1OFCX

Nucleosome recognition module of iswi atpase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
266
Chain Sequence
AVDAYFREALKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERENIELEEKERAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure and Functional Analysis of a Nucleosome Recognition Module of the Remodeling Factor Iswi
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
molecule keywords ISWI PROTEIN
total genus 103
structure length 266
sequence length 281
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09110 HAND HAND
X PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1ofcX01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 1ofcX03
4IHWA 1ETYA 4C2MJ 5M5YJ 5K7ZA 1A6IA 5M3FJ 1MSEC 5EYRA 3LOCA 1FEXA 4B4CA 5K7FA 2CJJA 1VF9A 2CUFA 4XK4A 3ZQGA 1MSFC 1UHSA 1K61A 4BY1J 1TWFJ 4M6VA 4QSHA 2GBYA 3BR0A 2DA5A 1JKPC 2LK2A 2LP0A 5F27A 5EF6A 4A3IJ 2P81A 3MN2A 1F36A 3HOWJ 1NK2P 4M3BA 1GDTA 5DS9A 2DA7A 4DYCA 4DCKA 2MSYA 1AHDP 5EGOA 3Q0WA 3GTPJ 2I10A 4A3CJ 4XRMA 3TW7A 1BJZA 4A3DJ 2DA6A 4FE7A 4W1UA 2DMNA 1JKRC 2LFBA 2X6OA 1SFOJ 2KDZA 3G1OA 4A3MJ 3OSGA 1U8BA 1IRZA 2AHQA 2ME6A 5GP9A 1GUUA 1WI3A 4QTRA 1GV2A 1W0UA 5M5XJ 3HM5A 2CU7A 2DMUA 3NAUA 4I76A 2YUSA 1ZK8A 2JA7J 2TCTA 4IHXA 3HGGA 4AUXA 1U9OA 1GT0C 3MVPA 1LFUP 3A01B 3CDLA 2XRLA 3BR3A 2L7MP 3JRDA 4CYCA 1VNDA 4MLOA 3RKQA 1JJ6C 2JA5J 3TW6A 2ID6A 1APLC 4BBSJ 2JN6A 1XG1A 5EEAA 1JJ8C 1X2MA 1JT0A 3LSJA 2NVYJ 3DCFA 3F0CA 1FIPA 4JQ0D 1RR7A 2NVTJ 2EZLA 1XS9A 2E2IJ 3OSFA 1FTZA 2E19A 2H1KA 2VPRA 1IDYA 2DA3A 3B6AA 5FJ8J 2L0KA 3ZQLA 3HBLA 2H8RA 2PMZN 4I6ZA 1NK3P 2DA1A 1IUFA 4J19A 4IHYA 2CQQA 4UUSA 2ME0A 4X1EA 5J3LA 1ETQA 3HB9A 1WH7A 5GPCA 1JT6A 5EG0B 3W6VA 3ZQIA 2HOSA 2M2EA 1MNMC 1X2NA 2R0QC 4A3LJ 3M4OJ 4JX5A 3S17J 1QVUA 4Y7NJ 2K9SA 2NS7A 2QF7A 3QPLA 2XGCA 1X58A 5E3LA 4AC0A 4IHVA 1ETXA 5F0CA 5JLWA 4JX6A 1MBKA 1IC8A 5HODA 5EG0A 2ECBA 4M3GA 2JJ7A 1UG2A 4LOCA 3E7LA 2OPTA 3IH2A 5F0FA 4D5CA 1W0TA 3JRAA 2CQXA 1MH3A 2YU9J 3JRBA 3BR1A 4C3IJ 3TEDA 3S2HJ 2N8GA 3HGYA 1SANA 2HXOA 1QPIA 4M3FA 2VUMJ 1UMQA 3LNQA 1FJLA 2L9RA 4C3HJ 4B3AA 3D1NI 4XIDA 4BY7J 1ETVA 1ZQ3P 1IGNA 1AKHB 3BQYA 2DA4A 3OOUA 3LSPA 4RBOA 2B63J 3BTLA 1QRYA 2XPVA 2D5VA 3GTOJ 1WCMJ 4BXXJ 1FIAA 2K9QA 1K83J 5GPAA 4OVNF 2DJNA 2YS9A 2ZB9A 4A3BJ 4L5EA 1OCPA 1U9NA 1I6HJ 2M9HA 1IJWC 2HDDA 1ENHA 3S1MJ 3CCYA 2IBDA 4A69C 4HNVA 1T56A 3G1MA 5FKNA 1TWAJ 3CMYA 4AYBN 1ZGWA 2G0EA 4A93J 1EF4A 1GV5A 5IYBJ 1TWGJ 5IP9J 1MH4A 1MBJA 2O9LA 2CUEA 2M34A 1OFCX 3IH3A 1B72A 4XICA 1B8IA 2L7FP 4M3DA 3FISA 1WPKA 1QVTA 5EZGA 3SJMA 5IOYA 1TWHJ 1MBFA 2XPUA 3GTKJ 2R7ZJ 5IOZA 3PM1A 3RQIA 3WHBA 4XRSA 3BTCA 5F04A 2GLOA 3H0GJ 1R9TJ 2HXIA 5F1JA 2LKXA 4CYCB 2IAIA 1BW6A 4V2GA 3S1NJ 5FLVA 2IEKA 3BR2A 5FKOA 3WHCA 3RZOJ 3JRFA 1HDDC 1ETOA 3GTJJ 4X6AJ 1OCTC 4MIMA 2HI3A 3JRCA 2XPWA 2JMWA 5E3NA 1IV6A 3I4MJ 5F08A 1ORKA 1P7IA 3MKLA 1PUFB 1P7JA 2VKEA 4EEFG 2LR8A 1MBGA 3LSGA 4NDLA 3GTQJ 4FE4A 3HOZJ 2EQRA 3FKIJ 2M8GX 1O4XA 3C2BA 5EZHA 1JKOC 1BW5A 4D7MA 2K9NA 4G12A 5C4JJ 4Y52J 1VFCA 2E1OA 3S2DJ 2MW8A 3BR5A 1Q1VA 3GTLJ 5F0HA 1ETWA 3IH4A 5FKLA 2ECCA 5FKMA 3GTGJ 2EZKA 3TP3A 1WGXA 2MGQA 3JREA 1PUFA 2R93J 2R5ZB 5FLMJ 1Z0XA 3Q3SA 3HOXJ 1U78A 2COBA 5JLXA 5IP7J 1IG7A 3SDGA 1RESA 1ZKGA 3L1PA 3A02A 2DMQA 4B1RA 3S1RJ 3RZDJ 2R92J 1YRNB 5IPAA 1XC5A 1YRNA 3PO2J 1JUSA 2HQ5A 3BG5A 3K7AJ 4FCYA 5DTDA 1IDZA 1DU6A 2MG4A 4DYRA 3FIWA 2NS8A 2L7ZA 4A3FJ 2W48A 5FKKA 2X48A 1ITYA 4DZPA 3I4NJ 3CQZJ 2XB0X 2FX0A 3FK6A 3GTMJ 1H89C 5J1RA 2R5YA 3BTIA 3NARA 1Y1WJ 3UKGA 3B6CA 1VI0A 1POGA 3FK7A 2M0CA 3Q0UA 5IYCJ 3JRIA 1HF0A 1F43A 5M5WJ 2EZHA 1MBHA 2JWTA 5J1YA 5EDNA 1TC3C 3PO3J 2Y30A 3HOYJ 1D5YA 3JRHA 2OF7A 1S7EA 5E3MA 2O7OA 1GVDA 1BL0A 2DMTA 2Y9YA 1A5JA 2VI6A 2K40A 4DZJA 1H8AC 3O8HA 3LSRA 2HYJA 1I50J 3G1LA 4JYKA 1H88C 4GFBA 3BR6A 3VPRA 1NTCA 4JPZB 2EH3A 2CRGA 5C4XJ 2EBIA 4ABZA 5BNGA 4XRSG 3H3VK 2EZIA 5M3MJ 3QPSA 2DA2A 5EGOB 1ZR4A 1WH5A 4IEJA 2FD5A 5E3OA 4D7NA 2WAQN 5K7HA 2WB1N 1JGGA 3A03A 1AKHA 2TRTA 3GBGA 4C3JJ 5IYDJ 4S0HB 2ID3A 4D5FA 1ETKA 1LFBA 4A3JJ 1JTYA 2LY9A 2ELKA 2R5ZA 1JUPA 1RPWA 2KT0A 3ZQHA 2HOTA 3HEFA 2E2HJ 3S14J 5J1UA 3SFIA 2LTPA 2JK3A 3S15J 3K2AA 4DW6A 1T33A 3A01A 1HCRA 1HDPA 3HDDA 2XGDA 1BA5A 1FTTA 3Q0VA 3BG3A 2GM4A 1CQTA 9ANTA 1TWCJ 2Y31A 3S16J 4BBRJ 1RKTA 3IV5A 1JTXA 2JA6J 5C3EJ 3BTJA 3ZQFA 1B72B 4DYQA 2LD5A 2RAEA 5C44J 1B8IB 1DU0A 1HLVA 2NOGA 4M3EA 4A3EJ 2NVQJ 3M3YJ 1G2HA 4MFEA 2O8KA 4FTHA 2XSDC 2JA8J 2E2JJ 4A3KJ 4BKXA 2HOAA 4MFDA 2DN0A 2X9DA 4FISA 1RETA 3HOVJ 3ZOBA 2DTZA 4JP0A 2WV1A 3S1QJ 2NVXJ 3DEWA 3QQAA 4JX4A 2AO9A 1AU7A 1ZTRA 4A3GJ 1MBEA 3HKZN 3O8GA 4W97A 4QIWN 4UUSB 4RDUA 2R5YB 3HOUJ 2Y2ZA 3BT9A 2Y0SN 3JR9A 1Y1VJ 3ZQCA 1ZR2A 1Z77A 1I3QJ 5IP6A 2Y9ZA 2LLKA 1LE8B 3BG9A 1LE8A 2FQ4A 1E3OC 3TP0A 2XB5A 1JKQC 2QCOA 4V2FA 2XGEA 2FJ1A 3OIOA 1JUMA 1HOMA 2DMPA 2VKVA 1RKWA 2LVSA 3JRGA 1OJLA 4UUTA 3BQZA 4MO7A
chains in the Genus database with same CATH superfamily
3SDBA 4L5JA 4I02A 4A0YA 1IAWA 1OR7A 1U57A 1SQBK 1M2WA 1A6IA 1UELB 4HDVA 3FMQA 1FBQA 1OYIA 1WZ2A 3LAPA 2VONA 3SWYA 5EYRA 1XSDA 1R5HA 3CO6C 4C9YA 1KYZA 4XK4A 1CSBA 4I09A 4N0BA 3QOEA 3HUGA 4II2A 5ICEA 3JTHA 1AA7A 1YFHA 3CCVI 4BY1J 4M6VA 5CCGA 1R7JA 1LUJB 2GBYA 1X1PA 1GZLA 1L0LE 3HKZA 1SC7A 1N25A 1SD4A 1FBSA 4CCKA 2E5NA 3BR0A 1I6XA 1V5EA 1JKPC 1P4XA 4KMFA 2IPPA 1YVEI 1MW7A 2FNAA 2LP0A 5F27A 4A3IJ 2E76C 5DV5A 5DYMA 5JFRA 1YO5C 5IY5H 4KJZA 2BXYA 3PLRA 1M67A 1GU5A 4KT6A 1QZZA 4NC7A 4WWIA 2MSYA 1BR2A 1JXSA 4XOPA 4XNFA 1L0LD 1TT5B 3TW7A 2WSEH 1BJAA 2K9YA 3A7OA 5K1YA 1BG6A 5AW5B 3KZZA 1JKRC 2K5CA 4IVNA 1DD3A 3K70C 2HKOA 1HC8A 3OIPA 3TOBA 1PYVA 3MGNA 1IJDB 3ZP5A 4HZFA 1OX3A 1T0FA 3U21A 4LGDE 5LRSA 4JQFA 3H3UA 4HOBA 4GWKA 4U87A 2YKPA 1N2DC 2DYRH 3OIQA 4QPOA 3WTYC 3P8MC 3RL0C 1DUXC 2A5WA 2Q3EA 4I76A 3RYRA 1DLIA 2WT7B 4U3FJ 3PL8A 3HN2A 3GCMA 2CPBA 2HGCA 1HJ0A 1Z21A 2BHYA 2E35A 1M57D 1N7SD 1LFUP 2QM3A 2Z16A 1MDMA 3H6PA 5MGBA 3A01B 2P4WA 3CDLA 1FWZA 1Z82A 2RN0A 1ZLLA 1LNQA 2FYUG 3BR3A 4GO1A 2CK3H 4KIGA 2ZMEB 1Z6TA 3KEYA 3LW5H 1WJEA 3HPHA 2Y48A 1BE3J 4D3SA 1KU3A 1S7AA 4HF1A 2M3BA 3CCEI 3T0YA 3MD2A 4HRIA 1K04A 4BBSJ 3A0HH 1FY7A 2JN6A 3FHNA 1XG1A 5DUKA 4IXAA 3FM3A 3RCOA 2HVRA 2WSFJ 3PSFA 1N8RQ 2XKPA 2ZJQF 2NRAC 3DCFA 2B9SA 1FIPA 1GLNA 2EZLA 5CVIA 2IVMA 1YX5A 4HG2A 1YIOA 4NQWB 1VZ0A 3CCUI 3OSFA 1FTZA 2FY8A 2KDOA 1YYVA 3ABTA 4GYGA 1KB9H 1YQ4C 2RH0A 2VXDA 2DA3A 5KAIE 3B6AA 3MKYB 4ZYAA 2IS4A 4H44D 4E6KG 5FJ8J 4PJ0E 1FZPB 2KISA 3ZQLA 3RIRA 3TGUD 2PMZN 1PFIA 5E8IA 4OINF 3MUDA 4IHYA 5B66H 2EB7A 2E1MB 5AVYB 5K5RA 4F91B 3PUFA 1J0RA 3H1LD 2KKOA 4X1EA 2XV4S 3Q1MA 1Y8RB 1QA6A 3EQ2A 1JT6A 5EG0B 4E7KA 5KVRA 3MIWA 4S04A 2WITA 3AE7C 3LA7A 2VLAA 3OOPA 3E6DA 3AAFA 1EV7A 3AG3H 3HRUA 2FYNC 1Y8QB 4XLCA 4HQMA 2R7OA 2F4MB 3MZ8A 4JX5A 4BU2A 3N97A 3M4OJ 3PJRA 1RF1C 2ZXJA 1M1KQ 3I56I 3MCZA 5KAIC 1L4AB 3MP7B 3H9JA 2XGCA 1X58A 4ZYHA 5E3LA 2YKQA 3SWFA 2HPCA 3MWMA 5L3EA 2DOEA 3F89A 3V4QA 4Y99B 1W2EA 3TDZC 3EUAA 1S3JA 1W7PD 3IP4B 2ECBA 3ZXSA 5LBQA 3ZGYA 1KQ0A 2DJIA 2JJ7A 1YJNP 5LGTA 1OVRA 2IXSA 2LREA 1KU7A 1QU3A 1KILB 1T98A 1NTKK 1SQPK 3IH2A 2MFZA 1CI6B 3ITKA 1W0TA 3S93A 3GEZA 3JRAA 2CQXA 3CESA 1CF7A 1S5LC 3VN0A 2KSEA 3BR1A 4HSTA 4C3IJ 4WY4B 2FQ3A 4G6QA 3H32B 2TDXA 1G3SA 3VMAA 3I9V2 3RDIA 3LNQA 4U0YA 1SQBE 2LDUA 3A5TA 2E7XA 2Q3IA 2LNBA 4OH8B 1TW3A 1VF5D 4XIDA 4J0FA 3L73E 4RESB 2V7FA 1EDJA 2W1OA 3PNYA 4CCOA 1KFNA 5IT9K 2B63J 1I36A 1U5TB 5EJCA 1QRYA 3H1HG 3G6EI 3CXHI 1WCMJ 4BXXJ 1FIAA 1LWUC 1NU1J 3HE5B 3L74E 2RREA 1BCCG 3KZIC 4KA4A 2OARA 2IGNA 3HXLA 3EQLF 4BQOA 3IQDB 3ZQQA 5J4YA 2QG4A 1UHMA 4XOTA 1VQ8I 1SQPD 1GD2E 3T5XA 2R3CA 2HZDA 3B5NA 2LOOA 2HDDA 3S1MJ 3WFIA 1BC7C 2LG4A 3S1KA 4U3FD 3PQJA 3TNUA 2ITAA 1ON1A 3O6BB 1TWAJ 5LGNA 3CMYA 1ZGWA 1T2KA 3L75E 4BHBA 1MH4A 3CL3D 2CUEA 2QUFA 4HLYA 2EPFA 2FXAA 4OMZA 3HTUA 3S2WA 1DH3A 2KJBA 1B72A 1U5TC 5FB2A 4I2OA 2L7FP 2IYPA 3V4WA 4NBQA 5IOYA 1PZQA 3CX5E 3OYKA 1E79H 2E7WA 1Z7LA 4HX8A 3DKXA 2IBZI 3WHBA 3H3ZA 1TZLA 2OFPA 1T6SA 2KLUA 4AD9A 2GLOA 3DBHB 4DGWB 1FAVA 4XSZF 2JUGA 3GUDA 4G94A 1R9TJ 4OQZA 2D2CB 4AU7A 2AXCA 5F1JA 3FWNA 2QM8A 3K5BA 2G3AA 1FX7A 4V2GA 3RBXA 2BZTA 2O61A 4YFXF 2YPRA 3BR2A 2A45H 3BWGA 3H5RA 2R3SA 1MJBA 3FF5A 2YXRB 3VMZA 1STZA 2XF5A 4B44A 1XDUA 2A3SA 2IS6A 1W5CC 3ECOA 4HV5A 2HI3A 2YX4A 4ASVA 4I6MC 2FE3A 1JY2P 5E3NA 1BDDA 1LWUA 1AFOA 1J9IA 1LTAC 5TISE 1FJPA 2H8PD 2O0YA 2GA1A 1ZMEC 1P7IA 5A9RA 2WSCH 2QA4I 3MKLA 4F3QA 2VKEA 3A4CA 3AECC 3D5LA 2QJPB 2OBPA 4M73A 3QPTA 3HE4B 1SFCB 2V6CA 2E1NA 3CCQI 3A0BE 2E75C 2PMHA 1SFCD 5ED4A 2M0MA 1JDJA 1KYWA 3FKIJ 4R79A 4B3IA 2K4BA 2ELHA 3DPLC 5EZHA 2P0WA 1KZUB 3PFIA 4D7MA 1AV1A 2P7CB 2PRRA 2D2WA 1K6OA 1EVZA 4KUHA 2OQQA 1Z05A 2QBYB 1EXJA 4ZZDA 2F5CA 2LR2A 3GHGB 4ZYDA 1SQQJ 5LD2C 3GTLJ 4U3FG 5F0HA 2W7NA 3IH4A 5FKLA 4E7JA 2R7UA 1U5TA 5AYVA 2L01A 4FQGA 3I0TA 2CQ7A 3PFYA 1P4WA 3GTGJ 3EGOA 5HS9A 3TP3A 1WGXA 2MGQA 2R7WA 3JREA 1XTAA 2FOWA 2VJ4A 1W36C 2R93J 1L0NE 4PSXA 3ZMVA 3BCCE 3L72G 1CW5A 3DEUA 5GAEJ 3OR2C 4XKVA 4N4OB 2H1LA 4Z2YA 1W4MA 4Z1MH 5CVVA 4CICA 3F21A 3CUQC 5KLIB 5L3BA 3BPXA 3BPVA 2LBFB 1AA0A 2COBA 3NMDA 3I55P 4KMUX 3D0SA 5IP7J 1OYWA 2HDWA 4OIOF 4KT0J 3SDGA 1NG6A 5B66C 2ZFUA 1SMYF 4I7ZC 1D0YA 2CWEA 2MH2A 3BZKA 1XMXA 3TL4X 3L1PA 5A9SA 4PD4D 2ZVOB 3KPHA 1V54H 3AE1C 4NNJA 3RZDJ 1BSHA 2R92J 3MD0A 2K3PA 4D3FA 2WC2A 1Q90D 5DJUB 3ESWB 2E60A 3TMOA 1PGJA 1VF5B 4UXNA 3F8NA 3T97B 2HYGD 2X6XA 1LTGC 3AEEC 3QU6A 2ELJA 1NTMK 3HSRA 5FWNA 3K7AJ 1XSXA 1P84I 3V2RA 3KP3A 2PN6A 3MQ0A 1LTJC 1LSOA 3L71J 2Q2EB 4DYRA 2K9LA 3JCUC 2FRHA 1YQ3C 2Y75A 3P8CD 2J5PA 4BRYB 2NS8A 3K4NA 1LQ1A 2YKOA 4ESJA 3VSLA 2NNNA 1KGSA 2ZAEB 1ZLJA 1DIPA 3JTGA 2RKLA 1ITYA 2X48A 5L3DA 3WGHA 1NTKE 1LJ9A 3V7SA 4BH9A 2FX0A 3KCCA 2V9KA 1WJDA 2V1DA 1JY2N 1LGHB 1NAFA 3BRVB 2M1BA 5J1RA 3M8JA 1HKQA 2CO5A 2XZRA 2V1XA 2QZ8A 2L5QA 1NKZB 3D6ZA 1W5SA 1KQFB 3F8BA 3I4PA 4MTDA 3CD6P 2XNXA 1HF0A 3HD7A 5H6RA 5M5WJ 2EZHA 1G3TA 3V5BA 2DXIA 2Y30A 3LA2A 5EEHA 3ZW8A 4AQRD 3AEGC 2M8EA 3HOYJ 1SFCA 1FPQA 1QQIA 4U7BA 4EJVA 3JRHA 1AJYA 1URQB 1VQ9P 3H92A 2PMUA 2PQ8A 2O03A 2VASA 3S3MA 4WXCA 2A45G 3TK1A 1TQPA 3DBLB 5KTBA 3MEXA 2Q7CA 4HEA2 4ASWA 2DMTA 2CMPA 2F4IA 3L71D 1M1JB 2EFOA 2W4SA 3HOTA 1A5JA 1PGPA 1X79B 2R5BA 1LDDA 1S29A 1FMVA 2XAFA 2KMUA 1FLIA 1N86A 2L91A 2Z1DA 4JYKA 4ENJA 2BCCJ 4GFBA 3H1KE 3HSEA 1ON2A 1HQCA 2HFED 4Y4RA 4HF2A 3MOGA 2EH3A 4JPZB 4C7RA 2CRGA 2EBIA 5AW0B 1NU1G 3VYSB 1RF0C 1HW5A 2LF7A 5D4SA 5M3MJ 3NTNA 1M7LA 2O01H 2DA2A 1QO0D 1BIAA 3M9BA 3ZDMA 3EUKL 3RJPA 2O8XA 4OIQF 4D7NA 1E17A 2H6BA 1KILE 1K8AQ 2KSJA 2VQGA 2J5UA 1RY3A 2WSSH 3IFMA 1JMBA 3A03A 4I2LC 1OISA 5A9SB 3EWKA 2L3DA 3HRMA 4ZNCA 5HS8A 2ZT9B 4XLAA 1RZ4A 3SQNA 2Q6QA 5AVZB 1KU9A 3D71A 2LY9A 3LMMA 1IF1A 4JYBA 4EDFA 1JY3O 4ESFA 3ABKH 1WSUA 4WY4A 2PFXA 1RPWA 3L2CA 4RLQA 2GOXB 2LRDA 3G17A 4L9NA 2EINH 3SFIA 1ZN2A 1KQ9A 4RS8A 2HEOA 1IL0A 1NAYA 2P5LC 3CJNA 1D0XA 3R2PA 3QU3A 1OYYA 1V3FA 3HZJA 3BG3A 4FX0A 3L2RA 2O3JA 1QHGA 1R71A 1OCRH 2HR3A 4OIRF 3FM5A 4CXFA 5J47A 2OYHB 2VC0A 1EZVE 2RMZA 3II6A 1HXDA 3DTEA 4Y28J 4LLLA 3GZNB 2B9BA 3S3NA 2OYHC 3ZQFA 1P84D 4L18B 1B8IB 2EV0A 4H13B 1HLVA 3D70A 3DV8A 1IXSB 1YW7A 1RQVA 5FGMA 2IA0A 2VN2A 4FGWA 1LTJA 1Y47A 2NVQJ 2FBKA 4CYDA 1G2HA 3BJ6A 2O8KA 2STWA 4RMNA 2XSDC 3B02A 1VQ9I 4HBLA 2PEXA 1UJ8A 1WDMA 2HVSA 5E20A 4A5MA 3QWOC 2HOAA 2I5UA 3C9IA 3ASNH 3L2WA 2NPSC 1DP7P 1LTSC 1RETA 4BL0B 1F0YA 2K9JA 2DTZA 2WV1A 3S1QJ 1SLQA 3J81Z 1S9KE 1NG7A 3R6SA 3F23A 1AU7A 1DLJA 1UHWA 1HTLC 2V7QJ 3ZQ7A 4H44C 3I53A 1JTHB 2OYIB 3KP6A 1H9TA 1NTZE 3HKZN 2D45A 1GVJA 3KETA 3LFKA 2CUJA 2FA5A 1L0LK 3SHFA 1MKMA 1XTGB 