1OFCX

Nucleosome recognition module of iswi atpase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
266
Chain Sequence
AVDAYFREALKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERENIELEEKERAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure and Functional Analysis of a Nucleosome Recognition Module of the Remodeling Factor Iswi
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
molecule keywords ISWI PROTEIN
total genus 103
structure length 266
sequence length 281
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09110 HAND HAND
X PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1ofcX01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 1ofcX03
5J1YA 2XSDC 1F36A 1IUFA 2X6OA 5F08A 3TEDA 1OJLA 2R7ZJ 1MH4A 1SFOJ 2DA3A 2E2JJ 4EEFG 5C3EJ 3NAUA 5BNGA 4ABZA 1ITYA 5DTDA 1MSFC 1XS9A 1JKQC 3OIOA 1BA5A 1S7EA 2B63J 1Y1VJ 1ZK8A 1FEXA 3F0CA 3HGGA 4A3BJ 2JN6A 3TP0A 4UUSA 2MGQA 1U78A 2HOAA 3FIWA 3H3VK 1FTTA 2GBYA 1OCPA 5GP9A 1T33A 3Q3SA 1JKPC 4D7MA 4A3GJ 2XGDA 3JRHA 1D5YA 4GFBA 2R5YA 4MO7A 4D5FA 3BG3A 1QVTA 5C4XJ 1MBHA 1X58A 1AHDP 2ECCA 2L9RA 1MBFA 1QVUA 1ZKGA 2TRTA 1YRNB 1GVDA 2K9NA 5FKNA 5IYBJ 1IJWC 1B8IA 1MBJA 2L7FP 5FKOA 3BTIA 1ETXA 4B3AA 4FTHA 3DCFA 4D7NA 1B72A 5EG0A 3FISA 3UKGA 3ZQFA 4MFDA 3MVPA 2CJJA 2LD5A 1NK3P 2L0KA 3E7LA 2DA1A 2ID6A 1U8BA 1G2HA 2DMUA 4C2MJ 2R5ZA 1IC8A 3MKLA 3BG5A 4DYCA 4C3JJ 2QCOA 3M3YJ 3ZQIA 1WGXA 2R5ZB 1IRZA 2R92J 3HOXJ 3DEWA 4QSHA 3W6VA 5E3NA 3HB9A 4D5CA 4A3IJ 2YU9J 3WHCA 1ZTRA 2JA6J 1JT6A 3C2BA 3LNQA 5EG0B 2Y0SN 3TW6A 2EZLA 2Y2ZA 4X6AJ 4B4CA 2CUFA 2WB1N 3LSJA 2DMTA 4HNVA 2MG4A 4JX5A 4IHYA 5M5WJ 5K7FA 1YRNA 3BR6A 4BXXJ 1OFCX 1FJLA 1K83J 3H0GJ 3S1RJ 3BTCA 3G1LA 1WH5A 1H8AC 1RKTA 1CQTA 3SFIA 2GM4A 2K40A 2IAIA 2ECBA 3VPRA 3JRAA 3S1QJ 1Z77A 3BG9A 5F04A 2HDDA 2OPTA 4OVNF 4CYCB 1P7IA 3LSGA 4Y7NJ 3GTKJ 1LFUP 2EBIA 2H1KA 3G1OA 3GTLJ 1NTCA 3BQYA 3JRFA 4LOCA 2DA5A 3A03A 1H89C 1GT0C 2JK3A 2KT0A 4A3CJ 3A01B 5C44J 1BW6A 4MIMA 1VNDA 2R93J 3ZQHA 1ETVA 2DMPA 5E3MA 3HGYA 1BL0A 5IYDJ 1UG2A 2HXOA 4RBOA 2COBA 2M34A 3JRGA 1WCMJ 3PO2J 1HDPA 4CYCA 5M5YJ 5IYCJ 5FKKA 2CU7A 1I6HJ 4DCKA 3CMYA 1ETWA 4I76A 3JRDA 1IDZA 4BBSJ 1JJ6C 3JRBA 4JX4A 1P7JA 2HOSA 3ZQGA 4IHVA 2JA7J 4BY1J 2E19A 2N8GA 4UUTA 1H88C 5FKLA 2JWTA 4XK4A 4DW6A 3BR2A 4RDUA 5M5XJ 2K9SA 1JKOC 1TWAJ 1ENHA 3BQZA 5IPAA 5IP7J 1Q1VA 5F0CA 4S0HB 2AO9A 2ELKA 1DU0A 1RPWA 4MLOA 4XRSG 1B72B 5J1UA 1IGNA 2HI3A 3HKZN 1I3QJ 3SDGA 4W1UA 1FIPA 1B8IB 3M4OJ 3O8GA 5E3OA 1JJ8C 3CQZJ 1T56A 2EH3A 1BJZA 3ZQCA 4M3BA 3OSFA 4M6VA 5EZGA 4JP0A 4A3KJ 1GV2A 1VF9A 5FLMJ 2Y31A 2EZHA 3WHBA 4QTRA 4IEJA 2E1OA 2ID3A 5EZHA 2TCTA 2NVTJ 3GTOJ 5E3LA 4M3DA 1ETOA 2HYJA 2NVXJ 2DA4A 3HOYJ 2X9DA 3FKIJ 1TWFJ 2JA8J 1NK2P 1IDYA 2G0EA 2YS9A 3BTJA 2I10A 1LE8B 9ANTA 1MSEC 3BTLA 2ME6A 5EGOA 4IHWA 1PUFB 3HDDA 2WV1A 1POGA 3K7AJ 1XG1A 3HEFA 3S17J 3A01A 2IBDA 5J1RA 1X2NA 2DA7A 1MBEA 4AUXA 5EEAA 2LVSA 1SANA 1UMQA 1XC5A 2LY9A 5F1JA 2JJ7A 3NARA 3O8HA 4FCYA 3GTPJ 2Y9ZA 1WI3A 2FQ4A 3SJMA 1ZR2A 2FD5A 2ZB9A 3RZOJ 4DZPA 2RAEA 3CCYA 2H8RA 2AHQA 1HDDC 2L7MP 2XPWA 4BKXA 5IOYA 2E2HJ 5EGOB 1TC3C 5K7HA 4FISA 3HOUJ 2XB0X 3PO3J 2M0CA 2XGCA 2VUMJ 3JRCA 1TWGJ 4A3JJ 1Z0XA 2HOTA 2Y30A 2NVQJ 1U9NA 1RESA 5F0FA 3BT9A 1JTYA 2GLOA 1UHSA 3GTQJ 2VI6A 2CQXA 1EF4A 3RZDJ 2K9QA 5JLWA 1TWHJ 1HCRA 3CDLA 1RKWA 2CRGA 2EQRA 4AC0A 4AYBN 1AKHB 2LTPA 2XRLA 3Q0VA 3JREA 2E2IJ 5M3FJ 3LSPA 3ZQLA 3S2DJ 1O4XA 4A69C 3S2HJ 4JPZB 3TW7A 3I4MJ 2O9LA 5JLXA 5C4JJ 4JQ0D 3HOZJ 1ZGWA 3D1NI 1R9TJ 4G12A 1MNMC 2IEKA 3S1NJ 2LK2A 2XB5A 2DN0A 2DTZA 4V2GA 5DS9A 5F0HA 2VKVA 4QIWN 5IP9J 3BR3A 2O8KA 4MFEA 5FJ8J 2DMNA 3HBLA 4V2FA 1K61A 1MBKA 4M3GA 4DYRA 3JR9A 1APLC 4A3EJ 3B6AA 1BW5A 3I4NJ 2R5YB 4A3LJ 1OCTC 1JUMA 2CUEA 4BY7J 1W0UA 4A3DJ 5IP6A 2NS8A 3GBGA 3ZOBA 1TWCJ 4XIDA 3IH2A 3RKQA 2HQ5A 4UUSB 1HLVA 2NS7A 3FK7A 1LFBA 4M3FA 2MSYA 3QPSA 1I50J 2WAQN 2LLKA 3IH4A 3A02A 4XRSA 1FIAA 3S14J 3HOVJ 5GPCA 3GTJJ 1IG7A 2O7OA 1Y1WJ 1JTXA 2XPUA 2LP0A 3MN2A 3JRIA 4DYQA 4J19A 3BR0A 1JT0A 2ME0A 4Y52J 5FLVA 3Q0WA 1ETQA 5M3MJ 3Q0UA 1QRYA 5F27A 1A6IA 1HOMA 1U9OA 2L7ZA 4C3HJ 3K2AA 1GV5A 4M3EA 2Y9YA 2LR8A 2OF7A 1ETYA 1WPKA 2CQQA 2R0QC 2VKEA 4JYKA 5IOZA 1JKRC 3GTGJ 3BR5A 2EZKA 4I6ZA 1RR7A 2JMWA 3LOCA 2KDZA 1RETA 4JX6A 1ETKA 1PUFA 4C3IJ 3L1PA 4A93J 1LE8A 2MW8A 2YUSA 4W97A 5J3LA 5HODA 4XRMA 3BR1A 3HM5A 1VFCA 1HF0A 4A3MJ 2NVYJ 2XGEA 2W48A 4FE4A 1A5JA 1WH7A 1JUPA 4X1EA 3LSRA 1AU7A 5K7ZA 3S16J 2P81A 5EF6A 2XPVA 3G1MA 1ORKA 1X2MA 2M8GX 3QPLA 2DJNA 2VPRA 1JUSA 5EYRA 2HXIA 1DU6A 5EDNA 4B1RA 2QF7A 2NOGA 1JGGA 1MBGA 2M2EA 4BBRJ 3OOUA 4DZJA 2JA5J 3IV5A 4L5EA 1ZR4A 5FKMA 4IHXA 3RQIA 5GPAA 1QPIA 3TP3A 2DA6A 1FTZA 1VI0A 2LKXA 2LFBA 2PMZN 4FE7A 4NDLA 1ZQ3P 2M9HA 3OSGA 3S1MJ 2FJ1A 3FK6A 1IV6A 1E3OC 2FX0A 3B6CA 1AKHA 3S15J 1F43A 4XICA 3PM1A 3HOWJ 2D5VA 2EZIA 2DA2A 3GTMJ 3QQAA 4A3FJ 1MH3A 2X48A 2DMQA 1GDTA 3IH3A 1GUUA 1W0TA
chains in the Genus database with same CATH superfamily
1DIPA 2HNHA 5BOXA 1OW8A 3H1LD 1USDA 5GTHH 4DOJA 1K73Q 2R7ZJ 5E8IA 3GHYA 2LKMA 3P8CD 1QGPA 1XGSA 4EEFG 3W67A 1FOYA 3CF2A 1NTKJ 2OCEA 1FMVA 2H1LA 2LBFB 5BNGA 5LD2C 1K6OA 5DTDA 4U7BA 3Q5FA 2VQLA 1EZVD 1L0OC 1NO4A 1BCCJ 3GF3A 3HXLA 1XS9A 1JKQC 2NNNA 2B0LA 3BY6A 1ZK8A 3CZ6A 2XZRA 3TP0A 3ULQB 4E7SA 1SAXA 1KILD 4RESB 2MGQA 2HZDA 1SQPD 3SEZA 1SQPJ 2IW5A 4I7HA 4B3XA 4YEJA 2SPZA 4UVAA 1VQ4I 1EH7A 4DYDA 2I1KA 3H3VK 2LY2A 2PEXA 3VB2A 2GBYA 1T33A 4KN7X 1D1BA 3W3CA 1QA6A 4C2UA 3MOGA 1RE3A 1S5LX 3V4WA 1YW8A 3JRHA 1S6LA 3LIEA 1D5YA 2JUGA 1JY3N 2AXTC 4XL9A 4CA0A 4S3MA 4A12A 5D6EA 4LB6B 3SWKA 4A0ZA 4D5FA 1QVTA 2WVRA 1MBHA 4R1HA 4D9JA 2XHKA 3KYQA 2OYIB 2HGCA 3WE2A 1AVOA 2PX9A 1R23A 1ZG1A 1DP3A 2DFIA 1FX7A 3C3WA 1NTMK 1PIXA 2A5YB 1QVUA 3GW2A 2F5VA 2V4JC 2EJRA 5K5QA 1N77A 1IFDA 1CW5A 3Q3CA 4F55A 3L9FA 1S9HA 4EGYA 3FDYA 4CCOA 1IJWC 1BIAA 4E21A 2ICWG 2QYTA 5KLIB 4ZYDA 5FKOA 1IK7A 1KU7A 3U2RA 3BDDA 3DCFA 4PZJA 5EG0A 1LQ1A 1YI2P 2L02A 4X0GA 4E7ZA 2P7VB 2PG4A 1XSVA 1YX5A 4FT8A 3L70J 3MVPA 1HC8A 3V8JA 3ZR8X 2DA1A 2ID6A 4JK1X 2KRHA 2ZAEB 3L7WA 5H2FC 1H88A 2J59M 2R5ZA 3B71A 4P1WA 4UV8A 1VQKP 2PJRB 2KOGA 1T0FC 1W5CC 3ZQIA 2R5ZB 2FXMA 1NH3A 1YRLA 3ASNH 4BQAA 5APSA 2PLYA 2RKHA 3EWKA 2DOEA 1WJBA 3BLYA 1HSTA 4BAYA 1ZTRA 3WE3A 1JT6A 2V9KA 3LNQA 5EG0B 5AVYB 5BU5A 1P92A 3CCRP 3TW6A 5K5RA 2EZLA 4ZDOA 4EQQA 1NGMB 3COAC 3HSRA 2DMTA 5B66C 4OGQB 5CVVA 1ZELA 2FE3A 3BRTB 2FBIA 2M0BA 3D5LA 3FXUA 3VEPA 2ZJSE 4PD4I 5KAFC 4BXXJ 3W2VA 1M57D 2VLAA 2BCCE 3CDIA 2FMLA 2MLKA 3RL0B 2VT2A 4OM8A 1S8NA 1YOVB 3L75J 2VXZA 3BTCA 2J5UA 2WPSA 5ICEA 3BCCG 4L73A 5MGBA 1M66A 1LFPA 3JRAA 3QWLA 4PJMA 2ZYDA 2V1NA 3BG9A 3LIDA 4WXCA 1XDSA 4FQGA 3I0TA 1BI3A 3H35A 1LFUP 2H1KA 4YG2F 2V4HA 1FZGA 3CC2P 5BPIA 2DODA 2DA5A 3A03A 4RGRA 3PL8A 3C1DA 3V5BA 1GT0C 5KVRA 1YIJI 1SMYF 2OARA 2A5WA 3CF5F 3BP8A 3VMXA 3FXOA 1GL2A 3JW4A 4LFUA 5BS6A 1JTHB 1BW6A 1OIPA 3ZQHA 3ITKA 1ETVA 3RYPA 1Y0UA 2DMPA 3KLNA 1DEBA 5J47A 1BCCE 3MUDA 2OYHB 2QVOA 2M5AB 3ZDMA 2KIKA 2HXOA 2XUBA 2MH2A 4RBOA 2P10A 3KHUA 2M34A 3PO2J 2ZJ2A 3H2ZA 4GYIA 2L4MA 2P0WA 5A2QZ 2L5QA 3TDKA 1M75A 2E7XA 1V55H 2JRMA 2NVUB 5KAIC 1I6HJ 1TQPA 1P4WA 4B48A 1IDZA 4BBSJ 2WSSH 5AVVB 1JJ6C 1WT6A 2M87A 4KN4X 5H20A 1P7JA 1SMTA 1J1EC 3HSEA 1ZRTE 2FYUE 3V2RA 2R3CA 4IHVA 1HJBA 1BI2A 1N7SC 4ESBA 2ETHA 4H13B 3D5SC 5FKLA 1FS0E 3GZ5A 4IFMA 2LRDA 3GHGC 2K85A 1U5TC 1JHFA 3BR2A 4H4KC 1N7LA 1SQVG 2EIMH 1KQ0A 2K9SA 1JKOC 4Y28J 2D2WA 1Z56A 1Q1VA 1D0ZA 4WF2A 4KISA 2Z2SB 1KZHA 1DU0A 1Z05A 1S2EA 1RPWA 3ECOA 4F93B 1BE3G 2WT7B 4IL6X 4XRSG 5APTA 1I1GA 4ZYAA 1H0TB 1DGWY 3OS0A 3CX5I 1A35A 3TOAA 3L70E 3W6JB 3GFIA 4Q47A 1P84D 4BRYB 1I3QJ 4LIVA 3AE7C 1BGYE 2BY3A 4ASNA 2W6AA 3OW2O 1BIBA 2LOOA 4I01A 3SDBA 3WG9A 2ACJA 3KFWX 3ABUA 1LEAA 3M7GA 1SQQG 1L0NK 4JBZA 2CFXA 2HYGD 1LWUB 2R44A 3TGNA 1ZLKA 1BJZA 3OSFA 3B5ND 4H0LD 2YX4A 3IWZA 2A6TA 3L71E 2KDOA 4A5NA 4NUBA 1LNQA 3HD7D 1IRGA 4QTRA 3PIOF 4IEJA 5GAGJ 2ID3A 1NH4A 1NU1E 4RGSA 5KK1A 4EDFA 2XF5A 3CI9A 3Q5PA 3FKIJ 2G0EA 3ESWB 3FR8A 4OQZA 1S7AA 1XGNA 3I58A 3RCOA 2WADA 3FMSA 3CCMP 2E1MB 2I10A 1LE8B 2Y48A 9ANTA 2DDAA 3HTKB 4HOBA 1OR7A 1PUFB 2O61A 2M3AA 1SQBE 3G73A 3HEFA 3S17J 2EFPA 2EIJH 2B87B 4K3AA 4G7OF 1MBEA 3HPHA 1YQAA 3RQ4A 5EEAA 1MFTA 4QWQA 3NARA 2KNCB 1LVKA 1DD4A 4EI2A 3U1KA 1T8ZA 4HSTA 3TDZC 2C9NY 3SJMA 3H1KD 2FD5A 2UYYA 3K10A 5GTHC 1PP9J 4WWIA 2L7MP 1KFNA 1QL2A 1KB9I 2OU2A 3GUDA 2VJ5A 1QLED 3PFIA 5GAEJ 2JR8A 3HTKA 3A5TA 3CMAP 2JPCA 1JEKA 3AE3C 4HV5A 2IGNA 3MMYB 6PAXA 1RQUA 4MN4C 2GA2A 1X79B 3I4PA 4I0AA 3W6UA 4XKBA 3A2KA 3T8TA 4BUPA 2W6BA 3HD7C 4M9XA 4XSXF 3ZRGA 1QBJA 1IXRC 1IXCA 3CC4P 2OCCH 2J58A 1Z0XA 2BV6A 2ADUA 4E13A 2MA3A 5F6FA 2JRTA 3BT9A 1FPQA 1JTYA 3FBNB 1SFCD 1T6AA 3A0BH 3GTQJ 4L9NA 2CQXA 5B1AH 2B9SA 2OAZA 2ZSHB 4R79A 2HODB 1L2PA 3P8MC 1WJEA 2K9QA 3CCSP 3TO6A 2L9SA 4HW0A 3HDHA 1KN7A 3WTXC 2WAFA 2DYRH 3PLRA 4LGDE 3HPGA 4M72A 1BR2A 2CSOA 4AWXB 2IBZG 1MMDA 4JPZB 3CCJP 4BRYA 1NYHA 3GG2A 2Q2EA 2W84A 4HBLA 2O9LA 3H92A 2XU6A 3H9JA 3KP7A 1MUUA 5CVUA 1N1GA 2W25A 3MTUE 1AWCA 4DQ2A 3HOZJ 2Z5UA 3M06A 3D1NI 1MD0A 2YIUB 4UNOA 1KORA 2KIQA 4G12A 3G17A 1L4AC 2X51A 1IN4A 3HL2A 3G71I 2IGMA 1GU4A 1SQXJ 3M91A 4M73A 2YPRA 3H3UA 4HX7A 4BJ6C 1F4KA 5F0HA 1FZEA 4PJLA 5IP9J 4AUWA 3GX4X 3CX5E 3CJNA 5GADJ 2O8KA 1K9MQ 1EXIA 3CD6P 4V2FA 1K61A 4M3GA 5EEHA 1JMBA 1APLC 1MKMA 1EKEA 2X0LA 3FMQA 4XKWA 3S8PA 1LTJA 3S2WA 4EM1A 1E0EA 1OYIA 3E5UA 3DPUA 2YIUC 3QU3A 4HAMA 1JUMA 2CUEA 5JI6A 3IRQA 1NTZD 2IYPA 3QSGA 5DJUB 5L3BA 4CCKA 4HNTA 1W0UA 2XDVA 1KMIZ 4U0VA 5IP6A 1GW4A 2QM3A 4U3FG 4AVZA 3PQKA 1TWCJ 4EJUA 3HHGA 2XNXA 3EFFK 5KLVE 1K8AQ 3P9IA 4KJZA 4XIDA 1IK9A 2OZ6A 4HNUA 2QSIA 2KPMA 2X6YA 3RKQA 4J0FA 2HPIA 1KYWA 1KD1Q 1DLJA 3A7OA 2BY1A 2NS7A 1C0WA 5D5UB 2OQGA 3L73J 4D6TJ 2PMHA 1VQLI 3MUDC 3M9BA 1X1AA 3J7YJ 1I50J 4HPQA 4BXUA 1MDMA 2R7XA 1G1IA 4IL6E 5B5EC 3KZYA 3AE6C 4PV1B 2LNBA 4NB5A 1YTZT 3S14J 5ILSA 3H1LG 1AQ5A 2YMKA 4B47A 5D8KB 4CYDA 1IG7A 1L0LD 1IO2A 1Y1WJ 2EINH 2ZJQF 1X3UA 3PNYA 4L75A 1JTXA 1LDDA 2PLAA 1U0JA 2PFBA 4U7JA 5KAIE 1YIOA 5J6XA 2R5BA 4CCLA 5LFAA 3MN2A 1IFPA 2OYHA 4G6QA 3BC8A 3E97A 3BR0A 1OW7A 2K4JA 3PDUA 2CVZA 2FNAA 2FXOA 1R36A 3L2VA 3BCBA 1QRYA 4D3FA 2K37A 2XRNA 3O2PE 1U9OA 4CHUA 2VQHA 3BOQA 3K2AA 5AYVA 2Q1ZB 3G3ZA 3L2CA 1BR1A 1KA8A 2GZWA 2CQQA 5DJTB 1XGMA 2OBPA 2R0QC 2E75B 4JYKA 5IOZA 2Y0DA 2MJZA 4JBAA 3CWBE 3BR5A 4I6ZA 1HF9A 1S9KD 2JVHA 4YPCA 1RR7A 2H6BA 3GO5A 2KDZA 4Q5SF 2GF2A 3ZMSA 3IAOA 2FFDC 1BOBA 3VODA 2V1UA 1EV7A 2QKLB 1VQ4P 1CSBA 1E17A 5FD5A 1H0MA 3H5RA 2Q5UA 3GMAA 3L73E 1BE3E 1WDKA 4R4MA 3Q5SA 2DW4A 2VN2A 3SFZA 4IM7A 4E7HA 1RI7A 1XGOA 4HG2A 2QJPC 3HE5A 2QWWA 4XORA 5A9SA 5CCGD 2OFPA 2FMYA 2M4KA 4TV7A 2Z5IA 4W7ZA 2NVYJ 4IF4A 2QLZA 3H1IE 1P4AA 1AA7A 1YQ3C 3K69A 3LSRA 3J7AY 4HRIA 2A07F 2JDIH 2A06G 3OR1C 5A9RA 5FGMA 1KTMA 4YELA 3BZCA 1G1JA 3ZMDA 4E6KG 1SVMA 1OW6A 1SQQJ 4D6TD 2JJLA 1XD7A 5IT9K 3IP4B 4J0EA 4OGQC 3L35A 2YMYA 4B1RA 4M9ZA 5FB2A 1KYOI 2E74B 2NOGA 1VDFA 1U5TA 1MBGA 3K5BA 4LLLA 4A0YA 2Y0EA 4FX0A 1W36C 2DQLA 2VBXA 2K86A 4UB6E 1KFMA 4RMNA 2OYIA 3PFYA 2JA5J 1ZN2A 2FFDA 2VL8A 4L5EA 4L9JA 2O1KA 2AEMA 3BRVB 1O7LA 3TGUJ 2P6TA 1FWZA 3CO6C 3SFEC 3H25A 3DPLC 1JCCA 4L9VA 1G4DA 1SFXA 3K6GA 3KLOA 4KUHA 1PP9D 3BJAA 4FE7A 4OOIA 3TDUC 1ZQ3P 1L0NJ 4UV9A 1GD2E 4NPFX 4PCQA 4EJVA 1PV3A 2FJ1A 2LMDA 3FK6A 1F5TA 2F4OB 3WG7H 3KZIH 3AE9C 2H8PD 1T95A 2FX0A 1AKHA 3S15J 1YI2I 2VE8A 2CK3H 4L76A 3O3KA 2PRRA 3PM1A 2W57A 3HOWJ 2ZNZA 2IPPA 1NWQA 1S72P 2R7SA 3IL2A 4JF7A 1QHGA 2DA2A 3KEOA 1VQPI 1FC2C 2OYIC 1EDJA 3ISPA 2HTJA 2FXPA 2G9WA 3PJGA 1K78B 3NWSA 1OVUA 3QWOC 3OYIA 5CJ9A 3WTYC 1DGRM 1GDTA 1UHWA 3BCCJ 2YKPA 1VZ0A 1WQ2A 1EVZA 4K35A 4NHJA 2EV5A 2VRSA 4BYYA 1SQQE 2DBBA 3M9AA 2PQ8A 4HDVA 3K4JA 1FZPB 2Z1DA 2CW0F 1MH4A 1R7JA 1W7PD 3LSIA 2DA3A 1SFOJ 1PGQA 4OGQD 4LG3A 4KICA 1NTZJ 2E2JJ 1BI0A 3E3VA 1QHHD 1T8IA 3H1JD 1NKNA 1MGTA 3ZGKA 3ZPLA 4TLFA 1XTCC 1X9VA 1V5GA 4PD4D 3K6JA 3OIOA 1BA5A 4W80A 1WRJA 