A;  3CP8 A;  3TGN A;  1VQK I;  3NXS A;  1NYH A;  5DM7 F;  3T97 A;  4KN4 X;  3OYD A;  2K02 A;  3QP6 A;  1W7P A;  2FBI A;  1ENH A;  5F0F A;  5K7Z A;  3ZWB A;  1NTZ J;  4BEH B;  1WJD A;  2N9Y B;  1TW3 A;  3JAM Z;  2WY7 Q;  1BG6 A;  1IC2 A;  5BPD A;  2H8R A;  2EWN A;  2IS1 A;  1QZY A;  1KB9 H;  1SQV K;  4GOF A;  4RO0 A;  5AW2 B;  1MJ9 A;  1F1Z A;  4OL9 A;  4IJA A;  3TDU C;  3A0H H;  1JKP C;  2L5G B;  1SQQ E;  2X85 A;  2NPS C;  2FYU G;  4IXA A;  3BVH A;  2DI3 A;  3I4M J;  3L00 A;  1B8I B;  3S1R J;  1HTL C;  1JY2 O;  3I71 A;  4PD4 H;  4YXD C;  2KHM A;  3DPT A;  2ZXW H;  1YHQ P;  3RZD J;  2IYP A;  3AEB C;  1N73 B;  4H44 D;  1DLI A;  4C7N A;  4P1W A;  2VJI A;  5AVS B;  1VQK P;  1P84 H;  4EGY A;  2KZG A;  4W7Y A;  3CPW O;  1JY2 P;  2WVR A;  1XCV A;  1JT6 A;  3DEU A;  3H1I J;  4U0V A;  1YG2 A;  3ZQI A;  5HOO A;  2BVM A;  3DLL F;  1SFE A;  2X6O A;  2W90 A;  1V5E A;  2XUB A;  3FXR A;  1A6I A;  3TP0 A;  5KHD A;  2R7U A;  2O8X A;  2OQG A;  3DWL E;  4HNV A;  4ZTF A;  4FX0 A;  2ADU A;  1L0N J;  3M06 A;  1D5Y A;  2QJP B;  4P9U A;  1JCD A;  3VYS B;  5CLS A;  1GTW A;  3D71 A;  3Q0V A;  2GXG A;  4U7B A;  3SFI A;  2DPD A;  1XD7 A;  2ZT9 D;  3CXH I;  1CI6 A;  2XPU A;  2BY1 A;  1Z3Y A;  2H8W A;  1OPC A;  2GAU A;  2IGN A;  1LTJ A;  4GDO A;  3OR1 C;  5KAI H;  3D1N I;  1RR7 A;  2PGD A;  3WU2 E;  3ASO H;  4A0Z A;  4I7Z C;  1B9N A;  1FZP B;  2A6H F;  4ZKU A;  5EEH A;  3EUH C;  1I6H J;  3D5R C;  1YB4 A;  5F04 A;  3BG5 A;  4UVC A;  1I50 J;  2HVS A;  4IQJ A;  3PNY A;  1G1J A;  3CXH H;  3H1K G;  1GUU A;  1XMA A;  4PCQ A;  5KCM A;  3CC4 I;  3ZMD A;  5AVU B;  1QRY A;  2C0W A;  1RZ4 A;  3P7N A;  3BG7 A;  3JRG A;  1ETO A;  1N8R Q;  1P92 A;  3DBH B;  2ZXX A;  1T0F A;  3DPU A;  5C3E J;  1BW6 A;  2CUZ A;  2ZB9 A;  4HF2 A;  3RQI A;  2KZV A;  1V4R A;  2Q0O A;  2WA0 A;  4BJ5 C;  4BUP A;  3CTA A;  2AEM A;  4BEH A;  1BM9 A;  3R2P A;  3FF5 A;  4WCG A;  1U3E M;  4PJM A;  2JWD A;  3HSF A;  3QH9 A;  3FMR A;  2F4I A;  4XN3 A;  1HW2 A;  3F3S A;  2JA6 J;  2MH2 A;  3IH4 A;  1NAY A;  4FIS A;  3KDP B;  2KSJ A;  2HS5 A;  3S3N A;  1XS9 A;  3CC4 P;  3E5Q A;  4F7Z A;  3Q2Y A;  1IXR C;  4NPD A;  2FOW A;  5B1B H;  2FYU J;  3OMY A;  2RN7 A;  3VEP A;  4DNC A;  2KIQ A;  3RPU A;  3JRD A;  4BXF A;  2A61 A;  4UB8 H;  2MH9 A;  2R7S A;  3K9T A;  5APQ A;  1BIB A;  1S6L A;  2FU4 A;  2FJ1 A;  3OYF A;  2R7T A;  2IZ0 A;  1ZLK A;  3AE3 C;  2Q2E B;  1FTT A;  5CVJ A;  3HDH A;  1N7S C;  3ZR8 X;  2PI0 A;  3ML6 A;  1IG7 A;  1K4T A;  2R7D A;  2WAE A;  2K3P A;  1SAX A;  1LTI C;  1D0Z A;  3HTU A;  2GUV A;  1DQU A;  5AW9 B;  1EQ7 A;  2FE3 A;  1E0E A;  2H27 A;  2N1T D;  3ZMU A;  5FD5 A;  2JKV A;  2L3D A;  2RQP A;  4AID A;  4E7I A;  5D5U B;  1SFO J;  2XGD A;  3ZDM A;  1BSN A;  2CQN A;  3NWS A;  2NYX A;  4KIC A;  3S3M A;  4MEY F;  4CDG A;  3L37 A;  3GF7 A;  2KS1 A;  1FZF A;  2M0C A;  2Y0D A;  3KFW X;  1H8A C;  2W6A A;  4PV1 B;  3KLN A;  3PID A;  1ACI A;  2A07 F;  2NVY J;  2WTE A;  4OWF A;  2MGQ A;  5KAF H;  1LDJ A;  2IDB A;  4HB1 A;  3CC7 P;  1LE8 B;  3OR2 C;  1LTB C;  2XKM A;  2QWW A;  3F8N A;  3OYI A;  5FLX K;  4OH8 B;  2KIF A;  1QPI A;  2FFD A;  4BQN A;  3H1K J;  5APT A;  2GF2 A;  2VC1 A;  1OCO H;  2W24 A;  2WTB A;  4XLH A;  2BGC A;  3LSM A;  4PSW A;  1SD6 A;  2WT7 A;  2EZI A;  1VQ7 I;  1CW5 A;  2XAF A;  4H0E A;  2FXO A;  2M0B A;  3OIP A;  4CPG A;  3CX5 H;  3P9K A;  4EJW A;  2MG4 A;  1UJ8 A;  5DV5 A;  2V1X A;  3DQV C;  2CQ7 A;  2V6E A;  1FZG A;  3GFJ A;  1SFX A;  3I9V 2;  4HX8 A;  3ZOB A;  5FLV A;  3N7N A;  1I1S A;  2HTJ A;  2A6E F;  2FYN C;  4EM0 B;  1TXG A;  2KDZ A;  1T2K D;  1IN7 A;  5E3N A;  5LLQ A;  4BS9 