1P92A 3GMAA 2IBZE 2VE8A 3V8JA 1MJ9A 4U7DA 2X1CA 3F8FA 1IRFA 4U0WA 1LT9C 5J6XA 3ZQCA 4BACA 1SQXJ 5DJTB 2STTA 2LLKA 1YJ9I 1PPJD 4NQWA 3ULQB 1ZP0C 3C3WA 3VDXA 1SEUA 2K88A 1S9KD 2Z3YA 5E79E 3TP0A 3HYIA 4MN4C 1SVMA 1YTZI 4CSWA 4OAYA 4XQFA 3OYGA 2R7FA 1K05A 1VQ6I 4N78D 3ZMUA 3AFHA 2PP6A 1BI3A 1T95A 2LXCB 4CZCA 1KILC 2VKVA 4PFPA 1RKWA 2KZIA 3AEFC 4OL9A 4HYEA 1SQXD 1SAXA 1SFEA 2MH9A 3DXJF 1IRGA 5LHGA 4IHWA 1Z91A 4PJNA 3M8EA 3IL2A 2KP6A 2DT6A 1Y39A 1FZBA 2YO2A 3HE4A 1L3LA 1YONA 1RF0A 3VSKA 1FEXA 4B4CA 1RE3C 1N1EA 3CJRB 2ETHA 1JCDA 2CUFA 3I64A 5BMZA 4ZKPA 2G7UA 1FBUA 5KCMA 1MZ9A 3IF4A 3IR9A 4PV1B 2FFDC 3KZYA 1FE6A 1P6RA 2NPSA 1TWFJ 3ZMSA 1VQ4I 3C2HA 1B4AA 2UZKA 5A2QK 4JBAA 3KZIE 3UIAA 5CCHA 1BOAA 2WA0A 1U8RA 3GG2A 5FD6A 2DDAA 3H36A 1BC8C 4EJWA 5B1BH 1MFZA 1ODDA 2P81A 3C7JA 1USSA 4KJMA 3TYYA 3V2NA 3RKYA 3HOWJ 2VPLA 1R5ID 2IP2A 3ZHBA 2YIUC 4WY4C 1GDTA 4HW0A 4DYCA 1AHDP 3Q5RA 3Q0WA 3GTPJ 4XSXF 4XMYA 2R7XA 2QVOA 4PV1C 4M6XA 5APQA 4A3DJ 3OYBA 3H1HD 2DA6A 1MDMB 1BOBA 4W1UA 3K1PA 2VC1A 5JVGF 3L73J 1FZCC 3E0JB 5TGTA 3OYHA 1A02F 5B5EE 2WPQA 2LFBA 1SFOJ 2AQFA 3GLMA 3G1OA 4RB1A 1F4KA 1X1CA 2D3TA 4FT8A 3K6JA 4D6TG 2AHQA 2E43A 1GUUA 1WI3A 4RLFA 1SQVJ 5DEQA 4IHSA 1J1DC 5M5XJ 3HM5A 2JSCA 4ZDPA 2QWWA 5BU8B 2CU7A 4LLGF 3OYAA 3WG7H 2LH9A 3NAUA 4IO9F 1M75A 4XR6A 1FSEA 2JA7J 1XD7A 1DQUA 1FDIA 4OWFA 2RKHA 1O7LA 2QJKC 2ZXXA 3J80Z 3MVPA 3K4LA 3SZPA 3P32A 5D5XB 4YG2F 3L70D 3Q5PA 2FEZA 4WWCA 2L7MP 4MHGA 3WTSC 4CYCA 2FFDA 3CP2A 2PBIA 1VNDA 4MLOA 3RKQA 1L0NK 1LT1A 1WVRA 4FETA 4XONA 1FZGA 2ID6A 2W00A 1M1EB 2HOEA 2JVGA 1JM0A 4IQ4A 3Q9VA 1ZREA 2KPMA 1N7SA 2PJRB 5LLQA 1WJ5A 1OZHA 1X3WB 1D1CA 4MEXF 1TXGA 2QRXA 3R4YA 2WT7A 4F7ZA 2HNHA 4L9VA 3ZMZA 4BEHA 4YXWH 1G3WA 2CG4A 4ANJA 4ZTJA 1LT9A 3CMEP 4BEHB 4H13C 2E19A 2DOAA 1I5ZA 4HA8A 1PGQA 2D2CD 5APUA 5AW3B 1NKNA 3W2WA 1SQVE 1SFKA 2DO7A 3G4SP 3TBIA 1V55H 1KB9E 4J01A 2OQRA 2H8RA 4PJ0H 3P7NA 4I6ZA 1NK3P 2PAJA 5AW1B 4J19A 5HNHA 2C6YA 3RK2D 2LKMA 4FASD 3H1CA 5J3LA 3LSMA 2EW2A 5B66E 2MD0A 2DU9A 2OZ6A 2XAUA 2P5VA 3Q5SA 1GXQA 2HOSA 4DIQA 3H1KD 2L9SA 1MNMC 1X2NA 2K86A 2XKOA 2CS3A 4BQQA 3L35A 1QPMA 2VQLA 3FXQA 2YX7A 1JCCA 1T6AA 2H43A 2VKDA 3CKYA 3S17J 5GTIE 3ZWCA 2UYYA 1QVUA 2WTBA 1BE3G 5BPDA 1IXCA 2L54A 4UVAA 2QF7A 2OJED 2K9MA 3QPLA 4P9UA 3TGNA 2X58A 2F5FA 2A45I 1FC3A 1SQPE 2G8YA 3WODF 1L0LG 3H32A 3E97A 4AC0A 1BE3E 2MD5A 2EV6A 4U7JA 5F0CA 3HD7D 2JO1A 2H94A 4U3FE 2V9PA 4JX6A 3D5RC 1LVAA 4G8XA 2OC6A 5CPRB 4XBFA 4CCMA 5JR3A 1DD4A 4HLXA 1OW8A 3L2VA 5HODA 2KS1B 1LKXA 5CCHC 4XE5B 3GHGA 2HKXA 2RV8A 4LOCA 4UHTA 1ZGAA 4E12A 4XLFA 4UVCA 2P2UA 4YRVA 1J1EC 3AE4C 2X85A 2XGXA 4ZDLA 1ZRCA 3ABVC 3JRBA 4GBJA 2P8TA 1SANA 3I83A 3JSVC 2VQCA 1LTJB 4M3FA 1W7PA 2M87A 4GDFA 4KYWA 1X3UA 4R4LA 4XN3A 2L9RA 3H1IE 3U9GA 4C3HJ 2LBFA 4ZYEA 3D1NI 4BY7J 3V42A 1ETVA 5L3FA 1IFNA 1IGNA 4OAZA 1AKHB 5ICCA 3BQYA 4EJUA 3OOUA 2MA3A 1L0LJ 5KLVJ 3G3ZA 1BCCD 2MLGA 2KL4A 2R7QA 2XPVA 1HWTC 1CI6A 4C7NB 1IFPA 3AE9C 1QZEA 2K9QA 3FXOA 1KYOH 2PJRA 3FWLA 4OVNF 3NQOA 3BP8A 1MGTA 1VDFA 2ZB9A 5BVZA 4A3BJ 1K6YA 4L5EA 4XKWA 1OCPA 5AVQB 1I6HJ 2IFMA 1SQQD 2M9HA 2HDHA 4IM7A 2I1KA 2IPQX 4O6JA 4N9IA 3CCYA 2VT2A 2W90A 2IBDA 3GFMA 3G1MA 4P9FA 4A12A 3EYIA 1NTZK 5IP9J 2L4AA 2Q9IA 3JSOA 1MBJA 1OPCA 4UB6H 3V2QA 2O9LA 4IFFA 1K9MQ 3CCSP 3IH3A 1OFCX 3RK3E 5B1AH 3CCUP 1AVOA 3C1LA 2XV5A 4XICA 3CWBJ 4M3DA 4KN7X 3GW2A 1WPKA 2AXLA 4A7PA 5KLVG 5EZGA 4PUSA 4U0VA 4BHCA 4AVZA 1TWHJ 2F48A 2XPUA 3AG2H 3F22A 3GTKJ 2R7ZJ 2IBZD 3GW6A 2X6YA 3LQQA 3JCUE 1S5LH 5CYVA 3FXDA 3GYHX 3KYDB 1SQBD 3BTCA 4OQYA 4OGQC 1PPJE 3CX5H 1NJIQ 2DT5A 2R7DA 2J5OA 4LG0B 2K4JA 3BJOA 3OYFA 4H0LD 3CI9A 5AVRB 3CUQB 3FGAD 1R1VA 2C0WA 1NHLA 4NB5A 5F1RA 4M74A 1UG0A 1R5GA 5FKOA 2K1AA 3JRFA 2PX9A 2KNCA 4LGWA 1TW2A 1FOWA 3GTJJ 4X6AJ 2X6WA 3PIDA 1X9VA 1KA8A 1A31A 2A05A 3E3VA 4MIMA 2IT0A 1LEBA 1N7LA 4NC8A 1SP4A 2FXMA 3OJAB 3JRCA 2JMWA 1IV6A 4CHUA 4LITA 3I4MJ 5C39A 2X1EA 3AG4H 2IDBA 1ORKA 3GF2A 1D8KA 2WQYC 3SFZA 1P7JA 1PUFB 3CC7P 3F8CA 5FLXZ 3D5SC 2G9WA 2JT1A 2ZFWA 2MKVA 2I8DA 1RE4A 1XGMA 3GTQJ 3J80K 2OTJI 3CMAI 1OVVA 1U6GA 4WBAA 2BW3A 1JMMA 3PHLA 3DP7A 1O4XA 3L2UA 1U7MA 2WV0A 2K9NA 3SEQA 1GHCA 4E7LA 2NAZA 3ZWAA 3P8CE 4ZKUA 5KJ7D 1A02J 4Y15A 5BOXA 1QVGO 3ONQA 2MW8A 3BR5A 1Q1VA 3K6GA 2FYZA 2GXBA 5DD8A 2KS1A 3M9HA 2OTLP 1JGSA 2ECCA 2M4GA 2HODA 4GODA 4LG3A 1VQMP 5FROA 5EEGA 2POHA 2OAZA 1FMWA 1RR8C 4UB8E 1LEAA 1XMAA 4RGUA 2XASA 1IW7F 2E74B 3HOXJ 1YHQP 4O5VA 4ENMA 4AUWA 1NTMG 3F6VA 2RNGA 4A5NA 1IZNB 2Q2EA 2ZNZA 1LB2A 3PJGA 1RESA 4MGRA 3KP2A 4BRYA 3HTKB 1AWCA 2QBYA 1K7AA 4DOZA 1SQBG 1VQ6P 4B3XA 2HQAA 2WVRA 3I58A 3FMSA 1B59A 2NS0A 4C46A 2E75D 3MZWB 3AL0C 1J2JB 1XC5A 1NO4A 2BYVE 1YRNA 1PJRA 2E76B 1JUSA 3CCJI 4MQ9F 3SYTA 4JBZA 4Q5SF 5BPIA 3L70J 1XGSA 4IL6X 2QENA 3BJAA 2DQLA 2MC3A 4FCYA 1IDZA 1LT9B 1DU6A 1OW7A 1MJAA 1HW1A 3FR8A 2MG4A 2VRSA 1LNWA 1SVLA 3T1BA 1KQSO 3L75G 1RE4C 2LXBA 3I5CA 2Z5UA 3FIWA 3IHUA 4PZJA 1B6AA 4IL6H 4M3LA 3TSIA 4ITVA 2O6GE 3EUHC 2F4OB 5CLSA 3J7AO 4PJJA 1Z56A 2W48A 5HNFA 1PGOA 2M3EA 2BOLA 2XF6A 4IF4A 3CCRP 1URQA 2CFXA 5KLVK 3CO7C 1OCZH 3P9CA 1LVKA 3R0JA 1A35A 3QWLA 3BTIA 3NARA 5JHFA 3T97A 1Y1WJ 3WG9A 3UKGA 3KXDA 4BAYA 1UAAA 3CXHD 1FOSF 2O1JA 1M1JA 2P58A 3RPQA 4YFNF 1NTZG 1QX8A 3L73D 3U1AA 2CW7A 2ZXWH 4UV9A 5GTHC 1ZRFA 2FXPA 3P7KA 5FD5A 3VB2A 1O57A 3KFWX 4E7SA 1C0WA 2JWTA 3H5NA 5J1YA 3CTVA 4YCAA 1A36A 1J1EB 1E3PA 2GUSA 1ZG3A 5KK1A 2MYSA 4PD4E 2V9VA 5LHHA 4XLEA 2KLOA 1FS0E 4LG0A 2R4GA 3I59B 1P2FA 3M1EA 4QWQA 4H0EA 1JI8A 4XFJA 3L71G 3AG1H 3OS1A 4LIVA 1J5YA 3S9OA 1S7EA 5E3MA 1R22A 5DUIA 3CCLP 1BR4A 2XSJC 2SPZA 2O7OA 1GVDA 3X2QH 3RK3B 2BHZA 2Y9YA 1U0JA 4LJZF 2UWMA 4JYCA 1XMKA 4S05A 2O1KA 1YJWI 3H1LE 4H0LB 1YS6A 1P84H 2VXZA 2LYCA 5ICGA 3O8HA 1FT9A 3O6QB 3G1LA 1H88C 2Q0OA 3WFJA 1HA8A 5A2QZ 2H89C 1IO2A 1NTCA 3HD7B 1N73C 1YBKA 2QE7H 1UCRA 3WGIA 2MLKA 4ABZA 4EGYA 4IRGA 2EZIA 4QPQA 3WTWC 2VBWA 3WTVC 4BHPA 1L4AD 2A61A 1ZR4A 1KS9A 1BE3D 2DFIA 2FD5A 4KIFA 5E3OA 3ADPA 3RGUA 5D6FA 4XN0A 3EUHA 2QKLB 2WB1N 1ZAOA 3BATA 1QVFO 1FZCB 2QJYB 4RB0A 1I27A 2E1MC 1Q2NA 2ISYA 3GBGA 5H2FC 4JK1X 2Z4EA 4D5FA 1T08B 2WMMA 5KJ7A 3B5ND 2V1UA 1JTYA 3H5AA 3N05A 1S5LX 2O01N 1R49A 4I99C 4HNUA 1QNTA 1VPCA 4GDOA 3E6BA 1WHUA 3ZQHA 1M56D 2KIUA 5J1UA 3M91A 2BE5F 5HVQC 1H0TA 1T33A 4M71A 3IN6A 3E5UA 5FRNA 1BA5A 1FTTA 3R60A 2FSWA 1S72I 2R7SA 3L09A 2Y0MA 4EJOA 1TWCJ 2Y31A 3P9KA 1D1BA 3L73G 4BBRJ 1EJ9A 2JA6J 1JTXA 5JE8A 1WI9A 2W6BA 1WQ2A 3QP5A 4D6TE 3GFIA 1ZHFA 3WTTC 1DU0A 1X4OA 2Q5UA 4L76A 3L74D 1O7FA 2EK5A 3I3LA 2AXTC 4A3EJ 1M90Q 2YIUB 4R1HA 4RGSA 3ZWBA 3GVAA 3M3YJ 2HTJA 4BS9A 4G7HF 3P5JA 5D8LB 4FTHA 2FYUJ 3OR1C 4EI2A 4XKCA 3SSUA 1EZVI 3AEDC 4N3YB 1Z7UA 2EIJH 4O9BA 1NTKG 4UV8A 5FLXK 1E3HA 4MFDA 4IOCF 1PP9D 1L0ND 1BGYJ 2EA2A 4CPGA 4I0AA 2X9DA 4FISA 3N7NA 1BI1A 5E1XA 1URQC 2XVCA 4XKBA 1D1AA 4JP0A 4IRIA 2BXZA 2XHKA 4IKFA 3DEWA 1T38A 4G7OF 4E13A 1JNMA 2AO9A 2V4HA 5KLVE 2GIZA 3KLOA 3H1JD 4LK0F 1EDKA 2NNYA 3EYYA 4A3GJ 4R8HA 1MBEA 5TJHA 3BG7A 5KAFE 2QSFX 3HOUJ 1OR7C 2HLOA 1RUOA 1VQLI 3K70D 4E70A 1S4XA 2B0LA 4L74A 1GMJA 2YO3A 1IN7A 3VFZA 3B73A 3GFLA 1IC2A 5J8CA 2OTKE 4BE1A 4S3MA 3W2AA 1WJFA 1L4AA 2FXOA 4AYCA 1F1ZA 4PJ0C 3MKWB 3L7WA 3ECHA 3OMYA 2IGOA 2RC4A 4KN4X 1TU3F 1MMGA 2LVSA 3IRQA 3JRGA 1YRLA 5APTA 1VQKI 3C2GA 2P67A 5CQGA 4UUTA 5CVUA 1SQBJ 6PAXA 1KV4A 3VOEA 3WUVA 2W25A 1ETYA 3L74J 4IQJA 2A06E 1NU1E 2OV7A 3FBNB 1R5LA 3M0AA 5FRMA 2W27A 1I3AA 3ZPLA 3LOCA 5K7FA 3CXHH 2KRCA 5IT3A 1VF9A 2BVMA 2I9PA 3NFQA 1VQOP 1ZELA 1MSFC 3Q2YA 3WU2H 2IA2A 3A3YB 1UHSA 2FMYA 4KISA 3KYQA 1FP2A 1K61A 2F5EA 3HIFA 3OYDA 3PNVA 1JY3N 4CCNA 3VODA 2R32A 1G4DA 1QGKB 4HH2A 3H35A 4G6DA 2QEXI 2ACJA 4I1LA 3ERMA 2DA5A 5EF6A 4CZZA 2IZ1A 1T8ZA 2BY3A 3M06A 4PD4I 3MN2A 3L2QA 3CC4I 2KXPB 3IWFA 3LL7A 1VTNC 1PP8F 3EETA 1NK2P 1GW4A 2C9LY 3BZ6A 2VJIA 4BQNA 3R61A 3MAJA 5AW2B 2IGMA 5EGOA 3L72D 1WKMA 4N78E 2I10A 4I7ZB 1IO4A 3B5NB 2DT7B 2DMNA 1Z9CA 1QL2A 3USSA 3C7AA 4RGRA 1J7KA 1HSTA 4XLHA 2BY2A 1REPC 3W6KB 1EZVG 3H9QA 3L6DA 4N9HA 4A3MJ 3OSGA 2PGDA 1QEXA 4IFDK 5HS7A 1HJBA 2CW8A 3A1YA 5GP9A 1TLHB 3I5UA 4QTRA 3CCMI 1IK7A 4AYBA 1PL5A 5DM6F 1O3SA 2V1NA 2KI7B 1YHQI 4EQQA 1N73B 3DLAA 1FDMA 3FMRA 4UY8I 2YUSA 1ZK8A 2WY7Q 1IN8A 4IHXA 4AUXA 1U9OA 1GT0C 1DGWY 2WADA 1OXZA 3V4GA 3TNUB 2VL8A 1OMIA 2FU4A 1RC9A 5KLIC 1CGPA 3DU6A 2BY0A 2CYYA 1ZV8A 2N1TC 3QRFF 2EV5A 4QLCU 3JRDA 2R44A 2Q1ZB 2PLYA 2JSPA 4UVBA 4NPEA 1S9HA 4C30A 2E5ZA 3TW6A 3V8LA 4TT3H 1OLTA 1T0FC 4M72A 3G71P 3VYUB 3F3SA 5APXA 3SFEC 3W67A 1X2MA 1WP4A 2W6JH 4L9TA 1RUNA 3M0DC 2NVYJ 4Y3OA 1FOXA 2O5RA 1ZYRF 5DM7F 1RR7A 2BCCE 3HUSA 1G6NA 2ZJSE 4EIJA 5CJ9A 4L9JA 2E2IJ 4KITB 1Y0UA 4IJAA 2KZGA 2BCCG 1WJBA 2VIXA 4RAZA 3ZR8X 2E75B 5AVXB 3PJSK 1RF1A 1MFTA 5JVTA 4B3JA 4LLNA 1NH4A 2L0KA 2B7EA 3GO5A 3VMYA 2Z9OA 2FFDB 1A6QA 1MMDA 4NC6A 5CJ4A 4YIFA 3HBLA 3CCQP 3SWKA 1FOYA 2DA1A 5CCGD 2H8WA 3H25A 2NZ2A 1L0OC 1NYHA 2K3FA 1VQNP 2K37A 3WS7A 3OYCA 1ERDA 5H2FE 2HG5D 5B5EC 3Q5FA 1K78B 1ETQA 2JRMA 2ZT9D 4PGGA 3K1MA 5GPCA 4LB5A 3ISPA 1JHHA 5AW6B 1B9NA 4PZEA 3DEEA 1YLFA 2GZWA 4G6TB 4ZH4F 4A3LJ 3EFGA 4HB1A 3L70E 5TISH 2JDIH 3E7KA 5CMZA 1HUCA 3PNTA 1NWQA 4D1QA 2NS7A 5E8GA 1CZQA 1YOVB 1FDOA 4YPCA 2ZSHB 1JO5A 4R4MA 1TL8A 2V7QH 1SD5A 4KDPA 1W1WE 1IFDA 1S7OA 3GWZA 1IZ1A 5CKTA 3H1HJ 3ZW9A 4RKUJ 3VP9A 1J75A 4KFCA 1TP4A 2JWDA 3HTSB 3LWFA 4BNCA 1YIJP 1RH5B 4M3GA 5JI6A 2NOJB 1ONVA 3TGUJ 1UG2A 2QGUA 2W8ZA 3E7LA 3HOSA 1K4SA 1BI0A 4PJLA 5F0FA 4D5CA 1BSNA 1ZG1A 5LGUA 3HADA 4JF7A 1MH3A 3HUSC 1ZOYC 5ICFA 2YU9J 1OWAA 3M9QA 1WWXA 1SQVD 4F92B 3TEDA 3S2HJ 2OCEA 4ETSA 1YJWP 4MQVA 1QPIA 4Y17A 2VUMJ 3CCMP 3CCVP 1UMQA 1R58A 3I54A 4HNTA 2ZJRF 1O3TA 1FJLA 1NU1K 1E0EA 4B3AA 3B71A 4I7HA 1E5WA 2IYOA 1XDSA 4NUBA 1ZQ3P 2MJZA 3K4KA 3TGUG 2BBYA 1X4PA 3S32A 3QP6A 4YIRX 4RBOA 1MMAA 4B09A 1QLED 3HDHA 4WXDA 3C7DB 2RQQA 3E5XA 1KFMA 2P5KA 3GLLA 3VYIA 3DTKA 1DEEG 1WJAA 3ASOH 3COAC 5CJ0A 2A6TA 3EDPA 4HV6A 2H7HA 1K83J 1SQVK 2AEMA 3HJEA 1BGYD 2Q1KA 2HPIA 1H9GA 2ZJPF 4Q47A 1FC2C 5HLHA 2KLVA 2AXTH 1KMIZ 2JVHA 2M30A 1Y9BA 3RYPA 2XAHA 2KRHA 3R0AA 1OW6A 2B89A 1ENHA 3LIDA 3DF8A 5CBOA 3WE2A 4HNVA 1KD1Q 3CCEP 3OW2O 1B1BA 3LSHA 4RAYA 4AYBN 5TRDA 2H27A 3A2KA 1R5SA 3A0HE 1GV5A 4BXLA 5IYBJ 1TWGJ 1ULYA 5DD4A 1F12A 1P9QC 2VOOA 3VYRB 1NOHA 4GT1A 4LD5A 3JAMZ 4F93B 1KORA 3MHVA 1Q7YQ 4AWXB 1YS7A 2OA4A 3BY6A 4NHJA 1B8IA 2E34A 3NWSA 3FISA 1IFMA 1RQUA 3SJMA 1MBFA 2XROA 4DBRA 1FZEA 2ZT9C 3PM1A 2DODA 2W57A 1HSJA 2DFEA 2QVAA 5BU5A 5KAIH 4G7ZF 2VQHA 4II3A 4EM0B 2CQKA 3H0GJ 1S5LE 3ZMTA 3JCUH 1UIXA 1S8NA 2L02A 3KEQA 2HXIA 5AIQA 1SVFA 2NRGA 2KP8A 2Z5HA 5GAHJ 2LKXA 2HWVA 2LKSA 3RSNA 3GHYA 2YMYA 3FR7A 2IAIA 2ZCWA 1KZHA 2GQQA 3CWBE 5TJJA 1T2KC 1BW6A 1XX5A 5FLVA 1DGRM 3GZ6A 2IEKA 3SXYA 2KZVA 5FFZA 1VQ5I 1VQOI 2ZMEC 4DYDA 3W2VA 3DWLE 4L75A 1FU1A 1ETOA 3BC8A 4MEYF 1OVUA 2W24A 1R4NB 1GTWA 2WAQA 5BQTA 3G2BA 2VKHA 2XPWA 3C7CB 1D0ZA 1K73Q 2FBIA 4RJTA 3H1LG 2QJPC 5GADJ 3EPZA 5K5OA 1LWUB 1OIPA 3RL0B 3CWBD 2P4QA 3J7YJ 4YELA 1MMSA 2LR8A 1CF7B 1DPRA 1X1BA 3CUQA 3FXUA 1YTYA 1YIJI 1XCVA 5GTIC 4FE4A 3HOZJ 2EQRA 4IOAF 3T8TA 4WVZA 4XRFA 3L75J 2VBXA 3KP5A 4BE0A 1JKOC 3CC2I 4MTEA 2A07F 3PDUA 2WSFH 4HSRA 3F5HA 2E1OA 4AIKA 3GZ5A 2I76A 2OTJP 5AONA 1L0NG 1ETWA 4RM2A 4WF2A 1QZYA 1TTYA 2EZKA 1V4RA 4H0LC 3ZRGA 1PUFA 1X0XA 5HDKA 2R5ZB 4HQEA 2GUVA 3AEAC 5JHUA 5FLMJ 2HQRA 3OBBA 3K96A 3PEFA 2KIKA 3BOQA 2P6TA 1KN7A 3WMM0 1BCCJ 3Q3SA 1N77A 3L72E 1FNNA 5D6EA 1SD7A 2E5YA 1Z3XA 4K35A 1ZARA 2P6SA 1YITI 2DOFA 3SZTA 3AE8C 2PLAA 3V2PA 5JLXA 4DQ2A 2NPSB 2RN7A 4KNYA 1IG7A 3OY9A 3GLXA 4H13D 1S72P 2RQPA 2YXQB 3V7CA 2OUMA 3KHUA 2QYOA 3W6ZA 