5LEJA 4E7JA 3TNUA 1VQNP 1V4RA 3GFLA 1Y1VJ 1JE8A 3V7CA 3RK2D 3HGGA 4A3BJ 4UB6H 2LBFA 3RIRA 2B7EA 4KDPA 4DIQA 3FIWA 3OYKA 1HW5A 2IA1A 1MMSA 5L3CA 2QVAA 3BCAA 3K4BA 4R8HA 2VC1A 1KU9A 2BW3B 3HIFA 1FJPA 2OTLI 3IKTA 5FLXK 1OYWA 1JKPC 4D7MA 4A3GJ 2XGDA 3EETA 1HBXG 2PFXA 3H1JJ 5B66H 1MDMB 4KUEA 2DYSH 1H89A 2A06D 2R5YA 2Q7CA 1CGPA 3PIPF 2QKMB 4W7YA 2ZXWH 1LT9B 3BG3A 1FOXA 2Y69H 3W6KB 2VKHA 4BHCA 4HDUA 4DGWB 1KC8Q 3H0DA 2W24A 1X58A 2WTBA 2M30A 4RB1A 3SWFA 3HOTA 1UFMA 1YRNB 2LXCB 2ZT9B 3GMEA 1GVDA 2K9NA 2RMZA 5IYBJ 2XKMA 3PTZA 1LT1A 2NXNB 5FD6A 1Q90D 2BASA 4ZKPA 2Q3EA 5DUKA 4N9HA 4E70A 4GT1A 4JQFA 2VXDA 3KETA 1SQXK 5HWSA 1O3SA 4D7NA 5H2FH 2OC6A 2XNDH 3HRNA 3FZVA 3ZQFA 2IS4A 4XONA 3ZHBA 1BSNA 1JY2P 1BDDA 1SFEA 3CC2I 3H1HE 3H1IJ 3D70A 1NK3P 2L0KA 1WWXA 3HUSC 2O5RA 1BGYJ 5F1RA 1EH8A 3TYYA 2BBYA 1XMXA 2MD5A 5AVXB 1RIOH 3GLLA 4C2MJ 1ON2A 4RAZA 2ZT9C 3MKLA 2DQRA 3BG5A 4B3JA 2K9LA 3AE8C 4ZDLA 3F3SA 1IRXA 1TBXA 1V3FA 4RB0A 1X3WB 4IOCF 3DEWA 2KJCA 4XA4A 4QSHA 1SVLA 3W2AA 3CTAA 3AEAC 4M9SA 1FNNA 1FAVA 5GAHJ 2YU9J 4IO9F 3CCVI 3HADA 2LSOA 2X6WA 3C2BA 3IUOA 3QRFF 4ZKUA 1FBUA 4H44C 1XX5A 1FOSF 3UR3C 2XKPA 4E7IA 1LTTC 2Y2ZA 5K1YA 4NBQA 4X6AJ 5CCHA 1VF5D 3TKYA 1TP4A 3NEUA 2CUFA 3HUSA 3LSJA 4KITB 4KMUX 3V4GA 1DD3A 2IX7C 3HD7A 3BG6A 3K0LA 4XN3A 5HDGA 1FYKA 3E1RA 2HVSA 1RQVA 4UY8I 2LF7A 3FR7A 4B86A 5CBOA 2KLOA 3C18A 1FYMA 1YTZI 3BR6A 1OFCX 1FJLA 1K83J 3DLLF 2HDWA 3PEFA 2R3SA 3LAJA 3AKZA 1FOKA 2HODA 3ERMA 3H1HD 2QG4A 1VQKI 1RF0A 2PI0A 4PJ0E 2BXYA 4OWRB 4HYEA 4XRFA 1XDUA 2GM4A 2IAIA 2ECBA 3VPRA 2WBMA 1T39A 1L3LA 1ZLLA 4H13D 3ABLH 2HDDA 2OPTA 4OVNF 4UB8E 1MV8A 4CYCB 1P7IA 1NTMD 2KI7B 3LSGA 5EJCA 1Z3YA 1ZYRF 3G1OA 4G6TB 4EMSA 3BQYA 2FNPA 2IFMA 2ITAA 2V1DA 1M8OB 4HJGH 1H89C 2RH0A 2UWJE 2YKOA 3JSOA 2IS2A 1DEEG 3QODA 5ILUA 2ZVNB 3A01B 2IYOA 4L18B 1PDNC 2NPSA 3LMMA 3N4MA 1WDMA 1A36A 2PMUA 2R7OA 1S7OA 2A45H 2GOXB 2K5CA 2IS1A 2D2CC 3ECHA 2O01N 1BL0A 4O3MA 4ZDPA 1UG2A 5DM7F 1TXGA 5AW9B 4I6MC 1YE9A 2KP8A 2K7LA 3JRGA 1FOSE 1WCMJ 2R7QA 3LA3A 4A0XA 4CYCA 5M5YJ 5IYCJ 3KDPB 2M3EA 4S04A 3SEQA 3A2AA 1UG0A 4CPGA 3HUGA 2B87A 3CMYA 5TISE 3VTPC 1KILA 1X3ZB 1J59A 3V4QA 3RTRA 2QJKC 2MYSA 5DDGA 1ERDA 2XDJA 4LITA 3PJRA 3CXHE 4RGUA 1FSHA 1MMAA 1X22A 1D7MA 2BCCJ 2NRGA 5B1BH 5B5EH 4MQ9F 4BH9A 2DCEA 4L0YB 2QA4I 4PGHA 3P9CA 1PGOA 1ZMEC 3A0HE 4LD5A 1HKTA 4XBFA 2GA1A 2PN6A 5CVRA 1O57A 4BGDA 2E74C 2KIFA 5KLVK 3ZQ7A 2MFZA 3MIWA 2ZNYA 4M74A 2RVCA 1G3YA 3K70D 4RDUA 4B43A 2POHA 3I83A 5M5XJ 3E6CC 2BVLA 3ZP5A 1VQ7I 1ENHA 3LSMA 4HA8A 3I55I 1T0FA 3AE4C 2XGXA 3P7NA 1HQCA 4C7NB 2AO9A 1KZUB 1SQQK 2E35A 1JGSA 1L0NG 1SFUA 1AQTA 3ABMH 4AIDA 4MLOA 4JYCA 2NAZA 1B72B 1FYLA 5J1UA 3WU0A 1KONA 2X1DA 2HI3A 3FM5A 1KYOH 2LDUA 2NOJB 2VBZA 3PQJA 1HJ0A 4GODA 2K3PA 4H0LB 2QA4P 2F5DA 3GLMA 4LIUA 2K3RA 1W5CE 1OMIA 3GHGA 1M90Q 4XSZF 1QZZA 4W1UA 1PPJE 1B8IB 3M4OJ 5M1BA 5E3OA 1PP9E 1HBWA 1U3EM 1D3YA 1RR8C 1OLTA 2WV0A 3LQRA 1YB4A 2ZCWA 3MD0A 3VP9A 1T56A 1IN7A 3FXJA 1V5EA 3BASA 3KXDA 1YIJP 2LG4A 4P5OA 4YIFA 1M76A 2MABA 5EZGA 3S3OA 1GV2A 4M3LA 3PSIA 2VBWA 5FLMJ 3OIQA 3OYMA 2FKWB 2E1OA 2HLOA 3TMOA 5KNLA 4Z2YA 2OTJI 3J80K 2NVTJ 1NTZG 3GTOJ 2CPBA 5E3LA 4IOIH 1JNMA 4M3DA 2A68F 1JM0A 4BWNA 4RS8A 1WZ2A 1W5SA 4IRHA 1Y39A 1P84H 3FWEA 4HQMA 4U3FJ 2E74D 1TWFJ 2DT5A 3ZMZA 3K2ZA 1NK2P 2JA8J 2K9JB 2YO2A 4D6TE 1I1SA 4UB8H 5L3EA 4GWKA 4LK0F 1YONA 2W83C 1MSEC 1FP1D 2BZTA 3BTLA 4IFFA 1LT9A 4OL9A 3R61A 5CVJA 4YRVA 1T2KA 3AEDC 3J80Z 2NNYA 3L2WA 3A01A 3CWBG 1QPMA 2KJBA 4I09A 1X2NA 1B6AA 3D6ZA 1QVFO 3WU1B 4U87A 2DPUA 3LA7A 1YYCA 2DA7A 2CO5A 3B73A 2LVSA 3VYTB 3K96A 2X1CA 4KUGA 2IJLA 1B4AA 1K4SA 3HE4A 3MHVA 2JJ7A 1Z91A 2YX7A 4FCYA 1L0LG 1ON1A 4I2LC 5FWNA 3GTPJ 5E79C 3L73D 1TZLA 3I54A 3RKXA 2FYNB 4CCNA 4RAFA 3QHAA 1R5GA 5F64A 4DZPA 1EQ7A 2C9LY 1HUCA 3F23A 2CPSA 1U7JA 2AHQA 5LGUA 1HDDC 2YXRB 2ZXEB 2XPWA 3OR2C 4OH8B 4BKXA 3CCEP 3ABTA 4ZTFA 1NJIQ 2CUJA 5L3GA 5FFZA 5K7HA 4FISA 2ESHA 5CPRB 1FZFA 1URQB 3CWBD 3I53A 1UIXA 1OQYA 2E5NA 2QSHX 3F89A 3EFGA 3CWBJ 1P2FA 3WMM0 4BQNA 2VUMJ 5AVSB 3RK3C 2FF4A 3NQOA 1NU1J 5CJ4A 5HDKA 1TWGJ 3MQ0A 4L5IA 3JRCA 2HOTA 2IT0A 1PPJD 2WAEA 2WPVB 1EH6A 1ZG3A 3RPQA 3HUSB 1U9NA 3M8FA 4IQJA 2Q1KA 3R4YA 2KSEA 1VQOI 2Z4EA 3F8FA 3GZ6A 5CCHD 2E5YA 4RO0A 3WGIA 3FHNA 2E1CA 1W5TA 1JXSA 5LHGA 3IR9A 5JLWA 3IFMA 1HCRA 3CDLA 5HLIA 3CXHI 2EQRA 4AC0A 1I3AA 1KYZA 4YIIA 1AKHB 3VYIA 3GYHX 1N25A 2XRLA 4G6DA 4ANJA 3Q0VA 3LSPA 3ZQLA 3S2DJ 2Y0MA 4EJOA 4ESJA 2VQGA 2L9VA 3TW7A 2KUBA 5AVQB 3I4MJ 1USSA 4L0ZB 3KPEA 2WSEH 1IZ1A 4ZYGA 1HWTC 2QQAA 1WJ5A 1FBQA 2KKOA 1IJDB 3B02A 1N73C 3V42A 3CC4I 2VJJA 1KB9H 2H09A 2XIGA 1HH0A 1R9TJ 5AVRB 1OPCA 4HQEA 4DLLA 1AJYA 2IEKA 4YFKF 2H89C 2HS5A 3VSLA 3CXHD 2AXLA 4PZDA 3KYLA 1TU3F 3HRMA 4I7ZB 1BG6A 1S5LE 1K7AA 3S1NJ 2XB5A 1U5TB 2DN0A 2L9NA 5IT3A 5DS9A 4WY4D 2ZFUA 4QIWN 3HTUA 4A7PA 3KQGA 1VQMP 3RI4A 2LREA 2FU4A 2DMNA 1YJWI 1LTAC 4O9BA 1Y6IA 2BHZA 1CI6A 4BNCA 4H44D 3D1LA 4E12A 1SS1A 4F3QA 1UZCA 3KPHA 3ADPA 3ZWCA 1BW5A 5LLQA 1VF5C 5APQA 3ADOA 2R5YB 4ZYHA 4A3LJ 1OCTC 1ZXGA 3PNVA 1JDJA 3VYUB 2MLGA 3CCLI 3CX5D 3R0JA 4BY7J 2VODA 2KFDA 1LTBC 2FYZA 3KYCB 3DBLB 4JYBA 3B5NA 4PFOA 2BW3A 3ZOBA 1T2KD 3M1CA 2D2CD 1BN5A 4ASVA 2UZKA 1LP1A 3AEBC 1B9NA 5JVGF 1NTME 4Y99B 2OYHC 2MKVA 1X8YA 1R5HA 5GTHE 4H0EA 1G8XA 1PYVA 2KL4A 4OAZA 2OJED 3WTSC 4M6YA 4HB1A 2X4HA 3FK7A 4I99C 2EFWA 1Y8QB 1ZV8A 1AV1A 1KQGB 2MSYA 3REOA 4BXFA 2HR3A 3VWBA 3L09A 1IFMA 3QPSA 3L72G 2M0MA 1UAAA 4E7KA 3LW5J 4XRSA 1LGHB 1FBMA 3GVAA 3CP2A 2W90A 1BJAA 2X85A 5HDNA 2KRFA 4J00A 3M0AA 3GTJJ 2IBZI 5HOOA 2O7OA 2EPFA 4I2OA 2BY2A 2YU3A 5TISC 2N1TD 1FZCA 2G3AA 5D5VB 1AVYA 2GUVA 1YW9A 2LP0A 4KNYA 4KJMA 5APXA 4MGRA 2V7FA 2G7HA 2ME0A 2A61A 2EA4A 1JT0A 1K78A 1EZVG 1ZP0C 2A45I 1PP8F 1M1JA 3L74J 4UVCA 3B4SA 2X58A 2RN7A 1LDKB 2QRXA 3L71G 3CX5H 2ISZA 4C3HJ 2PBIA 4NNJA 1YTYA 3AG3H 3MD2A 1SQPG 1GV5A 4GBJA 3O6BB 1OCRH 1FZCC 2WY8Q 2NRAC 1XCBA 3K4MA 4KIGA 3UNGC 5D4SA 4BHPA 3ZGYA 3JCUE 2EZKA 2JUCA 3ZN0A 2QM8A 2JMWA 3LOCA 2F5EA 3OYLA 3ONQA 4CCJA 4HKZH 1S1CX 3BPVA 3LSHA 4HYTB 2QJKB 5FFXA 1R5ID 1W2BO 3WU2H 1XB4A 2WSCJ 4OIQF 1L4AD 2P4QA 3F6OA 2KS1B 3MZWB 3R60A 1YJ9P 5D6FA 2IA2A 3DTKA 3IWFA 5DEQA 3HM5A 3WTTC 3R0AA 3LAPA 3SZPA 4Z6YA 2VASA 2KMUA 3NWTA 5BMZA 1VFCA 3VMYA 4B3HA 1QO0D 4FE4A 4WX9A 3V8KA 2OZUA 2QENA 3FF5A 3P5JA 4X1EA 3G0OA 1AU7A 3CCUI 4IHTA 1GHCA 4FGWA 1NAFA 4PFPA 4KFCA 3GF7A 1R4NB 3G1MA 1X2MA 3KZZA 3QPLA 4KIBA 4OU0A 4Y13A 3OYDA 4LLNA 3CKYA 2F4IA 1JUSA 3QYFA 1X0VA 2IP2A 5KJ7C 1B59A 2HXIA 2A06E 4RJTA 4HV6A 5HS9A 4BL0B 1BGYG 1YBKA 2E76C 2Z33A 1U2WA 1VL2A 2O1JA 1GLNA 4A5MA 1JGGA 1SFCB 3M9QA 3CCQI 2N1TA 4QPQA 2CYYA 2CG4A 4PJNA 2QBYA 1VQ7P 1DX7A 5ED4A 4UB6C 4XLHA 3IV5A 2VIXA 1GU5A 2W27A 4ASWA 3ELKA 2Q8KA 1RRJA 1QPIA 3TP3A 3DTEA 3OYBA 1FTZA 3JCUH 1U8RA 2CW8A 1VI0A 2Z5HA 1SFKA 2LFBA 1BC7C 4PD4E 2Q2EB 1Z6TA 1BGYD 4ZJZA 3OSGA 1W7PB 2E7WA 1WDLA 1XTAA 1G59A 1P84E 3S1MJ 2W82A 1Y47A 3L70D 4BHBA 2JWAA 5ICCA 3H1JE 3V2PA 1FOWA 1E3OC 1Q1HA 1K4TA 2FBWC 3H1HG 2ZXXA 2IZ0A 3LSKA 1SQQD 1R6RA 3GFJA 4IRGA 3CO7C 1D0YA 3DPTA 3QQAA 2IFNA 1ZRDA 5DYMA 5B3SH 3CLQA 3MCZA 4DOZA 1T6SA 3CMMA 3QPTA 2QQBA 3AE5C 1JB0J 1X1DA 5HLTA 3JR9A 2LR2A 3K4NA 3HOSA 1KQ9A 1WP4A 3OYCA 2ZVOB 2XSDC 1F36A 3EUAA 5CCHC 1IUFA 2FA5A 1UB9A 2X6OA 2FUG2 4RM3A 2R7WA 2FY8A 3OA7A 3FXEA 1ZGAA 3B5NC 3NMDA 3CCVP 2XAGA 3MKYB 4RAGA 4EJTA 2HVRA 2FYUD 1MSFC 5LRSA 1S7EA 2R7DA 1BC8C 3FWNA 4XFJA 4LLGF 1FEXA 3F0CA 2IS6A 5AW8B 1LSJA 2JN6A 2FBKA 1OCZH 2UWMA 5E17F 2QM7A 5B66E 4G7ZF 1J1DB 3S4RA 2HOAA 1TNTA 1FC3A 3OIPA 2E75C 1JY2O 4XOPA 1KV4A 2B89A 2F4MB 3EUKL 2WITA 4G9YA 3S93A 3ZCOA 4NC6A 4XR6A 3CESA 5JFRA 2A3SA 1OCPA 2W4SA 3Q3SA 5GP9A 3AAFA 1UIIA 2K9YA 2M4GA 2HQRA 2H8WA 3SYTA 4B3IA 3L73G 2C6YA 2N9BA 4WVZA 4I7ZC 2VPLA 1XN7A 1E79H 2UV1A 4GFBA 2HWVA 3KP3A 3AG4H 3FX3A 1SQXG 2F5FA 5HLHA 2BCCG 4LGWA 1QZEA 4IFDK 1TTYA 2K27A 4XKCA 4HF1A 1AHDP 3U21A 3W2WA 2V26A 2FYNC 3L2QA 1NKZB 2ECCA 2TRTA 1MBFA 2L9RA 3FX0A 4PSXA 3H1ID 5DM6F 3QP6A 1F1ZA 4CDGA 1B8IA 1FY7A 1MBJA 1A31A 2W6JH 3HSFA 1QL1A 3GHGB 4XM3A 4ZYEA 2F5CA 5DCMB 2L7FP 4ZC3A 1O3QA 2CV1A 5LHIA 3BTIA 1ETXA 2V7QJ 1MZBA 2HFED 5CHXA 1B72A 1SD6A 5CQGA 3UKGA 4PZEA 2HZTA 1BE3D 2KQRA 5E20A 2L2OA 4MFDA 3T97B 2BCCD 5JHFA 4C7NA 3KYDB 3D0SA 1N73B 1G2HA 2FRHA 4PUSA 2CH0A 1S9KE 4OAYA 3FGAD 2QSFX 1YFHA 2K02A 4C3JJ 2QCOA 1KQSO 3M3YJ 3M0DC 1EC5A 2WA0A 1WGXA 1IRZA 2RV8A 1TW3A 3OY9A 2R92J 2E75D 1H9TA 5APUA 1WFXA 2O0YA 4WK8F 2XVCA 2KYVA 1Z9CA 1N73A 3W6VA 5E3NA 4NQWA 1J2JB 2B88A 3HB9A 1Y56A 4D5CA 3FMRA 3G4SP 2DOAA 2L91A 3WHCA 3CMEI 2L4AA 3F3XA 1FP2A 1ODDA 1JI8A 1K05A 5EFWB 1T2KC 4ITVA 1OKRA 1X0TA 2ZXHA 4B4CA 1LJ8A 4LB5A 2HVQA 2COMA 4HNVA 1IC2A 1IXSB 2L7KA 1BOAA 4JX5A 4IHYA 2HPCA 4PDKA 5K7FA 1L0LE 3L72J 3Q3DA 2P4WA 3F5HA 1SQBJ 1X1CA 2DFEA 5HVQC 2XSJC 2M5WA 5AW6B 3RKYA 3VOEA 2JEEA 3CCQP 2W8ZA 2QJYC 3V7SA 2STWA 3G1LA 2Z99A 1WH5A 5BU8B 2NYXA 3F8CA 1H8AC 2ZYGA 1RH5B 5E18F 1CQTA 4HSRA 3SFIA 4KT0J 2G7UA 4KT5C 3S1QJ 1RY3A 1PGJA 3CCLP 2EFQA 4ESFA 1YJNI 3F8NA 3GEZA 1M1KQ 1FMWA 3A0BC 4HLXA 4Y7NJ 1TQIA 1VQ6P 3GTLJ 5AVWB 3OYHA 5KLVD 1VQOP 1IN5A 4LOCA 1ZW0A 1SEUA 4EGZA 3EYYA 3I64A 2JK3A 2KT0A 2ZMEB 1TNSA 3LL7A 4Y4RA 5C44J 1NTZE 2N9YB 2WMMA 2F48A 4MIMA 1VNDA 3CJTB 3WUTA 1WSUA 2ZSIB 3CP8A 1Y8AA 4XLAA 3CJQB 5TISH 4PK4A 2E34A 2VKDA 3HGYA 4HZFA 4WXDA 5IYDJ 2OTJP 3EGOA 2EA2A 1P9QC 2ZFWA 3KEYA 3A0BE 2COBA 2V79A 3W6ZA 3FXDA 1HDPA 3BPXA 4XLFA 3KZIE 2AXCA 1EXJA 1SQPE 2PJPA 5KLVG 1W7PA 2CU7A 4U7DA 2KK7A 3HG9A 4DCKA 1ETWA 3IKVA 4I76A 2NS0A 1FTTA 4H0LC 3RK2B 1P84I 4N9IA 3P7KA 3JRBA 1GTWA 3ZN1A 3X2QH 3WFJA 3KP2A 1D0XA 3AG1H 3ZQGA 4IL6C 2XC7A 4FETA 4BY1J 3A3YB 1YHQP 4QLCU 2BE5F 1LWUA 3H1KJ 2N8GA 1H88C 1N86A 5AVUB 2JWTA 3R4KA 4XK4A 5A2QK 1PFIA 5TGTA 3AEGC 3GW6A 4ZZDA 1DH3A 1VPDA 1JY3O 1SFCA 1BI1A 3S3MA 3U9GA 3H1LE 1YLFA 4BACA 4LK1F 3PP5A 4Y17A 2XAFA 1JHHA 1TWAJ 4H44B 1SC7A 3BQZA 1R5SA 5IP7J 1TLHB 4MNUA 5F0CA 5LRRA 1ZCJA 4WBAA 1YW7A 1H0TA 3HWRA 1LTGC 4PV1D 3SWYA 3L6DA 3BJOA 4NPEA 3VOPA 3P9KA 3GLXA 1KU3A 3HKZN 2JA2A 1R1TA 4GYGA 4Q48A 1Q82Q 2DXIA 4IQ4A 3HHHA 3SDGA 4Z1MH 1NTZK 1BSHA 2OA4A 5CJ0A 3S32A 4DNCA 4IKFA 4EATA 3E6DA 2BEZF 1JJ8C 1F0YA 3TK1A 2DJIA 3CC7P 3H1CA 2OQRA 1J9IA 2D2CB 2STTA 3MZ8A 1TW2A 2EH3A 3ZQCA 4BU2A 4M6VA 4JP0A 4A3KJ 1VF9A 2NPSC 1Z3XA 2ISYA 1RC9A 2R5DA 2Y31A 2BXZA 2EZHA 5E1XA 2E1NA 4QPOA 2WAQA 2FYUJ 2VOPA 2I8DA 4D3DA 4WY4C 1N7SD 3H1KE 5IT9Z 1YS7A 2HYJA 4C30A 3S3NA 1SLQA 2NVXJ 3KCCA 3L37A 2DA4A 2X9DA 1MMGA 3PUFA 2CS3A 3CMAI 3UIAA 1PGPA 1URQC 2YS9A 3OWTA 4IL6H 2M5AA 1HVVA 1R49A 3BTJA 4IPAA 1L0LK 1IFNA 4OMYA 2ME6A 2HOEA 2VC0A 4AD9A 5EGOA 1Y0NA 4IHWA 4G94A 1UHMA 2RREA 1POGA 4YIRX 2I1JA 1XG1A 1JTHA 1GL2B 3OYJA 2HYFA 2IBDA 5K5OA 5J1RA 1SQBD 1YHQI 1RUOA 3ZXSA 3L2RA 5KKZC 3S9OA 4AUXA 1WI9A 3WTUC 2FOWA 4BE2A 2CQNA 5F1JA 5CVIA 3TOBA 1T08B 4B8XA 1LEBA 1IFJA 5TRDA 1I39A 5KLIC 3T5XA 2RN0A 2CV2A 2VB6A 1N75A 4D1QA 4MTEA 3VDXA 3F21A 3Q2YA 3QH9A 1WI3A 2FQ4A 3IHUA 1ZR2A 1O3TA 2ZB9A 1D8JA 1FZBA 1NU1D 2BHYA 3MZYA 3RPUA 3CCYA 1M1JB 1USTA 5AW2B 1WVRA 3DLAA 2K1AA 3I3LA 1SD7A 3I59B 3L71D 5EGOB 4YTPC 5E79H 1ACIA 1VF5B 2ELHA 3L71J 1AA0A 3F8MA 3PO3J 1SFCC 1LP1B 2M0CA 4DT0A 1J2XA 2BEOA 4ON0A 2KISA 2FSWA 4C9YA 4A3JJ 2W00A 5C39A 2P7JA 1VQ8P 2YXQB 3U1AA 1NHAA 3CLOA 4EV0A 2BYVE 3AFHA 4A2UA 5F0FA 2H94A 2W7NA 4OWFA 1UHSA 1F14A 3NRVA 1YVEI 5CMZA 4C7RA 3NTNA 4Y33A 3ZW9A 3MKWB 5LBQA 1EF4A 4KHXA 2A6EF 4EOTA 1JY3P 2YR2A 3VP8A 2WQYC 3BZ6A 1MW7A 2EFOA 3HRTA 1RKWA 2CRGA 2H27A 5AW4B 2LTPA 3LFUA 1TT5B 1ONVA 4BS9A 3JREA 5M3FJ 3VYSB 2E2IJ 2PJRA 1O4XA 4A69C 3S2HJ 4MTDA 1YJ8A 5KAFH 2DU9A 2E43A 3H9QA 2O3JA 2OTLP 1OZHA 1G6NA 2X1EA 1PJRA 2HTSA 3C2GA 1GXPA 1F12A 1E3PA 2I5UA 5E1ZB 4E7LA 5H2FE 2UXXA 1NHLA 5JR3A 2DT7B 2V9PA 1ZRTD 2KXPB 2GAUA 2E42A 2O6GE 2V9VA 3AL0C 2M8EA 2Y0CA 3AE1C 3I56P 1N7SA 2L01A 3CMEP 4CZZA 2QSGX 3F6VA 5JHUA 2LK2A 3KE2A 4V2GA 2H88C 2ZJRF 3RBZA 1IO4A 2I76A 1VQLP 2OTKE 2Z9OA 1X0XA 2P2UA 5FROA 4MFEA 