A;  1LNW A;  1T08 B;  4ZYD A;  2LC2 A;  4A5M A;  1TC3 C;  2RVC A;  4XKC A;  3DBR B;  3FIS A;  3C7C B;  4MQ9 F;  1VQ7 P;  1M76 A;  4XOT A;  4KDP A;  1OW7 A;  2Q3I A;  3MP7 B;  3HTS B;  3KZY A;  5L3E A;  3OSG A;  1Z7U A;  1RF0 C;  3A3Y B;  3HZJ A;  1O3Q A;  1JKQ C;  1W7P D;  2Q2E A;  4ZJZ A;  3ERE D;  2KB7 P;  4LK1 F;  5CCH C;  4L9J A;  2OTL P;  2HDD A;  3TBI A;  3OYH A;  2G7H A;  1ZRE A;  1LKX A;  4MQV A;  4XRS G;  3CCL I;  1QMG A;  4KYW A;  1HBW A;  4R8H A;  3RL0 B;  3IV5 A;  5KLI B;  2XPV A;  1LFB A;  5ILS A;  2XB5 A;  1SMY F;  3WE3 A;  4A3D J;  2EV0 A;  1JUP A;  3IQD B;  1Z6T A;  2K1A A;  1EDL A;  3MGN A;  2ESN A;  2PJR B;  1LPQ A;  2KLO A;  2LBF B;  3HWR A;  3AE8 C;  4EQQ A;  3ASN H;  5DS9 A;  2IPP A;  4MEX F;  2A5W A;  3HXL A;  1NU1 G;  1ZN5 A;  2WSS H;  4WVZ A;  1R1U A;  3Q5R A;  2DT7 B;  1WJB A;  4M3D A;  2FSW A;  3GME A;  5H2F E;  3CCL P;  2IS2 A;  1G8X A;  3LQQ A;  4A3M J;  3CUQ B;  4OIP F;  2I9P A;  2LH9 A;  4BU2 A;  3S1Q J;  1UII A;  4GO1 A;  1QEX A;  3EYI A;  1N1E A;  1JY2 N;  1X3Z B;  2FXM A;  2VE9 A;  2OC6 A;  3QPL A;  5L3C A;  4DJA A;  1IRF A;  3WTX C;  4IFF A;  1N75 A;  2IEK A;  3OL4 A;  2WPS A;  4LG0 A;  3O6Q A;  1ON1 A;  1JDJ A;  1JO5 A;  3FXU A;  5E1W A;  3ZMZ A;  2H1K A;  3LW5 J;  3M0D C;  1MZ9 A;  4WK8 F;  1AVY A;  4EAT A;  5M5W J;  3JRH A;  1SQQ G;  1AJY A;  2NXN B;  4R79 A;  2V9K A;  4ASV A;  1R7J A;  1IFI A;  2DN0 A;  2O1J A;  5AVT B;  3FXD A;  4IEJ A;  1ZOY C;  1M2W A;  1NAF A;  4Y99 B;  2WTY A;  1P4A A;  4XRF A;  9ANT A;  5CVU A;  2M1B A;  2CO5 A;  4Y4R A;  5F0H A;  2EB7 A;  2DT5 A;  1HCR A;  5CBN A;  1MKM A;  3CUO A;  3IUO A;  1MDM B;  3HM5 A;  3CDI A;  3QOD A;  5TIS C;  3I83 A;  2W4S A;  1QA6 A;  1O3S A;  5FRM A;  4R4L A;  1Z3X A;  5AVW B;  1S29 A;  3CL3 D;  3AFH A;  2P0W A;  2M3E A;  5J3L A;  4HQM A;  2JUC A;  5TGT A;  3HRS A;  4ON0 A;  4CIC A;  5EF6 A;  2XRL A;  2VON A;  3L75 J;  2OTJ I;  4EIJ A;  4HG2 A;  3ZGY A;  5B5E E;  1OCR H;  3F6O A;  1SFU A;  3L35 A;  5J4V A;  1NTZ K;  1ULY A;  3WTU C;  2E74 B;  1DX7 A;  2VL8 A;  2NVX J;  4QTR A;  1FNN A;  2W57 A;  5AIQ A;  2Q7C A;  3GO5 A;  2HOT A;  2P7J A;  4G6Q A;  4H13 C;  1U6G A;  1VQ5 I;  4BXU A;  3SWF A;  1JJ6 C;  1T3U A;  2NNN A;  3KCC A;  3WHB A;  2E75 B;  5AW1 B;  2CPS A;  1M1J C;  1UHW A;  4XN0 A;  1WKM A;  1JGG A;  1TLH B;  3CWB E;  1E3O C;  3R4Y A;  3RPU D;  1XGN A;  2X51 A;  4HEA 2;  1G59 A;  2OTJ P;  1S5L C;  3TO9 A;  3H3V K;  5L3G A;  3JRB A;  3QYF A;  2GOM A;  3IHU A;  1USE A;  2UXX A;  4L9T A;  4DOJ A;  2VXZ A;  4N78 E;  3N4X A;  3CUQ A;  1F5T A;  1NU1 J;  3DKX A;  5E3L A;  3JSO A;  5F08 A;  3H3U A;  4DGW B;  3PH0 A;  1VQ5 P;  2Y31 A;  2B87 A;  1KA8 A;  2JN6 A;  1LTS C;  2WY8 Q;  1E5W A;  1GLN A;  5BNG A;  4AC0 A;  3CCM I;  3HPG A;  3MIW A;  3QWO C;  1FJK A;  3P8C E;  2EZK A;  1L0N K;  1VQM I;  2E71 A;  1D3Y A;  3PLN A;  4PJ0 H;  3RK3 E;  1IF1 A;  1J1D B;  1TWG J;  4IO9 F;  4G8X A;  1UHS A;  2UZK A;  2C6Y A;  1ZHF A;  2IT0 A;  2ZNZ A;  2ZJR F;  1HC8 A;  5CVV A;  3E5U A;  1MFZ A;  2O1K A;  3AED C;  5AW0 B;  4YEJ A;  3ZQL A;  5JE8 A;  3IC7 A;  3VOE A;  4XNF A;  1ETQ A;  2FML A;  4E7H A;  4GDF A;  1QVG O;  2EIN H;  1NG6 A;  1KC8 Q;  3B02 A;  3MAJ A;  5B66 H;  5DD4 A;  3T8T A;  1SQQ J;  4HV6 A;  1IUF A;  1OWA A;  2HG5 D;  1VQM P;  5J4Y A;  3W2W A;  5APY A;  1MDM A;  2ZXJ A;  5DCM B;  3CDL A;  2QSH X;  3A0H E;  3GG2 A;  3QP5 A;  5BS6 A;  2A3S A;  2HPI A;  4HV5 A;  1GL2 B;  2HNH A;  1LTT C;  2IP2 A;  4P5O A;  4HQE A;  2D5V A;  3FHZ A;  1EVY A;  3PEF A;  1HUC A;  4PD4 E;  1M90 Q;  3ZQG A;  3BTC A;  1U7M A;  5CCG D;  5FRO A;  5APX A;  4CCJ A;  