3A02A 2ZMEA 1EC5A 3D6YA 3P9IA 2M0BA 4NPDA 2OZUA 5H20A 3KYLA 1MV8A 3AE6C 2QSGX 2KIFA 3FXRA 1Q82Q 5IPAA 4OGQD 3CDIA 2K3RA 4NPFX 2H6CA 3TO6A 3N4XA 2OU2A 1O3QA 3ADOA 1PP9J 2R5DA 4BXUA 2CH0A 1UIIA 1URQD 3FDYA 3E1IA 5DTDA 3KYCB 3LSTA 2FYUE 1XN7A 1TNTA 3MZYA 2IX7C 3HD7C 3ELKA 3G71I 3HTKA 2L7ZA 1T3UA 1SFCC 4A3FJ 1LP1B 1IRXA 3DFGA 2ICWG 4Y99C 3FWEA 1SS1A 5FKKA 3CC2P 3MUDC 3GMEA 3GX4X 4DZPA 3RK2B 3CQZJ 2XB0X 1K4TA 2N1TB 4HAMA 2Z5IA 3E1SA 1PP9G 2QKMB 3FZVA 2E5TA 2AEFA 3EFFK 2IS1A 2WSCJ 4ESBA 1TBXA 3ML6A 4AIJA 4C2UA 1VF5C 3I56P 5D5VB 5DCMB 3K9TA 3DOJA 1RHZB 2ZXIA 1PPJG 2ZKZA 3N4MA 3OWTA 2V79A 1VI0A 3B6CA 1PV3A 5IT9Z 1R36A 3FK7A 3S4RA 2M0CA 3JRIA 2DW3A 1IFJA 1F43A 1SD6A 1MBHA 5EDNA 1T3JA 3F8MA 3M1CA 3PO3J 3PTZA 1ZRDA 1W36D 4DNCA 2VBYA 2VJJA 3BCCJ 2QSHX 1E2XA 3UNGC 5D5UB 2XDVA 1GL2D 2XAGA 2Y0SA 3ABUA 4EJTA 4PD4H 4BE2A 1Y56A 5HLGA 2MBFA 3OYJA 1SQQE 1UB9A 3R4KA 3TQNA 2JTVA 3QODA 1NH3A 2XAQA 4RM3A 2WB1A 1O3RA 4FX4A 2HYNA 2E42A 4DZJA 4YFKF 1W5TA 1N7SC 1DP3A 1LJ8A 3J81K 3LSRA 5DCFA 2HYJA 3BR6A 3VPRA 5D4RA 3BDDA 4U88A 1Q86Q 4GIFA 3RK3D 5LFAA 3BASA 4ZMDA 2GA2A 4IL6C 3A0BC 3H3VK 2DDBA 4HJGH 1VQ5P 2HVQA 1USEA 3KP4A 3DPUA 2QJKB 2GOMA 2K02A 1YYCA 4IEJA 1PP7U 2JR8A 4EVIA 2WAQN 3LAJA 1SQPG 2PFBA 4GGGA 1J1DB 1FOSE 2TRTA 2CV0A 3F9KA 4S0HB 3WTZA 3O6QA 2ID3A 1ETKA 4TLFA 2I1JA 1IFIA 1LFBA 4A3JJ 3U2RA 2WZ7A 4WB4A 3KZIH 2LMDA 1A04A 1EH7A 1YQAA 2V4JC 2HPMA 2D2CC 4HKZH 2F5VA 2DQRA 1PUEE 2W6AA 4AIDA 2LY1A 2R5ZA 5L8RJ 4E21A 2EWNA 3B5NC 3CCRI 3HEFA 2VB6A 3S14J 4BXFA 2B87B 2WWWA 4ZJZA 4BJTA 3MKZA 2JK3A 1Y0NA 3K2AA 3H1ID 1HDPA 3HDDA 2XGDA 3BZCA 2EIKH 3Q0VA 5B3SH 3V8KA 4EGZA 2GM4A 1CQTA 4MNUA 9ANTA 1WDLA 1KU2A 5CVJA 2J58A 4N4NB 5B5EH 2Y69H 1VQPP 2CW0F 1X1DA 2FBHA 1BCCE 3B4SA 1PVEA 2F2EA 2VBZA 3U1DA 5C3EJ 3IV5A 1B72B 2YNYA 1OCCH 1EH8A 2RAEA 3LFUA 5C44J 1BGYE 2NOGA 2ZBKA 5HOOA 5FO5A 3RQSA 4C7NA 3KQGA 2DYSH 3IAS2 1KYOI 4QMAA 3OYIA 1SFUA 5AW7B 5E1ZB 1NTZD 2ZXEB 4UNOA 3SFDC 3V6IA 4PZDA 1TQMA 2G7HA 2XIGA 3LSKA 2XNDH 2H09A 4A6DA 2JA8J 3ABMH 5HLIA 1G1IA 5J4VA 2Z33A 2E2JJ 1IK9A 1JY2O 4A3KJ 2EFWA 2RDPA 1VPDA 1HH0A 3L75D 2DN0A 3T8RA 1D7MA 1QBJA 4F55A 4D6TJ 4HDUA 1J59A 2ZXHA 1PDNC 1XSVA 2NVXJ 3WU1B 3QQAA 4JX4A 2M3AA 2K9JB 3CMAP 2UWJE 1IN5A 2RVCA 4KIBA 3TKYA 4YEJA 3QHAA 1VQLP 2WAFA 1ZTRA 2DFFA 4M9XA 1VQMI 3KX2A 4UUSB 3O8GA 1WFXA 3TO9A 4QIWN 4PZCA 4RDUA 4D3DA 1FOKA 4PV1D 2M5AB 2IW5A 2Y2ZA 4LC1A 2OTLI 3M07A 3NEUA 2WWYA 1N1GA 2FBWC 1XCBA 5KAFH 1ZR2A 4Y33A 1I3QJ 3ZMDA 2Y9ZA 2CV1A 2B88A 3BG9A 4KUMA 1N78A 1EDIA 2DLLA 3JC22 2VT3A 4X0GA 2A5YB 1R1TA 1E3OC 2E76D 3G9RA 4LK1F 3KPEA 4DJAA 5H6QA 3KE2A 3W6UA 1M8OB 2YSRA 1HOMA 2XGEA 2FJ1A 3OIOA 1MNEA 1N7SB 1UFMA 1DPUA 2KB7P 2OYIC 3HG9A 1OJLA 3L37A 4H44B 2A6HF 1Y6IA 1XB4A 3WGGA 3JR9A 4OMYA 1NTZJ 2OYOA 2XF7A 3CLOA 4ON0A 1K78A 2QM7A 3MTUE 3U59A 1VQ7P 2GXGA 2ZYDA 4C2MJ 1HGZA 5M5YJ 3FXMA 4BJ5C 5K7ZA 5BS6A 2N9YB 1QHHD 3LA3A 1MZBA 5M3FJ 1MSEC 3JSPA 4R1NA 2J59M 2CJJA 5GAGJ 1HBXG 4FHTA 4DLLA 4B47A 2IRFG 3ZQGA 1EQ7A 2CUZA 3DKWA 3L70G 3LW5J 4KUEA 5GTIH 3CCSI 3CXHE 4B48A 5APWA 4A0XA 1YITP 1YX3A 3MFKA 4QSHA 3W3CA 1TQIA 2QSIA 2CGPA 3AE2C 1Z1DA 1D5VA 2BV6A 4P1WA 4G9YA 4TV7A 4E4HA 2KIMA 5ERIA 5F64A 2LK2A 1FYMA 4EM2A 1HGVA 2FMLA 4HX4A 1TNSA 2M5WA 2CSOA 1F36A 3CLQA 2HODB 1MNDA 1Z6RA 3MMYB 1KQ8A 4M3BA 2WSEJ 5DS9A 2COMA 3WUTA 2DA7A 2QLZA 5LHIA 2BVLA 4ASNA 1HKTA 4DCKA 2E74D 2HU9A 3PH0A 5K5GB 2DFHA 3FX3A 3DLLF 4XRMA 4A3CJ 1BJZA 1BBYA 4H4KC 4BJ6C 4FE7A 1X0TA 3PRJA 3QYEA 1X1AA 2WBMA 3G73A 1NTME 5KKZB 3VEPA 2X6OA 1V5GA 2GAUA 2KDZA 1U8BA 4IHTA 4EM1A 2JQ7A 3K4JA 1IRZA 2ME6A 3MZHA 1WMKA 3OYMA 2Y0DA 1GK4A 4RO0A 3QOPA 2DW4A 2JEEA 2Z99A 4GYIA 1GV2A 1U3EM 1T8IA 1W0UA 1HW2A 1KYOD 5APVA 1F5TA 2A6EF 2M7AA 2KJCA 2DMUA 2XRNA 4E7ZA 2M4KA 1Z67A 3HSFA 5D5WB 1EVYA 3H1HE 2TCTA 4LB6B 3HGGA 3RTRA 2XC7A 1K79A 1GU4A 3HUSB 3CC4P 2N1TD 2ZFCA 1HKSA 4D0PA 2DK5A 4Z6YA 3K0LA 3L00A 2K7LA 2ISZA 2HQNA 1FP1D 4K3AA 3QAHA 4CUGA 3VMXA 3WUUA 2XRLA 1R8EA 5HLTA 4KT5C 3IKTA 1AQ5A 3IRRA 1JJ6C 4CCLA 4KUGA 1SMTA 5E18F 2JA5J 3G0OA 3DTIA 4LMYA 4PFOA 2V6EA 3FXEA 1YJ9P 1P4AA 2MABA 2X4HA 1APLC 3RL0g 3AL0B 5DCMA 4DZOA 4UB6E 5EFWB 5EEAA 1JJ8C 3FHZA 1GW3A 3LQRA 1I39A 1JT0A 4ZDOA 2OQGA 2WY8Q 3FBIB 3LSJA 2W84A 4P5OA 3A2AA 2O3FA 4GXOA 3F0CA 3QYFA 3OA7A 4JQ0D 1MIJA 2NVTJ 1XS9A 5KAFC 2UXXA 3KEOA 4BGDA 2R7VA 3OS2A 3AE5C 3HRSA 2BASA 2ADUA 3DPTA 1D8JA 2H1KA 2EIMH 2VPRA 3KLNA 3O2PE 4I0BA 4UB8C 2FKWB 1IDYA 4EMSA 2E74C 5AVSB 3O8ZA 3E5QA 4OU0A 3CF5F 2X0LA 2JJLA 3RBZA 1YI2I 1IUYA 3BCCD 4XL9A 1LTTC 2D1VA 1EKEA 1SQVG 3CWBG 1IUFA 2L7KA 2DPDA 3JAMK 1I1SA 1AQTA 2CQQA 3PIPF 1PIXA 1SQXK 5KHDA 3L71E 2OYIA 4UUSA 4IX7A 2ME0A 3HB9A 3ERED 1WRGA 1WH7A 5CCHD 2ZVNB 3GF7A 3W6VA 1ZRTD 3ZQIA 3NWTA 2JA2A 2EA4A 2M2EA 5H2FH 2L9NA 4J00A 1M1JC 4WX9A 4AM3A 4RA2A 3OYLA 3VWBA 4CA0A 2R0QC 3ZCOA 4Y7NJ 2K9SA 3I59A 3IAOA 4O3MA 5AIPA 2P7VB 3I71A 2W83C 1I1GA 3BLYA 1NVOA 1KILD 3HRTA 4IHVA 1ETXA 2KNCB 3WE3A 4P55A 1ZRTE 5JLWA 4GRIA 2Z2SB 5HDNA 4IRHA 1JOCA 2IFNA 1MBKA 1IC8A 4OM8A 4YXDC 5EG0A 3CMEI 3LIEA 2X1DA 3LSIA 3TDKA 1LSJA 2OYHA 1DX7A 5CVRA 2A68F 4L0YB 4EYYQ 3O3KA 2OPTA 3OYNA 3CJQB 3V7RA 1R4MB 5LRRA 2CV2A 1G3YA 4Y13A 2VOPA 1EXIA 2UV1A 4WK8F 1IN6A 2F5DA 1G59A 4ZTFA 4CH7A 4HF0A 1YE9A 1FYKA 1LJ2A 2K85A 1MMNA 3BCCG 4LIUA 2N8GA 4WCGA 3HGYA 2QYTA 2HXOA 2KK7A 4UB8H 5TISC 2EJRA 4ZYGA 1BM9A 1RIOH 4GWGA 1R23A 5DDGA 2L5GB 1QMGA 2A06D 2KOGA 3JW4A 2C0XA 1ZN5A 1YI2P 2DA4A 2FNPA 2K27A 3WU2C 3NXSA 2QJYC 3LSPA 5LEJA 5HWSA 1EZVD 1X3ZB 3WTXC 3W6JB 3H0DA 1YW8A 1FSHA 3BTLA 1BGYG 1LTIC 4IFMA 4EOTA 2RGVA 2PMZA 4XLPF 3GHGC 1EH6A 3HRNA 2D5VA 2VODA 3GTOJ 2GXAA 3ZN1A 3E1RA 5GPAA 1DEBA 1JTHA 2FYNB 4D6TD 2JP3A 2DJNA 1WT6A 3IC7A 1RNLA 2YS9A 3PSIA 3BRTB 1U9NA 1BI2A 3F72A 5E1WA 1IJWC 3FXLA 2IJLA 4IPAA 4F52A 1H0TB 2AXTE 1USDA 4CGZA 4J0EA 4A69C 1S2EA 3RK2C 1T56A 5FKNA 3HHGA 3OAKA 1LFPA 4E7HA 2G0EA 4A93J 1EF4A 3OYEA 1PP9E 5AVUB 5J40A 4IL6E 1LP1A 4L0ZB 1S6LA 3HWRA 1YTZT 2M34A 2X51A 4I01A 1IV8A 3WTUC 3E6CC 5KLVD 3GF3A 1V5FA 1F9NA 1XGNA 3A0HC 3H1JE 2PG4A 1QVTA 2ZC2A 3K1NA 5L3CA 3VP8A 1NHAA 4C2TA 3H1JG 3VYTB 1W5CE 2GIVA 5IOZA 3H1IJ 3RQIA 4IOIH 2DBBA 3TGUE 4K2EA 3TF5A 5ILVA 4XRSA 2Y0EA 2WTYA 5F04A 1RE3A 2P7JA 5FFXA 2AQEA 4I98B 3DQVC 4ENKA 1ZH5A 1TT0A 3DKYA 1LDJA 4CYCB 2E71A 3H9GA 4LFUA 1NGMB 3D1LA 3L4FA 4OOIA 2XUBA 3CCLI 3S1NJ 1SQQG 3PQKA 1SVOA 3K4BA 3TDUC 1ZLKA 1UZCA 1ACIA 1YB4A 1B9MA 2WTEA 1J09A 3WHCA 3BG6A 4CDGA 1DDNA 2LF8A 1OKRA 3PUBA 5L3GA 1HDDC 3RZOJ 1KQLA 2WPSA 1JUNA 2OD5A 4RAGA 3I55I 3REOA 1KTMA 1OCTC 1U7JA 5AVWB 3HHHA 3K10A 3VOPA 3M9AA 4XORA 1LTBC 3QH9A 3QPHA 1OCOH 4PSWA 4Q48A 5F08A 1NU1D 1VQPI 2CVZA 3TO7A 2ZJ2A 3A0BH 4BWNA 2LKPA 4KHXA 4EEFG 1GK6A 2A06G 3H1JJ 3H1KG 3OV8A 3IWZA 1T2KD 1FZFA 1MBGA 3LSGA 1R00A 4NDLA 2D1HA 5A9TA 1HF9A 3S3OA 2ZNYA 2F6CA 1FZCA 2BEOA 3E6MA 2M8GX 2Q8KA 3ZGKA 3WU2E 3C2BA 1JE8A 1BW5A 1G2CB 2BCCD 3C8VA 3HPGA 4HPQA 5D8KB 1QL1A 4G12A 5C4JJ 5KKZC 2E1CA 4Y52J 1YG2A 3L9FA 2RNJA 1VFCA 3KIOA 2M45A 3S2DJ 1SQPJ 2W82A 1WPQA 4YTPC 1GL2C 1NTKD 3F3XA 2XU6A 5FKMA 2XDJA 2QQBA 3DU5A 2IS2A 2FYUK 4W80A 4UUVA 4AVPA 2NXNB 3IUOA 1X19A 2LSOA 4PJMA 4W7ZA 1Z0XA 1R1UA 1ZW0A 2QEXP 1N75A 2OCCH 3C1DA 4ENNA 1ZG5A 3FXKA 1U78A 1YW9A 1ZXGA 3L36A 3RPUA 3BCAA 1MUUA 2ZO4A 3RQ4A 2ZYAA 2BY1A 4EZBA 2LY2A 5ILUA 1L2PA 4GOFA 3QYBA 1NTMD 1ZKGA 4B86A 1EDLA 4DOJA 2YR2A 3TOAA 5CHXA 4M6YA 2AEJA 2FF4A 3G4SI 2DMQA 4B1RA 3OL3A 3S1RJ 3QSGA 2QA4P 1KYOE 3K69A 1YRNB 1USTA 3Q9SA 1X22A 2IGKA 2NPSD 4B43A 2WPVB 1KONA 3PO2J 1OQYA 2HFHA 4CCJA 1R6RA 2HQ5A 3BG5A 4A6EA 3ULKA 1SQQK 1VQKP 4E7IA 3DBRB 3KP7A 2L9VA 2O01J 2IA1A 5CBNA 4N6JA 1VL2A 4DJGA 3CF2A 2EFPA 4OWRB 1BDCA 4WXHA 3IKVA 1HVVA 1X8YA 3M7GA 4L73A 4XLNF 1XTCC 4W7YA 4RB3C 1AOYA 3I4NJ 3RK3C 3RL0D 1J2XA 2HS5A 1Y8AA 5HDGA 1H8AA 3FK6A 3OL4A 3GTMJ 3SZGA 4RB2C 1H89C 1F17A 2R5YA 5ILSA 1SFXA 2M8RA 4IZZA 1IXRC 1GL2A 3ROUA 5LEKA 1VQ8P 1ZCJA 3OS0A 5J8FA 3CC7I 1WDKA 5M1BA 3BCBA 3CDHA 4OGQB 1H88A 2ZSIB 2M5AA 1POGA 5IYCJ 3Q0UA 2R7TA 2UUZA 3H1LJ 3CJTB 3G6EP 2IBZG 2FOKA 4JOMA 2CQNA 4ZC3A 2JWAA 3PLNA 1AVYA 1KC8Q 1TC3C 1FYLA 3BROA 1JY3P 3CX5I 2GF2A 3RKWA 4LLHA 1KB9D 5GTHH 2HDCA 1S1CX 1D5YA 2HYFA 2OF7A 4PCQA 2N1TA 1LPQA 2YMKA 3KDPB 1Q1HA 2KZJA 1Z3YA 4PGHA 2ESNA 2DI3A 1BL0A 2LC2A 3K4MA 4EATA 2EFNA 4GCVA 1F14A 3CMMA 3SEZA 3J7AY 4XM3A 2VI6A 2K40A 4A2UA 2KRFA 3J7ZI 2OGUA 1H8AC 1M76A 4EV0A 1XPXA 3CD6I 5KJ7C 3W68A 1I50J 1W2BO 1RI7A 3M0DA 3AEBC 2JPBA 2W85A 3RKXA 2VE9A 5C4XJ 5AVVB 1VQNI 2A69F 5BNGA 1M66A 4XRSG 1T39A 3VTPC 1BIBA 2JZYA 2VJ5A 1FBMA 1JHFA 3QPSA 4V19K 5EGOB 1X0VA 2P1JA 2B87A 1WH5A 3CTAA 3FX0A 2V26A 3AE3C 3H1KJ 5K7HA 2DTRA 1JGGA 1IN4A 2HZTA 2BW3B 2FUG2 2KIQA 5E17F 2WPRA 5K5QA 2JUCA 1JB0J 3UR3C 1AKHA 4BQAA 4HYTB 2HPCB 1HBWA 3K2ZA 3L72J 2EFQA 1D3YA 4C3JJ 3AKZA 5IYDJ 4PDKA 2QQ8A 3U1CA 1PGNA 2JKVA 2P10A 5F6FA 5APYA 3CP8A 4YIIA 1YJNI 3FKJA 1N73A 4HX7A 5AW4B 2GWRA 2ELKA 3PIOF 4M9SA 1LDKB 3U1KA 3WU0A 1JUPA 2KT0A 5E79C 1FJKA 1NTKJ 1G8XA 1W7PB 2HOTA 3H1IG 2E2HJ 2BEQD 4GKGA 1VQ4P 3HUGB 2E36A 2MC4A 2LTPA 2PI0A 3S15J 4B3HA 4XA4A 4DW6A 1G2CA 3A01A 2HTSA 2M7BA 1HCRA 3RPUD 1NTMJ 4CO8A 1GXPA 4UB6C 2CPSA 2UXNA 1QGPA 4PK4A 1YJQA 2AS5F 3CPWO 4RAFA 3S16J 4WY4D 3CUOA 2DCEA 1FZAA 4BYYA 2XKMA 1KILA 1RKTA 2XAJA 3GFJA 1XGOA 2QQ9A 4ZZLA 1Q81Q 1SQXG 2BEZF 3BTJA 4DYQA 3K4CA 2LD5A 4DT0A 2DK8A 4M3EA 2IZ0A 1SQXE 1EA3A 2C9NY 3RI4A 2ESHA 3FXJA 2CFOA 2JRTA 2DPUA 3L74G 1ZGJA 4RGXA 4M9ZA 2BGCA 4MFEA 3GXOA 5AW8B 1YJ8A 1G1JA 3S8PA 2KYVA 4KICA 3ZN0A 4BKXA 3Q3CA 4BDYA 4D9JA 1L4AC 1WRJA 4GOEA 5AW9B 5CCGC 3NRVA 3BVHA 2WAEA 3HOVJ 1RRJA 2ZYGA 1BR1A 3ZOBA 5AVTB 4Q4ZF 2L4MA 4BUPA 2KQRA 3CZ6A 2YU3A 1H89A 4OIPF 3M8FA 2EILH 3HE5A 2PJPA 2N9BA 3B8EB 3Q3DA 4W97A 2R5YB 2QIWA 3C18A 2KFDA 1GL2B 3BT9A 1SAUA 5CQEA 4A0ZA 5GTHE 2DAOA 3CX5D 1RF1B 2Y0SN 1KB9I 4L5IA 1VQ7I 1Y1VJ 4AIHA 1Z77A 4DBQA 5IP6A 4BDZA 2R7RA 1LE8B 2H88C 5E79H 3HC7A 1BN5A 1H0MA 1MD0A 3PP5A 4B8XA 1LE8A 3F6OA 2KUBA 2FQ4A 4P96A 1KQGB 2NYXA 2XB5A 1WJCA 1L0NJ 1JKQC 2L2OA 2KHMA 2QCOA 3H2ZA 2JPCA 2QQAA 4V2FA 3ABLH 5KNLA 1JUMA 5APSA 1JEKA 1P84E 2DMPA 2NVUB 3IAM2 2FYUD 2Y0CA 3CCJP 3BQZA 4MO7A 3DFUA 3HL2A 1U2WA
chains in the Genus database with same CATH topology