5K5GB 4F92B 5FJ8J 3HBLA 4HEA2 1YO5C 3RK3B 1S3JA 5KJ7A 1A02F 1WHUA 1BCCD 3B6AA 2A45G 3CUOA 4M71A 1BCCG 4UHTA 1Z6RA 4XKVA 5H6RA 1FJKA 3C2HA 1MJBA 2RQPA 3J7ZI 2JKVA 1SQBG 2E76D 3C8VA 3L2UA 3CL3D 1YJ9I 3H3ZA 4O5VA 1YJNP 3CXHH 1SD4A 4A3DJ 4GGGA 5A9TA 2AEJA 2NS8A 2R7FA 3GBGA 1Q7YQ 1N1EA 2XKOA 3H5NA 3I5UA 3G6EP 1B1BA 5IY5H 4GO1A 2H6CA 3A1YA 3IH2A 4EJWA 2HQ5A 1PZQA 2V6CA 5D5WB 2D1HA 3H6PA 1IN6A 3USSA 1GXQA 2GUSA 1RF1A 5LHHA 1HLVA 5JE8A 2H43A 1LFBA 3I9V2 2MD0A 3N4XA 2R32A 3OV8A 3FWLA 2P5VA 2ESNA 3CDHA 2VOOA 2ZMEA 3EUHC 3KP5A 4F91B 3DU6A 1FIAA 3G9RA 3ZMTA 1Z1DA 3HE4B 3MZHA 3N97A 2DPDA 5KCMA 1NVOA 2CFOA 1SQPK 1R22A 1SVOA 1ZAOA 1DDNA 4HX4A 3JRIA 3H1KG 3M9HA 4DYQA 3QYBA 4J19A 4Y52J 4PZCA 5DV5A 2R4GA 2XV5A 3OMYA 4BJ5C 1OVRA 2KP6A 1HSJA 3WUUA 2JPBA 2RDPA 2RQQA 4AIJA 1HW1A 5F27A 1A6IA 1HOMA 2L7ZA 3C7DB 5GTIH 4N4NB 2QEXP 5AIPA 3PJSK 2CQ7A 5LGNA 1BR4A 1WKMA 3OYAA 2WSFH 3H1IG 4YXWH 2OUMA 4AM3A 2M1BA 3IF4A 1QQIA 3DWLE 2LR8A 3IN6A 1XSXA 2M7BA 1K79A 2OF7A 2J5OA 4IRIA 3DFUA 3CCUP 2VKEA 4KT6A 1EZVI 3D5RC 2O01H 4PD4H 4DZOA 3HTSB 3TGUE 2J5PA 4IX7A 1SD5A 1WRGA 1RETA 5J8FA 2WB1A 1LUJB 2W1OA 1U6GA 4C3IJ 1MJ9A 4CCMA 2ZJPF 1IAWA 4A93J 4ZTJA 4RLQA 1RNLA 2K9MA 2MW8A 2MH9A 1LB2A 1SAUA 2YUSA 2FXAA 4NQWB 4W97A 5HODA 1EDKA 3IC7A 1QZYA 2XF6A 2JVGA 4IVNA 1OISA 4JOMA 1USEA 4B44A 2LKPA 4L74A 3PIDA 2NPSD 4LC1A 1Y9BA 4XRMA 5BPDA 3BR1A 1G3WA 2JWDA 3E6BA 2QEXI 2MBFA 5D5XB 1TL8A 4PV1C 1O7FA 4CZCA 2CW7A 5FLXZ 2XGEA 3K70C 4A3MJ 1HF0A 1WH7A 1JUPA 2E5ZA 1A5JA 4RKUJ 5LEKA 5K7ZA 3DBRB 4EYYQ 3T97A 3ZQQA 3S16J 2P81A 3PH0A 1E3HA 2LC2A 4MQVA 1VQMI 2O8XA 2XPVA 4WCGA 2M8GX 3KEQA 2VQCA 4M6XA 1FE6A 2WPRA 2RKLA 4EM0B 1MNEA 1DU6A 4GXOA 4D0PA 5EDNA 1GK6A 2ZBKA 2JTVA 3OL4A 1HW2A 5DCMA 2QE7H 1I6XA 3OYGA 1FDIA 1M1EB 2XAJA 2M2EA 1F17A 3AE2C 1DQUA 4I1LA 1WMKA 2IGOA 3MEXA 3M8JA 3BVHA 1PL5A 3K1PA 1KILE 1ZR4A 5FKMA 4DBRA 2QYOA 4P55A 4IHXA 3RQIA 3LWFA 1GMJA 2HU9A 5D4RA 2DA6A 2LKSA 2CGPA 1KQ8A 1IV8A 1R1VA 2DK5A 4KUMA 2LKXA 1NAYA 4NPDA 5J40A 4NDLA 4YCAA 1EZVE 1L0LJ 1XMAA 1XTGB 3H32A 5JVTA 2M9HA 3PUBA 3RBXA 2AQFA 3R6SA 1LSOA 3P8CE 3DTIA 1IV6A 2DO7A 1Z82A 3CC7I 3E7KA 4XICA 3PHLA 1L4AB 1STZA 4KA4A 2FYUG 2N1TC 2L54A 2P58A 2LY1A 2EZIA 4A6DA 4II2A 3GTMJ 4A3FJ 3SXYA 1XMKA 1AFOA 2DMQA 2WSCH 4WY4A 2VJIA 2PMZA 2R7RA 1LDJA 3I71A 3IH3A 1GUUA 1MIJA 3GF2A 3HUGB 3LQQA 3ZMUA 1W0TA 3ASOH 4MEXF 1SQVE 1WJFA 2XASA 3RL0g 5J1YA 1A6QA 1LTJB 3L75D 5AW7B 5CBNA 2KNCA 5F08A 2VE9A 1OJLA 3TEDA 4U3FD 4L5JA 4B09A 2EIKH 5HS8A 4ENMA 5C3EJ 2ZC2A 5ICFA 3NAUA 1G2CA 4ABZA 1ITYA 3ULKA 3DFGA 4LG0B 2X6XA 1D5VA 3WFIA 1FBSA 3T8RA 2QUFA 2PP6A 2BY0A 3WTWC 2DFFA 3HRSA 2B63J 1JCDA 3O6QA 5E79E 1YITP 2XAUA 1I36A 2AXTH 1EVYA 2P5LC 3QOPA 1T3JA 4IXAA 4UUSA 4ZH4F 1U78A 5L3DA 2C0WA 1R4MB 1B9MA 1J1DC 3B8EB 1LTIC 1J09A 2I9PA 4XN0A 3HD7B 3DBHB 4AIHA 2EFNA 2R7VA 1GL2C 1NTKD 3ERED 3BATA 2RNGA 3CUQC 1VQ5P 1BM9A 2MC4A 2FQ3A 2FOKA 3CPWO 4MO7A 1X4OA 1KB9D 3N7NA 5C4XJ 3SZGA 3ML6A 5DUIA 3KP4A 3G71P 3H1LJ 1YITI 2XAHA 1IUYA 1V5FA 2EK5A 1ZKGA 3C9IA 3W68A 3DV8A 5CQEA 5FKNA 4XNFA 1LNWA 5LGTA 2IBZD 4G7HF 2ZFCA 1JO5A 3K1MA 3E0JB 2PGDA 2D3TA 2YKQA 2QGUA 3ZMVA 4EZBA 4HH2A 1YQ4C 2O3FA 3OBBA 5BQTA 1IF1A 1I27A 2HKOA 4B3AA 1S29A 4FTHA 1GW3A 1AOYA 3FISA 2IPQX 1JMMA 3AL0B 3LW5H 3RL0D 2WT7A 5KHDA 3T0YA 1L0ND 3NFQA 5AW5B 3RK3D 1YG2A 2CJJA 3F9KA 2LD5A 1GZLA 3E7LA 5FO5A 2P1JA 2JSCA 2QBYB 1VPCA 1U8BA 4DJGA 2DMUA 3U59A 1WJCA 2QQ9A 2QJPB 3OYFA 1IC8A 1ZARA 1PGNA 4DYCA 4DBQA 3G2BA 2IRFG 4CH7A 2GOMA 2P8TA 1PP7U 3HOXJ 2KS1A 3EQ2A 2GWRA 1KYOE 3MAJA 3Q9SA 3Q1MA 2RGVA 1QX8A 4A3IJ 4U0YA 3CUQB 2JA6J 1KYOD 2AEFA 2Y0SN 1IZNB 3BG7A 1LWUC 1S4XA 2M45A 1RF0C 2DI3A 2QZ8A 1DUXC 1R58A 3WTZA 1NG6A 3I56I 2WB1N 4R1NA 2ZXIA 4N78E 2MG4A 4WB4A 3V2NA 3K4LA 1TQMA 1GK4A 3HC7A 5M5WJ 1N2DC 3VN0A 1LTJC 1F9NA 1YRNA 3D6YA 1NU1G 3H0GJ 4QMAA 3SZTA 3H9GA 5HNHA 3S1RJ 4C2TA 1X19A 4BEHA 2DT6A 5FRNA 3TNUB 2A69F 3DKXA 3FKJA 1RKTA 4PJ0C 4P9UA 2E1MC 2P5KA 3V2QA 3CCEI 3MWMA 1HKSA 3BCCD 2L3DA 2KRCA 1GVJA 2K40A 1OYYA 2JT1A 3TO7A 5HS7A 3J81Z 1Z77A 5F04A 2ZYAA 3K9TA 2CQKA 1UELB 2IBZE 4CSWA 2FBHA 3GTKJ 3NXSA 2EBIA 1NTCA 3JTGA 5KAIH 1RF1C 4WXHA 4LJZF 1NTKG 1QU3A 1VQ9I 3JRFA 2K4BA 2Q0OA 2ZKZA 3K4KA 4XLPF 2GXBA 2IDBA 1T38A 3OYEA 3BJ6A 3GWZA 1IN8A 2V1XA 1ZRCA 4A3CJ 1ZHFA 1RE3C 3I59A 1R00A 2MC3A 5KTBA 3K1NA 2ZMEC 2JSPA 3EUHA 3KP6A 2R93J 2E5TA 2WPQA 3JAMK 5E3MA 4NC7A 2CUZA 5J8CA 2AS5F 1Z7UA 3PNTA 1J7KA 2D1VA 4BDZA 3RDIA 2KSJA 1FZCB 1W1WE 5DD8A 4RB3C 4N3YB 2DLLA 1KQFB 1RZ4A 1U57A 3L4FA 1Y8RB 1X1BA 4CUGA 3FBIB 2R7TA 2M8RA 3B5NB 4OIPF 2Q9IA 5FKKA 2BOLA 5H6QA 3H1JG 1M2WA 5D8LB 3M1EA 1IFIA 3JRDA 1VTNC 2CV0A 1LPQA 4XQFA 3GFMA 3M07A 1BDCA 4I02A 4BEHB 4JX4A 2WSEJ 1VQ6I 2GXAA 1Q81Q 1Q86Q 2HOSA 3JCUC 1DPRA 2JA7J 2FFDB 2JO1A 3GZNB 3EDPA 2E19A 5CLSA 1PVEA 4UUTA 1ZRFA 1CI6B 5AVZB 2P7CB 4XLNF 1V54H 5AVTB 3ZW8A 4U3FE 4DW6A 3OL3A 3AEEC 2KZVA 3FXLA 4BQQA 3HRUA 1HTLC 4N4OB 3K4CA 1SQVD 1OXZA 2F6CA 1DLIA 2XAQA 3TQNA 4BE0A 2KB7P 3BZKA 4XMYA 1YS6A 5IPAA 2E71A 3JTHA 4S0HB 1R8EA 4AQRD 5AIQA 3RYRA 1N78A 4YFXF 2ELKA 1MFZA 2XF7A 3CUQA 1XCVA 1J1EB 3C1LA 3O8ZA 3ZWBA 1SQXE 4AYCA 3DKWA 2B9BA 3PRJA 3DOJA 4D6TG 4IJAA 1M56D 1IGNA 3C7AA 3M8EA 1EDIA 4F7ZA 1JY2N 2LF8A 1RE4A 3L00A 3H1HJ 3GXOA 4G8XA 2DFHA 5A9SB 3L36A 4FX4A 2CWEA 1FIPA 3HE5B 5DCFA 1XPXA 4KMFA 1W2EA 3O8GA 1QVGO 3CCMI 2EWNA 4YXDC 2IVMA 1OVVA 3JAMZ 3CQZJ 2DK8A 2WZ7A 3OOPA 4HX8A 1E5WA 3WU2C 4UVBA 2LXBA 5B5EE 4M3BA 4E4HA 4Y3OA 1RE4C 2F2EA 1O3RA 3WHBA 2KLVA 1ZGJA 4GKGA 4Q4ZF 1IW7F 5EZHA 2TCTA 3L74G 2VT3A 1WPQA 4ENNA 3L74D 3WUVA 1ETOA 3RK2C 3HOYJ 2HDHA 1FU1A 4N6JA 3WS7A 1OWAA 1IDYA 2HKXA 5CKTA 4IOAF 2R7UA 1R5LA 2QIWA 5L8RJ 1Z7LA 3HZJA 3F22A 4XOTA 4PSWA 3L72E 3J7AO 5FRMA 1M1JC 1E2XA 3BROA 2EILH 2WV1A 3HDDA 2OYOA 4GOEA 2EB7A 1KU2A 1X1PA 3K7AJ 5AW0B 3U1CA 1Z21A 4MHGA 3DEUA 4K2EA 3L72D 4S05A 2KIMA 5APVA 3HKZA 4P96A 4RB2C 1EJ9A 1SANA 1UMQA 1XC5A 2A05A 2LY9A 2Y75A 2K88A 2UXNA 4UXNA 1CZQA 1NTMG 2V7QH 4GDOA 3O8HA 4XLEA 1ULYA 3C7JA 4HF2A 1G3SA 5APWA 1YJWP 2Y9ZA 3EQLF 3DU5A 3RZOJ 1VQPP 4RAYA 1URQA 3L74E 1PUEE 3MP7B 3P32A 3T1BA 2DTRA 2RAEA 3MKZA 2H8RA 1A02J 4UB8C 3HJEA 2JQ7A 4OIRF 3IQDB 5IOYA 4CXFA 1YX3A 2E2HJ 4V19K 4ZNCA 1TC3C 3TGUD 4LG0A 3HOUJ 2C0XA 2IGKA 1FDOA 5GTIE 2XB0X 4RGXA 3OYNA 4DJAA 1RUNA 3RL0C 1SP4A 2K9JA 2XGCA 1IL0A 3SQNA 1ZH5A 5CCGA 2FYUK 3KZIC 3V7RA 4CGZA 1LJ2A 2Y30A 2NVQJ 3Q5RA 3IAM2 3TO9A 1RESA 1D8KA 2EV6A 2RNJA 3SHFA 4CO8A 2WWWA 3LSTA 3OAKA 2GLOA 4RLFA 5J4YA 3VFZA 2M3BA 1HKQA 2VI6A 5KJ7D 2G8YA 1FDMA 3R2PA 4GOFA 2VJ4A 1Z67A 3SSUA 1FLIA 2ELJA 4HLYA 3E1SA 3RZDJ 1SQXD 5CYVA 4GDFA 3TGUG 1A04A 1TWHJ 2UUZA 2XV4S 2HFHA 1RHZB 4AYBN 4NC8A 2DOFA 3Q9VA 2GIZA 2D45A 2HPCB 4ZZLA 1FSEA 4J01A 4KIFA 1VQ5I 2HEOA 3H32B 4LLHA 3ABKH 5JLXA 4YFNF 2CMPA 1KILC 2KLUA 2Z16A 1K6YA 2O03A 2Z3YA 4IZZA 5C4JJ 4IHSA 1JOCA 1QGKB 4JQ0D 3RKWA 1VQ8I 3JSVC 1ZGWA 1MZ9A 1FT9A 2K3FA 3MGNA 3OJAB 3DKYA 1H8AA 5J4VA 3QAHA 1MNMC 3WGHA 1HGZA 2VBYA 4GRIA 5HLGA 1ZG5A 1CF7A 1KGSA 3CCRI 3F8BA 1SQBK 4TT3H 3ABVC 4LMYA 2DTZA 2FEZA 5DD4A 2XROA 2E36A 5CCGC 2E76B 3II6A 1UJ8A 2VKVA 3RJPA 3H36A 2WSFJ 1S72I 4GWGA 1WJAA 4AU7A 3BR3A 4KYWA 1U7MA 4H13C 3EYIA 3HN2A 1MNDA 1NG7A 1URQD 1MBKA 4DYRA 2EV0A 3FXMA 1REPC 2KHMA 1G3TA 2PAJA 2EW2A 4A3EJ 5AONA 3EPZA 3I4NJ 5AW1B 4WWCA 3J81K 4EM2A 2AXTE 3OS1A 5ICGA 4OIOF 4ZMDA 3TSIA 2W85A 1D1AA 1KILB 3AECC 3WODF 3KX2A 3RQSA 3L70G 3FXRA 5EEGA 1R71A 1W36D 3AG2H 3VMZA 3QU6A 3M0DA 1HXDA 3QP5A 4D3SA 1ZLJA 4UUSB 1N8RQ 3OS2A 3WU2E 1VQ9P 3I5CA 1M7LA 3A4CA 3BCCE 3GCMA 4PJ0H 4EIJA 4O6JA 3O6QB 4M3FA 2NPSB 5KKZB 1TT0A 3HYIA 4R4LA 2TDXA 2RC4A 3E1IA 3N05A 2JZYA 3E5QA 4OQYA 2Q3IA 2WAQN 2LLKA 3IH4A 3A02A 2HPMA 1G2CB 2Y0SA 3V8LA 4F52A 1W4MA 3HOVJ 1T98A 2WTEA 2BEQD 3FXKA 5GPCA 3L75G 5HNFA 4A6EA 4I98B 2V6EA 1K04A 1IRFA 3KIOA 2WTYA 4N78D 1ZOYC 2XPUA 3CCJI 2YSRA 1DP7P 1EDLA 2JP3A 4OINF 2GIVA 1SQVK 1S5LH 3V6IA 1LVAA 4U0WA 3JSPA 3S1KA 4L9TA 4WY4B 2QJYB 3FXQA 1FZAA 5FLVA 4RM2A 2VONA 2HYNA 2OQQA 3Q0WA 1ETQA 1OCCH 2IA0A 2M7AA 3Q0UA 3IAS2 5M3MJ 3WTVC 3C7CB 1LT9C 1OCOH 2HG5D 3SFDC 1JUNA 1L4AA 1EA3A 2OD5A 3QPHA 2LH9A 4II3A 2O01J 1J5YA 4N0BA 3RPUD 2KZJA 1T3UA 4ENJA 4MEYF 4FASD 4M3EA 2Y9YA 1NU1K 1S5LC 1DPUA 3A0HC 3U1DA 1ETYA 1WPKA 2DAOA 2QQ8A 3LFKA 3VYRB 1LJ9A 1OX3A 3VMAA 3I55P 4HF0A 1JKRC 3GTGJ 3DXJF 4JX6A 1ETKA 1D1CA 1PUFA 3CD6I 3L1PA 3WGGA 3RK3E 1L0NE 4BQOA 2GXGA 1LE8A 4EVIA 2WWYA 1HA8A 1RF1B 4PJJA 4I0BA 5J3LA 5GTIC 3DEEA 3CTVA 1YYVA 1NTKK 2OGUA 3LA2A 1XSDA 4BE1A 3RSNA 4OMZA 4RA2A 1BBYA 1GL2D 3ROUA 2L5GB 1VQNI 1PPJG 3G4SI 5TJHA 3TL4X 2KIUA 2YO3A 1CF7B 5L3FA 2W48A 2KZGA 4UUVA 4PGGA 5E1WA 1X4PA 5AW3B 1YJQA 3FHZA 5EF6A 1UCRA 3BWGA 2AQEA 3MFKA 1SQVJ 2IZ1A 2DW3A 1ORKA 1KB9E 3JC22 2DJNA 2VPRA 5APYA 5EYRA 2N1TB 2A6HF 1MJAA 3H5AA 3DF8A 2YNYA 4ETSA 4Y99C 3D71A 3DQVC 4AVPA 1KS9A 2QF7A 1MMNA 3E5XA 3CCSI 1NTKE 3E6MA 1WJDA 2ZO4A 2BVMA 3DP7A 3PSFA 2WC2A 4XE5B 1LKXA 4BBRJ 1N7SB 2E60A 4GCVA 3OOUA 2Q6QA 4DZJA 3F72A 1QNTA 3CJRB 1NOHA 4P9FA 3RGUA 1I5ZA 3IRRA 2HQAA 3G6EI 2GQQA 5GPAA 4XLCA 4GIFA 3VSKA 1OR7C 5ERIA 1M67A 1QMGA 1J75A 2PMZN 5TJJA 5ILVA 4BDYA 4CICA 3ZWAA 2KZIA 2ZT9D 3PLNA 4AYBA 2WY7Q 4U88A 1BE3J 1KQLA 1R1UA 2ZXJA 3QOEA 2HDCA 2IXSA 3AEFC 5KAFE 3A0HH 4C46A 3B6CA 1ZN5A 1P4XA 4BJTA 1F43A 3TBIA 4Y15A 2OV7A 1ZREA 1SVFA 2NZ2A 3L75E 2H7HA 1J0RA 2BGCA 3FM3A 2LYCA 5KLVJ 2P67A 2D5VA 4FHTA 1MH3A 5E8GA 1NTMJ 5BVZA 3TF5A 1QEXA 2X48A 1HGVA 4ENKA 1LTSC 4BXLA 1P6RA 1H9GA 4AIKA 1Q2NA 2HQNA 2DDBA 2P6SA 3QYEA 1PP9G
chains in the Genus database with same CATH topology
1WP4A 5J1YA 2XSDC 1F36A 1IUFA 2X6OA 5F08A 3TEDA 1OJLA 2R7ZJ 1MH4A 1SFOJ 1PGQA 2DA3A 3GHYA 2E2JJ 4EEFG 5C3EJ 3NAUA 5BNGA 4ABZA 1ITYA 3ULKA 5DTDA 3WFIA 1MSFC 1XS9A 1JKQC 3K6JA 3OIOA 1BA5A 1S7EA 3FWNA 2B63J 1Y1VJ 1ZK8A 1FEXA 3F0CA 3HGGA 1EVYA 1I36A 1LSJA 4A3BJ 2JN6A 3TP0A 4UUSA 2MGQA 1U78A 2HOAA 3FIWA 4DYDA 2I9PA 3H3VK 1FTTA 2GBYA 1OCPA 5GP9A 1T33A 3Q3SA 3MOGA 1JKPC 4D7MA 4A3GJ 4B3IA 2XGDA 3JRHA 4KUEA 1D5YA 4GFBA 4S3MA 2R5YA 4MO7A 4D5FA 3BG3A 1QVTA 5C4XJ 1MBHA 2WTBA 1X58A 1AHDP 2ECCA 2L9RA 1MBFA 1QVUA 1ZKGA 2TRTA 1YRNB 1GVDA 2K9NA 5FKNA 5IYBJ 3Q3CA 1IJWC 1B8IA 1MBJA 2PGDA 4E21A 2L7FP 2D3TA 2QYTA 4EZBA 5FKOA 3BTIA 3OBBA 1ETXA 4B3AA 4FTHA 5HWSA 3DCFA 4D7NA 1B72A 5EG0A 3FISA 3UKGA 4PZEA 3ZQFA 3ZHBA 4MFDA 3MVPA 2CJJA 2LD5A 1NK3P 2L0KA 3E7LA 2DA1A 2ID6A 1U8BA 1G2HA 2DMUA 4C2MJ 2R5ZA 1IC8A 3MKLA 3BG5A 1PGNA 4DYCA 4C3JJ 2QCOA 4B3JA 3M3YJ 3ZQIA 1WGXA 2R5ZB 1IRZA 3F3SA 2R92J 3HOXJ 1YRLA 3DEWA 4QSHA 3W6VA 5E3NA 3HB9A 4D5CA 4A3IJ 2YU9J 3WHCA 1ZTRA 2JA6J 3HADA 1JT6A 3C2BA 3LNQA 5EG0B 2Y0SN 3TW6A 2EZLA 2Y2ZA 4X6AJ 4B4CA 1LJ8A 2CUFA 2WB1N 4R1NA 3LSJA 2DMTA 4HNVA 2MG4A 4JX5A 4IHYA 5M5WJ 5K7FA 3FR7A 1YRNA 3BR6A 4BXXJ 1OFCX 1FJLA 1K83J 3PEFA 3H0GJ 4OM8A 2W8ZA 3S1RJ 3BTCA 3G1LA 1WH5A 1H8AC 1RKTA 2ZYGA 1CQTA 3SFIA 5MGBA 1M66A 2GM4A 2K40A 2IAIA 2ECBA 3VPRA 3JRAA 3S1QJ 1Z77A 3BG9A 5F04A 2HDDA 2OPTA 1PGJA 2ZYAA 2ZYDA 4CYCB 1P7IA 3LSGA 4Y7NJ 3GTKJ 1LFUP 2EBIA 2H1KA 3G1OA 3GTLJ 1NTCA 3BQYA 3JRFA 4LOCA 2DA5A 3A03A 1H89C 1GT0C 2JK3A 2KT0A 4A3CJ 3A01B 5C44J 2IYOA 1BW6A 4MIMA 1VNDA 2R93J 3ZQHA 1WDMA 1ETVA 2DMPA 5E3MA 3HGYA 1BL0A 5IYDJ 3EGOA 1UG2A 2HXOA 1TXGA 4RBOA 2COBA 2M34A 3JRGA 1WCMJ 3PO2J 1HDPA 3W6ZA 3H2ZA 4CYCA 5M5YJ 5IYCJ 5FKKA 1M75A 2CU7A 1I6HJ 1M2WA 4DCKA 3CMYA 1ETWA 4I76A 3JRDA 1IDZA 4BBSJ 1JJ6C 3JRBA 4JX4A 1P7JA 3WFJA 2HOSA 3ZQGA 4IHVA 2JA7J 1PGOA 4BY1J 2E19A 2N8GA 4UUTA 1H88C 5FKLA 2JWTA 4XK4A 3ZW8A 4DW6A 1VPDA 3BR2A 4RDUA 3I83A 5M5XJ 2K9SA 1JKOC 1DLIA 1TWAJ 1ENHA 3BQZA 5IPAA 5IP7J 1Q1VA 5F0CA 1ZCJA 4S0HB 3HWRA 2AO9A 2ELKA 1DU0A 3L6DA 1RPWA 3ZWBA 4MLOA 4XRSG 3DOJA 1B72B 5J1UA 1IGNA 3C7AA 2HI3A 3HKZN 1I3QJ 5A9SB 3SDGA 4W1UA 1FIPA 1B8IB 3M4OJ 3O8GA 5E3OA 1YB4A 1JJ8C 1F0YA 3CQZJ 1T56A 2EH3A 1BJZA 3ZQCA 4M3BA 3OSFA 4M6VA 5EZGA 4JP0A 4A3KJ 1GV2A 1VF9A 1M76A 5FLMJ 2Y31A 2EZHA 3WHBA 4QTRA 4IEJA 2E1OA 2ID3A 5EZHA 2TCTA 2NVTJ 1WPQA 3GTOJ 4D3DA 5E3LA 4M3DA 1ETOA 