4WY4 C;  2VBY A;  2LD5 A;  2OA4 A;  4WB4 A;  1WI9 A;  2ZJ2 A;  2OV7 A;  2Y30 A;  3FXL A;  2WPR A;  3P32 A;  5APS A;  4WWC A;  2O3F A;  2JA7 J;  1FJP A;  1JKR C;  1YON A;  2GA2 A;  2JVG A;  3KZI C;  4EDF A;  2E43 A;  4IL6 C;  3M9H A;  3TL4 X;  2HWV A;  2W1O A;  2H6B A;  1SS1 A;  4IRG A;  1JTX A;  2X0L A;  3BR0 A;  5K7H A;  3B5N C;  5IP9 J;  4ZYA A;  1XB4 A;  3FKJ A;  2J5P A;  1OR7 C;  1XGO A;  2JSC A;  2W48 A;  3K2Z A;  4KIG A;  3J7Z I;  3HOY J;  2FYU K;  2M3B A;  3RBZ A;  3C7J A;  1PJR A;  2LF7 A;  3PQJ A;  4HZF A;  3KHU A;  1TWH J;  1OIS A;  4HX4 A;  3BCC E;  2QQA A;  1YQ3 C;  2FRH A;  1MBJ A;  1K7A A;  2BEO A;  4PSX A;  4ZTJ A;  5KAI E;  1X2M A;  2CU7 A;  3RGU A;  2KIS A;  1AU7 A;  4KFC A;  3WU1 B;  3H32 B;  3HE4 B;  2NVQ J;  1B6A A;  2KRH A;  1QLE D;  3Q5S A;  4MGR A;  1UMQ A;  4UUT A;  4A3G J;  4IOI H;  5JLW A;  2MJZ A;  3G6E I;  3PJS K;  2YU3 A;  1HGZ A;  1LWU C;  1EH7 A;  4EEF G;  3ABT A;  3SXY A;  1STZ A;  2B9B A;  1KIL C;  1XX5 A;  3CXH E;  3V7C A;  3ECH A;  5CKT A;  2WPV B;  3HKZ N;  2YSR A;  4KIB A;  2HOA A;  4XMY A;  5ICE A;  1T39 A;  2QSG X;  5FFX A;  2AQF A;  5E1X A;  1HLV A;  2NPS B;  2QM8 A;  2VIX A;  1V5F A;  2E34 A;  4JQF A;  3DV8 A;  1QO0 D;  3WTV C;  1PUF B;  2RH0 A;  3MUD A;  3K4C A;  4U3F E;  3BY6 A;  3F8C A;  3OYE A;  3GEZ A;  5EGO B;  1B1B A;  3QPT A;  3T0Y A;  3VOD A;  2D2C C;  2COB A;  4XLP F;  3CCU I;  3GMA A;  3G6E P;  1G2C B;  2FQ4 A;  4K35 A;  2OYI C;  1WFX A;  2EV6 A;  1IN5 A;  1GL2 A;  2STT A;  1Y8A A;  2M7B A;  3IAM 2;  3IRQ A;  1QVU A;  4BBS J;  2IS6 A;  1WHU A;  1G3W A;  4NC7 A;  4UB6 E;  4XLE A;  1T95 A;  1X19 A;  3S2W A;  1F12 A;  1DP7 P;  4PJJ A;  2XAH A;  1GV2 A;  1Y0N A;  2KDO A;  3CWB D;  5C44 J;  1R5I D;  3H9J A;  1C0W A;  2OZ6 A;  1FOX A;  4Y52 J;  5H6Q A;  1L4A A;  3CJN A;  2HQN A;  2WB1 A;  2OQQ A;  1X1C A;  5D5X B;  3TNU B;  3CCU P;  4ZC3 A;  3PP5 A;  2BY2 A;  2VBZ A;  5DEQ A;  2O0Y A;  2ZXH A;  3VWB A;  3H1J D;  3R6S A;  2HYG D;  4GFB A;  4GWG A;  3ZQF A;  2KSE A;  2W84 A;  2WSC J;  2I76 A;  2M4K A;  4BRY A;  4HX7 A;  3BLY A;  2VI6 A;  4XKB A;  3FR8 A;  1TT5 B;  3LOC A;  4XSX F;  4I7Z B;  3F3X A;  1BDC A;  1LUJ B;  3P8C D;  1JHF A;  3L2C A;  1ZKG A;  5D8K B;  3LSP A;  1NTM E;  3RK3 D;  4CUG A;  5K1Y A;  4L5I A;  5A9S B;  3KP6 A;  2L01 A;  4G6T B;  3CMA I;  2WSC H;  3A1Y A;  5E79 E;  1EDI A;  3S3O A;  1FPQ A;  1RES A;  3KEO A;  2PFX A;  2FD5 A;  3H32 A;  5J6X A;  1L2P A;  1WJF A;  3E3V A;  1FEX A;  3HHH A;  2W6B A;  4N9I A;  2F5E A;  3F22 A;  5BVZ A;  1HBX G;  3P9I A;  1SAN A;  3A4C A;  1DLJ A;  1YTZ I;  3W6V A;  4A3J J;  5KLI C;  3I54 A;  2O01 N;  3RL0 C;  2LDU A;  1TWC J;  4DYC A;  4E7S A;  3Q3S A;  5ICC A;  1F14 A;  4MO7 A;  3G2B A;  2YU9 J;  1KQ8 A;  2ID6 A;  1M75 A;  1MBH A;  3HKZ A;  4RAZ A;  3HL2 A;  3CCJ I;  3CMA P;  3V7R A;  3JCU C;  4PFP A;  4ENJ A;  1KGS A;  3SYT A;  3I59 A;  3PL8 A;  3VYR B;  2Q1K A;  4MTD A;  1JHH A;  3G71 I;  2XSJ C;  3S16 J;  1IFP A;  1ZAO A;  1G4D A;  3HD7 D;  3L73 E;  1KTM A;  5CHX A;  1PUF A;  2Q5U A;  5DUK A;  2QQ8 A;  3C7D B;  4ENM A;  1AV1 A;  2BXZ A;  4A0X A;  3K5B A;  3V4W A;  2L02 A;  1ZQ3 P;  4PZJ A;  4RLQ A;  3ADP A;  1X8Y A;  5J1R A;  1U7J A;  2FKW B;  3CCJ P;  1ETY A;  1N7S B;  1X79 B;  1AQ5 A;  3JR9 A;  2LY2 A;  3DU6 A;  3O6B B;  3ZMT A;  4UUV A;  3IKT A;  3G71 P;  2JJL A;  2KIM A;  5L3F A;  5CVI A;  5BQT A;  3WFJ A;  1W2E A;  2XNX A;  1U9N A;  1HDD C;  3GW2 A;  3CTV A;  2F6C A;  3CJT B;  4D9J A;  2PLA A;  3TNU A;  1WJC A;  3G4S I;  3RSN A;  4BBR J;  1YIJ I;  2HLO A;  1FMW A;  3BCC D;  3JW4 A;  3JTG A;  3KQG A;  3I58 A;  4C2T A;  1YIT P;  