4IHWA 1ETYA 2ZYDA 4C2MJ 5M5YJ 5K7ZA 1A6IA 1M2WA 5M3FJ 1MSEC 5EYRA 1YONA 3LOCA 1FEXA 4R1NA 4B4CA 5K7FA 2CJJA 1N1EA 2I9PA 1VF9A 4DLLA 2CUFA 4XK4A 3ZQGA 1MSFC 4KUEA 1UHSA 1K61A 4BY1J 1TWFJ 4M6VA 4QSHA 2GBYA 3BR0A 2DA5A 1JKPC 2LK2A 1YVEI 2LP0A 5F27A 5EF6A 4A3IJ 2IZ1A 2P81A 3MN2A 1F36A 3HOWJ 1NK2P 3ZHBA 4M3BA 3PLRA 1GDTA 1M67A 5DS9A 2DA7A 4DYCA 4DCKA 2MSYA 1AHDP 5EGOA 3Q0WA 3GTPJ 2I10A 4A3CJ 4XRMA 3TW7A 1BJZA 4A3DJ 2DA6A 4FE7A 1BG6A 4W1UA 2DMNA 1JKRC 3C7AA 2LFBA 2X6OA 1SFOJ 3L6DA 2KDZA 3G1OA 4A3MJ 3OSGA 1U8BA 2D3TA 2PGDA 3K6JA 1IRZA 2AHQA 2ME6A 5GP9A 1GUUA 1WI3A 4QTRA 1GV2A 1W0UA 5M5XJ 3HM5A 4GWKA 2CU7A 2DMUA 1M75A 3NAUA 4I76A 2YUSA 1DLIA 1EVYA 1ZK8A 3HN2A 2JA7J 2TCTA 4IHXA 3HGGA 4AUXA 1U9OA 1GT0C 3MVPA 1LFUP 5MGBA 3A01B 3CDLA 1Z82A 2XRLA 3BR3A 2L7MP 3JRDA 4CYCA 1VNDA 4MLOA 3RKQA 1JJ6C 2JA5J 3G0OA 4KUGA 4D3SA 3TW6A 2ID6A 1APLC 4BBSJ 2JN6A 1XG1A 3F3SA 5EEAA 1JJ8C 1X2MA 1JT0A 1WP4A 1TXGA 3LSJA 2NVYJ 3DCFA 3F0CA 1FIPA 4JQ0D 1RR7A 2NVTJ 2EZLA 1XS9A 2E2IJ 3OSFA 1FTZA 2E19A 2H1KA 2VPRA 1PGQA 1IDYA 2DA3A 4B3JA 3B6AA 5FJ8J 2L0KA 3ZQLA 3HBLA 2H8RA 2PMZN 4I6ZA 1NK3P 2DA1A 1IUFA 4J19A 4IHYA 2CQQA 3WS7A 4UUSA 2ME0A 4X1EA 5J3LA 1ETQA 3HB9A 2EW2A 1WH7A 5GPCA 1JT6A 5EG0B 3W6VA 3ZQIA 2HOSA 2M2EA 1MNMC 1X2NA 4PZEA 2R0QC 4A3LJ 3M4OJ 4JX5A 3CKYA 3S17J 3ZWCA 2UYYA 1QVUA 4Y7NJ 2WTBA 2K9SA 2NS7A 2QF7A 3QPLA 2XGCA 2X58A 1X58A 5E3LA 4AC0A 4IHVA 1ETXA 5F0CA 5JLWA 3ZW9A 4JX6A 1MBKA 1IC8A 4OM8A 5HODA 5EG0A 2ECBA 3ZGYA 4M3GA 2JJ7A 1LSJA 1UG2A 4LOCA 2W8ZA 3E7LA 2OPTA 3IH2A 5F0FA 4D5CA 4E12A 1W0TA 3JRAA 3HADA 2CQXA 1MH3A 2YU9J 3JRBA 3BR1A 4C3IJ 3TEDA 3S2HJ 4GBJA 2N8GA 2QYTA 3HGYA 1SANA 2HXOA 3I83A 1QPIA 4M3FA 2VUMJ 1UMQA 3LNQA 4GWGA 1FJLA 2L9RA 4C3HJ 4B3AA 3D1NI 4XIDA 4BY7J 1QMGA 1ETVA 2IYOA 1ZQ3P 4J0FA 1IGNA 1AKHB 3BQYA 2DA4A 3OOUA 3LSPA 4RBOA 5HWSA 3HDHA 2B63J 1I36A 3C7DB 3BTLA 1QRYA 2XPVA 2D5VA 3GTOJ 1WCMJ 4BXXJ 1FIAA 2K9QA 1K83J 5GPAA 4OVNF 2DJNA 2YS9A 2ZB9A 4A3BJ 4L5EA 1OCPA 1U9NA 3IQDB 1I6HJ 2M9HA 2HDHA 1IJWC 4IM7A 2HDDA 1ENHA 3S1MJ 3WFIA 3CCYA 4J0EA 2W90A 2IBDA 4A69C 4HNVA 1T56A 3G1MA 5FKNA 1TWAJ 3CMYA 4AYBN 1ZGWA 2G0EA 4A93J 1EF4A 1GV5A 5IYBJ 1TWGJ 5IP9J 1MH4A 1MBJA 1F12A 3HWRA 2O9LA 2CUEA 2M34A 1OFCX 3IH3A 1B72A 4XICA 2IYPA 1B8IA 2L7FP 4M3DA 3FISA 1WPKA 1QVTA 5EZGA 3SJMA 5IOYA 1TWHJ 1MBFA 2XPUA 3GTKJ 2R7ZJ 5IOZA 3PM1A 3RQIA 3WHBA 4XRSA 2OFPA 3BTCA 5F04A 2GLOA 3H0GJ 4OQZA 4OQYA 1R9TJ 2HXIA 5F1JA 2LKXA 3FWNA 3GHYA 3FR7A 4CYCB 2IAIA 1BW6A 4V2GA 3S1NJ 5FLVA 1YB4A 2IEKA 4DYDA 3BR2A 3ADOA 5FKOA 3WHCA 3RZOJ 3JRFA 1HDDC 1ETOA 3GTJJ 4X6AJ 1OCTC 3PIDA 4MIMA 2HI3A 3JRCA 2XPWA 3C7CB 2JMWA 5E3NA 1IV6A 3I4MJ 5F08A 1ORKA 1P7IA 5A9RA 2CVZA 3MKLA 1PUFB 1P7JA 2P4QA 2VKEA 4EEFG 2LR8A 1MBGA 3LSGA 4NDLA 3GTQJ 4FE4A 1JDJA 3HOZJ 5A9TA 2EQRA 3FKIJ 4B3IA 2M8GX 1O4XA 3C2BA 5EZHA 1JKOC 1BW5A 4D7MA 2K9NA 4G12A 5C4JJ 3PDUA 3ZWAA 4Y52J 1EVZA 4KUHA 1VFCA 2E1OA 3S2DJ 2MW8A 3BR5A 1Q1VA 3GTLJ 5F0HA 1WPQA 1ETWA 3IH4A 5FKLA 5AYVA 2ECCA 3EGOA 5FKMA 3GTGJ 2EZKA 3TP3A 1WGXA 2MGQA 3JREA 1PUFA 2R93J 1X0XA 2R5ZB 5FLMJ 3OBBA 3PEFA 3K96A 1Z0XA 3Q3SA 3HOXJ 1U78A 2ZYAA 2COBA 2PLAA 5JLXA 4EZBA 5IP7J 1IG7A 3SDGA 3PJGA 1RESA 1ZKGA 3L1PA 3W6ZA 3A02A 5A9SA 2DMQA 4B1RA 3S1RJ 3QSGA 3RZDJ 2R92J 1YRNB 5IPAA 4D3FA 1XC5A 1PGJA 1YRNA 3PO2J 1JUSA 2HQ5A 3BG5A 3ULKA 5FWNA 3K7AJ 4FCYA 5DTDA 1IDZA 1DU6A 3FR8A 2MG4A 1LSOA 4DYRA 3FIWA 2NS8A 2L7ZA 4A3FJ 2W48A 5FKKA 2X48A 1ITYA 1PGOA 4DZPA 3I4NJ 3CQZJ 2XB0X 2FX0A 3FK6A 3GTMJ 1F17A 1H89C 5J1RA 2R5YA 3BTIA 3NARA 1Y1WJ 3UKGA 3DOJA 1ZCJA 1WDKA 3B6CA 1VI0A 1POGA 3FK7A 2M0CA 3Q0UA 5IYCJ 3JRIA 1HF0A 1F43A 5M5WJ 2EZHA 1MBHA 2JWTA 5J1YA 5EDNA 3CTVA 4YCAA 1TC3C 3PO3J 2Y30A 3ZW8A 2GF2A 3HOYJ 1D5YA 3JRHA 2OF7A 1S7EA 5E3MA 2O7OA 1GVDA 1BL0A 2DMTA 2Y9YA 1F14A 1A5JA 2VI6A 2K40A 4DZJA 1PGPA 1H8AC 1M76A 3O8HA 1LJ8A 3LSRA 2HYJA 1I50J 3G1LA 4JYKA 1H88C 4GFBA 3WFJA 3BR6A 3VPRA 1NTCA 4JPZB 3MOGA 2EH3A 2CRGA 5C4XJ 2EBIA 4ABZA 5BNGA 1M66A 4XRSG 3H3VK 2EZIA 5M3MJ 3QPSA 2DA2A 5EGOB 1X0VA 1ZR4A 1WH5A 1KS9A 4IEJA 2FD5A 5E3OA 3ADPA 4D7NA 2WAQN 5K7HA 2WB1N 1JGGA 3A03A 1AKHA 5A9SB 2TRTA 3GBGA 4C3JJ 5IYDJ 4S0HB 2ID3A 4D5FA 1ETKA 1LFBA 1PGNA 4A3JJ 2JKVA 1JTYA 2LY9A 2ELKA 2R5ZA 1JUPA 1RPWA 2KT0A 3ZQHA 2HOTA 4E21A 3HEFA 2E2HJ 3S14J 5J1UA 3G17A 3SFIA 2LTPA 2JK3A 3S15J 1IL0A 3K2AA 4B3HA 4DW6A 1T33A 3A01A 1HCRA 1HDPA 3HDDA 2XGDA 1BA5A 1FTTA 3Q0VA 3BG3A 2GM4A 1CQTA 9ANTA 1WDLA 1YJQA 1TWCJ 2Y31A 3S16J 4BBRJ 1RKTA 3IV5A 1JTXA 2JA6J 5C3EJ 5JE8A 3BTJA 3ZQFA 1B72B 4DYQA 2LD5A 2RAEA 5C44J 1B8IB 1DU0A 1HLVA 2NOGA 3RQSA 2IZ0A 4M3EA 4A3EJ 4FGWA 3ZWBA 4PZDA 2NVQJ 3M3YJ 1G2HA 4MFEA 2O8KA 4FTHA 2XSDC 2JA8J 2E2JJ 1YJ8A 1WDMA 4A3KJ 4BKXA 1VPDA 2HOAA 4MFDA 3Q3CA 2DN0A 2X9DA 4FISA 1RETA 3HOVJ 1F0YA 2ZYGA 3ZOBA 2DTZA 4JP0A 2WV1A 3S1QJ 2NVXJ 3DEWA 3QQAA 4JX4A 4E13A 2AO9A 1AU7A 1DLJA 3QHAA 1ZTRA 4A3GJ 1MBEA 3HKZN 3O8GA 4W97A 4QIWN 4UUSB 4PZCA 4RDUA 4D3DA 2R5YB 3HOUJ 2Y2ZA 3BT9A 1N1GA 2Y0SN 3JR9A 1Y1VJ 3ZQCA 1ZR2A 1Z77A 1I3QJ 5IP6A 2Y9ZA 2LLKA 1LE8B 3BG9A 4S3MA 1LE8A 2FQ4A 1E3OC 3TP0A 2XB5A 1JKQC 3W6UA 2QCOA 3H2ZA 4V2FA 2XGEA 2FJ1A 3OIOA 1JUMA 1HOMA 2DMPA 2VKVA 1RKWA 2LVSA 3JRGA 1YRLA 4OL9A 1OJLA 4UUTA 3BQZA 4MO7A 3DFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHW A;  1ETY A;  4C2M J;  5M5Y J;  5K7Z A;  1A6I A;  5M3F J;  1MSE C;  5EYR A;  3LOC A;  1FEX A;  4B4C A;  5K7F A;  2CJJ A;  1VF9 A;  2CUF A;  4XK4 A;  3ZQG A;  1MSF C;  1UHS A;  1K61 A;  4BY1 J;  1TWF J;  4M6V A;  4QSH A;  2GBY A;  3BR0 A;  2DA5 A;  1JKP C;  2LK2 A;  2LP0 A;  5F27 A;  5EF6 A;  4A3I J;  2P81 A;  3MN2 A;  1F36 A;  3HOW J;  1NK2 P;  4M3B A;  1GDT A;  5DS9 A;  2DA7 A;  4DYC A;  4DCK A;  2MSY A;  1AHD P;  5EGO A;  3Q0W A;  3GTP J;  2I10 A;  4A3C J;  4XRM A;  3TW7 A;  1BJZ A;  4A3D J;  2DA6 A;  4FE7 A;  4W1U A;  2DMN A;  1JKR C;  2LFB A;  2X6O A;  1SFO J;  2KDZ A;  3G1O A;  4A3M J;  3OSG A;  1U8B A;  1IRZ A;  2AHQ A;  2ME6 A;  5GP9 A;  1GUU A;  1WI3 A;  4QTR A;  1GV2 A;  1W0U A;  5M5X J;  3HM5 A;  2CU7 A;  2DMU A;  3NAU A;  4I76 A;  2YUS A;  1ZK8 A;  2JA7 J;  2TCT A;  4IHX A;  3HGG A;  4AUX A;  1U9O A;  1GT0 C;  3MVP A;  1LFU P;  3A01 B;  3CDL A;  2XRL A;  3BR3 A;  2L7M P;  3JRD A;  4CYC A;  1VND A;  4MLO A;  3RKQ A;  1JJ6 C;  2JA5 J;  3TW6 A;  2ID6 A;  1APL C;  4BBS J;  2JN6 A;  1XG1 A;  5EEA A;  1JJ8 C;  1X2M A;  1JT0 A;  3LSJ A;  2NVY J;  3DCF A;  3F0C A;  1FIP A;  4JQ0 D;  1RR7 A;  2NVT J;  2EZL A;  1XS9 A;  2E2I J;  3OSF A;  1FTZ A;  2E19 A;  2H1K A;  2VPR A;  1IDY A;  2DA3 A;  3B6A A;  5FJ8 J;  2L0K A;  3ZQL A;  3HBL A;  2H8R A;  2PMZ N;  4I6Z A;  1NK3 P;  2DA1 A;  1IUF A;  4J19 A;  4IHY A;  2CQQ A;  4UUS A;  2ME0 A;  4X1E A;  5J3L A;  1ETQ A;  3HB9 A;  1WH7 A;  5GPC A;  1JT6 A;  5EG0 B;  3W6V A;  3ZQI A;  2HOS A;  2M2E A;  1MNM C;  1X2N A;  2R0Q C;  4A3L J;  3M4O J;  4JX5 A;  3S17 J;  1QVU A;  4Y7N J;  2K9S A;  2NS7 A;  2QF7 A;  3QPL A;  2XGC A;  1X58 A;  5E3L A;  4AC0 A;  4IHV A;  1ETX A;  5F0C A;  5JLW A;  4JX6 A;  1MBK A;  1IC8 A;  5HOD A;  5EG0 A;  2ECB A;  4M3G A;  2JJ7 A;  1UG2 A;  4LOC A;  3E7L A;  2OPT A;  3IH2 A;  5F0F A;  4D5C A;  1W0T A;  3JRA A;  2CQX A;  1MH3 A;  2YU9 J;  3JRB A;  3BR1 A;  4C3I J;  3TED A;  3S2H J;  2N8G A;  3HGY A;  1SAN A;  2HXO A;  1QPI A;  4M3F A;  2VUM J;  1UMQ A;  3LNQ A;  1FJL A;  2L9R A;  4C3H J;  4B3A A;  3D1N I;  4XID A;  4BY7 J;  1ETV A;  1ZQ3 P;  1IGN A;  1AKH B;  3BQY A;  2DA4 A;  3OOU A;  3LSP A;  4RBO A;  2B63 J;  3BTL A;  1QRY A;  2XPV A;  2D5V A;  3GTO J;  1WCM J;  4BXX J;  1FIA A;  2K9Q A;  1K83 J;  5GPA A;  4OVN F;  2DJN A;  2YS9 A;  2ZB9 A;  4A3B J;  4L5E A;  1OCP A;  1U9N A;  1I6H J;  2M9H A;  1IJW C;  2HDD A;  1ENH A;  3S1M J;  3CCY A;  2IBD A;  4A69 C;  4HNV A;  1T56 A;  3G1M A;  5FKN A;  1TWA J;  3CMY A;  4AYB N;  1ZGW A;  2G0E A;  4A93 J;  1EF4 A;  1GV5 A;  5IYB J;  1TWG J;  5IP9 J;  1MH4 A;  1MBJ A;  2O9L A;  2CUE A;  2M34 A;  1OFC X;  3IH3 A;  1B72 A;  4XIC A;  1B8I A;  2L7F P;  4M3D A;  3FIS A;  1WPK A;  1QVT A;  5EZG A;  3SJM A;  5IOY A;  1TWH J;  1MBF A;  2XPU A;  3GTK J;  2R7Z J;  5IOZ A;  3PM1 A;  3RQI A;  3WHB A;  4XRS A;  3BTC A;  5F04 A;  2GLO A;  3H0G J;  1R9T J;  2HXI A;  5F1J A;  2LKX A;  4CYC B;  2IAI A;  1BW6 A;  4V2G A;  3S1N J;  5FLV A;  2IEK A;  3BR2 A;  5FKO A;  3WHC A;  3RZO J;  3JRF A;  1HDD C;  1ETO A;  3GTJ J;  4X6A J;  1OCT C;  4MIM A;  2HI3 A;  3JRC A;  2XPW A;  2JMW A;  5E3N A;  1IV6 A;  3I4M J;  5F08 A;  1ORK A;  1P7I A;  3MKL A;  1PUF B;  1P7J A;  2VKE A;  4EEF G;  2LR8 A;  1MBG A;  3LSG A;  4NDL A;  3GTQ J;  4FE4 A;  3HOZ J;  2EQR A;  3FKI J;  2M8G X;  1O4X A;  3C2B A;  5EZH A;  1JKO C;  1BW5 A;  4D7M A;  2K9N A;  4G12 A;  5C4J J;  4Y52 J;  1VFC A;  2E1O A;  3S2D J;  2MW8 A;  3BR5 A;  1Q1V A;  3GTL J;  5F0H A;  1ETW A;  3IH4 A;  5FKL A;  2ECC A;  5FKM A;  3GTG J;  2EZK A;  3TP3 A;  1WGX A;  2MGQ A;  3JRE A;  1PUF A;  2R93 J;  2R5Z B;  5FLM J;  1Z0X A;  3Q3S A;  3HOX J;  1U78 A;  2COB A;  5JLX A;  5IP7 J;  1IG7 A;  3SDG A;  1RES A;  1ZKG A;  3L1P A;  3A02 A;  2DMQ A;  4B1R A;  3S1R J;  3RZD J;  2R92 J;  1YRN B;  5IPA A;  1XC5 A;  1YRN A;  3PO2 J;  1JUS A;  2HQ5 A;  3BG5 A;  3K7A J;  4FCY A;  5DTD A;  1IDZ A;  1DU6 A;  2MG4 A;  4DYR A;  3FIW A;  2NS8 A;  2L7Z A;  4A3F J;  2W48 A;  5FKK A;  2X48 A;  1ITY A;  4DZP A;  3I4N J;  3CQZ J;  2XB0 X;  2FX0 A;  3FK6 A;  3GTM J;  1H89 C;  5J1R A;  2R5Y A;  3BTI A;  3NAR A;  1Y1W J;  3UKG A;  3B6C A;  1VI0 A;  1POG A;  3FK7 A;  2M0C A;  3Q0U A;  5IYC J;  3JRI A;  1HF0 A;  1F43 A;  5M5W J;  2EZH A;  1MBH A;  2JWT A;  5J1Y A;  5EDN A;  1TC3 C;  3PO3 J;  2Y30 A;  3HOY J;  1D5Y A;  3JRH A;  2OF7 A;  1S7E A;  5E3M A;  2O7O A;  1GVD A;  1BL0 A;  2DMT A;  2Y9Y A;  1A5J A;  2VI6 A;  2K40 A;  4DZJ A;  1H8A C;  3O8H A;  3LSR A;  2HYJ A;  1I50 J;  3G1L A;  4JYK A;  1H88 C;  4GFB A;  3BR6 A;  3VPR A;  1NTC A;  4JPZ B;  2EH3 A;  2CRG A;  5C4X J;  2EBI A;  4ABZ A;  5BNG A;  4XRS G;  3H3V K;  2EZI A;  5M3M J;  3QPS A;  2DA2 A;  5EGO B;  1ZR4 A;  1WH5 A;  4IEJ A;  2FD5 A;  5E3O A;  4D7N A;  2WAQ N;  5K7H A;  2WB1 N;  1JGG A;  3A03 A;  1AKH A;  2TRT A;  3GBG A;  4C3J J;  5IYD J;  4S0H B;  2ID3 A;  4D5F A;  1ETK A;  1LFB A;  4A3J J;  1JTY A;  2LY9 A;  2ELK A;  2R5Z A;  1JUP A;  1RPW A;  2KT0 A;  3ZQH A;  2HOT A;  3HEF A;  2E2H J;  3S14 J;  5J1U A;  3SFI A;  2LTP A;  2JK3 A;  3S15 J;  3K2A A;  4DW6 A;  1T33 A;  3A01 A;  1HCR A;  1HDP A;  3HDD A;  2XGD A;  1BA5 A;  1FTT A;  3Q0V A;  3BG3 A;  2GM4 A;  1CQT A;  9ANT A;  1TWC J;  2Y31 A;  3S16 J;  4BBR J;  1RKT A;  3IV5 A;  1JTX A;  2JA6 J;  5C3E J;  3BTJ A;  3ZQF A;  1B72 B;  4DYQ A;  2LD5 A;  2RAE A;  5C44 J;  1B8I B;  1DU0 A;  1HLV A;  2NOG A;  4M3E A;  4A3E J;  2NVQ J;  3M3Y J;  1G2H A;  4MFE A;  2O8K A;  4FTH A;  2XSD C;  2JA8 J;  2E2J J;  4A3K J;  4BKX A;  2HOA A;  4MFD A;  2DN0 A;  2X9D A;  4FIS A;  1RET A;  3HOV J;  3ZOB A;  2DTZ A;  4JP0 A;  2WV1 A;  3S1Q J;  2NVX J;  3DEW A;  3QQA A;  4JX4 A;  2AO9 A;  1AU7 A;  1ZTR A;  4A3G J;  1MBE A;  3HKZ N;  3O8G A;  4W97 A;  4QIW N;  4UUS B;  4RDU A;  2R5Y B;  3HOU J;  2Y2Z A;  3BT9 A;  2Y0S N;  3JR9 A;  1Y1V J;  3ZQC A;  1ZR2 A;  1Z77 A;  1I3Q J;  5IP6 A;  2Y9Z A;  2LLK A;  1LE8 B;  3BG9 A;  1LE8 A;  2FQ4 A;  1E3O C;  3TP0 A;  2XB5 A;  1JKQ C;  2QCO A;  4V2F A;  2XGE A;  2FJ1 A;  3OIO A;  1JUM A;  1HOM A;  2DMP A;  2VKV A;  1RKW A;  2LVS A;  3JRG A;  1OJL A;  4UUT A;  3BQZ A;  4MO7 A; 
#chains in the Genus database with same CATH topology