2HYJA 2NVXJ 2DA4A 3HOYJ 2X9DA 2HDHA 3FKIJ 1TWFJ 3WS7A 1PGPA 2JA8J 1NK2P 1IDYA 2G0EA 2YS9A 3FR8A 4OQZA 4GWKA 3BTJA 2I10A 1LE8B 9ANTA 1MSEC 1YONA 3BTLA 2ME6A 5EGOA 4IHWA 1PUFB 4OL9A 3HDDA 2WV1A 1POGA 3K7AJ 1XG1A 3HEFA 3S17J 3A01A 2IBDA 5J1RA 1X2NA 2DA7A 1MBEA 4AUXA 5EEAA 2LVSA 3K96A 1SANA 1UMQA 1XC5A 2LY9A 5F1JA 4KUGA 2JJ7A 3NARA 3O8HA 4FCYA 5FWNA 3GTPJ 2Y9ZA 1WI3A 2FQ4A 3SJMA 1ZR2A 2FD5A 2ZB9A 3RZOJ 2UYYA 3QHAA 4DZPA 2RAEA 3CCYA 2H8RA 2AHQA 1HDDC 2L7MP 2XPWA 3IQDB 4BKXA 5IOYA 2E2HJ 5EGOB 1TC3C 5K7HA 4FISA 3HOUJ 2XB0X 3W6UA 3PO3J 2M0CA 2XGCA 1IL0A 2VUMJ 3JRCA 1TWGJ 4A3JJ 1Z0XA 2HOTA 2Y30A 2NVQJ 4E13A 1U9NA 1RESA 5F0FA 3BT9A 1JTYA 2GLOA 1UHSA 1F14A 1YVEI 3GTQJ 2VI6A 3ZW9A 2CQXA 1EF4A 3RZDJ 2K9QA 5JLWA 1TWHJ 1HCRA 3HDHA 3CDLA 1RKWA 2CRGA 2EQRA 4AC0A 4AYBN 3PLRA 1AKHB 2LTPA 2XRLA 3Q0VA 3JREA 2E2IJ 5M3FJ 3LSPA 3ZQLA 3S2DJ 1O4XA 4A69C 3S2HJ 4JPZB 1YJ8A 3TW7A 3I4MJ 2O9LA 5JLXA 1F12A 1N1GA 5C4JJ 4JQ0D 3HOZJ 1ZGWA 3D1NI 1R9TJ 4DLLA 4G12A 1MNMC 2IEKA 3G17A 4PZDA 1BG6A 3S1NJ 2LK2A 2XB5A 2DN0A 2DTZA 4V2GA 5DS9A 5F0HA 2VKVA 4QIWN 5IP9J 1X0XA 4GWGA 3BR3A 2O8KA 4MFEA 5FJ8J 3HN2A 2DMNA 3HBLA 4V2FA 1K61A 1MBKA 4M3GA 4DYRA 3JR9A 1APLC 4E12A 2EW2A 4A3EJ 3B6AA 3ADPA 3ZWCA 1BW5A 3I4NJ 3ADOA 2R5YB 4A3LJ 1OCTC 2JKVA 1JUMA 2CUEA 1JDJA 2IYPA 3QSGA 4BY7J 1W0UA 4A3DJ 5A9TA 3RQSA 5IP6A 2NS8A 3GBGA 1N1EA 3ZOBA 1TWCJ 4XIDA 3IH2A 3RKQA 2HQ5A 4J0FA 4D3SA 4UUSB 1DLJA 1HLVA 2NS7A 5JE8A 3FK7A 1LFBA 4M3FA 2MSYA 3QPSA 4OQYA 1I50J 2WAQN 2LLKA 3IH4A 3A02A 4XRSA 1FIAA 3S14J 3HOVJ 2W90A 5GPCA 3GTJJ 1IG7A 2O7OA 1Y1WJ 1JTXA 2PLAA 2XPUA 2LP0A 3MN2A 3JRIA 4DYQA 4J19A 3BR0A 1JT0A 2ME0A 4Y52J 4PZCA 5FLVA 2CVZA 3PDUA 3Q0WA 1ETQA 5M3MJ 3C7CB 3Q0UA 1QRYA 2X58A 5F27A 4B3HA 1A6IA 1HOMA 1U9OA 2L7ZA 3C7DB 4D3FA 4C3HJ 3K2AA 5AYVA 1GV5A 4GBJA 4M3EA 2Y9YA 2LR8A 2OF7A 1ETYA 1WPKA 2CQQA 3DFUA 3ZGYA 2R0QC 2VKEA 4JYKA 5IOZA 1JKRC 3GTGJ 3BR5A 2EZKA 4I6ZA 1RR7A 2JMWA 3LOCA 2KDZA 1RETA 2GF2A 4JX6A 1ETKA 1PUFA 4C3IJ 3L1PA 4A93J 1LE8A 2MW8A 1WDKA 2YUSA 4W97A 5J3LA 5HODA 3CTVA 4IM7A 2P4QA 3PIDA 4XRMA 3BR1A 3HM5A 5A9SA 2OFPA 1VFCA 1HF0A 4A3MJ 2NVYJ 2XGEA 2W48A 4FE4A 1A5JA 1WH7A 1JUPA 4X1EA 3G0OA 3LSRA 4FGWA 1AU7A 5K7ZA 5A9RA 1YJQA 3S16J 2P81A 5EF6A 2XPVA 2IZ1A 3G1MA 1ORKA 1X2MA 2M8GX 3QPLA 3CKYA 2DJNA 2VPRA 1JUSA 1EVZA 1X0VA 5EYRA 2HXIA 1DU6A 5EDNA 4J0EA 4B1RA 1KS9A 2QF7A 2NOGA 1JGGA 1MBGA 2M2EA 1F17A 4OVNF 4BBRJ 3OOUA 4DZJA 2JA5J 3IV5A 4L5EA 1ZR4A 5FKMA 4IHXA 3RQIA 5GPAA 1QPIA 3TP3A 2DA6A 1FTZA 1VI0A 2LKXA 2LFBA 1M67A 1QMGA 4KUHA 2PMZN 4FE7A 4NDLA 1ZQ3P 4YCAA 3ZWAA 2M9HA 3OSGA 1WDLA 3S1MJ 2FJ1A 3FK6A 1LSOA 1IV6A 1Z82A 1E3OC 2FX0A 3B6CA 1AKHA 3S15J 1F43A 4XICA 2IZ0A 3PM1A 3HOWJ 2D5VA 2EZIA 2DA2A 3GTMJ 3QQAA 4A3FJ 1MH3A 2X48A 2DMQA 3PJGA 1GDTA 3IH3A 1GUUA 1W0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1Y A;  2XSD C;  1F36 A;  1IUF A;  2X6O A;  5F08 A;  3TED A;  1OJL A;  2R7Z J;  1MH4 A;  1SFO J;  2DA3 A;  2E2J J;  4EEF G;  5C3E J;  3NAU A;  5BNG A;  4ABZ A;  1ITY A;  5DTD A;  1MSF C;  1XS9 A;  1JKQ C;  3OIO A;  1BA5 A;  1S7E A;  2B63 J;  1Y1V J;  1ZK8 A;  1FEX A;  3F0C A;  3HGG A;  4A3B J;  2JN6 A;  3TP0 A;  4UUS A;  2MGQ A;  1U78 A;  2HOA A;  3FIW A;  3H3V K;  1FTT A;  2GBY A;  1OCP A;  5GP9 A;  1T33 A;  3Q3S A;  1JKP C;  4D7M A;  4A3G J;  2XGD A;  3JRH A;  1D5Y A;  4GFB A;  2R5Y A;  4MO7 A;  4D5F A;  3BG3 A;  1QVT A;  5C4X J;  1MBH A;  1X58 A;  1AHD P;  2ECC A;  2L9R A;  1MBF A;  1QVU A;  1ZKG A;  2TRT A;  1YRN B;  1GVD A;  2K9N A;  5FKN A;  5IYB J;  1IJW C;  1B8I A;  1MBJ A;  2L7F P;  5FKO A;  3BTI A;  1ETX A;  4B3A A;  4FTH A;  3DCF A;  4D7N A;  1B72 A;  5EG0 A;  3FIS A;  3UKG A;  3ZQF A;  4MFD A;  3MVP A;  2CJJ A;  2LD5 A;  1NK3 P;  2L0K A;  3E7L A;  2DA1 A;  2ID6 A;  1U8B A;  1G2H A;  2DMU A;  4C2M J;  2R5Z A;  1IC8 A;  3MKL A;  3BG5 A;  4DYC A;  4C3J J;  2QCO A;  3M3Y J;  3ZQI A;  1WGX A;  2R5Z B;  1IRZ A;  2R92 J;  3HOX J;  3DEW A;  4QSH A;  3W6V A;  5E3N A;  3HB9 A;  4D5C A;  4A3I J;  2YU9 J;  3WHC A;  1ZTR A;  2JA6 J;  1JT6 A;  3C2B A;  3LNQ A;  5EG0 B;  2Y0S N;  3TW6 A;  2EZL A;  2Y2Z A;  4X6A J;  4B4C A;  2CUF A;  2WB1 N;  3LSJ A;  2DMT A;  4HNV A;  2MG4 A;  4JX5 A;  4IHY A;  5M5W J;  5K7F A;  1YRN A;  3BR6 A;  4BXX J;  1OFC X;  1FJL A;  1K83 J;  3H0G J;  3S1R J;  3BTC A;  3G1L A;  1WH5 A;  1H8A C;  1RKT A;  1CQT A;  3SFI A;  2GM4 A;  2K40 A;  2IAI A;  2ECB A;  3VPR A;  3JRA A;  3S1Q J;  1Z77 A;  3BG9 A;  5F04 A;  2HDD A;  2OPT A;  4OVN F;  4CYC B;  1P7I A;  3LSG A;  4Y7N J;  3GTK J;  1LFU P;  2EBI A;  2H1K A;  3G1O A;  3GTL J;  1NTC A;  3BQY A;  3JRF A;  4LOC A;  2DA5 A;  3A03 A;  1H89 C;  1GT0 C;  2JK3 A;  2KT0 A;  4A3C J;  3A01 B;  5C44 J;  1BW6 A;  4MIM A;  1VND A;  2R93 J;  3ZQH A;  1ETV A;  2DMP A;  5E3M A;  3HGY A;  1BL0 A;  5IYD J;  1UG2 A;  2HXO A;  4RBO A;  2COB A;  2M34 A;  3JRG A;  1WCM J;  3PO2 J;  1HDP A;  4CYC A;  5M5Y J;  5IYC J;  5FKK A;  2CU7 A;  1I6H J;  4DCK A;  3CMY A;  1ETW A;  4I76 A;  3JRD A;  1IDZ A;  4BBS J;  1JJ6 C;  3JRB A;  4JX4 A;  1P7J A;  2HOS A;  3ZQG A;  4IHV A;  2JA7 J;  4BY1 J;  2E19 A;  2N8G A;  4UUT A;  1H88 C;  5FKL A;  2JWT A;  4XK4 A;  4DW6 A;  3BR2 A;  4RDU A;  5M5X J;  2K9S A;  1JKO C;  1TWA J;  1ENH A;  3BQZ A;  5IPA A;  5IP7 J;  1Q1V A;  5F0C A;  4S0H B;  2AO9 A;  2ELK A;  1DU0 A;  1RPW A;  4MLO A;  4XRS G;  1B72 B;  5J1U A;  1IGN A;  2HI3 A;  3HKZ N;  1I3Q J;  3SDG A;  4W1U A;  1FIP A;  1B8I B;  3M4O J;  3O8G A;  5E3O A;  1JJ8 C;  3CQZ J;  1T56 A;  2EH3 A;  1BJZ A;  3ZQC A;  4M3B A;  3OSF A;  4M6V A;  5EZG A;  4JP0 A;  4A3K J;  1GV2 A;  1VF9 A;  5FLM J;  2Y31 A;  2EZH A;  3WHB A;  4QTR A;  4IEJ A;  2E1O A;  2ID3 A;  5EZH A;  2TCT A;  2NVT J;  3GTO J;  5E3L A;  4M3D A;  1ETO A;  2HYJ A;  2NVX J;  2DA4 A;  3HOY J;  2X9D A;  3FKI J;  1TWF J;  2JA8 J;  1NK2 P;  1IDY A;  2G0E A;  2YS9 A;  3BTJ A;  2I10 A;  1LE8 B;  9ANT A;  1MSE C;  3BTL A;  2ME6 A;  5EGO A;  4IHW A;  1PUF B;  3HDD A;  2WV1 A;  1POG A;  3K7A J;  1XG1 A;  3HEF A;  3S17 J;  3A01 A;  2IBD A;  5J1R A;  1X2N A;  2DA7 A;  1MBE A;  4AUX A;  5EEA A;  2LVS A;  1SAN A;  1UMQ A;  1XC5 A;  2LY9 A;  5F1J A;  2JJ7 A;  3NAR A;  3O8H A;  4FCY A;  3GTP J;  2Y9Z A;  1WI3 A;  2FQ4 A;  3SJM A;  1ZR2 A;  2FD5 A;  2ZB9 A;  3RZO J;  4DZP A;  2RAE A;  3CCY A;  2H8R A;  2AHQ A;  1HDD C;  2L7M P;  2XPW A;  4BKX A;  5IOY A;  2E2H J;  5EGO B;  1TC3 C;  5K7H A;  4FIS A;  3HOU J;  2XB0 X;  3PO3 J;  2M0C A;  2XGC A;  2VUM J;  3JRC A;  1TWG J;  4A3J J;  1Z0X A;  2HOT A;  2Y30 A;  2NVQ J;  1U9N A;  1RES A;  5F0F A;  3BT9 A;  1JTY A;  2GLO A;  1UHS A;  3GTQ J;  2VI6 A;  2CQX A;  1EF4 A;  3RZD J;  2K9Q A;  5JLW A;  1TWH J;  1HCR A;  3CDL A;  1RKW A;  2CRG A;  2EQR A;  4AC0 A;  4AYB N;  1AKH B;  2LTP A;  2XRL A;  3Q0V A;  3JRE A;  2E2I J;  5M3F J;  3LSP A;  3ZQL A;  3S2D J;  1O4X A;  4A69 C;  3S2H J;  4JPZ B;  3TW7 A;  3I4M J;  2O9L A;  5JLX A;  5C4J J;  4JQ0 D;  3HOZ J;  1ZGW A;  3D1N I;  1R9T J;  4G12 A;  1MNM C;  2IEK A;  3S1N J;  2LK2 A;  2XB5 A;  2DN0 A;  2DTZ A;  4V2G A;  5DS9 A;  5F0H A;  2VKV A;  4QIW N;  5IP9 J;  3BR3 A;  2O8K A;  4MFE A;  5FJ8 J;  2DMN A;  3HBL A;  4V2F A;  1K61 A;  1MBK A;  4M3G A;  4DYR A;  3JR9 A;  1APL C;  4A3E J;  3B6A A;  1BW5 A;  3I4N J;  2R5Y B;  4A3L J;  1OCT C;  1JUM A;  2CUE A;  4BY7 J;  1W0U A;  4A3D J;  5IP6 A;  2NS8 A;  3GBG A;  3ZOB A;  1TWC J;  4XID A;  3IH2 A;  3RKQ A;  2HQ5 A;  4UUS B;  1HLV A;  2NS7 A;  3FK7 A;  1LFB A;  4M3F A;  2MSY A;  3QPS A;  1I50 J;  2WAQ N;  2LLK A;  3IH4 A;  3A02 A;  4XRS A;  1FIA A;  3S14 J;  3HOV J;  5GPC A;  3GTJ J;  1IG7 A;  2O7O A;  1Y1W J;  1JTX A;  2XPU A;  2LP0 A;  3MN2 A;  3JRI A;  4DYQ A;  4J19 A;  3BR0 A;  1JT0 A;  2ME0 A;  4Y52 J;  5FLV A;  3Q0W A;  1ETQ A;  5M3M J;  3Q0U A;  1QRY A;  5F27 A;  1A6I A;  1HOM A;  1U9O A;  2L7Z A;  4C3H J;  3K2A A;  1GV5 A;  4M3E A;  2Y9Y A;  2LR8 A;  2OF7 A;  1ETY A;  1WPK A;  2CQQ A;  2R0Q C;  2VKE A;  4JYK A;  5IOZ A;  1JKR C;  3GTG J;  3BR5 A;  2EZK A;  4I6Z A;  1RR7 A;  2JMW A;  3LOC A;  2KDZ A;  1RET A;  4JX6 A;  1ETK A;  1PUF A;  4C3I J;  3L1P A;  4A93 J;  1LE8 A;  2MW8 A;  2YUS A;  4W97 A;  5J3L A;  5HOD A;  4XRM A;  3BR1 A;  3HM5 A;  1VFC A;  1HF0 A;  4A3M J;  2NVY J;  2XGE A;  2W48 A;  4FE4 A;  1A5J A;  1WH7 A;  1JUP A;  4X1E A;  3LSR A;  1AU7 A;  5K7Z A;  3S16 J;  2P81 A;  5EF6 A;  2XPV A;  3G1M A;  1ORK A;  1X2M A;  2M8G X;  3QPL A;  2DJN A;  2VPR A;  1JUS A;  5EYR A;  2HXI A;  1DU6 A;  5EDN A;  4B1R A;  2QF7 A;  2NOG A;  1JGG A;  1MBG A;  2M2E A;  4BBR J;  3OOU A;  4DZJ A;  2JA5 J;  3IV5 A;  4L5E A;  1ZR4 A;  5FKM A;  4IHX A;  3RQI A;  5GPA A;  1QPI A;  3TP3 A;  2DA6 A;  1FTZ A;  1VI0 A;  2LKX A;  2LFB A;  2PMZ N;  4FE7 A;  4NDL A;  1ZQ3 P;  2M9H A;  3OSG A;  3S1M J;  2FJ1 A;  3FK6 A;  1IV6 A;  1E3O C;  2FX0 A;  3B6C A;  1AKH A;  3S15 J;  1F43 A;  4XIC A;  3PM1 A;  3HOW J;  2D5V A;  2EZI A;  2DA2 A;  3GTM J;  3QQA A;  4A3F J;  1MH3 A;  2X48 A;  2DMQ A;  1GDT A;  3IH3 A;  1GUU A;  1W0T A; 
#chains in the Genus database with same CATH topology
 1DIP A;  2HNH A;  5BOX A;  1OW8 A;  3H1L D;  1USD A;  5GTH H;  4DOJ A;  1K73 Q;  2R7Z J;  5E8I A;  3GHY A;  2LKM A;  3P8C D;  1QGP A;  1XGS A;  4EEF G;  3W67 A;  1FOY A;  3CF2 A;  1NTK J;  2OCE A;  1FMV A;  2H1L A;  2LBF B;  5BNG A;  5LD2 C;  1K6O A;  5DTD A;  4U7B A;  3Q5F A;  2VQL A;  1EZV D;  1L0O C;  1NO4 A;  1BCC J;  3GF3 A;  3HXL A;  1XS9 A;  1JKQ C;  2NNN A;  2B0L A;  3BY6 A;  1ZK8 A;  3CZ6 A;  2XZR A;  3TP0 A;  3ULQ B;  4E7S A;  1SAX A;  1KIL D;  4RES B;  2MGQ A;  2HZD A;  1SQP D;  3SEZ A;  1SQP J;  2IW5 A;  4I7H A;  4B3X A;  4YEJ A;  2SPZ A;  4UVA A;  1VQ4 I;  1EH7 A;  4DYD A;  2I1K A;  3H3V K;  2LY2 A;  2PEX A;  3VB2 A;  2GBY A;  1T33 A;  4KN7 X;  1D1B A;  3W3C A;  1QA6 A;  4C2U A;  3MOG A;  1RE3 A;  1S5L X;  3V4W A;  1YW8 A;  3JRH A;  1S6L A;  3LIE A;  1D5Y A;  2JUG A;  1JY3 N;  2AXT C;  4XL9 A;  4CA0 A;  4S3M A;  4A12 A;  5D6E A;  4LB6 B;  3SWK A;  4A0Z A;  4D5F A;  1QVT A;  2WVR A;  1MBH A;  4R1H A;  4D9J A;  2XHK A;  3KYQ A;  2OYI B;  2HGC A;  3WE2 A;  1AVO A;  2PX9 A;  1R23 A;  1ZG1 A;  1DP3 A;  2DFI A;  1FX7 A;  3C3W A;  1NTM K;  1PIX A;  2A5Y B;  1QVU A;  3GW2 A;  2F5V A;  2V4J C;  2EJR A;  5K5Q A;  1N77 A;  1IFD A;  1CW5 A;  3Q3C A;  4F55 A;  3L9F A;  1S9H A;  4EGY A;  3FDY A;  4CCO A;  1IJW C;  1BIA A;  4E21 A;  2ICW G;  2QYT A;  5KLI B;  4ZYD A;  5FKO A;  1IK7 A;  1KU7 A;  3U2R A;  3BDD A;  3DCF A;  4PZJ A;  5EG0 A;  1LQ1 A;  1YI2 P;  2L02 A;  4X0G A;  4E7Z A;  2P7V B;  2PG4 A;  1XSV A;  1YX5 A;  4FT8 A;  3L70 J;  3MVP A;  1HC8 A;  3V8J A;  3ZR8 X;  2DA1 A;  2ID6 A;  4JK1 X;  2KRH A;  2ZAE B;  3L7W A;  5H2F C;  1H88 A;  2J59 M;  2R5Z A;  3B71 A;  4P1W A;  4UV8 A;  1VQK P;  2PJR B;  2KOG A;  1T0F C;  1W5C C;  3ZQI A;  2R5Z B;  2FXM A;  1NH3 A;  1YRL A;  3ASN H;  4BQA A;  5APS A;  2PLY A;  2RKH A;  3EWK A;  2DOE A;  1WJB A;  3BLY A;  1HST A;  4BAY A;  1ZTR A;  3WE3 A;  1JT6 A;  2V9K A;  3LNQ A;  5EG0 B;  5AVY B;  5BU5 A;  1P92 A;  3CCR P;  3TW6 A;  5K5R A;  2EZL A;  4ZDO A;  4EQQ A;  1NGM B;  3COA C;  3HSR A;  2DMT A;  5B66 C;  4OGQ B;  5CVV A;  1ZEL A;  2FE3 A;  3BRT B;  2FBI A;  2M0B A;  3D5L A;  3FXU A;  3VEP A;  2ZJS E;  4PD4 I;  5KAF C;  4BXX J;  3W2V A;  1M57 D;  2VLA A;  2BCC E;  3CDI A;  2FML A;  2MLK A;  3RL0 B;  2VT2 A;  4OM8 A;  1S8N A;  1YOV B;  3L75 J;  2VXZ A;  3BTC A;  2J5U A;  2WPS A;  5ICE A;  3BCC G;  4L73 A;  5MGB A;  1M66 A;  1LFP A;  3JRA A;  3QWL A;  4PJM A;  2ZYD A;  2V1N A;  3BG9 A;  3LID A;  4WXC A;  1XDS A;  4FQG A;  3I0T A;  1BI3 A;  3H35 A;  1LFU P;  2H1K A;  4YG2 F;  2V4H A;  1FZG A;  3CC2 P;  5BPI A;  2DOD A;  2DA5 A;  3A03 A;  4RGR A;  3PL8 A;  3C1D A;  3V5B A;  1GT0 C;  5KVR A;  1YIJ I;  1SMY