1CQT A;  3CWB G;  2YX4 A;  1IRX A;  4RGX A;  3V2N A;  5ILV A;  5D5W B;  3V7S A;  3QHA A;  1LT9 C;  2VXD A;  3DP7 A;  3LSI A;  5HS8 A;  1VQP I;  4AD9 A;  2P4W A;  2HXI A;  2A06 D;  5H6R A;  1Y1V J;  1AOY A;  3MTU E;  1MD0 A;  2XRO A;  1BI1 A;  4IFD K;  2DQL A;  3NEU A;  5EZH A;  4OQZ A;  4G7Z F;  3EUH A;  3T1B A;  4EGZ A;  4S04 A;  2Z1D A;  5JR3 A;  2VJJ A;  1YOV B;  4RB2 C;  5A9S A;  4JF7 A;  1OJL A;  1NTK D;  4H0L C;  4QWQ A;  2VKH A;  4B44 A;  5JVT A;  1HVV A;  3G4S P;  1YIJ P;  3QSG A;  3K0L A;  1W0U A;  3V6I A;  2XKP A;  1NOH A;  1EA3 A;  5KK1 A;  5CJ4 A;  5ICG A;  2KQR A;  1SVL A;  5D4S A;  2E75 D;  4BE0 A;  1VQP P;  5GPC A;  2QLZ A;  1IC8 A;  1LTG C;  2DMQ A;  4A0Y A;  2CUE A;  1URQ A;  2YO3 A;  3TK1 A;  4N0B A;  2SPZ A;  2K4B A;  3MUD C;  3K70 D;  1XN7 A;  1T33 A;  4XSZ F;  3H25 A;  5DYM A;  2G3A A;  3M9Q A;  1K78 B;  4HLX A;  5HNF A;  2DXI A;  4IRI A;  2FYN B;  3HUG B;  2AXC A;  1U8R A;  2QSF X;  5GAE J;  1YBK A;  3BRV B;  1L0L E;  1TP4 A;  3LSH A;  1X1D A;  4ENN A;  4XID A;  1NU1 K;  1IO2 A;  3EDP A;  3JRE A;  2VN2 A;  1W36 C;  3OW2 O;  3RYP A;  3SZG A;  1X1B A;  2LOO A;  3K4K A;  5FRN A;  1VQN I;  1TNS A;  4UV8 A;  3OJA B;  5CYV A;  1EZV I;  5KJ7 A;  3RZO J;  1PP9 J;  4BDZ A;  3QAH A;  3PNT A;  3BDD A;  4HBL A;  4OU0 A;  3AEF C;  2QE7 H;  5DJU B;  3E0J B;  4PGG A;  4LD5 A;  3DPL C;  2QF7 A;  2R7X A;  2MD0 A;  2HEO A;  1VF9 A;  1YRN A;  1FC2 C;  2KOG A;  1S7O A;  4RDU A;  2R7V A;  2ZXI A;  3S14 J;  1NTM D;  2XGE A;  1VQN P;  4XOR A;  2AQE A;  5DDG A;  3M3Y J;  2PLY A;  2ZME A;  2FY8 A;  4CCL A;  3AE4 C;  3ZW9 A;  1SQQ K;  5B5E H;  5HLT A;  2JT1 A;  4CA0 A;  3TDK A;  1RUO A;  5DM6 F;  4UB8 C;  3W67 A;  1GL2 D;  3ZQQ A;  3CWB J;  1M67 A;  3TYY A;  4M3L A;  3WUV A;  4M9X A;  4Y33 A;  1F0Y A;  5E8G A;  4S05 A;  3BCC G;  2HI3 A;  4EVI A;  3RCO A;  4XBF A;  1REP C;  1S2E A;  1RC9 A;  4M3B A;  1XMX A;  1EH6 A;  2OD5 A;  1SQB E;  1JI8 A;  1FE6 A;  1K8A Q;  2KJC A;  2BVL A;  2DA3 A;  4CYC B;  1J59 A;  1DDN A;  3LAJ A;  3BJO A;  1JXS A;  2E60 A;  4D5C A;  1L4A D;  3TOA A;  2OYH C;  4G94 A;  3ZMV A;  2GOX B;  2BY3 A;  3OYC A;  3L73 D;  3AEG C;  3GTG J;  3FHN A;  4HA8 A;  1FSE A;  1I3Q J;  3ZCO A;  1XTG B;  3LSR A;  1HKQ A;  5HDK A;  1X4P A;  4JX5 A;  4BDY A;  1I36 A;  3HOV J;  2FF4 A;  1D5V A;  1RY3 A;  4YG2 F;  5BMZ A;  2H43 A;  2C0X A;  2CRG A;  4UXN A;  5TJJ A;  3L7W A;  4RB3 C;  3OS2 A;  3MN2 A;  3A2K A;  3RKQ A;  4PJ0 E;  3M9B A;  2GBY A;  4A7P A;  3OOU A;  1HF9 A;  1E3H A;  2ZKZ A;  4XQF A;  5KAF C;  3AAF A;  1WH5 A;  4I1L A;  2EJR A;  5E17 F;  2MC3 A;  3J80 Z;  4Z1M H;  1S1C X;  4JK1 X;  5H20 A;  1M7L A;  3SDB A;  2DDB A;  1RF0 A;  1ORK A;  3CCY A;  4NQW A;  2BOL A;  3TKY A;  3F8M A;  5KLV D;  5B66 E;  4JBA A;  5CCH A;  2ZO4 A;  1RRJ A;  1PFI A;  1VQ6 I;  3KZZ A;  3SQN A;  2I1K A;  5ILU A;  2UYY A;  2OTK E;  4H13 B;  4XLA A;  3V4G A;  4E6K G;  3DFG A;  1RF1 A;  3M8E A;  1QL2 A;  4U87 A;  2R3C A;  4I0A A;  1M1J B;  3OA7 A;  1ODD A;  2K9J B;  2Z5I A;  5J8F A;  1BC8 C;  4LGW A;  3E1R A;  2DLL A;  1XG1 A;  1GHC A;  3A2A A;  3W3C A;  2ELK A;  1UAA A;  4KIT B;  2HU9 A;  2L7K A;  4DJG A;  1VQ6 P;  1PGN A;  5L3B A;  1VQ8 I;  1J9I A;  1NTM G;  4IZZ A;  3GF3 A;  4JYB A;  4I01 A;  1D8K A;  4HAM A;  4M74 A;  5LGN A;  3K96 A;  1BI0 A;  2E35 A;  3CCS I;  1XSX A;  3W6K B;  1P4X A;  1IDY A;  4XLC A;  2MD5 A;  4HLY A;  2H8P D;  5HWS A;  1MUU A;  1QPM A;  5HLG A;  2BHY A;  2XAJ A;  1GW3 A;  2QKM B;  3OSF A;  1QU3 A;  3EYY A;  3I55 I;  5EZG A;  4RKU J;  5FB2 A;  4GYG A;  3RPQ A;  2Z5U A;  2LY9 A;  4QIW N;  4ESJ A;  1R9T J;  1AHD P;  1HXD