 3SDB A;  4L5J A;  4I02 A;  4A0Y A;  1IAW A;  1OR7 A;  1U57 A;  1SQB K;  1M2W A;  1A6I A;  1UEL B;  4HDV A;  3FMQ A;  1FBQ A;  1OYI A;  1WZ2 A;  3LAP A;  2VON A;  3SWY A;  5EYR A;  1XSD A;  1R5H A;  3CO6 C;  4C9Y A;  1KYZ A;  4XK4 A;  1CSB A;  4I09 A;  4N0B A;  3QOE A;  3HUG A;  4II2 A;  5ICE A;  3JTH A;  1AA7 A;  1YFH A;  3CCV I;  4BY1 J;  4M6V A;  5CCG A;  1R7J A;  1LUJ B;  2GBY A;  1X1P A;  1GZL A;  1L0L E;  3HKZ A;  1SC7 A;  1N25 A;  1SD4 A;  1FBS A;  4CCK A;  2E5N A;  3BR0 A;  1I6X A;  1V5E A;  1JKP C;  1P4X A;  4KMF A;  2IPP A;  1YVE I;  1MW7 A;  2FNA A;  2LP0 A;  5F27 A;  4A3I J;  2E76 C;  5DV5 A;  5DYM A;  5JFR A;  1YO5 C;  5IY5 H;  4KJZ A;  2BXY A;  3PLR A;  1M67 A;  1GU5 A;  4KT6 A;  1QZZ A;  4NC7 A;  4WWI A;  2MSY A;  1BR2 A;  1JXS A;  4XOP A;  4XNF A;  1L0L D;  1TT5 B;  3TW7 A;  2WSE H;  1BJA A;  2K9Y A;  3A7O A;  5K1Y A;  1BG6 A;  5AW5 B;  3KZZ A;  1JKR C;  2K5C A;  4IVN A;  1DD3 A;  3K70 C;  2HKO A;  1HC8 A;  3OIP A;  3TOB A;  1PYV A;  3MGN A;  1IJD B;  3ZP5 A;  4HZF A;  1OX3 A;  1T0F A;  3U21 A;  4LGD E;  5LRS A;  4JQF A;  3H3U A;  4HOB A;  4GWK A;  4U87 A;  2YKP A;  1N2D C;  2DYR H;  3OIQ A;  4QPO A;  3WTY C;  3P8M C;  3RL0 C;  1DUX C;  2A5W A;  2Q3E A;  4I76 A;  3RYR A;  1DLI A;  2WT7 B;  4U3F J;  3PL8 A;  3HN2 A;  3GCM A;  2CPB A;  2HGC A;  1HJ0 A;  1Z21 A;  2BHY A;  2E35 A;  1M57 D;  1N7S D;  1LFU P;  2QM3 A;  2Z16 A;  1MDM A;  3H6P A;  5MGB A;  3A01 B;  2P4W A;  3CDL A;  1FWZ A;  1Z82 A;  2RN0 A;  1ZLL A;  1LNQ A;  2FYU G;  3BR3 A;  4GO1 A;  2CK3 H;  4KIG A;  2ZME B;  1Z6T A;  3KEY A;  3LW5 H;  1WJE A;  3HPH A;  2Y48 A;  1BE3 J;  4D3S A;  1KU3 A;  1S7A A;  4HF1 A;  2M3B A;  3CCE I;  3T0Y A;  3MD2 A;  4HRI A;  1K04 A;  4BBS J;  3A0H H;  1FY7 A;  2JN6 A;  3FHN A;  1XG1 A;  5DUK A;  4IXA A;  3FM3 A;  3RCO A;  2HVR A;  2WSF J;  3PSF A;  1N8R Q;  2XKP A;  2ZJQ F;  2NRA C;  3DCF A;  2B9S A;  1FIP A;  1GLN A;  2EZL A;  5CVI A;  2IVM A;  1YX5 A;  4HG2 A;  1YIO A;  4NQW B;  1VZ0 A;  3CCU I;  3OSF A;  1FTZ A;  2FY8 A;  2KDO A;  1YYV A;  3ABT A;  4GYG A;  1KB9 H;  1YQ4 C;  2RH0 A;  2VXD A;  2DA3 A;  5KAI E;  3B6A A;  3MKY B;  4ZYA A;  2IS4 A;  4H44 D;  4E6K G;  5FJ8 J;  4PJ0 E;  1FZP B;  2KIS A;  3ZQL A;  3RIR A;  3TGU D;  2PMZ N;  1PFI A;  5E8I A;  4OIN F;  3MUD A;  4IHY A;  5B66 H;  2EB7 A;  2E1M B;  5AVY B;  5K5R A;  4F91 B;  3PUF A;  1J0R A;  3H1L D;  2KKO A;  4X1E A;  2XV4 S;  3Q1M A;  1Y8R B;  1QA6 A;  3EQ2 A;  1JT6 A;  5EG0 B;  4E7K A;  5KVR A;  3MIW A;  4S04 A;  2WIT A;  3AE7 C;  3LA7 A;  2VLA A;  3OOP A;  3E6D A;  3AAF A;  1EV7 A;  3AG3 H;  3HRU A;  2FYN C;  1Y8Q B;  4XLC A;  4HQM A;  2R7O A;  2F4M B;  3MZ8 A;  4JX5 A;  4BU2 A;  3N97 A;  3M4O J;  3PJR A;  1RF1 C;  2ZXJ A;  1M1K Q;  3I56 I;  3MCZ A;  5KAI C;  1L4A B;  3MP7 B;  3H9J A;  2XGC A;  1X58 A;  4ZYH A;  5E3L A;  2YKQ A;  3SWF A;  2HPC A;  3MWM A;  5L3E A;  2DOE A;  3F89 A;  3V4Q A;  4Y99 B;  1W2E A;  3TDZ C;  3EUA A;  1S3J A;  1W7P D;  3IP4 B;  2ECB A;  3ZXS A;  5LBQ A;  3ZGY A;  1KQ0 A;  2DJI A;  2JJ7 A;  1YJN P;  5LGT A;  1OVR A;  2IXS A;  2LRE A;  1KU7 A;  1QU3 A;  1KIL B;  1T98 A;  1NTK K;  1SQP K;  3IH2 A;  2MFZ A;  1CI6 B;  3ITK A;  1W0T A;  3S93 A;  3GEZ A;  3JRA A;  2CQX A;  3CES A;  1CF7 A;  1S5L C;  3VN0 A;  2KSE A;  3BR1 A;  4HST A;  4C3I J;  4WY4 B;  2FQ3 A;  4G6Q A;  3H32 B;  2TDX A;  1G3S A;  3VMA A;  3I9V 2;  3RDI A;  3LNQ A;  4U0Y A;  1SQB E;  2LDU A;  3A5T A;  2E7X A;  2Q3I A;  2LNB A;  4OH8 B;  1TW3 A;  1VF5 D;  4XID A;  4J0F A;  3L73 E;  4RES B;  2V7F A;  1EDJ A;  2W1O A;  3PNY A;  4CCO A;  1KFN A;  5IT9 K;  2B63 J;  1I36 A;  1U5T B;  5EJC A;  1QRY A;  3H1H G;  3G6E I;  3CXH I;  1WCM J;  4BXX J;  1FIA A;  1LWU C;  1NU1 J;  3HE5 B;  3L74 E;  2RRE A;  1BCC G;  3KZI C;  4KA4 A;  2OAR A;  2IGN A;  3HXL A;  3EQL F;  4BQO A;  3IQD B;  3ZQQ A;  5J4Y A;  2QG4 A;  1UHM A;  4XOT A;  1VQ8 I;  1SQP D;  1GD2 E;  3T5X A;  2R3C A;  2HZD A;  3B5N A;  2LOO A;  2HDD A;  3S1M J;  3WFI A;  1BC7 C;  2LG4 A;  3S1K A;  4U3F D;  3PQJ A;  3TNU A;  2ITA A;  1ON1 A;  3O6B B;  1TWA J;  5LGN A;  3CMY A;  1ZGW A;  1T2K A;  3L75 E;  4BHB A;  1MH4 A;  3CL3 D;  2CUE A;  2QUF A;  4HLY A;  2EPF A;  2FXA A;  4OMZ A;  3HTU A;  3S2W A;  1DH3 A;  2KJB A;  1B72 A;  1U5T C;  5FB2 A;  4I2O A;  2L7F P;  2IYP A;  3V4W A;  4NBQ A;  5IOY A;  1PZQ A;  3CX5 E;  3OYK A;  1E79 H;  2E7W A;  1Z7L A;  4HX8 A;  3DKX A;  2IBZ I;  3WHB A;  3H3Z A;  1TZL A;  2OFP A;  1T6S A;  2KLU A;  4AD9 A;  2GLO A;  3DBH B;  4DGW B;  1FAV A;  4XSZ F;  2JUG A;  3GUD A;  4G94 A;  1R9T J;  4OQZ A;  2D2C B;  4AU7 A;  2AXC A;  5F1J A;  3FWN A;  2QM8 A;  3K5B A;  2G3A A;  1FX7 A;  4V2G A;  3RBX A;  2BZT A;  2O61 A;  4YFX F;  2YPR A;  3BR2 A;  2A45 H;  3BWG A;  3H5R A;  2R3S A;  1MJB A;  3FF5 A;  2YXR B;  3VMZ A;  1STZ A;  2XF5 A;  4B44 A;  1XDU A;  2A3S A;  2IS6 A;  1W5C C;  3ECO A;  4HV5 A;  2HI3 A;  2YX4 A;  4ASV A;  4I6M C;  2FE3 A;  1JY2 P;  5E3N A;  1BDD A;  1LWU A;  1AFO A;  1J9I A;  1LTA C;  5TIS E;  1FJP A;  2H8P D;  2O0Y A;  2GA1 A;  1ZME C;  1P7I A;  5A9R A;  2WSC H;  2QA4 I;  3MKL A;  4F3Q A;  2VKE A;  3A4C A;  3AEC C;  3D5L A;  2QJP B;  2OBP A;  4M73 A;  3QPT A;  3HE4 B;  1SFC B;  2V6C A;  2E1N A;  3CCQ I;  3A0B E;  2E75 C;  2PMH A;  1SFC D;  5ED4 A;  2M0M A;  1JDJ A;  1KYW A;  3FKI J;  4R79 A;  4B3I A;  2K4B A;  2ELH A;  3DPL C;  5EZH A;  2P0W A;  1KZU B;  3PFI A;  4D7M A;  1AV1 A;  2P7C B;  2PRR A;  2D2W A;  1K6O A;  1EVZ A;  4KUH A;  2OQQ A;  1Z05 A;  2QBY B;  1EXJ A;  4ZZD A;  2F5C A;  2LR2 A;  3GHG B;  4ZYD A;  1SQQ J;  5LD2 C;  3GTL J;  4U3F G;  5F0H A;  2W7N A;  3IH4 A;  5FKL A;  4E7J A;  2R7U A;  1U5T A;  5AYV A;  2L01 A;  4FQG A;  3I0T A;  2CQ7 A;  3PFY A;  1P4W A;  3GTG J;  3EGO A;  5HS9 A;  3TP3 A;  1WGX A;  2MGQ A;  2R7W A;  3JRE A;  1XTA A;  2FOW A;  2VJ4 A;  1W36 C;  2R93 J;  1L0N E;  4PSX A;  3ZMV A;  3BCC E;  3L72 G;  1CW5 A;  3DEU A;  5GAE J;  3OR2 C;  4XKV A;  4N4O B;  2H1L A;  4Z2Y A;  1W4M A;  4Z1M H;  5CVV A;  4CIC A;  3F21 A;  3CUQ C;  5KLI B;  5L3B A;  3BPX A;  3BPV A;  2LBF B;  1AA0 A;  2COB A;  3NMD A;  3I55 P;  4KMU X;  3D0S A;  5IP7 J;  1OYW A;  2HDW A;  4OIO F;  4KT0 J;  3SDG A;  1NG6 A;  5B66 C;  2ZFU A;  1SMY F;  4I7Z C;  1D0Y A;  2CWE A;  2MH2 A;  3BZK A;  1XMX A;  3TL4 X;  3L1P A;  5A9S A;  4PD4 D;  2ZVO B;  3KPH A;  1V54 H;  3AE1 C;  4NNJ A;  3RZD J;  1BSH A;  2R92 J;  3MD0 A;  2K3P A;  4D3F A;  2WC2 A;  1Q90 D;  5DJU B;  3ESW B;  2E60 A;  3TMO A;  1PGJ A;  1VF5 B;  4UXN A;  3F8N A;  3T97 B;  2HYG D;  2X6X A;  1LTG C;  3AEE C;  3QU6 A;  2ELJ A;  1NTM K;  3HSR A;  5FWN A;  3K7A J;  1XSX A;  1P84 I;  3V2R A;  3KP3 A;  2PN6 A;  3MQ0 A;  1LTJ C;  1LSO A;  3L71 J;  2Q2E B;  4DYR A;  2K9L A;  3JCU C;  2FRH A;  1YQ3 C;  2Y75 A;  3P8C D;  2J5P A;  4BRY B;  2NS8 A;  3K4N A;  1LQ1 A;  2YKO A;  4ESJ A;  3VSL A;  2NNN A;  1KGS A;  2ZAE B;  1ZLJ A;  1DIP A;  3JTG A;  2RKL A;  1ITY A;  2X48 A;  5L3D A;  3WGH A;  1NTK E;  1LJ9 A;  3V7S A;  4BH9 A;  2FX0 A;  3KCC A;  2V9K A;  1WJD A;  2V1D A;  1JY2 N;  1LGH B;  1NAF A;  3BRV B;  2M1B A;  5J1R A;  3M8J A;  1HKQ A;  2CO5 A;  2XZR A;  2V1X A;  2QZ8 A;  2L5Q A;  1NKZ B;  3D6Z A;  1W5S A;  1KQF B;  3F8B A;  3I4P A;  4MTD A;  3CD6 P;  2XNX A;  1HF0 A;  3HD7 A;  5H6R A;  5M5W J;  2EZH A;  1G3T A;  3V5B A;  2DXI A;  2Y30 A;  3LA2 A;  5EEH A;  3ZW8 A;  4AQR D;  3AEG C;  2M8E A;  3HOY J;  1SFC A;  1FPQ A;  1QQI A;  4U7B A;  4EJV A;  3JRH A;  1AJY A;  1URQ B;  1VQ9 P;  3H92 A;  2PMU A;  2PQ8 A;  2O03 A;  2VAS A;  3S3M A;  4WXC A;  2A45 G;  3TK1 A;  1TQP A;  3DBL B;  5KTB A;  3MEX A;  2Q7C A;  4HEA 2;  4ASW A;  2DMT A;  2CMP A;  2F4I A;  3L71 D;  1M1J B;  2EFO A;  2W4S A;  3HOT A;  1A5J A;  1PGP A;  1X79 B;  2R5B A;  1LDD A;  1S29 A;  1FMV A;  2XAF A;  2KMU A;  1FLI A;  1N86 A;  2L91 A;  2Z1D A;  4JYK A;  4ENJ A;  2BCC J;  4GFB A;  3H1K E;  3HSE A;  1ON2 A;  1HQC A;  2HFE D;  4Y4R A;  4HF2 A;  3MOG A;  2EH3 A;  4JPZ B;  4C7R A;  2CRG A;  2EBI A;  5AW0 B;  1NU1 G;  3VYS B;  1RF0 C;  1HW5 A;  2LF7 A;  5D4S A;  5M3M J;  3NTN A;  1M7L A;  2O01 H;  2DA2 A;  1QO0 D;  1BIA A;  3M9B A;  3ZDM A;  3EUK L;  3RJP A;  2O8X A;  4OIQ F;  4D7N A;  1E17 A;  2H6B A;  1KIL E;  1K8A Q;  2KSJ A;  2VQG A;  2J5U A;  1RY3 A;  2WSS H;  3IFM A;  1JMB A;  3A03 A;  4I2L C;  1OIS A;  5A9S B;  3EWK A;  2L3D A;  3HRM A;  4ZNC A;  5HS8 A;  2ZT9 B;  4XLA A;  1RZ4 A;  3SQN A;  2Q6Q A;  5AVZ B;  1KU9 A;  3D71 A;  2LY9 A;  3LMM A;  1IF1 A;  4JYB A;  4EDF A;  1JY3 O;  4ESF A;  3ABK H;  1WSU A;  4WY4 A;  2PFX A;  1RPW A;  3L2C A;  4RLQ A;  2GOX B;  2LRD A;  3G17 A;  4L9N A;  2EIN H;  3SFI A;  1ZN2 A;  1KQ9 A;  4RS8 A;  2HEO A;  1IL0 A;  1NAY A;  2P5L C;  3CJN A;  1D0X A;  3R2P A;  3QU3 A;  1OYY A;  1V3F A;  3HZJ A;  3BG3 A;  4FX0 A;  3L2R A;  2O3J A;  1QHG A;  1R71 A;  1OCR H;  2HR3 A;  4OIR F;  3FM5 A;  4CXF A;  5J47 A;  2OYH B;  2VC0 A;  1EZV E;  2RMZ A;  3II6 A;  1HXD A;  3DTE A;  4Y28 J;  4LLL A;  3GZN B;  2B9B A;  3S3N A;  2OYH C;  3ZQF A;  1P84 D;  4L18 B;  1B8I B;  2EV0 A;  4H13 B;  1HLV A;  3D70 A;  3DV8 A;  1IXS B;  1YW7 A;  1RQV A;  5FGM A;  2IA0 A;  2VN2 A;  4FGW A;  1LTJ A;  1Y47 A;  2NVQ J;  2FBK A;  4CYD A;  1G2H A;  3BJ6 A;  2O8K A;  2STW A;  4RMN A;  2XSD C;  3B02 A;  1VQ9 I;  4HBL A;  2PEX A;  1UJ8 A;  1WDM A;  2HVS A;  5E20 A;  4A5M A;  3QWO C;  2HOA A;  2I5U A;  3C9I A;  3ASN H;  3L2W A;  2NPS C;  1DP7 P;  1LTS C;  1RET A;  4BL0 B;  1F0Y A;  2K9J A;  2DTZ A;  2WV1 A;  3S1Q J;  1SLQ A;  3J81 Z;  1S9K E;  1NG7 A;  3R6S A;  3F23 A;  1AU7 A;  1DLJ A;  1UHW A;  1HTL C;  2V7Q J;  3ZQ7 A;  4H44 C;  3I53 A;  1JTH B;  2OYI B;  3KP6 A;  1H9T A;  1NTZ E;  3HKZ N;  2D45 A;  1GVJ A;  3KET A;  3LFK A;  2CUJ A;  2FA5 A;  1L0L K;  3SHF A;  1MKM A;  1XTG B;  1P92 A;  3GMA A;  2IBZ E;  2VE8 A;  3V8J A;  1MJ9 A;  4U7D A;  2X1C A;  3F8F A;  1IRF A;  4U0W A;  1LT9 C;  5J6X A;  3ZQC A;  4BAC A;  1SQX J;  5DJT B;  2STT A;  2LLK A;  1YJ9 I;  1PPJ D;  4NQW A;  3ULQ B;  1ZP0 C;  3C3W A;  3VDX A;  1SEU A;  2K88 A;  1S9K D;  2Z3Y A;  5E79 E;  3TP0 A;  3HYI A;  4MN4 C;  1SVM A;  1YTZ I;  4CSW A;  4OAY A;  4XQF A;  3OYG A;  2R7F A;  1K05 A;  1VQ6 I;  4N78 D;  3ZMU A;  3AFH A;  2PP6 A;  1BI3 A;  1T95 A;  2LXC B;  4CZC A;  1KIL C;  2VKV A;  4PFP A;  1RKW A;  2KZI A;  3AEF C;  4OL9 A;  4HYE A;  1SQX D;  1SAX A;  1SFE A;  2MH9 A;  3DXJ F;  1IRG A;  5LHG A;  4IHW A;  1Z91 A;  4PJN A;  3M8E A;  3IL2 A;  2KP6 A;  2DT6 A;  1Y39 A;  1FZB A;  2YO2 A;  3HE4 A;  1L3L A;  1YON A;  1RF0 A;  3VSK A;  1FEX A;  4B4C A;  1RE3 C;  1N1E A;  3CJR B;  2ETH A;  1JCD A;  2CUF A;  3I64 A;  5BMZ A;  4ZKP A;  2G7U A;  1FBU A;  5KCM A;  1MZ9 A;  3IF4 A;  3IR9 A;  4PV1 B;  2FFD C;  3KZY A;  1FE6 A;  1P6R A;  2NPS A;  1TWF J;  3ZMS A;  1VQ4 I;  3C2H A;  1B4A A;  2UZK A;  5A2Q K;  4JBA A;  3KZI E;  3UIA A;  5CCH A;  1BOA A;  2WA0 A;  1U8R A;  3GG2 A;  5FD6 A;  2DDA A;  3H36 A;  1BC8 C;  4EJW A;  5B1B H;  1MFZ A;  1ODD A;  2P81 A;  3C7J A;  1USS A;  4KJM A;  3TYY A;  3V2N A;  3RKY A;  3HOW J;  2VPL A;  1R5I D;  2IP2 A;  3ZHB A;  2YIU C;  4WY4 C;  1GDT A;  4HW0 A;  4DYC A;  1AHD P;  3Q5R A;  3Q0W A;  3GTP J;  4XSX F;  4XMY A;  2R7X A;  2QVO A;  4PV1 C;  4M6X A;  5APQ A;  4A3D J;  3OYB A;  3H1H D;  2DA6 A;  1MDM B;  1BOB A;  4W1U A;  3K1P A;  2VC1 A;  5JVG F;  3L73 J;  1FZC C;  3E0J B;  5TGT A;  3OYH A;  1A02 F;  5B5E E;  2WPQ A;  2LFB A;  1SFO J;  2AQF A;  3GLM A;  3G1O A;  4RB1 A;  1F4K A;  1X1C A;  2D3T A;  4FT8 A;  3K6J A;  4D6T G;  2AHQ A;  2E43 A;  1GUU A;  1WI3 A;  4RLF A;  1SQV J;  5DEQ A;  4IHS A;  1J1D C;  5M5X J;  3HM5 A;  2JSC A;  4ZDP A;  2QWW A;  5BU8 B;  2CU7 A;  4LLG F;  3OYA A;  3WG7 H;  2LH9 A;  3NAU A;  4IO9 F;  1M75 A;  4XR6 A;  1FSE A;  2JA7 J;  1XD7 A;  1DQU A;  1FDI A;  4OWF A;  2RKH A;  1O7L A;  2QJK C;  2ZXX A;  3J80 Z;  3MVP A;  3K4L A;  3SZP A;  3P32 A;  5D5X B;  4YG2 F;  3L70 D;  3Q5P A;  2FEZ A;  4WWC A;  2L7M P;  4MHG A;  3WTS C;  4CYC A;  2FFD A;  3CP2 A;  2PBI A;  1VND A;  4MLO A;  3RKQ A;  1L0N K;  1LT1 A;  1WVR A;  4FET A;  4XON A;  1FZG A;  2ID6 A;  2W00 A;  1M1E B;  2HOE A;  2JVG A;  1JM0 A;  4IQ4 A;  3Q9V A;  1ZRE A;  2KPM A;  1N7S A;  2PJR B;  5LLQ A;  1WJ5 A;  1OZH A;  1X3W B;  1D1C A;  4MEX F;  1TXG A;  2QRX A;  3R4Y A;  2WT7 A;  4F7Z A;  2HNH A;  4L9V A;  3ZMZ A;  4BEH A;  4YXW H;  1G3W A;  2CG4 A;  4ANJ A;  4ZTJ A;  1LT9 A;  3CME P;  4BEH B;  4H13 C;  2E19 A;  2DOA A;  1I5Z A;  4HA8 A;  1PGQ A;  2D2C D;  5APU A;  5AW3 B;  1NKN A;  3W2W A;  1SQV E;  1SFK A;  2DO7 A;  3G4S P;  3TBI A;  1V55 H;  1KB9 E;  4J01 A;  2OQR A;  2H8R A;  4PJ0 H;  3P7N A;  4I6Z A;  1NK3 P;  2PAJ A;  5AW1 B;  4J19 A;  5HNH A;  2C6Y A;  3RK2 D;  2LKM A;  4FAS D;  3H1C A;  5J3L A;  3LSM A;  2EW2 A;  5B66 E;  2MD0 A;  2DU9 A;  2OZ6 A;  2XAU A;  2P5V A;  3Q5S A;  1GXQ A;  2HOS A;  4DIQ A;  3H1K D;  2L9S A;  1MNM C;  1X2N A;  2K86 A;  2XKO A;  2CS3 A;  4BQQ A;  3L35 A;  1QPM A;  2VQL A;  3FXQ A;  2YX7 A;  1JCC A;  1T6A A;  2H43 A;  2VKD A;  3CKY A;  3S17 J;  5GTI E;  3ZWC A;  2UYY A;  1QVU A;  2WTB A;  1BE3 G;  5BPD A;  1IXC A;  2L54 A;  4UVA A;  2QF7 A;  2OJE D;  2K9M A;  3QPL A;  4P9U A;  3TGN A;  2X58 A;  2F5F A;  2A45 I;  1FC3 A;  1SQP E;  2G8Y A;  3WOD F;  1L0L G;  3H32 A;  3E97 A;  4AC0 A;  1BE3 E;  2MD5 A;  2EV6 A;  4U7J A;  5F0C A;  3HD7 D;  2JO1 A;  2H94 A;  4U3F E;  2V9P A;  4JX6 A;  3D5R C;  1LVA A;  4G8X A;  2OC6 A;  5CPR B;  4XBF A;  4CCM A;  5JR3 A;  1DD4 A;  4HLX A;  1OW8 A;  3L2V A;  5HOD A;  2KS1 B;  1LKX A;  5CCH C;  4XE5 B;  3GHG A;  2HKX A;  2RV8 A;  4LOC A;  4UHT A;  1ZGA A;  4E12 A;  4XLF A;  4UVC A;  2P2U A;  4YRV A;  1J1E C;  3AE4 C;  2X85 A;  2XGX A;  4ZDL A;  1ZRC A;  3ABV C;  3JRB A;  4GBJ A;  2P8T A;  1SAN A;  3I83 A;  3JSV C;  2VQC A;  1LTJ B;  4M3F A;  1W7P A;  2M87 A;  4GDF A;  4KYW A;  1X3U A;  4R4L A;  4XN3 A;  2L9R A;  3H1I E;  3U9G A;  4C3H J;  2LBF A;  4ZYE A;  3D1N I;  4BY7 J;  3V42 A;  1ETV A;  5L3F A;  1IFN A;  1IGN A;  4OAZ A;  1AKH B;  5ICC A;  3BQY A;  4EJU A;  3OOU A;  2MA3 A;  1L0L J;  5KLV J;  3G3Z A;  1BCC D;  2MLG A;  2KL4 A;  2R7Q A;  2XPV A;  1HWT C;  1CI6 A;  4C7N B;  1IFP A;  3AE9 C;  1QZE A;  2K9Q A;  3FXO A;  1KYO H;  2PJR A;  3FWL A;  4OVN F;  3NQO A;  3BP8 A;  1MGT A;  1VDF A;  2ZB9 A;  5BVZ A;  4A3B J;  1K6Y A;  4L5E A;  4XKW A;  1OCP A;  5AVQ B;  1I6H J;  2IFM A;  1SQQ D;  2M9H A;  2HDH A;  4IM7 A;  2I1K A;  2IPQ X;  4O6J A;  4N9I A;  3CCY A;  2VT2 A;  2W90 A;  2IBD A;  3GFM A;  3G1M A;  4P9F A;  4A12 A;  3EYI A;  1NTZ K;  5IP9 J;  2L4A A;  2Q9I A;  3JSO A;  1MBJ A;  1OPC A;  4UB6 H;  3V2Q A;  2O9L A;  4IFF A;  1K9M Q;  3CCS P;  3IH3 A;  1OFC X;  3RK3 E;  5B1A H;  3CCU P;  1AVO A;  3C1L A;  2XV5 A;  4XIC A;  3CWB J;  4M3D A;  4KN7 X;  3GW2 A;  1WPK A;  2AXL A;  4A7P A;  5KLV G;  5EZG A;  4PUS A;  4U0V A;  4BHC A;  4AVZ A;  1TWH J;  2F48 A;  2XPU A;  3AG2 H;  3F22 A;  3GTK J;  2R7Z J;  2IBZ D;  3GW6 A;  2X6Y A;  3LQQ A;  3JCU E;  1S5L H;  5CYV A;  3FXD A;  3GYH X;  3KYD B;  1SQB D;  3BTC A;  4OQY A;  4OGQ C;  1PPJ E;  3CX5 H;  1NJI Q;  2DT5 A;  2R7D A;  2J5O A;  4LG0 B;  2K4J A;  3BJO A;  3OYF A;  4H0L D;  3CI9 A;  5AVR B;  3CUQ B;  3FGA D;  1R1V A;  2C0W A;  1NHL A;  4NB5 A;  5F1R A;  4M74 A;  1UG0 A;  1R5G A;  5FKO A;  2K1A A;  3JRF A;  2PX9 A;  2KNC A;  4LGW A;  1TW2 A;  1FOW A;  3GTJ J;  4X6A J;  2X6W A;  3PID A;  1X9V A;  1KA8 A;  1A31 A;  2A05 A;  3E3V A;  4MIM A;  2IT0 A;  1LEB A;  1N7L A;  4NC8 A;  1SP4 A;  2FXM A;  3OJA B;  3JRC A;  2JMW A;  1IV6 A;  4CHU A;  4LIT A;  3I4M J;  5C39 A;  2X1E A;  3AG4 H;  2IDB A;  1ORK A;  3GF2 A;  1D8K A;  2WQY C;  3SFZ A;  1P7J A;  1PUF B;  3CC7 P;  3F8C A;  5FLX Z;  3D5S C;  2G9W A;  2JT1 A;  2ZFW A;  2MKV A;  2I8D A;  1RE4 A;  1XGM A;  3GTQ J;  3J80 K;  2OTJ I;  3CMA I;  1OVV A;  1U6G A;  4WBA A;  2BW3 A;  1JMM A;  3PHL A;  3DP7 A;  1O4X A;  3L2U A;  1U7M A;  2WV0 A;  2K9N A;  3SEQ A;  1GHC A;  4E7L A;  2NAZ A;  3ZWA A;  3P8C E;  4ZKU A;  5KJ7 D;  1A02 J;  4Y15 A;  5BOX A;  1QVG O;  3ONQ A;  2MW8 A;  3BR5 A;  1Q1V A;  3K6G A;  2FYZ A;  2GXB A;  5DD8 A;  2KS1 A;  3M9H A;  2OTL P;  1JGS A;  2ECC A;  2M4G A;  2HOD A;  4GOD A;  4LG3 A;  1VQM P;  5FRO A;  5EEG A;  2POH A;  2OAZ A;  1FMW A;  1RR8 C;  4UB8 E;  1LEA A;  1XMA A;  4RGU A;  2XAS A;  1IW7 F;  2E74 B;  3HOX J;  1YHQ P;  4O5V A;  4ENM A;  4AUW A;  1NTM G;  3F6V A;  2RNG A;  4A5N A;  1IZN B;  2Q2E A;  2ZNZ A;  1LB2 A;  3PJG A;  1RES A;  4MGR A;  3KP2 A;  4BRY A;  3HTK B;  1AWC A;  2QBY A;  1K7A A;  4DOZ A;  1SQB G;  1VQ6 P;  4B3X A;  2HQA A;  2WVR A;  3I58 A;  3FMS A;  1B59 A;  2NS0 A;  4C46 A;  2E75 D;  3MZW B;  3AL0 C;  1J2J B;  1XC5 A;  1NO4 A;  2BYV E;  1YRN A;  1PJR A;  2E76 B;  1JUS A;  3CCJ I;  4MQ9 F;  3SYT A;  4JBZ A;  4Q5S F;  5BPI A;  3L70 J;  1XGS A;  4IL6 X;  2QEN A;  3BJA A;  2DQL A;  2MC3 A;  4FCY A;  1IDZ A;  1LT9 B;  1DU6 A;  1OW7 A;  1MJA A;  1HW1 A;  3FR8 A;  2MG4 A;  2VRS A;  1LNW A;  1SVL A;  3T1B A;  1KQS O;  3L75 G;  1RE4 C;  2LXB A;  3I5C A;  2Z5U A;  3FIW A;  3IHU A;  4PZJ A;  1B6A A;  4IL6 H;  4M3L A;  3TSI A;  4ITV A;  2O6G E;  3EUH C;  2F4O B;  5CLS A;  3J7A O;  4PJJ A;  1Z56 A;  2W48 A;  5HNF A;  1PGO A;  2M3E A;  2BOL A;  2XF6 A;  4IF4 A;  3CCR P;  1URQ A;  2CFX A;  5KLV K;  3CO7 C;  1OCZ H;  3P9C A;  1LVK A;  3R0J A;  1A35 A;  3QWL A;  3BTI A;  3NAR A;  5JHF A;  3T97 A;  1Y1W J;  3WG9 A;  3UKG A;  3KXD A;  4BAY A;  1UAA A;  3CXH D;  1FOS F;  2O1J A;  1M1J A;  2P58 A;  3RPQ A;  4YFN F;  1NTZ G;  1QX8 A;  3L73 D;  3U1A A;  2CW7 A;  2ZXW H;  4UV9 A;  5GTH C;  1ZRF A;  2FXP A;  3P7K A;  5FD5 A;  3VB2 A;  1O57 A;  3KFW X;  4E7S A;  1C0W A;  2JWT A;  3H5N A;  5J1Y A;  3CTV A;  4YCA A;  1A36 A;  1J1E B;  1E3P A;  2GUS A;  1ZG3 A;  5KK1 A;  2MYS A;  4PD4 E;  2V9V A;  5LHH A;  4XLE A;  2KLO A;  1FS0 E;  4LG0 A;  2R4G A;  3I59 B;  1P2F A;  3M1E A;  4QWQ A;  4H0E A;  1JI8 A;  4XFJ A;  3L71 G;  3AG1 H;  3OS1 A;  4LIV A;  1J5Y A;  3S9O A;  1S7E A;  5E3M A;  1R22 A;  5DUI A;  3CCL P;  1BR4 A;  2XSJ C;  2SPZ A;  2O7O A;  1GVD A;  3X2Q H;  3RK3 B;  2BHZ A;  2Y9Y A;  1U0J A;  4LJZ F;  2UWM A;  4JYC A;  1XMK A;  4S05 A;  2O1K A;  1YJW I;  3H1L E;  4H0L B;  1YS6 A;  1P84 H;  2VXZ A;  2LYC A;  5ICG A;  3O8H A;  1FT9 A;  3O6Q B;  3G1L A;  1H88 C;  2Q0O A;  3WFJ A;  1HA8 A;  5A2Q Z;  2H89 C;  1IO2 A;  1NTC A;  3HD7 B;  1N73 C;  1YBK A;  2QE7 H;  1UCR A;  3WGI A;  2MLK A;  4ABZ A;  4EGY A;  4IRG A;  2EZI A;  4QPQ A;  3WTW C;  2VBW A;  3WTV C;  4BHP A;  1L4A D;  2A61 A;  1ZR4 A;  1KS9 A;  1BE3 D;  2DFI A;  2FD5 A;  4KIF A;  5E3O A;  3ADP A;  3RGU A;  5D6F A;  4XN0 A;  3EUH A;  2QKL B;  2WB1 N;  1ZAO A;  3BAT A;  1QVF O;  1FZC B;  2QJY B;  4RB0 A;  1I27 A;  2E1M C;  1Q2N A;  2ISY A;  3GBG A;  5H2F C;  4JK1 X;  2Z4E A;  4D5F A;  1T08 B;  2WMM A;  5KJ7 A;  3B5N D;  2V1U A;  1JTY A;  3H5A A;  3N05 A;  1S5L X;  2O01 N;  1R49 A;  4I99 C;  4HNU A;  1QNT A;  1VPC A;  4GDO A;  3E6B A;  1WHU A;  3ZQH A;  1M56 D;  2KIU A;  5J1U A;  3M91 A;  2BE5 F;  5HVQ C;  1H0T A;  1T33 A;  4M71 A;  3IN6 A;  3E5U A;  5FRN A;  1BA5 A;  1FTT A;  3R60 A;  2FSW A;  1S72 I;  2R7S A;  3L09 A;  2Y0M A;  4EJO A;  1TWC J;  2Y31 A;  3P9K A;  1D1B A;  3L73 G;  4BBR J;  1EJ9 A;  2JA6 J;  1JTX A;  5JE8 A;  1WI9 A;  2W6B A;  1WQ2 A;  3QP5 A;  4D6T E;  3GFI A;  1ZHF A;  3WTT C;  1DU0 A;  1X4O A;  2Q5U A;  4L76 A;  3L74 D;  1O7F A;  2EK5 A;  3I3L A;  2AXT C;  4A3E J;  1M90 Q;  2YIU B;  4R1H A;  4RGS A;  3ZWB A;  3GVA A;  3M3Y J;  2HTJ A;  4BS9 A;  4G7H F;  3P5J A;  5D8L B;  4FTH A;  2FYU J;  3OR1 C;  4EI2 A;  4XKC A;  3SSU A;  1EZV I;  3AED C;  4N3Y B;  1Z7U A;  2EIJ H;  4O9B A;  1NTK G;  4UV8 A;  5FLX K;  1E3H A;  4MFD A;  4IOC F;  1PP9 D;  1L0N D;  1BGY J;  2EA2 A;  4CPG A;  4I0A A;  2X9D A;  4FIS A;  3N7N A;  1BI1 A;  5E1X A;  1URQ C;  2XVC A;  4XKB A;  1D1A A;  4JP0 A;  4IRI A;  2BXZ A;  2XHK A;  4IKF A;  3DEW A;  1T38 A;  4G7O F;  4E13 A;  1JNM A;  2AO9 A;  2V4H A;  5KLV E;  2GIZ A;  3KLO A;  3H1J D;  4LK0 F;  1EDK A;  2NNY A;  3EYY A;  4A3G J;  4R8H A;  1MBE A;  5TJH A;  3BG7 A;  5KAF E;  2QSF X;  3HOU J;  1OR7 C;  2HLO A;  1RUO A;  1VQL I;  3K70 D;  4E70 A;  1S4X A;  2B0L A;  4L74 A;  1GMJ A;  2YO3 A;  1IN7 A;  3VFZ A;  3B73 A;  3GFL A;  1IC2 A;  5J8C A;  2OTK E;  4BE1 A;  4S3M A;  3W2A A;  1WJF A;  1L4A A;  2FXO A;  4AYC A;  1F1Z A;  4PJ0 C;  3MKW B;  3L7W A;  3ECH A;  3OMY A;  2IGO A;  2RC4 A;  4KN4 X;  1TU3 F;  1MMG A;  2LVS A;  3IRQ A;  3JRG A;  1YRL A;  5APT A;  1VQK I;  3C2G A;  2P67 A;  5CQG A;  4UUT A;  5CVU A;  1SQB J;  6PAX A;  1KV4 A;  3VOE A;  3WUV A;  2W25 A;  1ETY A;  3L74 J;  4IQJ A;  2A06 E;  1NU1 E;  2OV7 A;  3FBN B;  1R5L A;  3M0A A;  5FRM A;  2W27 A;  1I3A A;  3ZPL A;  3LOC A;  5K7F A;  3CXH H;  2KRC A;  5IT3 A;  1VF9 A;  2BVM A;  2I9P A;  3NFQ A;  1VQO P;  1ZEL A;  1MSF C;  3Q2Y A;  3WU2 H;  2IA2 A;  3A3Y B;  1UHS A;  2FMY A;  4KIS A;  3KYQ A;  1FP2 A;  1K61 A;  2F5E A;  3HIF A;  3OYD A;  3PNV A;  1JY3 N;  4CCN A;  3VOD A;  2R32 A;  1G4D A;  1QGK B;  4HH2 A;  3H35 A;  4G6D A;  2QEX I;  2ACJ A;  4I1L A;  3ERM A;  2DA5 A;  5EF6 A;  4CZZ A;  2IZ1 A;  1T8Z A;  2BY3 A;  3M06 A;  4PD4 I;  3MN2 A;  3L2Q A;  3CC4 I;  2KXP B;  3IWF A;  3LL7 A;  1VTN C;  1PP8 F;  3EET A;  1NK2 P;  1GW4 A;  2C9L Y;  3BZ6 A;  2VJI A;  4BQN A;  3R61 A;  3MAJ A;  5AW2 B;  2IGM A;  5EGO A;  3L72 D;  1WKM A;  4N78 E;  2I10 A;  4I7Z B;  1IO4 A;  3B5N B;  2DT7 B;  2DMN A;  1Z9C A;  1QL2 A;  3USS A;  3C7A A;  4RGR A;  1J7K A;  1HST A;  4XLH A;  2BY2 A;  1REP C;  3W6K B;  1EZV G;  3H9Q A;  3L6D A;  4N9H A;  4A3M J;  3OSG A;  2PGD A;  1QEX A;  4IFD K;  5HS7 A;  1HJB A;  2CW8 A;  3A1Y A;  5GP9 A;  1TLH B;  3I5U A;  4QTR A;  3CCM I;  1IK7 A;  4AYB A;  1PL5 A;  5DM6 F;  1O3S A;  2V1N A;  2KI7 B;  1YHQ I;  4EQQ A;  1N73 B;  3DLA A;  1FDM A;  3FMR A;  4UY8 I;  2YUS A;  1ZK8 A;  2WY7 Q;  1IN8 A;  4IHX A;  4AUX A;  1U9O A;  1GT0 C;  1DGW Y;  2WAD A;  1OXZ A;  3V4G A;  3TNU B;  2VL8 A;  1OMI A;  2FU4 A;  1RC9 A;  5KLI C;  1CGP A;  3DU6 A;  2BY0 A;  2CYY A;  1ZV8 A;  2N1T C;  3QRF F;  2EV5 A;  4QLC U;  3JRD A;  2R44 A;  2Q1Z B;  2PLY A;  2JSP A;  4UVB A;  4NPE A;  1S9H A;  4C30 A;  2E5Z A;  3TW6 A;  3V8L A;  4TT3 H;  1OLT A;  1T0F C;  4M72 A;  3G71 P;  3VYU B;  3F3S A;  5APX A;  3SFE C;  3W67 A;  1X2M A;  1WP4 A;  2W6J H;  4L9T A;  1RUN A;  3M0D C;  2NVY J;  4Y3O A;  1FOX A;  2O5R A;  1ZYR F;  5DM7 F;  1RR7 A;  2BCC E;  3HUS A;  1G6N A;  2ZJS E;  4EIJ A;  5CJ9 A;  4L9J A;  2E2I J;  4KIT B;  1Y0U A;  4IJA A;  2KZG A;  2BCC G;  1WJB A;  2VIX A;  4RAZ A;  3ZR8 X;  2E75 B;  5AVX B;  3PJS K;  1RF1 A;  1MFT A;  5JVT A;  4B3J A;  4LLN A;  1NH4 A;  2L0K A;  2B7E A;  3GO5 A;  3VMY A;  2Z9O A;  2FFD B;  1A6Q A;  1MMD A;  4NC6 A;  5CJ4 A;  4YIF A;  3HBL A;  3CCQ P;  3SWK A;  1FOY A;  2DA1 A;  5CCG D;  2H8W A;  3H25 A;  2NZ2 A;  1L0O C;  1NYH A;  2K3F A;  1VQN P;  2K37 A;  3WS7 A;  3OYC A;  1ERD A;  5H2F E;  2HG5 D;  5B5E C;  3Q5F A;  1K78 B;  1ETQ A;  2JRM A;  2ZT9 D;  4PGG A;  3K1M A;  5GPC A;  4LB5 A;  3ISP A;  1JHH A;  5AW6 B;  1B9N A;  4PZE A;  3DEE A;  1YLF A;  2GZW A;  4G6T B;  4ZH4 F;  4A3L J;  3EFG A;  4HB1 A;  3L70 E;  5TIS H;  2JDI H;  3E7K A;  5CMZ A;  1HUC A;  3PNT A;  1NWQ A;  4D1Q A;  2NS7 A;  5E8G A;  1CZQ A;  1YOV B;  1FDO A;  4YPC A;  2ZSH B;  1JO5 A;  4R4M A;  1TL8 A;  2V7Q H;  1SD5 A;  4KDP A;  1W1W E;  1IFD A;  1S7O A;  3GWZ A;  1IZ1 A;  5CKT A;  3H1H J;  3ZW9 A;  4RKU J;  3VP9 A;  1J75 A;  4KFC A;  1TP4 A;  2JWD A;  3HTS B;  3LWF A;  4BNC A;  1YIJ P;  1RH5 B;  4M3G A;  5JI6 A;  2NOJ B;  1ONV A;  3TGU J;  1UG2 A;  2QGU A;  2W8Z A;  3E7L A;  3HOS A;  1K4S A;  1BI0 A;  4PJL A;  5F0F A;  4D5C A;  1BSN A;  1ZG1 A;  5LGU A;  3HAD A;  4JF7 A;  1MH3 A;  3HUS C;  1ZOY C;  5ICF A;  2YU9 J;  1OWA A;  3M9Q A;  1WWX A;  1SQV D;  4F92 B;  3TED A;  3S2H J;  2OCE A;  4ETS A;  1YJW P;  4MQV A;  1QPI A;  4Y17 A;  2VUM J;  3CCM P;  3CCV P;  1UMQ A;  1R58 A;  3I54 A;  4HNT A;  2ZJR F;  1O3T A;  1FJL A;  1NU1 K;  1E0E A;  4B3A A;  3B71 A;  4I7H A;  1E5W A;  2IYO A;  1XDS A;  4NUB A;  1ZQ3 P;  2MJZ A;  3K4K A;  3TGU G;  2BBY A;  1X4P A;  3S32 A;  3QP6 A;  4YIR X;  4RBO A;  1MMA A;  4B09 A;  1QLE