F;  2OAR A;  2A5W A;  3CF5 F;  3BP8 A;  3VMX A;  3FXO A;  1GL2 A;  3JW4 A;  4LFU A;  5BS6 A;  1JTH B;  1BW6 A;  1OIP A;  3ZQH A;  3ITK A;  1ETV A;  3RYP A;  1Y0U A;  2DMP A;  3KLN A;  1DEB A;  5J47 A;  1BCC E;  3MUD A;  2OYH B;  2QVO A;  2M5A B;  3ZDM A;  2KIK A;  2HXO A;  2XUB A;  2MH2 A;  4RBO A;  2P10 A;  3KHU A;  2M34 A;  3PO2 J;  2ZJ2 A;  3H2Z A;  4GYI A;  2L4M A;  2P0W A;  5A2Q Z;  2L5Q A;  3TDK A;  1M75 A;  2E7X A;  1V55 H;  2JRM A;  2NVU B;  5KAI C;  1I6H J;  1TQP A;  1P4W A;  4B48 A;  1IDZ A;  4BBS J;  2WSS H;  5AVV B;  1JJ6 C;  1WT6 A;  2M87 A;  4KN4 X;  5H20 A;  1P7J A;  1SMT A;  1J1E C;  3HSE A;  1ZRT E;  2FYU E;  3V2R A;  2R3C A;  4IHV A;  1HJB A;  1BI2 A;  1N7S C;  4ESB A;  2ETH A;  4H13 B;  3D5S C;  5FKL A;  1FS0 E;  3GZ5 A;  4IFM A;  2LRD A;  3GHG C;  2K85 A;  1U5T C;  1JHF A;  3BR2 A;  4H4K C;  1N7L A;  1SQV G;  2EIM H;  1KQ0 A;  2K9S A;  1JKO C;  4Y28 J;  2D2W A;  1Z56 A;  1Q1V A;  1D0Z A;  4WF2 A;  4KIS A;  2Z2S B;  1KZH A;  1DU0 A;  1Z05 A;  1S2E A;  1RPW A;  3ECO A;  4F93 B;  1BE3 G;  2WT7 B;  4IL6 X;  4XRS G;  5APT A;  1I1G A;  4ZYA A;  1H0T B;  1DGW Y;  3OS0 A;  3CX5 I;  1A35 A;  3TOA A;  3L70 E;  3W6J B;  3GFI A;  4Q47 A;  1P84 D;  4BRY B;  1I3Q J;  4LIV A;  3AE7 C;  1BGY E;  2BY3 A;  4ASN A;  2W6A A;  3OW2 O;  1BIB A;  2LOO A;  4I01 A;  3SDB A;  3WG9 A;  2ACJ A;  3KFW X;  3ABU A;  1LEA A;  3M7G A;  1SQQ G;  1L0N K;  4JBZ A;  2CFX A;  2HYG D;  1LWU B;  2R44 A;  3TGN A;  1ZLK A;  1BJZ A;  3OSF A;  3B5N D;  4H0L D;  2YX4 A;  3IWZ A;  2A6T A;  3L71 E;  2KDO A;  4A5N A;  4NUB A;  1LNQ A;  3HD7 D;  1IRG A;  4QTR A;  3PIO F;  4IEJ A;  5GAG J;  2ID3 A;  1NH4 A;  1NU1 E;  4RGS A;  5KK1 A;  4EDF A;  2XF5 A;  3CI9 A;  3Q5P A;  3FKI J;  2G0E A;  3ESW B;  3FR8 A;  4OQZ A;  1S7A A;  1XGN A;  3I58 A;  3RCO A;  2WAD A;  3FMS A;  3CCM P;  2E1M B;  2I10 A;  1LE8 B;  2Y48 A;  9ANT A;  2DDA A;  3HTK B;  4HOB A;  1OR7 A;  1PUF B;  2O61 A;  2M3A A;  1SQB E;  3G73 A;  3HEF A;  3S17 J;  2EFP A;  2EIJ H;  2B87 B;  4K3A A;  4G7O F;  1MBE A;  3HPH A;  1YQA A;  3RQ4 A;  5EEA A;  1MFT A;  4QWQ A;  3NAR A;  2KNC B;  1LVK A;  1DD4 A;  4EI2 A;  3U1K A;  1T8Z A;  4HST A;  3TDZ C;  2C9N Y;  3SJM A;  3H1K D;  2FD5 A;  2UYY A;  3K10 A;  5GTH C;  1PP9 J;  4WWI A;  2L7M P;  1KFN A;  1QL2 A;  1KB9 I;  2OU2 A;  3GUD A;  2VJ5 A;  1QLE D;  3PFI A;  5GAE J;  2JR8 A;  3HTK A;  3A5T A;  3CMA P;  2JPC A;  1JEK A;  3AE3 C;  4HV5 A;  2IGN A;  3MMY B;  6PAX A;  1RQU A;  4MN4 C;  2GA2 A;  1X79 B;  3I4P A;  4I0A A;  3W6U A;  4XKB A;  3A2K A;  3T8T A;  4BUP A;  2W6B A;  3HD7 C;  4M9X A;  4XSX F;  3ZRG A;  1QBJ A;  1IXR C;  1IXC A;  3CC4 P;  2OCC H;  2J58 A;  1Z0X A;  2BV6 A;  2ADU A;  4E13 A;  2MA3 A;  5F6F A;  2JRT A;  3BT9 A;  1FPQ A;  1JTY A;  3FBN B;  1SFC D;  1T6A A;  3A0B H;  3GTQ J;  4L9N A;  2CQX A;  5B1A H;  2B9S A;  2OAZ A;  2ZSH B;  4R79 A;  2HOD B;  1L2P A;  3P8M C;  1WJE A;  2K9Q A;  3CCS P;  3TO6 A;  2L9S A;  4HW0 A;  3HDH A;  1KN7 A;  3WTX C;  2WAF A;  2DYR H;  3PLR A;  4LGD E;  3HPG A;  4M72 A;  1BR2 A;  2CSO A;  4AWX B;  2IBZ G;  1MMD A;  4JPZ B;  3CCJ P;  4BRY A;  1NYH A;  3GG2 A;  2Q2E A;  2W84 A;  4HBL A;  2O9L A;  3H92 A;  2XU6 A;  3H9J A;  3KP7 A;  1MUU A;  5CVU A;  1N1G A;  2W25 A;  3MTU E;  1AWC A;  4DQ2 A;  3HOZ J;  2Z5U A;  3M06 A;  3D1N I;  1MD0 A;  2YIU B;  4UNO A;  1KOR A;  2KIQ A;  4G12 A;  3G17 A;  1L4A C;  2X51 A;  1IN4 A;  3HL2 A;  3G71 I;  2IGM A;  1GU4 A;  1SQX J;  3M91 A;  4M73 A;  2YPR A;  3H3U A;  4HX7 A;  4BJ6 C;  1F4K A;  5F0H A;  1FZE A;  4PJL A;  5IP9 J;  4AUW A;  3GX4 X;  3CX5 E;  3CJN A;  5GAD J;  2O8K A;  1K9M Q;  1EXI A;  3CD6 P;  4V2F A;  1K61 A;  4M3G A;  5EEH A;  1JMB A;  1APL C;  1MKM A;  1EKE A;  2X0L A;  3FMQ A;  4XKW A;  3S8P A;  1LTJ A;  3S2W A;  4EM1 A;  1E0E A;  1OYI A;  3E5U A;  3DPU A;  2YIU C;  3QU3 A;  4HAM A;  1JUM A;  2CUE A;  5JI6 A;  3IRQ A;  1NTZ D;  2IYP A;  3QSG A;  5DJU B;  5L3B A;  4CCK A;  4HNT A;  1W0U A;  2XDV A;  1KMI Z;  4U0V A;  5IP6 A;  1GW4 A;  2QM3 A;  4U3F G;  4AVZ A;  3PQK A;  1TWC J;  4EJU A;  3HHG A;  2XNX A;  3EFF K;  5KLV E;  1K8A Q;  3P9I A;  4KJZ A;  4XID A;  1IK9 A;  2OZ6 A;  4HNU A;  2QSI A;  2KPM A;  2X6Y A;  3RKQ A;  4J0F A;  2HPI A;  1KYW A;  1KD1 Q;  1DLJ A;  3A7O A;  2BY1 A;  2NS7 A;  1C0W A;  5D5U B;  2OQG A;  3L73 J;  4D6T J;  2PMH A;  1VQL I;  3MUD C;  3M9B A;  1X1A A;  3J7Y J;  1I50 J;  4HPQ A;  4BXU A;  1MDM A;  2R7X A;  1G1I A;  4IL6 E;  5B5E C;  3KZY A;  3AE6 C;  4PV1 B;  2LNB A;  4NB5 A;  1YTZ T;  3S14 J;  5ILS A;  3H1L G;  1AQ5 A;  2YMK A;  4B47 A;  5D8K B;  4CYD A;  1IG7 A;  1L0L D;  1IO2 A;  1Y1W J;  2EIN H;  2ZJQ F;  1X3U A;  3PNY A;  4L75 A;  1JTX A;  1LDD A;  2PLA A;  1U0J A;  2PFB A;  4U7J A;  5KAI E;  1YIO A;  5J6X A;  2R5B A;  4CCL A;  5LFA A;  3MN2 A;  1IFP A;  2OYH A;  4G6Q A;  3BC8 A;  3E97 A;  3BR0 A;  1OW7 A;  2K4J A;  3PDU A;  2CVZ A;  2FNA A;  2FXO A;  1R36 A;  3L2V A;  3BCB A;  1QRY A;  4D3F A;  2K37 A;  2XRN A;  3O2P E;  1U9O A;  4CHU A;  2VQH A;  3BOQ A;  3K2A A;  5AYV A;  2Q1Z B;  3G3Z A;  3L2C A;  1BR1 A;  1KA8 A;  2GZW A;  2CQQ A;  5DJT B;  1XGM A;  2OBP A;  2R0Q C;  2E75 B;  4JYK A;  5IOZ A;  2Y0D A;  2MJZ A;  4JBA A;  3CWB E;  3BR5 A;  4I6Z A;  1HF9 A;  1S9K D;  2JVH A;  4YPC A;  1RR7 A;  2H6B A;  3GO5 A;  2KDZ A;  4Q5S F;  2GF2 A;  3ZMS A;  3IAO A;  2FFD C;  1BOB A;  3VOD A;  2V1U A;  1EV7 A;  2QKL B;  1VQ4 P;  1CSB A;  1E17 A;  5FD5 A;  1H0M A;  3H5R A;  2Q5U A;  3GMA A;  3L73 E;  1BE3 E;  1WDK A;  4R4M A;  3Q5S A;  2DW4 A;  2VN2 A;  3SFZ A;  4IM7 A;  4E7H A;  1RI7 A;  1XGO A;  4HG2 A;  2QJP C;  3HE5 A;  2QWW A;  4XOR A;  5A9S A;  5CCG D;  2OFP A;  2FMY A;  2M4K A;  4TV7 A;  2Z5I A;  4W7Z A;  2NVY J;  4IF4 A;  2QLZ A;  3H1I E;  1P4A A;  1AA7 A;  1YQ3 C;  3K69 A;  3LSR A;  3J7A Y;  4HRI A;  2A07 F;  2JDI H;  2A06 G;  3OR1 C;  5A9R A;  5FGM A;  1KTM A;  4YEL A;  3BZC A;  1G1J A;  3ZMD A;  4E6K G;  1SVM A;  1OW6 A;  1SQQ J;  4D6T D;  2JJL A;  1XD7 A;  5IT9 K;  3IP4 B;  4J0E A;  4OGQ C;  3L35 A;  2YMY A;  4B1R A;  4M9Z A;  5FB2 A;  1KYO I;  2E74 B;  2NOG A;  1VDF A;  1U5T A;  1MBG A;  3K5B A;  4LLL A;  4A0Y A;  2Y0E A;  4FX0 A;  1W36 C;  2DQL A;  2VBX A;  2K86 A;  4UB6 E;  1KFM A;  4RMN A;  2OYI A;  3PFY A;  2JA5 J;  1ZN2 A;  2FFD A;  2VL8 A;  4L5E A;  4L9J A;  2O1K A;  2AEM A;  3BRV B;  1O7L A;  3TGU J;  2P6T A;  1FWZ A;  3CO6 C;  3SFE C;  3H25 A;  3DPL C;  1JCC A;  4L9V A;  1G4D A;  1SFX A;  3K6G A;  3KLO A;  4KUH A;  1PP9 D;  3BJA A;  4FE7 A;  4OOI A;  3TDU C;  1ZQ3 P;  1L0N J;  4UV9 A;  1GD2 E;  4NPF X;  4PCQ A;  4EJV A;  1PV3 A;  2FJ1 A;  2LMD A;  3FK6 A;  1F5T A;  2F4O B;  3WG7 H;  3KZI H;  3AE9 C;  2H8P D;  1T95 A;  2FX0 A;  1AKH A;  3S15 J;  1YI2 I;  2VE8 A;  2CK3 H;  4L76 A;  3O3K A;  2PRR A;  3PM1 A;  2W57 A;  3HOW J;  2ZNZ A;  2IPP A;  1NWQ A;  1S72 P;  2R7S A;  3IL2 A;  4JF7 A;  1QHG A;  2DA2 A;  3KEO A;  1VQP I;  1FC2 C;  2OYI C;  1EDJ A;  3ISP A;  2HTJ A;  2FXP A;  2G9W A;  3PJG A;  1K78 B;  3NWS A;  1OVU A;  3QWO C;  3OYI A;  5CJ9 A;  3WTY C;  1DGR M;  1GDT A;  1UHW A;  3BCC J;  2YKP A;  1VZ0 A;  1WQ2 A;  1EVZ A;  4K35 A;  4NHJ A;  2EV5 A;  2VRS A;  4BYY A;  1SQQ E;  2DBB A;  3M9A A;  2PQ8 A;  4HDV A;  3K4J A;  1FZP B;  2Z1D A;  2CW0 F;  1MH4 A;  1R7J A;  1W7P D;  3LSI A;  2DA3 A;  1SFO J;  1PGQ A;  4OGQ D;  4LG3 A;  4KIC A;  1NTZ J;  2E2J J;  1BI0 A;  3E3V A;  1QHH D;  1T8I A;  3H1J D;  1NKN A;  1MGT A;  3ZGK A;  3ZPL A;  4TLF A;  1XTC C;  1X9V A;  1V5G A;  4PD4 D;  3K6J A;  3OIO A;  1BA5 A;  4W80 A;  1WRJ A;  5LEJ A;  4E7J A;  3TNU A;  1VQN P;  1V4R A;  3GFL A;  1Y1V J;  1JE8 A;  3V7C A;  3RK2 D;  3HGG A;  4A3B J;  4UB6 H;  2LBF A;  3RIR A;  2B7E A;  4KDP A;  4DIQ A;  3FIW A;  3OYK A;  1HW5 A;  2IA1 A;  1MMS A;  5L3C A;  2QVA A;  3BCA A;  3K4B A;  4R8H A;  2VC1 A;  1KU9 A;  2BW3 B;  3HIF A;  1FJP A;  2OTL I;  3IKT A;  5FLX K;  1OYW A;  1JKP C;  4D7M A;  4A3G J;  2XGD A;  3EET A;  1HBX G;  2PFX A;  3H1J J;  5B66 H;  1MDM B;  4KUE A;  2DYS H;  1H89 A;  2A06 D;  2R5Y A;  2Q7C A;  1CGP A;  3PIP F;  2QKM B;  4W7Y A;  2ZXW H;  1LT9 B;  3BG3 A;  1FOX A;  2Y69 H;  3W6K B;  2VKH A;  4BHC A;  4HDU A;  4DGW B;  1KC8 Q;  3H0D A;  2W24 A;  1X58 A;  2WTB A;  2M30 A;  4RB1 A;  3SWF A;  3HOT A;  1UFM A;  1YRN B;  2LXC B;  2ZT9 B;  3GME A;  1GVD A;  2K9N A;  2RMZ A;  5IYB J;  2XKM A;  3PTZ A;  1LT1 A;  2NXN B;  5FD6 A;  1Q90 D;  2BAS A;  4ZKP A;  2Q3E A;  5DUK A;  4N9H A;  4E70 A;  4GT1 A;  4JQF A;  2VXD A;  3KET A;  1SQX K;  5HWS A;  1O3S A;  4D7N A;  5H2F H;  2OC6 A;  2XND H;  3HRN A;  3FZV A;  3ZQF A;  2IS4 A;  4XON A;  3ZHB A;  1BSN A;  1JY2 P;  1BDD A;  1SFE A;  3CC2 I;  3H1H E;  3H1I J;  3D70 A;  1NK3 P;  2L0K A;  1WWX A;  3HUS C;  2O5R A;  1BGY J;  5F1R A;  1EH8 A;  3TYY A;  2BBY A;  1XMX A;  2MD5 A;  5AVX B;  1RIO H;  3GLL A;  4C2M J;  1ON2 A;  4RAZ A;  2ZT9 C;  3MKL A;  2DQR A;  3BG5 A;  4B3J A;  2K9L A;  3AE8 C;  4ZDL A;  3F3S A;  1IRX A;  1TBX A;  1V3F A;  4RB0 A;  1X3W B;  4IOC F;  3DEW A;  2KJC A;  4XA4 A;  4QSH A;  1SVL A;  3W2A A;  3CTA A;  3AEA C;  4M9S A;  1FNN A;  1FAV A;  5GAH J;  2YU9 J;  4IO9 F;  3CCV I;  3HAD A;  2LSO A;  2X6W A;  3C2B A;  3IUO A;  3QRF F;  4ZKU A;  1FBU A;  4H44 C;  1XX5 A;  1FOS F;  3UR3 C;  2XKP A;  4E7I A;  1LTT C;  2Y2Z A;  5K1Y A;  4NBQ A;  4X6A J;  5CCH A;  1VF5 D;  3TKY A;  1TP4 A;  3NEU A;  2CUF A;  3HUS A;  3LSJ A;  4KIT B;  4KMU X;  3V4G A;  1DD3 A;  2IX7 C;  3HD7 A;  3BG6 A;  3K0L A;  4XN3 A;  5HDG A;  1FYK A;  3E1R A;  2HVS A;  1RQV A;  4UY8 I;  2LF7 A;  3FR7 A;  4B86 A;  5CBO A;  2KLO A;  3C18 A;  1FYM A;  1YTZ I;  3BR6 A;  1OFC X;  1FJL A;  1K83 J;  3DLL F;  2HDW A;  3PEF A;  2R3S A;  3LAJ A;  3AKZ A;  1FOK A;  2HOD A;  3ERM A;  3H1H D;  2QG4 A;  1VQK I;  1RF0 A;  2PI0 A;  4PJ0 E;  2BXY A;  4OWR B;  4HYE A;  4XRF A;  1XDU A;  2GM4 A;  2IAI A;  2ECB A;  3VPR A;  2WBM A;  1T39 A;  1L3L A;  1ZLL A;  4H13 D;  3ABL H;  2HDD A;  2OPT A;  4OVN F;  4UB8 E;  1MV8 A;  4CYC B;  1P7I A;  1NTM D;  2KI7 B;  3LSG A;  5EJC A;  1Z3Y A;  1ZYR F;  3G1O A;  4G6T B;  4EMS A;  3BQY A;  2FNP A;  2IFM A;  2ITA A;  2V1D A;  1M8O B;  4HJG H;  1H89 C;  2RH0 A;  2UWJ E;  2YKO A;  3JSO A;  2IS2 A;  1DEE G;  3QOD A;  5ILU A;  2ZVN B;  3A01 B;  2IYO A;  4L18 B;  1PDN C;  2NPS A;  3LMM A;  3N4M A;  1WDM A;  1A36 A;  2PMU A;  2R7O A;  1S7O A;  2A45 H;  2GOX B;  2K5C A;  2IS1 A;  2D2C C;  3ECH A;  2O01 N;  1BL0 A;  4O3M A;  4ZDP A;  1UG2 A;  5DM7 F;  1TXG A;  5AW9 B;  4I6M C;  1YE9 A;  2KP8 A;  2K7L A;  3JRG A;  1FOS E;  1WCM J;  2R7Q A;  3LA3 A;  4A0X A;  4CYC A;  5M5Y J;  5IYC J;  3KDP B;  2M3E A;  4S04 A;  3SEQ A;  3A2A A;  1UG0 A;  4CPG A;  3HUG A;  2B87 A;  3CMY A;  5TIS E;  3VTP C;  1KIL A;  1X3Z B;  1J59 A;  3V4Q A;  3RTR A;  2QJK C;  2MYS A;  5DDG A;  1ERD A;  2XDJ A;  4LIT A;  3PJR A;  3CXH E;  4RGU A;  1FSH A;  1MMA A;  1X22 A;  1D7M A;  2BCC J;  2NRG A;  5B1B H;  5B5E H;  4MQ9 F;  4BH9 A;  2DCE A;  4L0Y B;  2QA4 I;  4PGH A;  3P9C A;  1PGO A;  1ZME C;  3A0H E;  4LD5 A;  1HKT A;  4XBF A;  2GA1 A;  2PN6 A;  5CVR A;  1O57 A;  4BGD A;  2E74 C;  2KIF A;  5KLV K;  3ZQ7 A;  2MFZ A;  3MIW A;  2ZNY A;  4M74 A;  2RVC A;  1G3Y A;  3K70 D;  4RDU A;  4B43 A;  2POH A;  3I83 A;  5M5X J;  3E6C C;  2BVL A;  3ZP5 A;  1VQ7 I;  1ENH A;  3LSM A;  4HA8 A;  3I55 I;  1T0F A;  3AE4 C;  2XGX A;  3P7N A;  1HQC A;  4C7N B;  2AO9 A;  1KZU B;  1SQQ K;  2E35 A;  1JGS A;  1L0N G;  1SFU A;  1AQT A;  3ABM H;  4AID A;  4MLO A;  4JYC A;  2NAZ A;  1B72 B;  1FYL A;  5J1U A;  3WU0 A;  1KON A;  2X1D A;  2HI3 A;  3FM5 A;  1KYO H;  2LDU A;  2NOJ B;  2VBZ A;  3PQJ A;  1HJ0 A;  4GOD A;  2K3P A;  4H0L B;  2QA4 P;  2F5D A;  3GLM A;  4LIU A;  2K3R