A;  3JRF A;  3E1I A;  1RKW A;  5K5R A;  1Y1W J;  3R0A A;  1L0L D;  3H6P A;  1VQ8 P;  1IN8 A;  2ECC A;  4W1U A;  2DO7 A;  2Q6Q A;  4CCO A;  5HLH A;  1J75 A;  3M0D A;  4M6V A;  4H44 C;  4E7Z A;  2DJN A;  2IZ1 A;  3L73 G;  1T38 A;  1OVV A;  1Z56 A;  1M1K Q;  2CW7 A;  5AYV A;  3PO2 J;  4EJV A;  3I55 P;  1X3U A;  1DPU A;  1Q82 Q;  4I09 A;  1D8J A;  2AXT H;  1E17 A;  2IBZ I;  4U3F J;  3M4O J;  3KLO A;  2DOA A;  1WSU A;  2UXN A;  4BJ6 C;  3R61 A;  2WQY C;  1YYV A;  5EFW B;  2X58 A;  3V2Q A;  4E70 A;  2K27 A;  4A3B J;  4FE4 A;  4BAY A;  1BA5 A;  2W83 C;  4YPC A;  3USS A;  1EVZ A;  5FKN A;  4A3C J;  2FMY A;  2UWJ E;  4WY4 B;  3ZQH A;  1RHZ B;  1ETV A;  1URQ D;  5B1A H;  1CF7 B;  4RGS A;  4AM3 A;  4MN4 C;  2XF5 A;  4K2E A;  1R5H A;  2BE5 F;  4B48 A;  2E2I J;  1H8A A;  3PFI A;  2L9N A;  5AW5 B;  1XTA A;  4C46 A;  3E7L A;  1IK9 A;  5KVR A;  2QJK B;  3B5N B;  2K9J A;  1B8I A;  1K79 A;  1RE3 C;  4C3J J;  1SQB D;  1F43 A;  1HQC A;  2MFZ A;  4E7K A;  1LGH B;  1YJQ A;  3FXE A;  1FBU A;  2VOP A;  4UB6 H;  4MNU A;  4A5N A;  3CME I;  1T98 A;  3ABM H;  3VPR A;  4ZZL A;  2DFI A;  4LLN A;  1N73 A;  3BR6 A;  1HJ0 A;  3W68 A;  1KQS O;  1FLI A;  1XTC C;  5KJ7 D;  1KN7 A;  1MV8 A;  3CCR I;  3HB9 A;  2Z2S B;  3W2V A;  3BJA A;  4U7J A;  2QJY C;  2LXB A;  3V2R A;  5GPA A;  5A9T A;  1F36 A;  3BZC A;  3HSE A;  1VPD A;  1NTM J;  4G7H F;  2JPC A;  4RAG A;  5TIS E;  2KRC A;  3DKW A;  1MBK A;  1YW7 A;  1A6Q A;  3I5U A;  4CZZ A;  2B7E A;  2EIJ H;  5TJH A;  2M5A B;  2DTZ A;  1XMK A;  2PG4 A;  3K1P A;  1M57 D;  3HG9 A;  3B73 A;  2JVH A;  3BJ6 A;  4OIR F;  2CV1 A;  1AQT A;  3H1L G;  2X1C A;  3S93 A;  1LWU B;  3I53 A;  1SC7 A;  1PGJ A;  2GUS A;  1KIL B;  1N7L A;  2JZY A;  3CCR P;  3G0O A;  2LG4 A;  2DMT A;  2M4G A;  1OYI A;  1XGM A;  2O03 A;  5E79 H;  2FNA A;  3C2H A;  4AYB N;  1RE4 C;  2WV1 A;  1Y6I A;  3PLR A;  1Y9B A;  2MYS A;  2BYV E;  1MZB A;  4F52 A;  2B88 A;  3HTK B;  2BZT A;  1A35 A;  2ZYA A;  1L0L G;  4XR6 A;  1K4S A;  2AO9 A;  3L73 J;  5AW7 B;  1BE3 E;  1VI0 A;  3W6J B;  2D2C B;  1BN5 A;  1J2X A;  1S5L E;  3HUS C;  3H1L E;  1BR4 A;  3FMQ A;  3WGG A;  1R23 A;  2Q8K A;  1LFP A;  3RIR A;  3SEQ A;  2OYI B;  3OWT A;  2Y75 A;  3L09 A;  3E6D A;  3ULQ B;  4D3F A;  4O5V A;  3A0B E;  1S5L H;  2R0Q C;  2Y9Y A;  2IX7 C;  2WIT A;  3LSJ A;  1J2J B;  3B4S A;  5DCF A;  3C2B A;  1TZL A;  4CCK A;  1H9T A;  1BL0 A;  1PZQ A;  1X1P A;  2N1T C;  3U1A A;  1BSH A;  1YX5 A;  4WY4 A;  1MSF C;  3ZHB A;  1T8Z A;  2WWY A;  1POG A;  3K4M A;  1RR8 C;  2E5Z A;  2OFP A;  2WPQ A;  1L0O C;  1GVD A;  1Y39 A;  3WMM 0;  1ZGJ A;  3EET A;  4DCK A;  4OVN F;  1OKR A;  1ZG1 A;  3V5B A;  2E7W A;  4ZMD A;  2KYV A;  1WH7 A;  2ZCW A;  3GF2 A;  2VOD A;  4P9F A;  2QSI A;  3BRO A;  5F1J A;  1YW9 A;  2CW0 F;  2ZBK A;  5AW8 B;  5GTH E;  2DMN A;  2Z5H A;  1GU5 A;  1NKN A;  2DAO A;  2EQR A;  1D0X A;  2NS0 A;  3MHV A;  4GIF A;  1S7A A;  4G7O F;  3D5L A;  1IV8 A;  1QZZ A;  4FCY A;  1FU1 A;  4Y7N J;  2R92 J;  5ICF A;  2IW5 A;  2IRF G;  4N3Y B;  5CCH D;  1P4W A;  1G2H A;  1SQB G;  3O3K A;  1NTC A;  3GHY A;  4OGQ D;  1RKT A;  2XGC A;  4DBQ A;  1ZLL A;  3DLA A;  4Z2Y A;  4AWX B;  4DT0 A;  4C2M J;  4UY8 I;  3VYT B;  3U1C A;  4HH2 A;  2GXA A;  2L9V A;  1BR2 A;  1QX8 A;  4JPZ B;  1JUM A;  2CS3 A;  1FIA A;  3AG2 H;  3JRC A;  3K69 A;  2QGU A;  3T5X A;  4A12 A;  2R93 J;  1LWU A;  2CUJ A;  2MKV A;  1S5L X;  1Q90 D;  1KIL A;  3GFM A;  2DFF A;  3H0D A;  5EG0 B;  2DW3 A;  3G9R A;  3QYE A;  2YIU C;  4GGG A;  1YX3 A;  2K9S A;  4AYB A;  2GZW A;  2DOE A;  3FXM A;  1D1B A;  1WGX A;  4AVZ A;  2KMU A;  2VLA A;  2Z4E A;  3MQ0 A;  1KYZ A;  3E6M A;  1O3T A;  1BCC E;  2L4M A;  2DYR H;  1ZV8 A;  3LNQ A;  4NB5 A;  2JP3 A;  3RL0 g;  3KEY A;  2EW2 A;  3OBB A;  1HGV A;  1LT1 A;  2MSY A;  1BR1 A;  2HYF A;  2IA0 A;  2OYI A;  1M1E B;  3RI4 A;  3FBI B;  3WUT A;  1FZE A;  3FR7 A;  1LE8 A;  3FXJ A;  1VF5 B;  1N86 A;  3WU2 C;  3NQO A;  2DA6 A;  3MOG A;  1X58 A;  2YKQ A;  2Q3E A;  2L4A A;  1PP7 U;  3BAS A;  1EF4 A;  4B1R A;  2DOD A;  2R5B A;  3C3W A;  3G17 A;  2QUF A;  3CI9 A;  4D6T D;  3PJG A;  4J0E A;  5J8C A;  2E2H J;  2YKO A;  3IL2 A;  3DU5 A;  5HVQ C;  1KFM A;  5D6E A;  2HXO A;  1TWA J;  1NKZ B;  4RM2 A;  3TO7 A;  2DPU A;  1YIO A;  1T56 A;  2JWT A;  1BDD A;  4GBJ A;  4BQQ A;  1DEE G;  5AW4 B;  3VMY A;  1IFM A;  1G3S A;  3L2V A;  4L0Y B;  4GXO A;  3KYL A;  1YIT I;  1ONV A;  2P6T A;  1GK6 A;  2JA2 A;  1N77 A;  3L74 E;  1NGM B;  2D1H A;  2OAZ A;  2PBI A;  2ZJQ F;  5FWN A;  1HH0 A;  2CJJ A;  5EDN A;  1KOR A;  1EDK A;  1LT9 B;  1G3Y A;  2JK3 A;  3TF5 A;  1TU3 F;  1H89 A;  3UIA A;  2GXB A;  4RMN A;  3VOP A;  3LA7 A;  4PZC A;  1EZV E;  2O01 H;  1LDK B;  4U0Y A;  1JTH B;  1MH4 A;  2HTS A;  4IHT A;  1GXP A;  4H0L B;  1OXZ A;  3ABU A;  3OYJ A;  2HYN A;  2Y2Z A;  4L9V A;  1KYO I;  3RDI A;  2FOK A;  2P6S A;  1TWF J;  2PX9 A;  3BR2 A;  4LLG F;  3CZ6 A;  4DW6 A;  1M8O B;  1WT6 A;  3H36 A;  1SFC C;  2HQA A;  5AW6 B;  2KIU A;  3AEC C;  4B3X A;  2DMP A;  2LP0 A;  2QQB A;  4RM3 A;  3F5H A;  1FZC C;  4D3D A;  4AUW A;  4AIH A;  1BE3 D;  3C2G A;  3U1D A;  2PJR A;  1VDF A;  2K40 A;  1EC5 A;  3H1L D;  4L9N A;  4EV0 A;  2EH3 A;  3OL3 A;  2LBF A;  3MCZ A;  4ETS A;  2Q1Z B;  2QBY B;  2GLO A;  4XLF A;  5K7F A;  3OYB A;  1ZRC A;  3LSK A;  1KYO H;  3FIW A;  3J7Y J;  2M2E A;  3EQ2 A;  2K4J A;  3H1H E;  1ZLJ A;  5GTI E;  2L2O A;  1JUN A;  1EH8 A;  3QOP A;  2OPT A;  3H35 A;  2WBM A;  3H1J E;  5CPR B;  4RES B;  6PAX A;  1ZR2 A;  3PFY A;  2VT2 A;  2HR3 A;  4IHW A;  4NPF X;  3MD2 A;  4IHS A;  3A7O A;  4N4O B;  2CYY A;  1IO4 A;  3HD7 B;  4LG3 A;  4W97 A;  3TW6 A;  2L0K A;  3TQN A;  5LHG A;  4EOT A;  1Y8R B;  3CKY A;  3ELK A;  2TCT A;  3K10 A;  4I2L C;  2R7Q A;  4M6Y A;  1IL0 A;  4D6T G;  4AIJ A;  3HRU A;  2IA1 A;  3CCM P;  4LLH A;  2RNG A;  2BXY A;  2IA2 A;  2RDP A;  5IP6 A;  1SQP E;  2HKO A;  2YNY A;  3SWK A;  4Y13 A;  1FC3 A;  3JTH A;  3CLO A;  1LSO A;  4QPO A;  1FS0 E;  3FM3 A;  3WTZ A;  1FP1 D;  1GMJ A;  4A3K J;  1MNE A;  1TQI A;  2VBX A;  3HJE A;  1VQ4 I;  2CV2 A;  2D45 A;  3NWT A;  3ZQC A;  2P2U A;  2D2W A;  3E1S A;  2V6C A;  2LMD A;  3P5J A;  2Y69 H;  5D6F A;  2P7C B;  4N6J A;  2OYH B;  3E7K A;  2VE8 A;  4ESB A;  5KNL A;  2V9P A;  1K73 Q;  3C18 A;  3KE2 A;  2KZJ A;  3HN2 A;  2IGK A;  4MIM A;  2WB1 N;  4PDK A;  3FXO A;  1BCC D;  3B71 A;  4NNJ A;  4JYC A;  2AHQ A;  2V26 A;  1Z82 A;  1GDT A;  2BCC E;  2QJK C;  3GTP J;  1KZH A;  2DDA A;  2F5C A;  2R5Z B;  3QOE A;  2JA8 J;  2QBY A;  1VQ4 P;  2X1D A;  3LST A;  4PZE A;  2E76 C;  1XSV A;  4OIN F;  4Q4Z F;  1Z7L A;  2V1D A;  5C4J J;  1NTZ E;  3GW6 A;  2FFD C;  1VTN C;  4I6Z A;  4HYT B;  2DFH A;  2ZYD A;  2P67 A;  5AW3 B;  3R60 A;  1BE3 G;  1R5G A;  1KQG B;  1R1T A; 
#chains in the Genus database with same CATH homology
 2VKV A;  1OJL A;  1A6I A;  3TP0 A;  1Q1V A;  1APL C;  4HNV A;  3QSG A;  2L7M P;  1W0U A;  4A3L J;  2W8Z A;  3LSG A;  4BXX J;  3SJM A;  1D5Y A;  3WFI A;  2LFB A;  3NAU A;  3Q0V A;  4JX6 A;  2YUS A;  3SFI A;  5GPC A;  1IC8 A;  2XPU A;  2DMQ A;  2CUE A;  1MH3 A;  1K83 J;  2G0E A;  2JMW A;  2B63 J;  4V2G A;  4X6A J;  3D1N I;  1RR7 A;  2PGD A;  4A69 C;  1T33 A;  2Y9Z A;  4MLO A;  1HOM A;  4KUG A;  1Z0X A;  1I6H J;  1YB4 A;  5F04 A;  3BG5 A;  3DEW A;  1I50 J;  4XID A;  3JRE A;  1GUU A;  5C4X J;  4M3E A;  1JTY A;  2DMU A;  1QRY A;  2JA5 J;  2P4Q A;  3GTQ J;  3JRG A;  1ETO A;  2X9D A;  3RZO J;  3W6Z A;  1A5J A;  4FGW A;  5C3E J;  1BW6 A;  2ZB9 A;  5FKO A;  3RQI A;  1FJL A;  1WI3 A;  2L7F P;  1K61 A;  2L7Z A;  2O7O A;  2QF7 A;  1ZGW A;  2P81 A;  5IYB J;  1VF9 A;  1IV6 A;  1YRN A;  2JA6 J;  3F3S A;  1OCP A;  3IH4 A;  4RDU A;  3G1M A;  2E2J J;  4FIS A;  3C7A A;  3S14 J;  3K2A A;  1XS9 A;  2XGE A;  3HGG A;  5IYD J;  5A9R A;  3M3Y J;  4BY1 J;  3ZW9 A;  5EG0 A;  4DYR A;  3JRD A;  1Z77 A;  5IPA A;  4FTH A;  2O9L A;  1M67 A;  4KUE A;  2Y0S N;  1F0Y A;  1WPK A;  1WP4 A;  2HI3 A;  1GT0 C;  3BQZ A;  4S0H B;  2FJ1 A;  3G1L A;  2IZ0 A;  3BR5 A;  5IP7 J;  3HDH A;  4M3B A;  1FTT A;  4UUS B;  4J0F A;  2LVS A;  2DA3 A;  1P7J A;  4CYC B;  1AKH B;  5EYR A;  2DA2 A;  1IG7 A;  4D5C A;  4QSH A;  1HDP A;  4DZJ A;  1IRZ A;  3GTG J;  2JKV A;  1MBF A;  4C3H J;  2K9Q A;  3BQY A;  1I3Q J;  3HOW J;  3LSR A;  1SFO J;  4JX5 A;  1RPW A;  4XK4 A;  2XGD A;  3HOV J;  2VKE A;  1I36 A;  1M66 A;  4KUH A;  2JJ7 A;  3SDG A;  2CRG A;  2M0C A;  3JRI A;  1OCT C;  1H8A C;  1X0X A;  3MN2 A;  1U78 A;  3RKQ A;  2E1O A;  3PID A;  2GBY A;  3ZWC A;  3OOU A;  2WAQ N;  2NVY J;  3BG3 A;  4DLL A;  4BY7 J;  3K7A J;  2MGQ A;  1WH5 A;  5EGO A;  2NOG A;  1LE8 B;  2CUF A;  4OQY A;  5MGB A;  4E21 A;  1ORK A;  1QPI A;  4B3A A;  3CCY A;  3GTK J;  1RET A;  2GF2 A;  2TRT A;  2WTB A;  5JLX A;  2EZI A;  1ETX A;  2LKX A;  2UYY A;  4B3I A;  2MG4 A;  1ZCJ A;  2M34 A;  2I10 A;  5J1Y A;  2LK2 A;  5FLV A;  3ZOB A;  2D3T A;  3BTL A;  1MBG A;  3O8H A;  1TXG A;  2KDZ A;  3ZWA A;  5E3N A;  1NK3 P;  5FLM J;  3FKI J;  1TC3 C;  1XG1 A;  2YS9 A;  2ELK A;  3FIS A;  3C7C B;  1M76 A;  1PGN A;  3OSG A;  4IHV A;  1JKQ C;  3K96 A;  1DU6 A;  3TED A;  1IDY A;  2HDD A;  5HWS A;  3MKL A;  1JKO C;  4XRS G;  3OSF A;  1QMG A;  2HOS A;  2ID3 A;  5EZG A;  3IV5 A;  2XPV A;  1LFB A;  2XB5 A;  5M5X J;  4A3D J;  2IAI A;  2LY9 A;  1JUP A;  4QIW N;  1R9T J;  2QYT A;  1AHD P;  3IQD B;  4OM8 A;  3JRF A;  1F17 A;  1RKW A;  1Y1W J;  2ECC A;  4W1U A;  1YJ8 A;  3HWR A;  5M3F J;  4M6V A;  2IZ1 A;  2DJN A;  5DS9 A;  1UG2 A;  4I76 A;  4GWK A;  4M3D A;  5AYV A;  4D3S A;  3A03 A;  3PO2 J;  3WS7 A;  4A3M J;  1ZR4 A;  3S2H J;  2I9P A;  3S1Q J;  1N1G A;  4D5F A;  3M4O J;  1FTZ A;  3Q3C A;  3BR1 A;  3QQA A;  1N1E A;  4AUX A;  1JJ8 C;  2X58 A;  3ULK A;  4IHX A;  4A3B J;  4FE4 A;  2OF7 A;  1BA5 A;  3QPL A;  3GTM J;  1EVZ A;  5FKN A;  4A3C J;  3ZQH A;  2IEK A;  1ETV A;  3IH2 A;  1JDJ A;  2E2I J;  3S2D J;  2ME0 A;  2H1K A;  3DCF A;  5M5W J;  5J1U A;  3NAR A;  2LTP A;  3JRH A;  1PGP A;  3E7L A;  2DN0 A;  4G12 A;  4IEJ A;  1M2W A;  2ZYG A;  9ANT A;  1B8I A;  5F0H A;  4C3I J;  4C3J J;  1F43 A;  1HCR A;  1WPQ A;  1YJQ A;  4BKX A;  2R5Z A;  3HM5 A;  3VPR A;  1O4X A;  3HDD A;  3I83 A;  3BR6 A;  1XC5 A;  3HOX J;  4D7N A;  2EZL A;  3Q0U A;  1BJZ A;  5J3L A;  3HB9 A;  5EF6 A;  2XRL A;  3CQZ J;  3ZGY A;  5GPA A;  5A9T A;  1F36 A;  1PGO A;  1IGN A;  1WDM A;  1VPD A;  4MFE A;  3HEF A;  2EBI A;  1MBK A;  2M8G X;  2NVX J;  4A3E J;  4QTR A;  1NK2 P;  2HOT A;  2DTZ A;  1JT0 A;  1JJ6 C;  4B3H A;  3A01 B;  3WHB A;  3PM1 A;  3DFU A;  1PGJ A;  3GTO J;  3JRA A;  2HYJ A;  1ZK8 A;  1JGG A;  3G0O A;  2DMT A;  1E3O C;  3ZW8 A;  1WCM J;  4E13 A;  1LSJ A;  4AYB N;  3H3V K;  3JRB A;  1W0T A;  2WV1 A;  2DA7 A;  3PLR A;  1H89 C;  3BTI A;  5IOY A;  1U9O A;  3UKG A;  2ZYA A;  2VPR A;  3MVP A;  2AO9 A;  5E3L A;  4A93 J;  1VI0 A;  2LLK A;  5F08 A;  4JQ0 D;  2Y31 A;  2JN6 A;  5HOD A;  3EGO A;  5BNG A;  4AC0 A;  4D3F A;  