D;  3HDH A;  4WXD A;  3C7D B;  2RQQ A;  3E5X A;  1KFM A;  2P5K A;  3GLL A;  3VYI A;  3DTK A;  1DEE G;  1WJA A;  3ASO H;  3COA C;  5CJ0 A;  2A6T A;  3EDP A;  4HV6 A;  2H7H A;  1K83 J;  1SQV K;  2AEM A;  3HJE A;  1BGY D;  2Q1K A;  2HPI A;  1H9G A;  2ZJP F;  4Q47 A;  1FC2 C;  5HLH A;  2KLV A;  2AXT H;  1KMI Z;  2JVH A;  2M30 A;  1Y9B A;  3RYP A;  2XAH A;  2KRH A;  3R0A A;  1OW6 A;  2B89 A;  1ENH A;  3LID A;  3DF8 A;  5CBO A;  3WE2 A;  4HNV A;  1KD1 Q;  3CCE P;  3OW2 O;  1B1B A;  3LSH A;  4RAY A;  4AYB N;  5TRD A;  2H27 A;  3A2K A;  1R5S A;  3A0H E;  1GV5 A;  4BXL A;  5IYB J;  1TWG J;  1ULY A;  5DD4 A;  1F12 A;  1P9Q C;  2VOO A;  3VYR B;  1NOH A;  4GT1 A;  4LD5 A;  3JAM Z;  4F93 B;  1KOR A;  3MHV A;  1Q7Y Q;  4AWX B;  1YS7 A;  2OA4 A;  3BY6 A;  4NHJ A;  1B8I A;  2E34 A;  3NWS A;  3FIS A;  1IFM A;  1RQU A;  3SJM A;  1MBF A;  2XRO A;  4DBR A;  1FZE A;  2ZT9 C;  3PM1 A;  2DOD A;  2W57 A;  1HSJ A;  2DFE A;  2QVA A;  5BU5 A;  5KAI H;  4G7Z F;  2VQH A;  4II3 A;  4EM0 B;  2CQK A;  3H0G J;  1S5L E;  3ZMT A;  3JCU H;  1UIX A;  1S8N A;  2L02 A;  3KEQ A;  2HXI A;  5AIQ A;  1SVF A;  2NRG A;  2KP8 A;  2Z5H A;  5GAH J;  2LKX A;  2HWV A;  2LKS A;  3RSN A;  3GHY A;  2YMY A;  3FR7 A;  2IAI A;  2ZCW A;  1KZH A;  2GQQ A;  3CWB E;  5TJJ A;  1T2K C;  1BW6 A;  1XX5 A;  5FLV A;  1DGR M;  3GZ6 A;  2IEK A;  3SXY A;  2KZV A;  5FFZ A;  1VQ5 I;  1VQO I;  2ZME C;  4DYD A;  3W2V A;  3DWL E;  4L75 A;  1FU1 A;  1ETO A;  3BC8 A;  4MEY F;  1OVU A;  2W24 A;  1R4N B;  1GTW A;  2WAQ A;  5BQT A;  3G2B A;  2VKH A;  2XPW A;  3C7C B;  1D0Z A;  1K73 Q;  2FBI A;  4RJT A;  3H1L G;  2QJP C;  5GAD J;  3EPZ A;  5K5O A;  1LWU B;  1OIP A;  3RL0 B;  3CWB D;  2P4Q A;  3J7Y J;  4YEL A;  1MMS A;  2LR8 A;  1CF7 B;  1DPR A;  1X1B A;  3CUQ A;  3FXU A;  1YTY A;  1YIJ I;  1XCV A;  5GTI C;  4FE4 A;  3HOZ J;  2EQR A;  4IOA F;  3T8T A;  4WVZ A;  4XRF A;  3L75 J;  2VBX A;  3KP5 A;  4BE0 A;  1JKO C;  3CC2 I;  4MTE A;  2A07 F;  3PDU A;  2WSF H;  4HSR A;  3F5H A;  2E1O A;  4AIK A;  3GZ5 A;  2I76 A;  2OTJ P;  5AON A;  1L0N G;  1ETW A;  4RM2 A;  4WF2 A;  1QZY A;  1TTY A;  2EZK A;  1V4R A;  4H0L C;  3ZRG A;  1PUF A;  1X0X A;  5HDK A;  2R5Z B;  4HQE A;  2GUV A;  3AEA C;  5JHU A;  5FLM J;  2HQR A;  3OBB A;  3K96 A;  3PEF A;  2KIK A;  3BOQ A;  2P6T A;  1KN7 A;  3WMM 0;  1BCC J;  3Q3S A;  1N77 A;  3L72 E;  1FNN A;  5D6E A;  1SD7 A;  2E5Y A;  1Z3X A;  4K35 A;  1ZAR A;  2P6S A;  1YIT I;  2DOF A;  3SZT A;  3AE8 C;  2PLA A;  3V2P A;  5JLX A;  4DQ2 A;  2NPS B;  2RN7 A;  4KNY A;  1IG7 A;  3OY9 A;  3GLX A;  4H13 D;  1S72 P;  2RQP A;  2YXQ B;  3V7C A;  2OUM A;  3KHU A;  2QYO A;  3W6Z A;  3A02 A;  2ZME A;  1EC5 A;  3D6Y A;  3P9I A;  2M0B A;  4NPD A;  2OZU A;  5H20 A;  3KYL A;  1MV8 A;  3AE6 C;  2QSG X;  2KIF A;  3FXR A;  1Q82 Q;  5IPA A;  4OGQ D;  3CDI A;  2K3R A;  4NPF X;  2H6C A;  3TO6 A;  3N4X A;  2OU2 A;  1O3Q A;  3ADO A;  1PP9 J;  2R5D A;  4BXU A;  2CH0 A;  1UII A;  1URQ D;  3FDY A;  3E1I A;  5DTD A;  3KYC B;  3LST A;  2FYU E;  1XN7 A;  1TNT A;  3MZY A;  2IX7 C;  3HD7 C;  3ELK A;  3G71 I;  3HTK A;  2L7Z A;  1T3U A;  1SFC C;  4A3F J;  1LP1 B;  1IRX A;  3DFG A;  2ICW G;  4Y99 C;  3FWE A;  1SS1 A;  5FKK A;  3CC2 P;  3MUD C;  3GME A;  3GX4 X;  4DZP A;  3RK2 B;  3CQZ J;  2XB0 X;  1K4T A;  2N1T B;  4HAM A;  2Z5I A;  3E1S A;  1PP9 G;  2QKM B;  3FZV A;  2E5T A;  2AEF A;  3EFF K;  2IS1 A;  2WSC J;  4ESB A;  1TBX A;  3ML6 A;  4AIJ A;  4C2U A;  1VF5 C;  3I56 P;  5D5V B;  5DCM B;  3K9T A;  3DOJ A;  1RHZ B;  2ZXI A;  1PPJ G;  2ZKZ A;  3N4M A;  3OWT A;  2V79 A;  1VI0 A;  3B6C A;  1PV3 A;  5IT9 Z;  1R36 A;  3FK7 A;  3S4R A;  2M0C A;  3JRI A;  2DW3 A;  1IFJ A;  1F43 A;  1SD6 A;  1MBH A;  5EDN A;  1T3J A;  3F8M A;  3M1C A;  3PO3 J;  3PTZ A;  1ZRD A;  1W36 D;  4DNC A;  2VBY A;  2VJJ A;  3BCC J;  2QSH X;  1E2X A;  3UNG C;  5D5U B;  2XDV A;  1GL2 D;  2XAG A;  2Y0S A;  3ABU A;  4EJT A;  4PD4 H;  4BE2 A;  1Y56 A;  5HLG A;  2MBF A;  3OYJ A;  1SQQ E;  1UB9 A;  3R4K A;  3TQN A;  2JTV A;  3QOD A;  1NH3 A;  2XAQ A;  4RM3 A;  2WB1 A;  1O3R A;  4FX4 A;  2HYN A;  2E42 A;  4DZJ A;  4YFK F;  1W5T A;  1N7S C;  1DP3 A;  1LJ8 A;  3J81 K;  3LSR A;  5DCF A;  2HYJ A;  3BR6 A;  3VPR A;  5D4R A;  3BDD A;  4U88 A;  1Q86 Q;  4GIF A;  3RK3 D;  5LFA A;  3BAS A;  4ZMD A;  2GA2 A;  4IL6 C;  3A0B C;  3H3V K;  2DDB A;  4HJG H;  1VQ5 P;  2HVQ A;  1USE A;  3KP4 A;  3DPU A;  2QJK B;  2GOM A;  2K02 A;  1YYC A;  4IEJ A;  1PP7 U;  2JR8 A;  4EVI A;  2WAQ N;  3LAJ A;  1SQP G;  2PFB A;  4GGG A;  1J1D B;  1FOS E;  2TRT A;  2CV0 A;  3F9K A;  4S0H B;  3WTZ A;  3O6Q A;  2ID3 A;  1ETK A;  4TLF A;  2I1J A;  1IFI A;  1LFB A;  4A3J J;  3U2R A;  2WZ7 A;  4WB4 A;  3KZI H;  2LMD A;  1A04 A;  1EH7 A;  1YQA A;  2V4J C;  2HPM A;  2D2C C;  4HKZ H;  2F5V A;  2DQR A;  1PUE E;  2W6A A;  4AID A;  2LY1 A;  2R5Z A;  5L8R J;  4E21 A;  2EWN A;  3B5N C;  3CCR I;  3HEF A;  2VB6 A;  3S14 J;  4BXF A;  2B87 B;  2WWW A;  4ZJZ A;  4BJT A;  3MKZ A;  2JK3 A;  1Y0N A;  3K2A A;  3H1I D;  1HDP A;  3HDD A;  2XGD A;  3BZC A;  2EIK H;  3Q0V A;  5B3S H;  3V8K A;  4EGZ A;  2GM4 A;  1CQT A;  4MNU A;  9ANT A;  1WDL A;  1KU2 A;  5CVJ A;  2J58 A;  4N4N B;  5B5E H;  2Y69 H;  1VQP P;  2CW0 F;  1X1D A;  2FBH A;  1BCC E;  3B4S A;  1PVE A;  2F2E A;  2VBZ A;  3U1D A;  5C3E J;  3IV5 A;  1B72 B;  2YNY A;  1OCC H;  1EH8 A;  2RAE A;  3LFU A;  5C44 J;  1BGY E;  2NOG A;  2ZBK A;  5HOO A;  5FO5 A;  3RQS A;  4C7N A;  3KQG A;  2DYS H;  3IAS 2;  1KYO I;  4QMA A;  3OYI A;  1SFU A;  5AW7 B;  5E1Z B;  1NTZ D;  2ZXE B;  4UNO A;  3SFD C;  3V6I A;  4PZD A;  1TQM A;  2G7H A;  2XIG A;  3LSK A;  2XND H;  2H09 A;  4A6D A;  2JA8 J;  3ABM H;  5HLI A;  1G1I A;  5J4V A;  2Z33 A;  2E2J J;  1IK9 A;  1JY2 O;  4A3K J;  2EFW A;  2RDP A;  1VPD A;  1HH0 A;  3L75 D;  2DN0 A;  3T8R A;  1D7M A;  1QBJ A;  4F55 A;  4D6T J;  4HDU A;  1J59 A;  2ZXH A;  1PDN C;  1XSV A;  2NVX J;  3WU1 B;  3QQA A;  4JX4 A;  2M3A A;  2K9J B;  3CMA P;  2UWJ E;  1IN5 A;  2RVC A;  4KIB A;  3TKY A;  4YEJ A;  3QHA A;  1VQL P;  2WAF A;  1ZTR A;  2DFF A;  4M9X A;  1VQM I;  3KX2 A;  4UUS B;  3O8G A;  1WFX A;  3TO9 A;  4QIW N;  4PZC A;  4RDU A;  4D3D A;  1FOK A;  4PV1 D;  2M5A B;  2IW5 A;  2Y2Z A;  4LC1 A;  2OTL I;  3M07 A;  3NEU A;  2WWY A;  1N1G A;  2FBW C;  1XCB A;  5KAF H;  1ZR2 A;  4Y33 A;  1I3Q J;  3ZMD A;  2Y9Z A;  2CV1 A;  2B88 A;  3BG9 A;  4KUM A;  1N78 A;  1EDI A;  2DLL A;  3JC2 2;  2VT3 A;  4X0G A;  2A5Y B;  1R1T A;  1E3O C;  2E76 D;  3G9R A;  4LK1 F;  3KPE A;  4DJA A;  5H6Q A;  3KE2 A;  3W6U A;  1M8O B;  2YSR A;  1HOM A;  2XGE A;  2FJ1 A;  3OIO A;  1MNE A;  1N7S B;  1UFM A;  1DPU A;  2KB7 P;  2OYI C;  3HG9 A;  1OJL A;  3L37 A;  4H44 B;  2A6H F;  1Y6I A;  1XB4 A;  3WGG A;  3JR9 A;  4OMY A;  1NTZ J;  2OYO A;  2XF7 A;  3CLO A;  4ON0 A;  1K78 A;  2QM7 A;  3MTU E;  3U59 A;  1VQ7 P;  2GXG A;  2ZYD A;  4C2M J;  1HGZ A;  5M5Y J;  3FXM A;  4BJ5 C;  5K7Z A;  5BS6 A;  2N9Y B;  1QHH D;  3LA3 A;  1MZB A;  5M3F J;  1MSE C;  3JSP A;  4R1N A;  2J59 M;  2CJJ A;  5GAG J;  1HBX G;  4FHT A;  4DLL A;  4B47 A;  2IRF G;  3ZQG A;  1EQ7 A;  2CUZ A;  3DKW A;  3L70 G;  3LW5 J;  4KUE A;  5GTI H;  3CCS I;  3CXH E;  4B48 A;  5APW A;  4A0X A;  1YIT P;  1YX3 A;  3MFK A;  4QSH A;  3W3C A;  1TQI A;  2QSI A;  2CGP A;  3AE2 C;  1Z1D A;  1D5V A;  2BV6 A;  4P1W A;  4G9Y A;  4TV7 A;  4E4H A;  2KIM A;  5ERI A;  5F64 A;  2LK2 A;  1FYM A;  4EM2 A;  1HGV A;  2FML A;  4HX4 A;  1TNS A;  2M5W A;  2CSO A;  1F36 A;  3CLQ A;  2HOD B;  1MND A;  1Z6R A;  3MMY B;  1KQ8 A;  4M3B A;  2WSE J;  5DS9 A;  2COM A;  3WUT A;  2DA7 A;  2QLZ A;  5LHI A;  2BVL A;  4ASN A;  1HKT A;  4DCK A;  2E74 D;  2HU9 A;  3PH0 A;  5K5G B;  2DFH A;  3FX3 A;  3DLL F;  4XRM A;  4A3C J;  1BJZ A;  1BBY A;  4H4K C;  4BJ6 C;  4FE7 A;  1X0T A;  3PRJ A;  3QYE A;  1X1A A;  2WBM A;  3G73 A;  1NTM E;  5KKZ B;  3VEP A;  2X6O A;  1V5G A;  2GAU A;  2KDZ A;  1U8B A;  4IHT A;  4EM1 A;  2JQ7 A;  3K4J A;  1IRZ A;  2ME6 A;  3MZH A;  1WMK A;  3OYM A;  2Y0D A;  1GK4 A;  4RO0 A;  3QOP A;  2DW4 A;  2JEE A;  2Z99 A;  4GYI A;  1GV2 A;  1U3E M;  1T8I A;  1W0U A;  1HW2 A;  1KYO D;  5APV A;  1F5T A;  2A6E F;  2M7A A;  2KJC A;  2DMU A;  2XRN A;  4E7Z A;  2M4K A;  1Z67 A;  3HSF A;  5D5W B;  1EVY A;  3H1H E;  2TCT A;  4LB6 B;  3HGG A;  3RTR A;  2XC7 A;  1K79 A;  1GU4 A;  3HUS B;  3CC4 P;  2N1T D;  2ZFC A;  1HKS A;  4D0P A;  2DK5 A;  4Z6Y A;  3K0L A;  3L00 A;  2K7L A;  2ISZ A;  2HQN A;  1FP1 D;  4K3A A;  3QAH A;  4CUG A;  3VMX A;  3WUU A;  2XRL A;  1R8E A;  5HLT A;  4KT5 C;  3IKT A;  1AQ5 A;  3IRR A;  1JJ6 C;  4CCL A;  4KUG A;  1SMT A;  5E18 F;  2JA5 J;  3G0O A;  3DTI A;  4LMY A;  4PFO A;  2V6E A;  3FXE A;  1YJ9 P;  1P4A A;  2MAB A;  2X4H A;  1APL C;  3RL0 g;  3AL0 B;  5DCM A;  4DZO A;  4UB6 E;  5EFW B;  5EEA A;  1JJ8 C;  3FHZ A;  1GW3 A;  3LQR A;  1I39 A;  1JT0 A;  4ZDO A;  2OQG A;  2WY8 Q;  3FBI B;  3LSJ A;  2W84 A;  4P5O A;  3A2A A;  2O3F A;  4GXO A;  3F0C A;  3QYF A;  3OA7 A;  4JQ0 D;  1MIJ A;  2NVT J;  1XS9 A;  5KAF C;  2UXX A;  3KEO A;  4BGD A;  2R7V A;  3OS2 A;  3AE5 C;  3HRS A;  2BAS A;  2ADU A;  3DPT A;  1D8J A;  2H1K A;  2EIM H;  2VPR A;  3KLN A;  3O2P E;  4I0B A;  4UB8 C;  2FKW B;  1IDY A;  4EMS A;  2E74 C;  5AVS B;  3O8Z A;  3E5Q A;  4OU0 A;  3CF5 F;  2X0L A;  2JJL A;  3RBZ A;  1YI2 I;  1IUY A;  3BCC D;  4XL9 A;  1LTT C;  2D1V A;  1EKE A;  1SQV G;  3CWB G;  1IUF A;  2L7K A;  2DPD A;  3JAM K;  1I1S A;  1AQT A;  2CQQ A;  3PIP F;  1PIX A;  1SQX K;  5KHD A;  3L71 E;  2OYI A;  4UUS A;  4IX7 A;  2ME0 A;  3HB9 A;  3ERE D;  1WRG A;  1WH7 A;  5CCH D;  2ZVN B;  3GF7 A;  3W6V A;  1ZRT D;  3ZQI A;  3NWT A;  2JA2 A;  2EA4 A;  2M2E A;  5H2F H;  2L9N A;  4J00 A;  1M1J C;  4WX9 A;  4AM3 A;  4RA2 A;  3OYL A;  3VWB A;  4CA0 A;  2R0Q C;  3ZCO A;  4Y7N J;  2K9S A;  3I59 A;  3IAO A;  4O3M A;  5AIP A;  2P7V B;  3I71 A;  2W83 C;  1I1G A;  3BLY A;  1NVO A;  1KIL D;  3HRT A;  4IHV A;  1ETX A;  2KNC B;  3WE3 A;  4P55 A;  1ZRT E;  5JLW A;  4GRI A;  2Z2S B;  5HDN A;  4IRH A;  1JOC A;  2IFN A;  1MBK A;  1IC8 A;  4OM8 A;  4YXD C;  5EG0 A;  3CME I;  3LIE A;  2X1D A;  3LSI A;  3TDK A;  1LSJ A;  2OYH A;  1DX7 A;  5CVR A;  2A68 F;  4L0Y B;  4EYY Q;  3O3K A;  2OPT A;  3OYN A;  3CJQ B;  3V7R A;  1R4M B;  5LRR A;  2CV2 A;  1G3Y A;  4Y13 A;  2VOP A;  1EXI A;  2UV1 A;  4WK8 F;  1IN6 A;  2F5D A;  1G59 A;  4ZTF A;  4CH7 A;  4HF0 A;  1YE9 A;  1FYK A;  1LJ2 A;  2K85 A;  1MMN A;  3BCC G;  4LIU A;  2N8G A;  4WCG A;  3HGY A;  2QYT A;  2HXO A;  2KK7 A;  4UB8 H;  5TIS C;  2EJR A;  4ZYG A;  1BM9 A;  1RIO H;  4GWG A;  1R23 A;  5DDG A;  2L5G B;  1QMG A;  2A06 D;  2KOG A;  3JW4 A;  2C0X A;  1ZN5 A;  1YI2 P;  2DA4 A;  2FNP A;  2K27 A;  3WU2 C;  3NXS A;  2QJY C;  3LSP A;  5LEJ A;  5HWS A;  1EZV D;  1X3Z B;  3WTX C;  3W6J B;  3H0D A;  1YW8 A;  1FSH A;  3BTL A;  1BGY G;  1LTI C;  4IFM A;  4EOT A;  2RGV A;  2PMZ A;  4XLP F;  3GHG C;  1EH6 A;  3HRN A;  2D5V A;  2VOD A;  3GTO J;  2GXA A;  3ZN1 A;  3E1R A;  5GPA A;  1DEB A;  1JTH A;  2FYN B;  4D6T D;  2JP3 A;  2DJN A;  1WT6 A;  3IC7 A;  1RNL A;  2YS9 A;  3PSI A;  3BRT B;  1U9N A;  1BI2 A;  3F72 A;  5E1W A;  1IJW C;  3FXL A;  2IJL A;  4IPA A;  4F52 A;  1H0T B;  2AXT E;  1USD A;  4CGZ A;  4J0E A;  4A69 C;  1S2E A;  3RK2 C;  1T56 A;  5FKN A;  3HHG A;  3OAK A;  1LFP A;  4E7H A;  2G0E A;  4A93 J;  1EF4 A;  3OYE A;  1PP9 E;  5AVU B;  5J40 A;  4IL6 E;  1LP1 A;  4L0Z B;  1S6L A;  