A;  1W5C E;  1OMI A;  3GHG A;  1M90 Q;  4XSZ F;  1QZZ A;  4W1U A;  1PPJ E;  1B8I B;  3M4O J;  5M1B A;  5E3O A;  1PP9 E;  1HBW A;  1U3E M;  1D3Y A;  1RR8 C;  1OLT A;  2WV0 A;  3LQR A;  1YB4 A;  2ZCW A;  3MD0 A;  3VP9 A;  1T56 A;  1IN7 A;  3FXJ A;  1V5E A;  3BAS A;  3KXD A;  1YIJ P;  2LG4 A;  4P5O A;  4YIF A;  1M76 A;  2MAB A;  5EZG A;  3S3O A;  1GV2 A;  4M3L A;  3PSI A;  2VBW A;  5FLM J;  3OIQ A;  3OYM A;  2FKW B;  2E1O A;  2HLO A;  3TMO A;  5KNL A;  4Z2Y A;  2OTJ I;  3J80 K;  2NVT J;  1NTZ G;  3GTO J;  2CPB A;  5E3L A;  4IOI H;  1JNM A;  4M3D A;  2A68 F;  1JM0 A;  4BWN A;  4RS8 A;  1WZ2 A;  1W5S A;  4IRH A;  1Y39 A;  1P84 H;  3FWE A;  4HQM A;  4U3F J;  2E74 D;  1TWF J;  2DT5 A;  3ZMZ A;  3K2Z A;  1NK2 P;  2JA8 J;  2K9J B;  2YO2 A;  4D6T E;  1I1S A;  4UB8 H;  5L3E A;  4GWK A;  4LK0 F;  1YON A;  2W83 C;  1MSE C;  1FP1 D;  2BZT A;  3BTL A;  4IFF A;  1LT9 A;  4OL9 A;  3R61 A;  5CVJ A;  4YRV A;  1T2K A;  3AED C;  3J80 Z;  2NNY A;  3L2W A;  3A01 A;  3CWB G;  1QPM A;  2KJB A;  4I09 A;  1X2N A;  1B6A A;  3D6Z A;  1QVF O;  3WU1 B;  4U87 A;  2DPU A;  3LA7 A;  1YYC A;  2DA7 A;  2CO5 A;  3B73 A;  2LVS A;  3VYT B;  3K96 A;  2X1C A;  4KUG A;  2IJL A;  1B4A A;  1K4S A;  3HE4 A;  3MHV A;  2JJ7 A;  1Z91 A;  2YX7 A;  4FCY A;  1L0L G;  1ON1 A;  4I2L C;  5FWN A;  3GTP J;  5E79 C;  3L73 D;  1TZL A;  3I54 A;  3RKX A;  2FYN B;  4CCN A;  4RAF A;  3QHA A;  1R5G A;  5F64 A;  4DZP A;  1EQ7 A;  2C9L Y;  1HUC A;  3F23 A;  2CPS A;  1U7J A;  2AHQ A;  5LGU A;  1HDD C;  2YXR B;  2ZXE B;  2XPW A;  3OR2 C;  4OH8 B;  4BKX A;  3CCE P;  3ABT A;  4ZTF A;  1NJI Q;  2CUJ A;  5L3G A;  5FFZ A;  5K7H A;  4FIS A;  2ESH A;  5CPR B;  1FZF A;  1URQ B;  3CWB D;  3I53 A;  1UIX A;  1OQY A;  2E5N A;  2QSH X;  3F89 A;  3EFG A;  3CWB J;  1P2F A;  3WMM 0;  4BQN A;  2VUM J;  5AVS B;  3RK3 C;  2FF4 A;  3NQO A;  1NU1 J;  5CJ4 A;  5HDK A;  1TWG J;  3MQ0 A;  4L5I A;  3JRC A;  2HOT A;  2IT0 A;  1PPJ D;  2WAE A;  2WPV B;  1EH6 A;  1ZG3 A;  3RPQ A;  3HUS B;  1U9N A;  3M8F A;  4IQJ A;  2Q1K A;  3R4Y A;  2KSE A;  1VQO I;  2Z4E A;  3F8F A;  3GZ6 A;  5CCH D;  2E5Y A;  4RO0 A;  3WGI A;  3FHN A;  2E1C A;  1W5T A;  1JXS A;  5LHG A;  3IR9 A;  5JLW A;  3IFM A;  1HCR A;  3CDL A;  5HLI A;  3CXH I;  2EQR A;  4AC0 A;  1I3A A;  1KYZ A;  4YII A;  1AKH B;  3VYI A;  3GYH X;  1N25 A;  2XRL A;  4G6D A;  4ANJ A;  3Q0V A;  3LSP A;  3ZQL A;  3S2D J;  2Y0M A;  4EJO A;  4ESJ A;  2VQG A;  2L9V A;  3TW7 A;  2KUB A;  5AVQ B;  3I4M J;  1USS A;  4L0Z B;  3KPE A;  2WSE H;  1IZ1 A;  4ZYG A;  1HWT C;  2QQA A;  1WJ5 A;  1FBQ A;  2KKO A;  1IJD B;  3B02 A;  1N73 C;  3V42 A;  3CC4 I;  2VJJ A;  1KB9 H;  2H09 A;  2XIG A;  1HH0 A;  1R9T J;  5AVR B;  1OPC A;  4HQE A;  4DLL A;  1AJY A;  2IEK A;  4YFK F;  2H89 C;  2HS5 A;  3VSL A;  3CXH D;  2AXL A;  4PZD A;  3KYL A;  1TU3 F;  3HRM A;  4I7Z B;  1BG6 A;  1S5L E;  1K7A A;  3S1N J;  2XB5 A;  1U5T B;  2DN0 A;  2L9N A;  5IT3 A;  5DS9 A;  4WY4 D;  2ZFU A;  4QIW N;  3HTU A;  4A7P A;  3KQG A;  1VQM P;  3RI4 A;  2LRE A;  2FU4 A;  2DMN A;  1YJW I;  1LTA C;  4O9B A;  1Y6I A;  2BHZ A;  1CI6 A;  4BNC A;  4H44 D;  3D1L A;  4E12 A;  1SS1 A;  4F3Q A;  1UZC A;  3KPH A;  3ADP A;  3ZWC A;  1BW5 A;  5LLQ A;  1VF5 C;  5APQ A;  3ADO A;  2R5Y B;  4ZYH A;  4A3L J;  1OCT C;  1ZXG A;  3PNV A;  1JDJ A;  3VYU B;  2MLG A;  3CCL I;  3CX5 D;  3R0J A;  4BY7 J;  2VOD A;  2KFD A;  1LTB C;  2FYZ A;  3KYC B;  3DBL B;  4JYB A;  3B5N A;  4PFO A;  2BW3 A;  3ZOB A;  1T2K D;  3M1C A;  2D2C D;  1BN5 A;  4ASV A;  2UZK A;  1LP1 A;  3AEB C;  1B9N A;  5JVG F;  1NTM E;  4Y99 B;  2OYH C;  2MKV A;  1X8Y A;  1R5H A;  5GTH E;  4H0E A;  1G8X A;  1PYV A;  2KL4 A;  4OAZ A;  2OJE D;  3WTS C;  4M6Y A;  4HB1 A;  2X4H A;  3FK7 A;  4I99 C;  2EFW A;  1Y8Q B;  1ZV8 A;  1AV1 A;  1KQG B;  2MSY A;  3REO A;  4BXF A;  2HR3 A;  3VWB A;  3L09 A;  1IFM A;  3QPS A;  3L72 G;  2M0M A;  1UAA A;  4E7K A;  3LW5 J;  4XRS A;  1LGH B;  1FBM A;  3GVA A;  3CP2 A;  2W90 A;  1BJA A;  2X85 A;  5HDN A;  2KRF A;  4J00 A;  3M0A A;  3GTJ J;  2IBZ I;  5HOO A;  2O7O A;  2EPF A;  4I2O A;  2BY2 A;  2YU3 A;  5TIS C;  2N1T D;  1FZC A;  2G3A A;  5D5V B;  1AVY A;  2GUV A;  1YW9 A;  2LP0 A;  4KNY A;  4KJM A;  5APX A;  4MGR A;  2V7F A;  2G7H A;  2ME0 A;  2A61 A;  2EA4 A;  1JT0 A;  1K78 A;  1EZV G;  1ZP0 C;  2A45 I;  1PP8 F;  1M1J A;  3L74 J;  4UVC A;  3B4S A;  2X58 A;  2RN7 A;  1LDK B;  2QRX A;  3L71 G;  3CX5 H;  2ISZ A;  4C3H J;  2PBI A;  4NNJ A;  1YTY A;  3AG3 H;  3MD2 A;  1SQP G;  1GV5 A;  4GBJ A;  3O6B B;  1OCR H;  1FZC C;  2WY8 Q;  2NRA C;  1XCB A;  3K4M A;  4KIG A;  3UNG C;  5D4S A;  4BHP A;  3ZGY A;  3JCU E;  2EZK A;  2JUC A;  3ZN0 A;  2QM8 A;  2JMW A;  3LOC A;  2F5E A;  3OYL A;  3ONQ A;  4CCJ A;  4HKZ H;  1S1C X;  3BPV A;  3LSH A;  4HYT B;  2QJK B;  5FFX A;  1R5I D;  1W2B O;  3WU2 H;  1XB4 A;  2WSC J;  4OIQ F;  1L4A D;  2P4Q A;  3F6O A;  2KS1 B;  3MZW B;  3R60 A;  1YJ9 P;  5D6F A;  2IA2 A;  3DTK A;  3IWF A;  5DEQ A;  3HM5 A;  3WTT C;  3R0A A;  3LAP A;  3SZP A;  4Z6Y A;  2VAS A;  2KMU A;  3NWT A;  5BMZ A;  1VFC A;  3VMY A;  4B3H A;  1QO0 D;  4FE4 A;  4WX9 A;  3V8K A;  2OZU A;  2QEN A;  3FF5 A;  3P5J A;  4X1E A;  3G0O A;  1AU7 A;  3CCU I;  4IHT A;  1GHC A;  4FGW A;  1NAF A;  4PFP A;  4KFC A;  3GF7 A;  1R4N B;  3G1M A;  1X2M A;  3KZZ A;  3QPL A;  4KIB A;  4OU0 A;  4Y13 A;  3OYD A;  4LLN A;  3CKY A;  2F4I A;  1JUS A;  3QYF A;  1X0V A;  2IP2 A;  5KJ7 C;  1B59 A;  2HXI A;  2A06 E;  4RJT A;  4HV6 A;  5HS9 A;  4BL0 B;  1BGY G;  1YBK A;  2E76 C;  2Z33 A;  1U2W A;  1VL2 A;  2O1J A;  1GLN A;  4A5M A;  1JGG A;  1SFC B;  3M9Q A;  3CCQ I;  2N1T A;  4QPQ A;  2CYY A;  2CG4 A;  4PJN A;  2QBY A;  1VQ7 P;  1DX7 A;  5ED4 A;  4UB6 C;  4XLH A;  3IV5 A;  2VIX A;  1GU5 A;  2W27 A;  4ASW A;  3ELK A;  2Q8K A;  1RRJ A;  1QPI A;  3TP3 A;  3DTE A;  3OYB A;  1FTZ A;  3JCU H;  1U8R A;  2CW8 A;  1VI0 A;  2Z5H A;  1SFK A;  2LFB A;  1BC7 C;  4PD4 E;  2Q2E B;  1Z6T A;  1BGY D;  4ZJZ A;  3OSG A;  1W7P B;  2E7W A;  1WDL A;  1XTA A;  1G59 A;  1P84 E;  3S1M J;  2W82 A;  1Y47 A;  3L70 D;  4BHB A;  2JWA A;  5ICC A;  3H1J E;  3V2P A;  1FOW A;  1E3O C;  1Q1H A;  1K4T A;  2FBW C;  3H1H G;  2ZXX A;  2IZ0 A;  3LSK A;  1SQQ D;  1R6R A;  3GFJ A;  4IRG A;  3CO7 C;  1D0Y A;  3DPT A;  3QQA A;  2IFN A;  1ZRD A;  5DYM A;  5B3S H;  3CLQ A;  3MCZ A;  4DOZ A;  1T6S A;  3CMM A;  3QPT A;  2QQB A;  3AE5 C;  1JB0 J;  1X1D A;  5HLT A;  3JR9 A;  2LR2 A;  3K4N A;  3HOS A;  1KQ9 A;  1WP4 A;  3OYC A;  2ZVO B;  2XSD C;  1F36 A;  3EUA A;  5CCH C;  1IUF A;  2FA5 A;  1UB9 A;  2X6O A;  2FUG 2;  4RM3 A;  2R7W A;  2FY8 A;  3OA7 A;  3FXE A;  1ZGA A;  3B5N C;  3NMD A;  3CCV P;  2XAG A;  3MKY B;  4RAG A;  4EJT A;  2HVR A;  2FYU D;  1MSF C;  5LRS A;  1S7E A;  2R7D A;  1BC8 C;  3FWN A;  4XFJ A;  4LLG F;  1FEX A;  3F0C A;  2IS6 A;  5AW8 B;  1LSJ A;  2JN6 A;  2FBK A;  1OCZ H;  2UWM A;  5E17 F;  2QM7 A;  5B66 E;  4G7Z F;  1J1D B;  3S4R A;  2HOA A;  1TNT A;  1FC3 A;  3OIP A;  2E75 C;  1JY2 O;  4XOP A;  1KV4 A;  2B89 A;  2F4M B;  3EUK L;  2WIT A;  4G9Y A;  3S93 A;  3ZCO A;  4NC6 A;  4XR6 A;  3CES A;  5JFR A;  2A3S A;  1OCP A;  2W4S A;  3Q3S A;  5GP9 A;  3AAF A;  1UII A;  2K9Y A;  2M4G A;  2HQR A;  2H8W A;  3SYT A;  4B3I A;  3L73 G;  2C6Y A;  2N9B A;  4WVZ A;  4I7Z C;  2VPL A;  1XN7 A;  1E79 H;  2UV1 A;  4GFB A;  2HWV A;  3KP3 A;  3AG4 H;  3FX3 A;  1SQX G;  2F5F A;  5HLH A;  2BCC G;  4LGW A;  1QZE A;  4IFD K;  1TTY A;  2K27 A;  4XKC A;  4HF1 A;  1AHD P;  3U21 A;  3W2W A;  2V26 A;  2FYN C;  3L2Q A;  1NKZ B;  2ECC A;  2TRT A;  1MBF A;  2L9R A;  3FX0 A;  4PSX A;  3H1I D;  5DM6 F;  3QP6 A;  1F1Z A;  4CDG A;  1B8I A;  1FY7 A;  1MBJ A;  1A31 A;  2W6J H;  3HSF A;  1QL1 A;  3GHG B;  4XM3 A;  4ZYE A;  2F5C A;  5DCM B;  2L7F P;  4ZC3 A;  1O3Q A;  2CV1 A;  5LHI A;  3BTI A;  1ETX A;  2V7Q J;  1MZB A;  2HFE D;  5CHX A;  1B72 A;  1SD6 A;  5CQG A;  3UKG A;  4PZE A;  2HZT A;  1BE3 D;  2KQR A;  5E20 A;  2L2O A;  4MFD A;  3T97 B;  2BCC D;  5JHF A;  4C7N A;  3KYD B;  3D0S A;  1N73 B;  1G2H A;  2FRH A;  4PUS A;  2CH0 A;  1S9K E;  4OAY A;  3FGA D;  2QSF X;  1YFH A;  2K02 A;  4C3J J;  2QCO A;  1KQS O;  3M3Y J;  3M0D C;  1EC5 A;  2WA0 A;  1WGX A;  1IRZ A;  2RV8 A;  1TW3 A;  3OY9 A;  2R92 J;  2E75 D;  1H9T A;  5APU A;  1WFX A;  2O0Y A;  4WK8 F;  2XVC A;  2KYV A;  1Z9C A;  1N73 A;  3W6V A;  5E3N A;  4NQW A;  1J2J B;  2B88 A;  3HB9 A;  1Y56 A;  4D5C A;  3FMR A;  3G4S P;  2DOA A;  2L91 A;  3WHC A;  3CME I;  2L4A A;  3F3X A;  1FP2 A;  1ODD A;  1JI8 A;  1K05 A;  5EFW B;  1T2K C;  4ITV A;  1OKR A;  1X0T A;  2ZXH A;  4B4C A;  1LJ8 A;  4LB5 A;  2HVQ A;  2COM A;  4HNV A;  1IC2 A;  1IXS B;  2L7K A;  1BOA A;  4JX5 A;  4IHY A;  2HPC A;  4PDK A;  5K7F A;  1L0L E;  3L72 J;  3Q3D A;  2P4W A;  3F5H A;  1SQB J;  1X1C A;  2DFE A;  5HVQ C;  2XSJ C;  2M5W A;  5AW6 B;  3RKY A;  3VOE A;  2JEE A;  3CCQ P;  2W8Z A;  2QJY C;  3V7S A;  2STW A;  3G1L A;  2Z99 A;  1WH5 A;  5BU8 B;  2NYX A;  3F8C A;  1H8A C;  2ZYG A;  1RH5 B;  5E18 F;  1CQT A;  4HSR A;  3SFI A;  4KT0 J;  2G7U A;  4KT5 C;  3S1Q J;  1RY3 A;  1PGJ A;  3CCL P;  2EFQ A;  4ESF A;  1YJN I;  3F8N A;  3GEZ A;  1M1K Q;  1FMW A;  3A0B C;  4HLX A;  4Y7N J;  1TQI A;  1VQ6 P;  3GTL J;  5AVW B;  3OYH A;  5KLV D;  1VQO P;  1IN5 A;  4LOC A;  1ZW0 A;  1SEU A;  4EGZ A;  3EYY A;  3I64 A;  2JK3 A;  2KT0 A;  2ZME B;  1TNS A;  3LL7 A;  4Y4R A;  5C44 J;  1NTZ E;  2N9Y B;  2WMM A;  2F48 A;  4MIM A;  1VND A;  3CJT B;  3WUT A;  1WSU A;  2ZSI B;  3CP8 A;  1Y8A A;  4XLA A;  3CJQ B;  5TIS H;  4PK4 A;  2E34 A;  2VKD A;  3HGY A;  4HZF A;  4WXD A;  5IYD J;  2OTJ P;  3EGO A;  2EA2 A;  1P9Q C;  2ZFW A;  3KEY A;  3A0B E;  2COB A;  2V79 A;  3W6Z A;  3FXD A;  1HDP A;  3BPX A;  4XLF A;  3KZI E;  2AXC A;  1EXJ A;  1SQP E;  2PJP A;  5KLV G;  1W7P A;  2CU7 A;  4U7D A;  2KK7 A;  3HG9 A;  4DCK A;  1ETW A;  3IKV A;  4I76 A;  2NS0 A;  1FTT A;  4H0L C;  3RK2 B;  1P84 I;  4N9I A;  3P7K A;  3JRB A;  1GTW A;  3ZN1 A;  3X2Q H;  3WFJ A;  3KP2 A;  1D0X A;  3AG1 H;  3ZQG A;  4IL6 C;  2XC7 A;  4FET A;  4BY1 J;  3A3Y B;  1YHQ P;  4QLC U;  2BE5 F;  1LWU A;  3H1K J;  2N8G A;  1H88 C;  1N86 A;  5AVU B;  2JWT A;  3R4K A;  4XK4 A;  5A2Q K;  1PFI A;  5TGT A;  3AEG C;  3GW6 A;  4ZZD A;  1DH3 A;  1VPD A;  1JY3 O;  1SFC A;  1BI1 A;  3S3M A;  3U9G A;  3H1L E;  1YLF A;  4BAC A;  4LK1 F;  3PP5 A;  4Y17 A;  2XAF A;  1JHH A;  1TWA J;  4H44 B;  1SC7 A;  3BQZ A;  1R5S A;  5IP7 J;  1TLH B;  4MNU A;  5F0C A;  5LRR A;  1ZCJ A;  4WBA A;  1YW7 A;  1H0T A;  3HWR A;  1LTG C;  4PV1 D;  3SWY A;  3L6D A;  3BJO A;  4NPE A;  3VOP A;  3P9K A;  3GLX A;  1KU3 A;  3HKZ N;  2JA2 A;  1R1T A;  4GYG A;  4Q48 A;  1Q82 Q;  2DXI A;  4IQ4 A;  3HHH A;  3SDG A;  4Z1M H;  1NTZ K;  1BSH A;  2OA4 A;  5CJ0 A;  3S32 A;  4DNC A;  4IKF A;  4EAT A;  3E6D A;  2BEZ F;  1JJ8 C;  1F0Y A;  3TK1 A;  2DJI A;  3CC7 P;  3H1C A;  2OQR A;  1J9I A;  2D2C B;  2STT A;  3MZ8 A;  1TW2 A;  2EH3 A;  3ZQC A;  4BU2 A;  4M6V A;  4JP0 A;  4A3K J;  1VF9 A;  2NPS C;  1Z3X A;  2ISY A;  1RC9 A;  2R5D A;  2Y31 A;  2BXZ A;  2EZH A;  5E1X A;  2E1N A;  4QPO A;  2WAQ A;  2FYU J;  2VOP A;  2I8D A;  4D3D A;  4WY4 C;  1N7S D;  3H1K E;  5IT9 Z;  1YS7 A;  2HYJ A;  4C30 A;  3S3N A;  1SLQ A;  2NVX J;  3KCC A;  3L37 A;  2DA4 A;  2X9D A;  1MMG A;  3PUF A;  2CS3 A;  3CMA I;  3UIA A;  1PGP A;  1URQ C;  2YS9 A;  3OWT A;  4IL6 H;  2M5A A;  1HVV A;  1R49 A;  3BTJ A;  4IPA A;  1L0L K;  1IFN A;  4OMY A;  2ME6 A;  2HOE A;  2VC0 A;  4AD9 A;  5EGO A;  1Y0N A;  4IHW A;  4G94 A;  1UHM A;  2RRE A;  1POG A;  4YIR X;  2I1J A;  1XG1 A;  1JTH A;  1GL2 B;  3OYJ A;  2HYF A;  2IBD A;  5K5O A;  5J1R A;  1SQB D;  1YHQ I;  1RUO A;  3ZXS A;  3L2R A;  5KKZ C;  3S9O A;  4AUX A;  1WI9 A;  3WTU C;  2FOW A;  