5GP9 A;  2EZK A;  2Y9Y A;  3TW7 A;  2R0Q C;  3LSJ A;  2NS7 A;  3C2B A;  4J19 A;  1BL0 A;  1TWG J;  5EEA A;  1UHS A;  1MSF C;  2R7Z J;  3ZHB A;  1POG A;  5JE8 A;  3ZQL A;  2OFP A;  1GVD A;  4DCK A;  1ETQ A;  4OVN F;  1MNM C;  1WH7 A;  3A02 A;  4MFD A;  4JX4 A;  1LFU P;  2FX0 A;  5F1J A;  1IUF A;  1P7I A;  2DMN A;  1LJ8 A;  2DA1 A;  3BTJ A;  1X2N A;  4D7M A;  2EQR A;  3CDL A;  3ADO A;  4L5E A;  3H0G J;  4B4C A;  4FCY A;  4Y7N J;  3BG9 A;  2R92 J;  4S3M A;  3PDU A;  2PMZ N;  2D5V A;  1G2H A;  1EVY A;  3PEF A;  1ITY A;  3L1P A;  3ZQG A;  3BTC A;  1NTC A;  1VFC A;  3GHY A;  1RKT A;  2XGC A;  4UUS A;  2M9H A;  5FKL A;  2LD5 A;  4CYC A;  1AKH A;  2Y30 A;  1BW5 A;  4B3J A;  3HOZ J;  4C2M J;  1YRN B;  2JA7 J;  1U8B A;  1JKR C;  3S17 J;  1YON A;  2CVZ A;  4JPZ B;  1JUM A;  3JRC A;  1FIA A;  2R93 J;  2L9R A;  3A01 A;  5K7H A;  1JTX A;  3BR0 A;  5EG0 B;  5IP9 J;  2R5Y B;  2K9S A;  3HOY J;  2W48 A;  3S1N J;  1WDK A;  3IH3 A;  3I4N J;  4XIC A;  1WGX A;  1TWH J;  4PZD A;  2CQQ A;  3DOJ A;  2RAE A;  3LNQ A;  2KT0 A;  1MBJ A;  2EW2 A;  3OBB A;  4IM7 A;  2MSY A;  1QVT A;  1X2M A;  1YRL A;  2CU7 A;  5FKM A;  1ETK A;  1AU7 A;  4X1E A;  2VUM J;  2DA4 A;  1LE8 A;  2NVQ J;  3FR7 A;  2HQ5 A;  3HGY A;  1FIP A;  2DA6 A;  3MOG A;  1UMQ A;  1X58 A;  4UUT A;  4A3G J;  5JLW A;  2K9N A;  3W6U A;  1EF4 A;  4B1R A;  3G17 A;  4EEF G;  1ETW A;  3PJG A;  4J0E A;  2E2H J;  4JP0 A;  3HKZ N;  3H2Z A;  2HOA A;  2NS8 A;  3HBL A;  5IYC J;  2HXO A;  1TWA J;  1HLV A;  1T56 A;  2JWT A;  4GBJ A;  5E3O A;  1B72 B;  3B6C A;  1PUF B;  2O8K A;  1KS9 A;  5EGO B;  1X0V A;  1JUS A;  2COB A;  4NDL A;  5FWN A;  2CJJ A;  5EDN A;  2FQ4 A;  2JK3 A;  3K6J A;  4XRS A;  1QVU A;  4BBS J;  4PZC A;  2X48 A;  1WDL A;  4DYD A;  2ECB A;  5E3M A;  4IHY A;  1MH4 A;  5IOZ A;  1F12 A;  3WHC A;  3CMY A;  1GV2 A;  4JYK A;  4V2F A;  5M3M J;  5C44 J;  2Y2Z A;  3BR2 A;  4FE7 A;  1TWF J;  4DW6 A;  4Y52 J;  5DTD A;  2XSD C;  4YCA A;  2DMP A;  2LP0 A;  3BR3 A;  1GV5 A;  4D3D A;  4GFB A;  4GWG A;  3ZQF A;  2CQX A;  2R5Y A;  2K40 A;  5F0C A;  5FJ8 J;  1MSE C;  2EH3 A;  3FR8 A;  2VI6 A;  3B6A A;  4M3F A;  4E12 A;  2GLO A;  3LOC A;  5K7F A;  2XB0 X;  3FIW A;  2M2E A;  4A3F J;  3HOU J;  1ZKG A;  4A3I J;  3LSP A;  1YVE I;  1MBE A;  1OFC X;  2OPT A;  5A9S B;  1H88 C;  2MW8 A;  3RQS A;  3G1O A;  4DYQ A;  1RES A;  3S1M J;  5F27 A;  2FD5 A;  1ZR2 A;  3GBG A;  1FEX A;  4DZP A;  4IHW A;  1SAN A;  1DLJ A;  4ABZ A;  3W6V A;  3GTJ J;  4A3J J;  4LOC A;  1TWC J;  4DYC A;  1ZTR A;  3Q3S A;  1F14 A;  2QCO A;  4MO7 A;  4W97 A;  3TW6 A;  2L0K A;  3Q0W A;  5M5Y J;  2ID6 A;  4XRM A;  2YU9 J;  2E19 A;  1M75 A;  3FWN A;  1MBH A;  3CKY A;  3L6D A;  2GM4 A;  2TCT A;  2HDH A;  1HF0 A;  3S16 J;  3GTL J;  2IYO A;  1B72 A;  1S7E A;  1PUF A;  1IL0 A;  3QPS A;  1VND A;  3S15 J;  4R1N A;  1IDZ A;  3PO3 J;  1PGQ A;  3FK7 A;  5IP6 A;  2ME6 A;  3C7D B;  3O8G A;  3BT9 A;  3FK6 A;  5FKK A;  1LSO A;  1ZQ3 P;  4M3G A;  4A3K J;  3ADP A;  5J1R A;  1ETY A;  3JR9 A;  3ZQC A;  2NVT J;  5F0F A;  1ENH A;  2LR8 A;  5K7Z A;  3ZWB A;  2DA5 A;  2XPW A;  1BG6 A;  3WFJ A;  2IBD A;  2H8R A;  1U9N A;  1HDD C;  4EZB A;  3CTV A;  4OL9 A;  1JKP C;  2PLA A;  3HN2 A;  4MIM A;  2WB1 N;  3HAD A;  4BBR J;  1IJW C;  3I4M J;  1DU0 A;  1B8I B;  3S1R J;  2AHQ A;  1Z82 A;  1CQT A;  1GDT A;  3F0C A;  3GTP J;  2R5Z B;  3RZD J;  2IYP A;  2JA8 J;  3OIO A;  1DLI A;  3TP3 A;  3QHA A;  4PZE A;  2HXI A;  1Y1V J;  5C4J J;  1JT6 A;  5EZH A;  4I6Z A;  4OQZ A;  2ZYD A;  3ZQI A;  2EZH A;  2N8G A;  5A9S A;  4RBO A;  2X6O A;  2W90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...