4BE2 A;  2CQN A;  5F1J A;  5CVI A;  3TOB A;  1T08 B;  4B8X A;  1LEB A;  1IFJ A;  5TRD A;  1I39 A;  5KLI C;  3T5X A;  2RN0 A;  2CV2 A;  2VB6 A;  1N75 A;  4D1Q A;  4MTE A;  3VDX A;  3F21 A;  3Q2Y A;  3QH9 A;  1WI3 A;  2FQ4 A;  3IHU A;  1ZR2 A;  1O3T A;  2ZB9 A;  1D8J A;  1FZB A;  1NU1 D;  2BHY A;  3MZY A;  3RPU A;  3CCY A;  1M1J B;  1UST A;  5AW2 B;  1WVR A;  3DLA A;  2K1A A;  3I3L A;  1SD7 A;  3I59 B;  3L71 D;  5EGO B;  4YTP C;  5E79 H;  1ACI A;  1VF5 B;  2ELH A;  3L71 J;  1AA0 A;  3F8M A;  3PO3 J;  1SFC C;  1LP1 B;  2M0C A;  4DT0 A;  1J2X A;  2BEO A;  4ON0 A;  2KIS A;  2FSW A;  4C9Y A;  4A3J J;  2W00 A;  5C39 A;  2P7J A;  1VQ8 P;  2YXQ B;  3U1A A;  1NHA A;  3CLO A;  4EV0 A;  2BYV E;  3AFH A;  4A2U A;  5F0F A;  2H94 A;  2W7N A;  4OWF A;  1UHS A;  1F14 A;  3NRV A;  1YVE I;  5CMZ A;  4C7R A;  3NTN A;  4Y33 A;  3ZW9 A;  3MKW B;  5LBQ A;  1EF4 A;  4KHX A;  2A6E F;  4EOT A;  1JY3 P;  2YR2 A;  3VP8 A;  2WQY C;  3BZ6 A;  1MW7 A;  2EFO A;  3HRT A;  1RKW A;  2CRG A;  2H27 A;  5AW4 B;  2LTP A;  3LFU A;  1TT5 B;  1ONV A;  4BS9 A;  3JRE A;  5M3F J;  3VYS B;  2E2I J;  2PJR A;  1O4X A;  4A69 C;  3S2H J;  4MTD A;  1YJ8 A;  5KAF H;  2DU9 A;  2E43 A;  3H9Q A;  2O3J A;  2OTL P;  1OZH A;  1G6N A;  2X1E A;  1PJR A;  2HTS A;  3C2G A;  1GXP A;  1F12 A;  1E3P A;  2I5U A;  5E1Z B;  4E7L A;  5H2F E;  2UXX A;  1NHL A;  5JR3 A;  2DT7 B;  2V9P A;  1ZRT D;  2KXP B;  2GAU A;  2E42 A;  2O6G E;  2V9V A;  3AL0 C;  2M8E A;  2Y0C A;  3AE1 C;  3I56 P;  1N7S A;  2L01 A;  3CME P;  4CZZ A;  2QSG X;  3F6V A;  5JHU A;  2LK2 A;  3KE2 A;  4V2G A;  2H88 C;  2ZJR F;  3RBZ A;  1IO4 A;  2I76 A;  1VQL P;  2OTK E;  2Z9O A;  1X0X A;  2P2U A;  5FRO A;  4MFE A;  5K5G B;  4F92 B;  5FJ8 J;  3HBL A;  4HEA 2;  1YO5 C;  3RK3 B;  1S3J A;  5KJ7 A;  1A02 F;  1WHU A;  1BCC D;  3B6A A;  2A45 G;  3CUO A;  4M71 A;  1BCC G;  4UHT A;  1Z6R A;  4XKV A;  5H6R A;  1FJK A;  3C2H A;  1MJB A;  2RQP A;  3J7Z I;  2JKV A;  1SQB G;  2E76 D;  3C8V A;  3L2U A;  3CL3 D;  1YJ9 I;  3H3Z A;  4O5V A;  1YJN P;  3CXH H;  1SD4 A;  4A3D J;  4GGG A;  5A9T A;  2AEJ A;  2NS8 A;  2R7F A;  3GBG A;  1Q7Y Q;  1N1E A;  2XKO A;  3H5N A;  3I5U A;  3G6E P;  1B1B A;  5IY5 H;  4GO1 A;  2H6C A;  3A1Y A;  3IH2 A;  4EJW A;  2HQ5 A;  1PZQ A;  2V6C A;  5D5W B;  2D1H A;  3H6P A;  1IN6 A;  3USS A;  1GXQ A;  2GUS A;  1RF1 A;  5LHH A;  1HLV A;  5JE8 A;  2H43 A;  1LFB A;  3I9V 2;  2MD0 A;  3N4X A;  2R32 A;  3OV8 A;  3FWL A;  2P5V A;  2ESN A;  3CDH A;  2VOO A;  2ZME A;  3EUH C;  3KP5 A;  4F91 B;  3DU6 A;  1FIA A;  3G9R A;  3ZMT A;  1Z1D A;  3HE4 B;  3MZH A;  3N97 A;  2DPD A;  5KCM A;  1NVO A;  2CFO A;  1SQP K;  1R22 A;  1SVO A;  1ZAO A;  1DDN A;  4HX4 A;  3JRI A;  3H1K G;  3M9H A;  4DYQ A;  3QYB A;  4J19 A;  4Y52 J;  4PZC A;  5DV5 A;  2R4G A;  2XV5 A;  3OMY A;  4BJ5 C;  1OVR A;  2KP6 A;  1HSJ A;  3WUU A;  2JPB A;  2RDP A;  2RQQ A;  4AIJ A;  1HW1 A;  5F27 A;  1A6I A;  1HOM A;  2L7Z A;  3C7D B;  5GTI H;  4N4N B;  2QEX P;  5AIP A;  3PJS K;  2CQ7 A;  5LGN A;  1BR4 A;  1WKM A;  3OYA A;  2WSF H;  3H1I G;  4YXW H;  2OUM A;  4AM3 A;  2M1B A;  3IF4 A;  1QQI A;  3DWL E;  2LR8 A;  3IN6 A;  1XSX A;  2M7B A;  1K79 A;  2OF7 A;  2J5O A;  4IRI A;  3DFU A;  3CCU P;  2VKE A;  4KT6 A;  1EZV I;  3D5R C;  2O01 H;  4PD4 H;  4DZO A;  3HTS B;  3TGU E;  2J5P A;  4IX7 A;  1SD5 A;  1WRG A;  1RET A;  5J8F A;  2WB1 A;  1LUJ B;  2W1O A;  1U6G A;  4C3I J;  1MJ9 A;  4CCM A;  2ZJP F;  1IAW A;  4A93 J;  4ZTJ A;  4RLQ A;  1RNL A;  2K9M A;  2MW8 A;  2MH9 A;  1LB2 A;  1SAU A;  2YUS A;  2FXA A;  4NQW B;  4W97 A;  5HOD A;  1EDK A;  3IC7 A;  1QZY A;  2XF6 A;  2JVG A;  4IVN A;  1OIS A;  4JOM A;  1USE A;  4B44 A;  2LKP A;  4L74 A;  3PID A;  2NPS D;  4LC1 A;  1Y9B A;  4XRM A;  5BPD A;  3BR1 A;  1G3W A;  2JWD A;  3E6B A;  2QEX I;  2MBF A;  5D5X B;  1TL8 A;  4PV1 C;  1O7F A;  4CZC A;  2CW7 A;  5FLX Z;  2XGE A;  3K70 C;  4A3M J;  1HF0 A;  1WH7 A;  1JUP A;  2E5Z A;  1A5J A;  4RKU J;  5LEK A;  5K7Z A;  3DBR B;  4EYY Q;  3T97 A;  3ZQQ A;  3S16 J;  2P81 A;  3PH0 A;  1E3H A;  2LC2 A;  4MQV A;  1VQM I;  2O8X A;  2XPV A;  4WCG A;  2M8G X;  3KEQ A;  2VQC A;  4M6X A;  1FE6 A;  2WPR A;  2RKL A;  4EM0 B;  1MNE A;  1DU6 A;  4GXO A;  4D0P A;  5EDN A;  1GK6 A;  2ZBK A;  2JTV A;  3OL4 A;  1HW2 A;  5DCM A;  2QE7 H;  1I6X A;  3OYG A;  1FDI A;  1M1E B;  2XAJ A;  2M2E A;  1F17 A;  3AE2 C;  1DQU A;  4I1L A;  1WMK A;  2IGO A;  3MEX A;  3M8J A;  3BVH A;  1PL5 A;  3K1P A;  1KIL E;  1ZR4 A;  5FKM A;  4DBR A;  2QYO A;  4P55 A;  4IHX A;  3RQI A;  3LWF A;  1GMJ A;  2HU9 A;  5D4R A;  2DA6 A;  2LKS A;  2CGP A;  1KQ8 A;  1IV8 A;  1R1V A;  2DK5 A;  4KUM A;  2LKX A;  1NAY A;  4NPD A;  5J40 A;  4NDL A;  4YCA A;  1EZV E;  1L0L J;  1XMA A;  1XTG B;  3H32 A;  5JVT A;  2M9H A;  3PUB A;  3RBX A;  2AQF A;  3R6S A;  1LSO A;  3P8C E;  3DTI A;  1IV6 A;  2DO7 A;  1Z82 A;  3CC7 I;  3E7K A;  4XIC A;  3PHL A;  1L4A B;  1STZ A;  4KA4 A;  2FYU G;  2N1T C;  2L54 A;  2P58 A;  2LY1 A;  2EZI A;  4A6D A;  4II2 A;  3GTM J;  4A3F J;  3SXY A;  1XMK A;  1AFO A;  2DMQ A;  2WSC H;  4WY4 A;  2VJI A;  2PMZ A;  2R7R A;  1LDJ A;  3I71 A;  3IH3 A;  1GUU A;  1MIJ A;  3GF2 A;  3HUG B;  3LQQ A;  3ZMU A;  1W0T A;  3ASO H;  4MEX F;  1SQV E;  1WJF A;  2XAS A;  3RL0 g;  5J1Y A;  1A6Q A;  1LTJ B;  3L75 D;  5AW7 B;  5CBN A;  2KNC A;  5F08 A;  2VE9 A;  1OJL A;  3TED A;  4U3F D;  4L5J A;  4B09 A;  2EIK H;  5HS8 A;  4ENM A;  5C3E J;  2ZC2 A;  5ICF A;  3NAU A;  1G2C A;  4ABZ A;  1ITY A;  3ULK A;  3DFG A;  4LG0 B;  2X6X A;  1D5V A;  3WFI A;  1FBS A;  3T8R A;  2QUF A;  2PP6 A;  2BY0 A;  3WTW C;  2DFF A;  3HRS A;  2B63 J;  1JCD A;  3O6Q A;  5E79 E;  1YIT P;  2XAU A;  1I36 A;  2AXT H;  1EVY A;  2P5L C;  3QOP A;  1T3J A;  4IXA A;  4UUS A;  4ZH4 F;  1U78 A;  5L3D A;  2C0W A;  1R4M B;  1B9M A;  1J1D C;  3B8E B;  1LTI C;  1J09 A;  2I9P A;  4XN0 A;  3HD7 B;  3DBH B;  4AIH A;  2EFN A;  2R7V A;  1GL2 C;  1NTK D;  3ERE D;  3BAT A;  2RNG A;  3CUQ C;  1VQ5 P;  1BM9 A;  2MC4 A;  2FQ3 A;  2FOK A;  3CPW O;  4MO7 A;  1X4O A;  1KB9 D;  3N7N A;  5C4X J;  3SZG A;  3ML6 A;  5DUI A;  3KP4 A;  3G71 P;  3H1L J;  1YIT I;  2XAH A;  1IUY A;  1V5F A;  2EK5 A;  1ZKG A;  3C9I A;  3W68 A;  3DV8 A;  5CQE A;  5FKN A;  4XNF A;  1LNW A;  5LGT A;  2IBZ D;  4G7H F;  2ZFC A;  1JO5 A;  3K1M A;  3E0J B;  2PGD A;  2D3T A;  2YKQ A;  2QGU A;  3ZMV A;  4EZB A;  4HH2 A;  1YQ4 C;  2O3F A;  3OBB A;  5BQT A;  1IF1 A;  1I27 A;  2HKO A;  4B3A A;  1S29 A;  4FTH A;  1GW3 A;  1AOY A;  3FIS A;  2IPQ X;  1JMM A;  3AL0 B;  3LW5 H;  3RL0 D;  2WT7 A;  5KHD A;  3T0Y A;  1L0N D;  3NFQ A;  5AW5 B;  3RK3 D;  1YG2 A;  2CJJ A;  3F9K A;  2LD5 A;  1GZL A;  3E7L A;  5FO5 A;  2P1J A;  2JSC A;  2QBY B;  1VPC A;  1U8B A;  4DJG A;  2DMU A;  3U59 A;  1WJC A;  2QQ9 A;  2QJP B;  3OYF A;  1IC8 A;  1ZAR A;  1PGN A;  4DYC A;  4DBQ A;  3G2B A;  2IRF G;  4CH7 A;  2GOM A;  2P8T A;  1PP7 U;  3HOX J;  2KS1 A;  3EQ2 A;  2GWR A;  1KYO E;  3MAJ A;  3Q9S A;  3Q1M A;  2RGV A;  1QX8 A;  4A3I J;  4U0Y A;  3CUQ B;  2JA6 J;  1KYO D;  2AEF A;  2Y0S N;  1IZN B;  3BG7 A;  1LWU C;  1S4X A;  2M45 A;  1RF0 C;  2DI3 A;  2QZ8 A;  1DUX C;  1R58 A;  3WTZ A;  1NG6 A;  3I56 I;  2WB1 N;  4R1N A;  2ZXI A;  4N78 E;  2MG4 A;  4WB4 A;  3V2N A;  3K4L A;  1TQM A;  1GK4 A;  3HC7 A;  5M5W J;  1N2D C;  3VN0 A;  1LTJ C;  1F9N A;  1YRN A;  3D6Y A;  1NU1 G;  3H0G J;  4QMA A;  3SZT A;  3H9G A;  5HNH A;  3S1R J;  4C2T A;  1X19 A;  4BEH A;  2DT6 A;  5FRN A;  3TNU B;  2A69 F;  3DKX A;  3FKJ A;  1RKT A;  4PJ0 C;  4P9U A;  2E1M C;  2P5K A;  3V2Q A;  3CCE I;  3MWM A;  1HKS A;  3BCC D;  2L3D A;  2KRC A;  1GVJ A;  2K40 A;  1OYY A;  2JT1 A;  3TO7 A;  5HS7 A;  3J81 Z;  1Z77 A;  5F04 A;  2ZYA A;  3K9T A;  2CQK A;  1UEL B;  2IBZ E;  4CSW A;  2FBH A;  3GTK J;  3NXS A;  2EBI A;  1NTC A;  3JTG A;  5KAI H;  1RF1 C;  4WXH A;  4LJZ F;  1NTK G;  1QU3 A;  1VQ9 I;  3JRF A;  2K4B A;  2Q0O A;  2ZKZ A;  3K4K A;  4XLP F;  2GXB A;  2IDB A;  1T38 A;  3OYE A;  3BJ6 A;  3GWZ A;  1IN8 A;  2V1X A;  1ZRC A;  4A3C J;  1ZHF A;  1RE3 C;  3I59 A;  1R00 A;  2MC3 A;  5KTB A;  3K1N A;  2ZME C;  2JSP A;  3EUH A;  3KP6 A;  2R93 J;  2E5T A;  2WPQ A;  3JAM K;  5E3M A;  4NC7 A;  2CUZ A;  5J8C A;  2AS5 F;  1Z7U A;  3PNT A;  1J7K A;  2D1V A;  4BDZ A;  3RDI A;  2KSJ A;  1FZC B;  1W1W E;  5DD8 A;  4RB3 C;  4N3Y B;  2DLL A;  1KQF B;  1RZ4 A;  1U57 A;  3L4F A;  1Y8R B;  1X1B A;  4CUG A;  3FBI B;  2R7T A;  2M8R A;  3B5N B;  4OIP F;  2Q9I A;  5FKK A;  2BOL A;  5H6Q A;  3H1J G;  1M2W A;  5D8L B;  3M1E A;  1IFI A;  3JRD A;  1VTN C;  2CV0 A;  1LPQ A;  4XQF A;  3GFM A;  3M07 A;  1BDC A;  4I02 A;  4BEH B;  4JX4 A;  2WSE J;  1VQ6 I;  2GXA A;  1Q81 Q;  1Q86 Q;  2HOS A;  3JCU C;  1DPR A;  2JA7 J;  2FFD B;  2JO1 A;  3GZN B;  3EDP A;  2E19 A;  5CLS A;  1PVE A;  4UUT A;  1ZRF A;  1CI6 B;  5AVZ B;  2P7C B;  4XLN F;  1V54 H;  5AVT B;  3ZW8 A;  4U3F E;  4DW6 A;  3OL3 A;  3AEE C;  2KZV A;  3FXL A;  4BQQ A;  3HRU A;  1HTL C;  4N4O B;  3K4C A;  1SQV D;  1OXZ A;  2F6C A;  1DLI A;  2XAQ A;  3TQN A;  4BE0 A;  2KB7 P;  3BZK A;  4XMY A;  1YS6 A;  5IPA A;  2E71 A;  3JTH A;  4S0H B;  1R8E A;  4AQR D;  5AIQ A;  3RYR A;  1N78 A;  4YFX F;  2ELK A;  1MFZ A;  2XF7 A;  3CUQ A;  1XCV A;  1J1E B;  3C1L A;  3O8Z A;  3ZWB A;  1SQX E;  4AYC A;  3DKW A;  2B9B A;  3PRJ A;  3DOJ A;  4D6T G;  4IJA A;  1M56 D;  1IGN A;  3C7A A;  3M8E A;  1EDI A;  4F7Z A;  1JY2 N;  2LF8 A;  1RE4 A;  3L00 A;  3H1H J;  3GXO A;  4G8X A;  2DFH A;  5A9S B;  3L36 A;  4FX4 A;  2CWE A;  1FIP A;  3HE5 B;  5DCF A;  1XPX A;  4KMF A;  1W2E A;  3O8G A;  1QVG O;  3CCM I;  2EWN A;  4YXD C;  2IVM A;  1OVV A;  3JAM Z;  3CQZ J;  2DK8 A;  2WZ7 A;  3OOP A;  4HX8 A;  1E5W A;  3WU2 C;  4UVB A;  2LXB A;  5B5E E;  4M3B A;  4E4H A;  4Y3O A;  1RE4 C;  2F2E A;  1O3R A;  3WHB A;  2KLV A;  1ZGJ A;  4GKG A;  4Q4Z F;  1IW7 F;  5EZH A;  2TCT A;  3L74 G;  2VT3 A;  1WPQ A;  4ENN A;  3L74 D;  3WUV A;  1ETO A;  3RK2 C;  3HOY J;  2HDH A;  1FU1 A;  4N6J A;  3WS7 A;  1OWA A;  1IDY A;  2HKX A;  5CKT A;  4IOA F;  2R7U A;  1R5L A;  2QIW A;  5L8R J;  1Z7L A;  3HZJ A;  3F22 A;  4XOT A;  4PSW A;  3L72 E;  3J7A O;  5FRM A;  1M1J C;  1E2X A;  3BRO A;  2EIL H;  2WV1 A;  3HDD A;  2OYO A;  4GOE A;  2EB7 A;  1KU2 A;  1X1P A;  3K7A J;  5AW0 B;  3U1C A;  1Z21 A;  4MHG A;  3DEU A;  4K2E A;  3L72 D;  4S05 A;  2KIM A;  5APV A;  3HKZ A;  4P96 A;  4RB2 C;  1EJ9 A;  1SAN A;  1UMQ A;  1XC5 A;  2A05 A;  2LY9 A;  2Y75 A;  2K88 A;  2UXN A;  4UXN A;  1CZQ A;  1NTM G;  2V7Q H;  4GDO A;  3O8H A;  4XLE A;  1ULY A;  3C7J A;  4HF2 A;  1G3S A;  5APW A;  1YJW P;  2Y9Z A;  3EQL F;  3DU5 A;  3RZO J;  1VQP P;  4RAY A;  1URQ A;  3L74 E;  1PUE E;  3MP7 B;  3P32 A;  3T1B A;  2DTR A;  2RAE A;  3MKZ A;  2H8R A;  1A02 J;  4UB8 C;  3HJE A;  2JQ7 A;  4OIR F;  3IQD B;  5IOY A;  4CXF A;  1YX3 A;  2E2H J;  4V19 K;  4ZNC A;  1TC3 C;  3TGU D;  4LG0 A;  3HOU J;  2C0X A;  2IGK A;  1FDO A;  5GTI E;  2XB0 X;  4RGX A;  3OYN A;  4DJA A;  1RUN A;  3RL0 C;  1SP4 A;  2K9J A;  2XGC A;  1IL0 A;  3SQN A;  1ZH5 A;  5CCG A;  2FYU K;  3KZI C;  3V7R A;  4CGZ A;  1LJ2 A;  2Y30 A;  2NVQ J;  3Q5R A;  3IAM 2;  3TO9 A;  1RES A;  1D8K A;  2EV6 A;  2RNJ A;  3SHF A;  4CO8 A;  2WWW A;  3LST A;  3OAK A;  2GLO A;  4RLF A;  5J4Y A;  3VFZ A;  2M3B A;  1HKQ A;  2VI6 A;  5KJ7 D;  2G8Y A;  1FDM A;  3R2P A;  4GOF A;  2VJ4 A;  1Z67 A;  3SSU A;  1FLI A;  2ELJ A;  4HLY A;  3E1S A;  3RZD J;  1SQX D;  5CYV A;  4GDF A;  3TGU G;  1A04 A;  1TWH J;  2UUZ A;  2XV4 S;  2HFH A;  1RHZ B;  4AYB N;  4NC8 A;  2DOF A;  3Q9V A;  2GIZ A;  2D45 A;  2HPC B;  4ZZL A;  1FSE A;  4J01 A;  4KIF A;  1VQ5 I;  2HEO A;  3H32 B;  4LLH A;  3ABK H;  5JLX A;  4YFN F;  2CMP A;  1KIL C;  2KLU A;  2Z16 A;  1K6Y A;  2O03 A;  2Z3Y A;  4IZZ A;  5C4J J;  4IHS A;  1JOC A;  1QGK B;  4JQ0 D;  3RKW A;  1VQ8 I;  3JSV C;  1ZGW A;  1MZ9 A;  1FT9 A;  2K3F A;  3MGN A;  3OJA B;  3DKY A;  1H8A A;  5J4V A;  3QAH A;  1MNM C;  3WGH A;  1HGZ A;  2VBY A;  4GRI A;  5HLG A;  1ZG5 A;  1CF7 A;  1KGS A;  3CCR I;  3F8B A;  1SQB K;  4TT3 H;  3ABV C;  4LMY A;  2DTZ A;  2FEZ A;  5DD4 A;  2XRO A;  2E36 A;  5CCG C;  2E76 B;  3II6 A;  1UJ8 A;  2VKV A;  3RJP A;  3H36 A;  2WSF J;  1S72 I;  4GWG A;  1WJA A;  4AU7 A;  3BR3 A;  4KYW A;  1U7M A;  4H13 C;  3EYI A;  3HN2 A;  1MND A;  1NG7 A;  1URQ D;  1MBK A;  4DYR A;  2EV0 A;  3FXM A;  1REP C;  2KHM A;  1G3T A;  2PAJ A;  2EW2 A;  4A3E J;  5AON A;  3EPZ A;  3I4N J;  5AW1 B;  4WWC A;  3J81 K;  4EM2 A;  2AXT E;  3OS1 A;  5ICG A;  4OIO F;  4ZMD A;  3TSI A;  2W85 A;  1D1A A;  1KIL B;  3AEC C;  3WOD F;  3KX2 A;  3RQS A;  3L70 G;  3FXR A;  5EEG A;  1R71 A;  1W36 D;  3AG2 H;  3VMZ A;  3QU6 A;  3M0D A;  1HXD A;  3QP5 A;  4D3S A;  1ZLJ A;  4UUS B;  1N8R Q;  3OS2 A;  3WU2 E;  1VQ9 P;  3I5C A;  1M7L A;  3A4C A;  3BCC E;  3GCM A;  4PJ0 H;  4EIJ A;  4O6J A;  3O6Q B;  4M3F A;  2NPS B;  5KKZ B;  1TT0 A;  3HYI A;  4R4L A;  2TDX A;  2RC4 A;  3E1I A;  3N05 A;  2JZY A;  3E5Q A;  4OQY A;  2Q3I A;  2WAQ N;  2LLK A;  3IH4 A;  3A02 A;  2HPM A;  1G2C B;  2Y0S A;  3V8L A;  4F52 A;  1W4M A;  3HOV J;  1T98 A;  2WTE A;  2BEQ D;  3FXK A;  5GPC A;  3L75 G;  5HNF A;  4A6E A;  4I98 B;  2V6E A;  1K04 A;  1IRF A;  3KIO A;  2WTY A;  4N78 D;  1ZOY C;  2XPU A;  3CCJ I;  2YSR A;  1DP7 P;  1EDL A;  2JP3 A;  4OIN F;  2GIV A;  1SQV K;  1S5L H;  3V6I A;  1LVA A;  4U0W A;  3JSP A;  3S1K A;  4L9T A;  4WY4 B;  2QJY B;  3FXQ A;  1FZA A;  5FLV A;  4RM2 A;  2VON A;  2HYN A;  2OQQ A;  3Q0W A;  1ETQ A;  1OCC H;  2IA0 A;  2M7A A;  3Q0U A;  3IAS 2;  5M3M J;  3WTV C;  3C7C B;  1LT9 C;  1OCO H;  2HG5 D;  3SFD C;  1JUN A;  1L4A A;  1EA3 A;  2OD5 A;  3QPH A;  2LH9 A;  4II3 A;  2O01 J;  1J5Y A;  4N0B A;  3RPU D;  2KZJ A;  1T3U A;  4ENJ A;  4MEY F;  4FAS D;  4M3E A;  2Y9Y A;  1NU1 K;  1S5L C;  1DPU A;  3A0H C;  3U1D A;  1ETY A;  1WPK A;  2DAO A;  2QQ8 A;  3LFK A;  3VYR B;  1LJ9 A;  1OX3 A;  3VMA A;  3I55 P;  4HF0 A;  1JKR C;  3GTG J;  3DXJ F;  4JX6 A;  1ETK A;  1D1C A;  1PUF A;  3CD6 I;  3L1P A;  3WGG A;  3RK3 E;  1L0N E;  4BQO A;  2GXG A;  1LE8 A;  4EVI A;  2WWY A;  1HA8 A;  1RF1 B;  4PJJ A;  4I0B A;  5J3L A;  5GTI C;  3DEE A;  3CTV A;  1YYV A;  1NTK K;  2OGU A;  3LA2 A;  1XSD A;  4BE1 A;  3RSN A;  4OMZ A;  4RA2 A;  1BBY A;  1GL2 D;  3ROU A;  2L5G B;  1VQN I;  1PPJ G;  3G4S I;  5TJH A;  3TL4 X;  2KIU A;  2YO3 A;  1CF7 B;  5L3F A;  2W48 A;  2KZG A;  4UUV A;  4PGG A;  5E1W A;  1X4P A;  5AW3 B;  1YJQ A;  3FHZ A;  5EF6 A;  1UCR A;  3BWG A;  2AQE A;  3MFK A;  1SQV J;  2IZ1 A;  2DW3 A;  1ORK A;  1KB9 E;  3JC2 2;  2DJN A;  2VPR A;  5APY A;  5EYR A;  2N1T B;  2A6H F;  1MJA A;  3H5A A;  3DF8 A;  2YNY A;  4ETS A;  4Y99 C;  3D71 A;  3DQV C;  4AVP A;  1KS9 A;  2QF7 A;  1MMN A;  3E5X A;  3CCS I;  1NTK E;  3E6M A;  1WJD A;  2ZO4 A;  2BVM A;  3DP7 A;  3PSF A;  2WC2 A;  4XE5 B;  1LKX A;  4BBR J;  1N7S B;  2E60 A;  4GCV A;  3OOU A;  2Q6Q A;  4DZJ A;  3F72 A;  1QNT A;  3CJR B;  1NOH A;  4P9F A;  3RGU A;  1I5Z A;  3IRR A;  2HQA A;  3G6E I;  2GQQ A;  5GPA A;  4XLC A;  4GIF A;  3VSK A;  1OR7 C;  5ERI A;  1M67 A;  1QMG A;  1J75 A;  2PMZ N;  5TJJ A;  5ILV A;  4BDY A;  4CIC A;  3ZWA A;  2KZI A;  2ZT9 D;  3PLN A;  4AYB A;  2WY7 Q;  4U88 A;  1BE3 J;  1KQL A;  1R1U A;  2ZXJ A;  3QOE A;  2HDC A;  2IXS A;  3AEF C;  5KAF E;  3A0H H;  4C46 A;  3B6C A;  1ZN5 A;  1P4X A;  4BJT A;  1F43 A;  3TBI A;  4Y15 A;  2OV7 A;  1ZRE A;  1SVF A;  2NZ2 A;  3L75 E;  2H7H A;  1J0R A;  2BGC A;  3FM3 A;  2LYC A;  5KLV J;  2P67 A;  2D5V A;  4FHT A;  1MH3 A;  5E8G A;  1NTM J;  5BVZ A;  3TF5 A;  1QEX A;  2X48 A;  1HGV A;  4ENK A;  1LTS C;  4BXL A;  1P6R A;  1H9G A;  4AIK A;  1Q2N A;  2HQN A;  2DDB A;  2P6S A;  3QYE A;  1PP9 G; 
#chains in the Genus database with same CATH homology
 1WP4 A;  5J1Y A;  2XSD C;  1F36 A;  1IUF A;  2X6O A;  5F08 A;  3TED A;  1OJL A;  2R7Z J;  1MH4 A;  1SFO J;  1PGQ A;  2DA3 A;  3GHY A;  2E2J J;  4EEF G;  5C3E J;  3NAU A;  5BNG A;  4ABZ A;  1ITY A;  3ULK A;  5DTD A;  3WFI A;  1MSF C;  1XS9 A;  1JKQ C;  3K6J A;  3OIO A;  1BA5 A;  1S7E A;  3FWN A;  2B63 J;  1Y1V J;  1ZK8 A;  1FEX A;  3F0C A;  3HGG A;  1EVY A;  1I36 A;  1LSJ A;  4A3B J;  2JN6 A;  3TP0 A;  4UUS A;  2MGQ A;  1U78 A;  2HOA A;  3FIW A;  4DYD A;  2I9P A;  3H3V K;  1FTT A;  2GBY A;  1OCP A;  5GP9 A;  1T33 A;  3Q3S A;  3MOG A;  1JKP C;  4D7M A;  4A3G J;  4B3I A;  2XGD A;  3JRH A;  4KUE A;  1D5Y A;  4GFB A;  4S3M A;  2R5Y A;  4MO7 A;  4D5F A;  3BG3 A;  1QVT A;  5C4X J;  1MBH A;  2WTB A;  1X58 A;  1AHD P;  2ECC A;  2L9R A;  1MBF A;  1QVU A;  1ZKG A;  2TRT A;  1YRN B;  1GVD A;  2K9N A;  5FKN A;  5IYB J;  3Q3C A;  1IJW C;  1B8I A;  1MBJ A;  2PGD A;  4E21 A;  2L7F P;  2D3T A;  2QYT A;  4EZB A;  5FKO A;  3BTI A;  3OBB A;  1ETX A;  4B3A A;  4FTH A;  5HWS A;  3DCF A;  4D7N A;  1B72 A;  5EG0 A;  3FIS A;  3UKG A;  4PZE A;  3ZQF A;  3ZHB A;  4MFD A;  3MVP A;  2CJJ A;  2LD5 A;  1NK3 P;  2L0K A;  3E7L A;  2DA1 A;  2ID6 A;  1U8B A;  1G2H A;  2DMU A;  4C2M J;  2R5Z A;  1IC8 A;  3MKL A;  3BG5 A;  1PGN A;  4DYC A;  4C3J J;  2QCO A;  4B3J A;  3M3Y J;  3ZQI A;  1WGX A;  2R5Z B;  1IRZ A;  3F3S A;  2R92 J;  3HOX J;  1YRL A;  3DEW A;  4QSH A;  3W6V A;  5E3N A;  3HB9 A;  4D5C A;  4A3I J;  2YU9 J;  3WHC A;  1ZTR A;  2JA6 J;  3HAD A;  1JT6 A;  3C2B A;  3LNQ A;  5EG0 B;  2Y0S N;  3TW6 A;  2EZL A;  2Y2Z A;  4X6A J;  4B4C A;  1LJ8 A;  2CUF A;  2WB1 N;  4R1N A;  3LSJ A;  2DMT A;  4HNV A;  2MG4 A;  4JX5 A;  4IHY A;  5M5W J;  5K7F A;  3FR7 A;  1YRN A;  3BR6 A;  4BXX J;  1OFC X;  1FJL A;  1K83 J;  3PEF A;  3H0G J;  4OM8 A;  2W8Z A;  3S1R J;  3BTC A;  3G1L A;  1WH5 A;  1H8A C;  1RKT A;  2ZYG A;  1CQT A;  3SFI A;  5MGB A;  1M66 A;  2GM4 A;  2K40 A;  2IAI A;  2ECB A;  3VPR A;  3JRA A;  3S1Q J;  1Z77 A;  3BG9 A;  5F04 A;  2HDD A;  2OPT A;  1PGJ A;  2ZYA A;  2ZYD A;  4CYC B;  1P7I A;  3LSG A;  4Y7N J;  3GTK J;  1LFU P;  2EBI A;  2H1K A;  3G1O A;  3GTL J;  1NTC A;  3BQY A;  3JRF A;  4LOC A;  2DA5 A;  3A03 A;  1H89 C;  1GT0 C;  2JK3 A;  2KT0 A;  4A3C J;  3A01 B;  5C44 J;  2IYO A;  1BW6 A;  4MIM A;  1VND A;  2R93 J;  3ZQH A;  1WDM A;  1ETV A;  2DMP A;  5E3M A;  3HGY A;  1BL0 A;  5IYD J;  3EGO A;  1UG2 A;  2HXO A;  1TXG A;  4RBO A;  2COB A;  2M34 A;  3JRG A;  1WCM J;  3PO2 J;  1HDP A;  3W6Z A;  3H2Z A;  4CYC A;  5M5Y J;  5IYC J;  5FKK A;  1M75 A;  2CU7 A;  1I6H J;  1M2W A;  4DCK A;  3CMY A;  1ETW A;  4I76 A;  3JRD A;  1IDZ A;  4BBS J;  1JJ6 C;  3JRB A;  4JX4 A;  1P7J A;  3WFJ A;  2HOS A;  3ZQG A;  4IHV A;  2JA7 J;  1PGO A;  4BY1 J;  2E19 A;  2N8G A;  4UUT A;  1H88 C;  5FKL A;  2JWT A;  4XK4 A;  3ZW8 A;  4DW6 A;  1VPD A;  3BR2 A;  4RDU A;  3I83 A;  5M5X J;  2K9S A;  1JKO C;  1DLI A;  1TWA J;  1ENH A;  3BQZ A;  5IPA A;  5IP7 J;  1Q1V A;  5F0C A;  1ZCJ A;  4S0H B;  3HWR A;  2AO9 A;  2ELK A;  1DU0 A;  3L6D A;  1RPW A;  3ZWB A;  4MLO A;  4XRS G;  3DOJ A;  1B72 B;  5J1U A;  1IGN A;  3C7A A;  2HI3 A;  3HKZ N;  1I3Q J;  5A9S B;  3SDG A;  4W1U A;  1FIP A;  1B8I B;  3M4O J;  3O8G A;  5E3O A;  1YB4 A;  1JJ8 C;  1F0Y A;  3CQZ J;  1T56 A;  2EH3 A;  1BJZ A;  3ZQC A;  4M3B A;  3OSF A;  4M6V A;  5EZG A;  4JP0 A;  4A3K J;  1GV2 A;  1VF9 A;  1M76 A;  5FLM J;  2Y31 A;  2EZH A;  3WHB A;  4QTR A;  4IEJ A;  2E1O A;  2ID3 A;  5EZH A;  2TCT A;  2NVT J;  1WPQ A;  3GTO J;  4D3D A;  5E3L A;  4M3D A;  1ETO A;  2HYJ A;  2NVX J;  2DA4 A;  3HOY J;  2X9D A;  2HDH A;  3FKI J;  1TWF J;  3WS7 A;  1PGP A;  2JA8 J;  1NK2 P;  1IDY A;  2G0E A;  2YS9 A;  3FR8 A;  4OQZ A;  4GWK A;  3BTJ A;  2I10 A;  1LE8 B;  9ANT A;  1MSE C;  1YON A;  3BTL A;  2ME6 A;  5EGO A;  4IHW A;  1PUF B;  4OL9 A;  3HDD A;  2WV1 A;  1POG A;  3K7A J;  1XG1 A;  3HEF A;  3S17 J;  3A01 A;  2IBD A;  5J1R A;  1X2N A;  2DA7 A;  1MBE A;  4AUX A;  5EEA A;  2LVS A;  3K96 A;  1SAN A;  1UMQ A;  1XC5 A;  2LY9 A;  5F1J A;  4KUG A;  2JJ7 A;  3NAR A;  3O8H A;  4FCY A;  5FWN A;  3GTP J;  2Y9Z A;  1WI3 A;  2FQ4 A;  3SJM A;  1ZR2 A;  2FD5 A;  2ZB9 A;  3RZO J;  2UYY A;  3QHA A;  4DZP A;  2RAE A;  3CCY A;  2H8R A;  2AHQ A;  1HDD C;  2L7M P;  2XPW A;  3IQD B;  4BKX A;  5IOY A;  2E2H J;  5EGO B;  1TC3 C;  5K7H A;  4FIS A;  3HOU J;  2XB0 X;  3W6U A;  3PO3 J;  2M0C A;  2XGC A;  1IL0 A;  2VUM J;  3JRC A;  1TWG J;  4A3J J;  1Z0X A;  2HOT A;  2Y30 A;  2NVQ J;  4E13 A;  1U9N A;  1RES A;  5F0F A;  3BT9 A;  1JTY A;  2GLO A;  1UHS A;  1F14 A;  1YVE I;  3GTQ J;  2VI6 A;  3ZW9 A;  2CQX A;  1EF4 A;  3RZD J;  2K9Q A;  5JLW A;  1TWH J;  1HCR A;  3HDH A;  3CDL A;  1RKW A;  2CRG A;  2EQR A;  4AC0 A;  4AYB N;  3PLR A;  1AKH B;  2LTP A;  2XRL A;  3Q0V A;  3JRE A;  2E2I J;  5M3F J;  3LSP A;  3ZQL A;  3S2D J;  1O4X A;  4A69 C;  3S2H J;  4JPZ B;  1YJ8 A;  3TW7 A;  3I4M J;  2O9L A;  5JLX A;  1F12 A;  1N1G A;  5C4J J;  4JQ0 D;  3HOZ J;  1ZGW A;  3D1N I;  1R9T J;  4DLL A;  4G12 A;  1MNM C;  2IEK A;  3G17 A;  4PZD A;  1BG6 A;  3S1N J;  2LK2 A;  2XB5 A;  2DN0 A;  2DTZ A;  4V2G A;  5DS9 A;  5F0H A;  2VKV A;  4QIW N;  5IP9 J;  1X0X A;  4GWG A;  3BR3 A;  2O8K A;  4MFE A;  5FJ8 J;  3HN2 A;  2DMN A;  3HBL A;  4V2F A;  1K61 A;  1MBK A;  4M3G A;  4DYR A;  3JR9 A;  1APL C;  4E12 A;  2EW2 A;  4A3E J;  3B6A A;  3ADP A;  3ZWC A;  1BW5 A;  3I4N J;  3ADO A;  2R5Y B;  4A3L J;  1OCT C;  2JKV A;  1JUM A;  2CUE A;  1JDJ A;  2IYP A;  3QSG A;  4BY7 J;  1W0U A;  4A3D J;  5A9T A;  3RQS A;  5IP6 A;  2NS8 A;  3GBG A;  1N1E A;  3ZOB A;  1TWC J;  4XID A;  3IH2 A;  3RKQ A;  2HQ5 A;  4J0F A;  4D3S A;  4UUS B;  1DLJ A;  1HLV A;  2NS7 A;  5JE8 A;  3FK7 A;  1LFB A;  4M3F A;  2MSY A;  3QPS A;  4OQY A;  1I50 J;  2WAQ N;  2LLK A;  3IH4 A;  3A02 A;  4XRS A;  1FIA A;  3S14 J;  3HOV J;  2W90 A;  5GPC A;  3GTJ J;  1IG7 A;  2O7O A;  1Y1W J;  1JTX A;  2PLA A;  2XPU A;  2LP0 A;  3MN2 A;  3JRI A;  4DYQ A;  4J19 A;  3BR0 A;  1JT0 A;  2ME0 A;  4Y52 J;  4PZC A;  5FLV A;  2CVZ A;  3PDU A;  3Q0W A;  1ETQ A;  5M3M J;  3C7C B;  3Q0U A;  1QRY A;  2X58 A;  5F27 A;  4B3H A;  1A6I A;  1HOM A;  1U9O A;  2L7Z A;  3C7D B;  4D3F A;  4C3H J;  3K2A A;  5AYV A;  1GV5 A;  4GBJ A;  4M3E A;  2Y9Y A;  2LR8 A;  2OF7 A;  1ETY A;  1WPK A;  2CQQ A;  3DFU A;  3ZGY A;  2R0Q C;  2VKE A;  4JYK A;  5IOZ A;  1JKR C;  3GTG J;  3BR5 A;  2EZK A;  4I6Z A;  1RR7 A;  2JMW A;  3LOC A;  2KDZ A;  1RET A;  2GF2 A;  4JX6 A;  1ETK A;  1PUF A;  4C3I J;  3L1P A;  4A93 J;  1LE8 A;  2MW8 A;  1WDK A;  2YUS A;  4W97 A;  5J3L A;  5HOD A;  3CTV A;  4IM7 A;  2P4Q A;  3PID A;  4XRM A;  3BR1 A;  3HM5 A;  5A9S A;  2OFP A;  1VFC A;  1HF0 A;  4A3M J;  2NVY J;  2XGE A;  2W48 A;  4FE4 A;  1A5J A;  1WH7 A;  1JUP A;  4X1E A;  3G0O A;  3LSR A;  4FGW A;  1AU7 A;  5K7Z A;  5A9R A;  1YJQ A;  3S16 J;  2P81 A;  5EF6 A;  2XPV A;  2IZ1 A;  3G1M A;  1ORK A;  1X2M A;  2M8G X;  3QPL A;  3CKY A;  2DJN A;  2VPR A;  1JUS A;  1EVZ A;  1X0V A;  5EYR A;  2HXI A;  1DU6 A;  5EDN A;  4J0E A;  4B1R A;  1KS9 A;  2QF7 A;  2NOG A;  1JGG A;  1MBG A;  2M2E A;  1F17 A;  4OVN F;  4BBR J;  3OOU A;  4DZJ A;  2JA5 J;  3IV5 A;  4L5E A;  1ZR4 A;  5FKM A;  4IHX A;  3RQI A;  5GPA A;  1QPI A;  3TP3 A;  2DA6 A;  1FTZ A;  1VI0 A;  2LKX A;  2LFB A;  1M67 A;  1QMG A;  4KUH A;  2PMZ N;  4FE7 A;  4NDL A;  1ZQ3 P;  4YCA A;  3ZWA A;  2M9H A;  3OSG A;  1WDL A;  3S1M J;  2FJ1 A;  3FK6 A;  1LSO A;  1IV6 A;  1Z82 A;  1E3O C;  2FX0 A;  3B6C A;  1AKH A;  3S15 J;  1F43 A;  4XIC A;  2IZ0 A;  3PM1 A;  3HOW J;  2D5V A;  2EZI A;  2DA2 A;  3GTM J;  3QQA A;  4A3F J;  1MH3 A;  2X48 A;  2DMQ A;  3PJG A;  1GDT A;  3IH3 A;  1GUU A;  1W0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...