3HWR A;  1YTZ T;  2M34 A;  2X51 A;  4I01 A;  1IV8 A;  3WTU C;  3E6C C;  5KLV D;  3GF3 A;  1V5F A;  1F9N A;  1XGN A;  3A0H C;  3H1J E;  2PG4 A;  1QVT A;  2ZC2 A;  3K1N A;  5L3C A;  3VP8 A;  1NHA A;  4C2T A;  3H1J G;  3VYT B;  1W5C E;  2GIV A;  5IOZ A;  3H1I J;  3RQI A;  4IOI H;  2DBB A;  3TGU E;  4K2E A;  3TF5 A;  5ILV A;  4XRS A;  2Y0E A;  2WTY A;  5F04 A;  1RE3 A;  2P7J A;  5FFX A;  2AQE A;  4I98 B;  3DQV C;  4ENK A;  1ZH5 A;  1TT0 A;  3DKY A;  1LDJ A;  4CYC B;  2E71 A;  3H9G A;  4LFU A;  1NGM B;  3D1L A;  3L4F A;  4OOI A;  2XUB A;  3CCL I;  3S1N J;  1SQQ G;  3PQK A;  1SVO A;  3K4B A;  3TDU C;  1ZLK A;  1UZC A;  1ACI A;  1YB4 A;  1B9M A;  2WTE A;  1J09 A;  3WHC A;  3BG6 A;  4CDG A;  1DDN A;  2LF8 A;  1OKR A;  3PUB A;  5L3G A;  1HDD C;  3RZO J;  1KQL A;  2WPS A;  1JUN A;  2OD5 A;  4RAG A;  3I55 I;  3REO A;  1KTM A;  1OCT C;  1U7J A;  5AVW B;  3HHH A;  3K10 A;  3VOP A;  3M9A A;  4XOR A;  1LTB C;  3QH9 A;  3QPH A;  1OCO H;  4PSW A;  4Q48 A;  5F08 A;  1NU1 D;  1VQP I;  2CVZ A;  3TO7 A;  2ZJ2 A;  3A0B H;  4BWN A;  2LKP A;  4KHX A;  4EEF G;  1GK6 A;  2A06 G;  3H1J J;  3H1K G;  3OV8 A;  3IWZ A;  1T2K D;  1FZF A;  1MBG A;  3LSG A;  1R00 A;  4NDL A;  2D1H A;  5A9T A;  1HF9 A;  3S3O A;  2ZNY A;  2F6C A;  1FZC A;  2BEO A;  3E6M A;  2M8G X;  2Q8K A;  3ZGK A;  3WU2 E;  3C2B A;  1JE8 A;  1BW5 A;  1G2C B;  2BCC D;  3C8V A;  3HPG A;  4HPQ A;  5D8K B;  1QL1 A;  4G12 A;  5C4J J;  5KKZ C;  2E1C A;  4Y52 J;  1YG2 A;  3L9F A;  2RNJ A;  1VFC A;  3KIO A;  2M45 A;  3S2D J;  1SQP J;  2W82 A;  1WPQ A;  4YTP C;  1GL2 C;  1NTK D;  3F3X A;  2XU6 A;  5FKM A;  2XDJ A;  2QQB A;  3DU5 A;  2IS2 A;  2FYU K;  4W80 A;  4UUV A;  4AVP A;  2NXN B;  3IUO A;  1X19 A;  2LSO A;  4PJM A;  4W7Z A;  1Z0X A;  1R1U A;  1ZW0 A;  2QEX P;  1N75 A;  2OCC H;  3C1D A;  4ENN A;  1ZG5 A;  3FXK A;  1U78 A;  1YW9 A;  1ZXG A;  3L36 A;  3RPU A;  3BCA A;  1MUU A;  2ZO4 A;  3RQ4 A;  2ZYA A;  2BY1 A;  4EZB A;  2LY2 A;  5ILU A;  1L2P A;  4GOF A;  3QYB A;  1NTM D;  1ZKG A;  4B86 A;  1EDL A;  4DOJ A;  2YR2 A;  3TOA A;  5CHX A;  4M6Y A;  2AEJ A;  2FF4 A;  3G4S I;  2DMQ A;  4B1R A;  3OL3 A;  3S1R J;  3QSG A;  2QA4 P;  1KYO E;  3K69 A;  1YRN B;  1UST A;  3Q9S A;  1X22 A;  2IGK A;  2NPS D;  4B43 A;  2WPV B;  1KON A;  3PO2 J;  1OQY A;  2HFH A;  4CCJ A;  1R6R A;  2HQ5 A;  3BG5 A;  4A6E A;  3ULK A;  1SQQ K;  1VQK P;  4E7I A;  3DBR B;  3KP7 A;  2L9V A;  2O01 J;  2IA1 A;  5CBN A;  4N6J A;  1VL2 A;  4DJG A;  3CF2 A;  2EFP A;  4OWR B;  1BDC A;  4WXH A;  3IKV A;  1HVV A;  1X8Y A;  3M7G A;  4L73 A;  4XLN F;  1XTC C;  4W7Y A;  4RB3 C;  1AOY A;  3I4N J;  3RK3 C;  3RL0 D;  1J2X A;  2HS5 A;  1Y8A A;  5HDG A;  1H8A A;  3FK6 A;  3OL4 A;  3GTM J;  3SZG A;  4RB2 C;  1H89 C;  1F17 A;  2R5Y A;  5ILS A;  1SFX A;  2M8R A;  4IZZ A;  1IXR C;  1GL2 A;  3ROU A;  5LEK A;  1VQ8 P;  1ZCJ A;  3OS0 A;  5J8F A;  3CC7 I;  1WDK A;  5M1B A;  3BCB A;  3CDH A;  4OGQ B;  1H88 A;  2ZSI B;  2M5A A;  1POG A;  5IYC J;  3Q0U A;  2R7T A;  2UUZ A;  3H1L J;  3CJT B;  3G6E P;  2IBZ G;  2FOK A;  4JOM A;  2CQN A;  4ZC3 A;  2JWA A;  3PLN A;  1AVY A;  1KC8 Q;  1TC3 C;  1FYL A;  3BRO A;  1JY3 P;  3CX5 I;  2GF2 A;  3RKW A;  4LLH A;  1KB9 D;  5GTH H;  2HDC A;  1S1C X;  1D5Y A;  2HYF A;  2OF7 A;  4PCQ A;  2N1T A;  1LPQ A;  2YMK A;  3KDP B;  1Q1H A;  2KZJ A;  1Z3Y A;  4PGH A;  2ESN A;  2DI3 A;  1BL0 A;  2LC2 A;  3K4M A;  4EAT A;  2EFN A;  4GCV A;  1F14 A;  3CMM A;  3SEZ A;  3J7A Y;  4XM3 A;  2VI6 A;  2K40 A;  4A2U A;  2KRF A;  3J7Z I;  2OGU A;  1H8A C;  1M76 A;  4EV0 A;  1XPX A;  3CD6 I;  5KJ7 C;  3W68 A;  1I50 J;  1W2B O;  1RI7 A;  3M0D A;  3AEB C;  2JPB A;  2W85 A;  3RKX A;  2VE9 A;  5C4X J;  5AVV B;  1VQN I;  2A69 F;  5BNG A;  1M66 A;  4XRS G;  1T39 A;  3VTP C;  1BIB A;  2JZY A;  2VJ5 A;  1FBM A;  1JHF A;  3QPS A;  4V19 K;  5EGO B;  1X0V A;  2P1J A;  2B87 A;  1WH5 A;  3CTA A;  3FX0 A;  2V26 A;  3AE3 C;  3H1K J;  5K7H A;  2DTR A;  1JGG A;  1IN4 A;  2HZT A;  2BW3 B;  2FUG 2;  2KIQ A;  5E17 F;  2WPR A;  5K5Q A;  2JUC A;  1JB0 J;  3UR3 C;  1AKH A;  4BQA A;  4HYT B;  2HPC B;  1HBW A;  3K2Z A;  3L72 J;  2EFQ A;  1D3Y A;  4C3J J;  3AKZ A;  5IYD J;  4PDK A;  2QQ8 A;  3U1C A;  1PGN A;  2JKV A;  2P10 A;  5F6F A;  5APY A;  3CP8 A;  4YII A;  1YJN I;  3FKJ A;  1N73 A;  4HX7 A;  5AW4 B;  2GWR A;  2ELK A;  3PIO F;  4M9S A;  1LDK B;  3U1K A;  3WU0 A;  1JUP A;  2KT0 A;  5E79 C;  1FJK A;  1NTK J;  1G8X A;  1W7P B;  2HOT A;  3H1I G;  2E2H J;  2BEQ D;  4GKG A;  1VQ4 P;  3HUG B;  2E36 A;  2MC4 A;  2LTP A;  2PI0 A;  3S15 J;  4B3H A;  4XA4 A;  4DW6 A;  1G2C A;  3A01 A;  2HTS A;  2M7B A;  1HCR A;  3RPU D;  1NTM J;  4CO8 A;  1GXP A;  4UB6 C;  2CPS A;  2UXN A;  1QGP A;  4PK4 A;  1YJQ A;  2AS5 F;  3CPW O;  4RAF A;  3S16 J;  4WY4 D;  3CUO A;  2DCE A;  1FZA A;  4BYY A;  2XKM A;  1KIL A;  1RKT A;  2XAJ A;  3GFJ A;  1XGO A;  2QQ9 A;  4ZZL A;  1Q81 Q;  1SQX G;  2BEZ F;  3BTJ A;  4DYQ A;  3K4C A;  2LD5 A;  4DT0 A;  2DK8 A;  4M3E A;  2IZ0 A;  1SQX E;  1EA3 A;  2C9N Y;  3RI4 A;  2ESH A;  3FXJ A;  2CFO A;  2JRT A;  2DPU A;  3L74 G;  1ZGJ A;  4RGX A;  4M9Z A;  2BGC A;  4MFE A;  3GXO A;  5AW8 B;  1YJ8 A;  1G1J A;  3S8P A;  2KYV A;  4KIC A;  3ZN0 A;  4BKX A;  3Q3C A;  4BDY A;  4D9J A;  1L4A C;  1WRJ A;  4GOE A;  5AW9 B;  5CCG C;  3NRV A;  3BVH A;  2WAE A;  3HOV J;  1RRJ A;  2ZYG A;  1BR1 A;  3ZOB A;  5AVT B;  4Q4Z F;  2L4M A;  4BUP A;  2KQR A;  3CZ6 A;  2YU3 A;  1H89 A;  4OIP F;  3M8F A;  2EIL H;  3HE5 A;  2PJP A;  2N9B A;  3B8E B;  3Q3D A;  4W97 A;  2R5Y B;  2QIW A;  3C18 A;  2KFD A;  1GL2 B;  3BT9 A;  1SAU A;  5CQE A;  4A0Z A;  5GTH E;  2DAO A;  3CX5 D;  1RF1 B;  2Y0S N;  1KB9 I;  4L5I A;  1VQ7 I;  1Y1V J;  4AIH A;  1Z77 A;  4DBQ A;  5IP6 A;  4BDZ A;  2R7R A;  1LE8 B;  2H88 C;  5E79 H;  3HC7 A;  1BN5 A;  1H0M A;  1MD0 A;  3PP5 A;  4B8X A;  1LE8 A;  3F6O A;  2KUB A;  2FQ4 A;  4P96 A;  1KQG B;  2NYX A;  2XB5 A;  1WJC A;  1L0N J;  1JKQ C;  2L2O A;  2KHM A;  2QCO A;  3H2Z A;  2JPC A;  2QQA A;  4V2F A;  3ABL H;  5KNL A;  1JUM A;  5APS A;  1JEK A;  1P84 E;  2DMP A;  2NVU B;  3IAM 2;  2FYU D;  2Y0C A;  3CCJ P;  3BQZ A;  4MO7 A;  3DFU A;  3HL2 A;  1U2W A; 
#chains in the Genus database with same CATH homology
 4IHW A;  1ETY A;  2ZYD A;  4C2M J;  5M5Y J;  5K7Z A;  1A6I A;  1M2W A;  5M3F J;  1MSE C;  5EYR A;  1YON A;  3LOC A;  1FEX A;  4R1N A;  4B4C A;  5K7F A;  2CJJ A;  1N1E A;  2I9P A;  1VF9 A;  4DLL A;  2CUF A;  4XK4 A;  3ZQG A;  1MSF C;  4KUE A;  1UHS A;  1K61 A;  4BY1 J;  1TWF J;  4M6V A;  4QSH A;  2GBY A;  3BR0 A;  2DA5 A;  1JKP C;  2LK2 A;  1YVE I;  2LP0 A;  5F27 A;  5EF6 A;  4A3I J;  2IZ1 A;  2P81 A;  3MN2 A;  1F36 A;  3HOW J;  1NK2 P;  3ZHB A;  4M3B A;  3PLR A;  1GDT A;  1M67 A;  5DS9 A;  2DA7 A;  4DYC A;  4DCK A;  2MSY A;  1AHD P;  5EGO A;  3Q0W A;  3GTP J;  2I10 A;  4A3C J;  4XRM A;  3TW7 A;  1BJZ A;  4A3D J;  2DA6 A;  4FE7 A;  1BG6 A;  4W1U A;  2DMN A;  1JKR C;  3C7A A;  2LFB A;  2X6O A;  1SFO J;  3L6D A;  2KDZ A;  3G1O A;  4A3M J;  3OSG A;  1U8B A;  2D3T A;  2PGD A;  3K6J A;  1IRZ A;  2AHQ A;  2ME6 A;  5GP9 A;  1GUU A;  1WI3 A;  4QTR A;  1GV2 A;  1W0U A;  5M5X J;  3HM5 A;  4GWK A;  2CU7 A;  2DMU A;  1M75 A;  3NAU A;  4I76 A;  2YUS A;  1DLI A;  1EVY A;  1ZK8 A;  3HN2 A;  2JA7 J;  2TCT A;  4IHX A;  3HGG A;  4AUX A;  1U9O A;  1GT0 C;  3MVP A;  1LFU P;  5MGB A;  3A01 B;  3CDL A;  1Z82 A;  2XRL A;  3BR3 A;  2L7M P;  3JRD A;  4CYC A;  1VND A;  4MLO A;  3RKQ A;  1JJ6 C;  2JA5 J;  3G0O A;  4KUG A;  4D3S A;  3TW6 A;  2ID6 A;  1APL C;  4BBS J;  2JN6 A;  1XG1 A;  3F3S A;  5EEA A;  1JJ8 C;  1X2M A;  1JT0 A;  1WP4 A;  1TXG A;  3LSJ A;  2NVY J;  3DCF A;  3F0C A;  1FIP A;  4JQ0 D;  1RR7 A;  2NVT J;  2EZL A;  1XS9 A;  2E2I J;  3OSF A;  1FTZ A;  2E19 A;  2H1K A;  2VPR A;  1PGQ A;  1IDY A;  2DA3 A;  4B3J A;  3B6A A;  5FJ8 J;  2L0K A;  3ZQL A;  3HBL A;  2H8R A;  2PMZ N;  4I6Z A;  1NK3 P;  2DA1 A;  1IUF A;  4J19 A;  4IHY A;  2CQQ A;  3WS7 A;  4UUS A;  2ME0 A;  4X1E A;  5J3L A;  1ETQ A;  3HB9 A;  2EW2 A;  1WH7 A;  5GPC A;  1JT6 A;  5EG0 B;  3W6V A;  3ZQI A;  2HOS A;  2M2E A;  1MNM C;  1X2N A;  4PZE A;  2R0Q C;  4A3L J;  3M4O J;  4JX5 A;  3CKY A;  3S17 J;  3ZWC A;  2UYY A;  1QVU A;  4Y7N J;  2WTB A;  2K9S A;  2NS7 A;  2QF7 A;  3QPL A;  2XGC A;  2X58 A;  1X58 A;  5E3L A;  4AC0 A;  4IHV A;  1ETX A;  5F0C A;  5JLW A;  3ZW9 A;  4JX6 A;  1MBK A;  1IC8 A;  4OM8 A;  5HOD A;  5EG0 A;  2ECB A;  3ZGY A;  4M3G A;  2JJ7 A;  1LSJ A;  1UG2 A;  4LOC A;  2W8Z A;  3E7L A;  2OPT A;  3IH2 A;  5F0F A;  4D5C A;  4E12 A;  1W0T A;  3JRA A;  3HAD A;  2CQX A;  1MH3 A;  2YU9 J;  3JRB A;  3BR1 A;  4C3I J;  3TED A;  3S2H J;  4GBJ A;  2N8G A;  2QYT A;  3HGY A;  1SAN A;  2HXO A;  3I83 A;  1QPI A;  4M3F A;  2VUM J;  1UMQ A;  3LNQ A;  4GWG A;  1FJL A;  2L9R A;  4C3H J;  4B3A A;  3D1N I;  4XID A;  4BY7 J;  1QMG A;  1ETV A;  2IYO A;  1ZQ3 P;  4J0F A;  1IGN A;  1AKH B;  3BQY A;  2DA4 A;  3OOU A;  3LSP A;  4RBO A;  5HWS A;  3HDH A;  2B63 J;  1I36 A;  3C7D B;  3BTL A;  1QRY A;  2XPV A;  2D5V A;  3GTO J;  1WCM J;  4BXX J;  1FIA A;  2K9Q A;  1K83 J;  5GPA A;  4OVN F;  2DJN A;  2YS9 A;  2ZB9 A;  4A3B J;  4L5E A;  1OCP A;  1U9N A;  3IQD B;  1I6H J;  2M9H A;  2HDH A;  1IJW C;  4IM7 A;  2HDD A;  1ENH A;  3S1M J;  3WFI A;  3CCY A;  4J0E A;  2W90 A;  2IBD A;  4A69 C;  4HNV A;  1T56 A;  3G1M A;  5FKN A;  1TWA J;  3CMY A;  4AYB N;  1ZGW A;  2G0E A;  4A93 J;  1EF4 A;  1GV5 A;  5IYB J;  1TWG J;  5IP9 J;  1MH4 A;  1MBJ A;  1F12 A;  3HWR A;  2O9L A;  2CUE A;  2M34 A;  1OFC X;  3IH3 A;  1B72 A;  4XIC A;  2IYP A;  1B8I A;  2L7F P;  4M3D A;  3FIS A;  1WPK A;  1QVT A;  5EZG A;  3SJM A;  5IOY A;  1TWH J;  1MBF A;  2XPU A;  3GTK J;  2R7Z J;  5IOZ A;  3PM1 A;  3RQI A;  3WHB A;  4XRS A;  2OFP A;  3BTC A;  5F04 A;  2GLO A;  3H0G J;  4OQZ A;  4OQY A;  1R9T J;  2HXI A;  5F1J A;  2LKX A;  3FWN A;  3GHY A;  3FR7 A;  4CYC B;  2IAI A;  1BW6 A;  4V2G A;  3S1N J;  5FLV A;  1YB4 A;  2IEK A;  4DYD A;  3BR2 A;  3ADO A;  5FKO A;  3WHC A;  3RZO J;  3JRF A;  1HDD C;  1ETO A;  3GTJ J;  4X6A J;  1OCT C;  3PID A;  4MIM A;  2HI3 A;  3JRC A;  2XPW A;  3C7C B;  2JMW A;  5E3N A;  1IV6 A;  3I4M J;  5F08 A;  1ORK A;  1P7I A;  5A9R A;  2CVZ A;  3MKL A;  1PUF B;  1P7J A;  2P4Q A;  2VKE A;  4EEF G;  2LR8 A;  1MBG A;  3LSG A;  4NDL A;  3GTQ J;  4FE4 A;  1JDJ A;  3HOZ J;  5A9T A;  2EQR A;  3FKI J;  4B3I A;  2M8G X;  1O4X A;  3C2B A;  5EZH A;  1JKO C;  1BW5 A;  4D7M A;  2K9N A;  4G12 A;  5C4J J;  3PDU A;  3ZWA A;  4Y52 J;  1EVZ A;  4KUH A;  1VFC A;  2E1O A;  3S2D J;  2MW8 A;  3BR5 A;  1Q1V A;  3GTL J;  5F0H A;  1WPQ A;  1ETW A;  3IH4 A;  5FKL A;  5AYV A;  2ECC A;  3EGO A;  5FKM A;  3GTG J;  2EZK A;  3TP3 A;  1WGX A;  2MGQ A;  3JRE A;  1PUF A;  2R93 J;  1X0X A;  2R5Z B;  5FLM J;  3OBB A;  3PEF A;  3K96 A;  1Z0X A;  3Q3S A;  3HOX J;  1U78 A;  2ZYA A;  2COB A;  2PLA A;  5JLX A;  4EZB A;  5IP7 J;  1IG7 A;  3SDG A;  3PJG A;  1RES A;  1ZKG A;  3L1P A;  3W6Z A;  3A02 A;  5A9S A;  2DMQ A;  4B1R A;  3S1R J;  3QSG A;  3RZD J;  2R92 J;  1YRN B;  5IPA A;  4D3F A;  1XC5 A;  1PGJ A;  1YRN A;  3PO2 J;  1JUS A;  2HQ5 A;  3BG5 A;  3ULK A;  5FWN A;  3K7A J;  4FCY A;  5DTD A;  1IDZ A;  1DU6 A;  3FR8 A;  2MG4 A;  1LSO A;  4DYR A;  3FIW A;  2NS8 A;  2L7Z A;  4A3F J;  2W48 A;  5FKK A;  2X48 A;  1ITY A;  1PGO A;  4DZP A;  3I4N J;  3CQZ J;  2XB0 X;  2FX0 A;  3FK6 A;  3GTM J;  1F17 A;  1H89 C;  5J1R A;  2R5Y A;  3BTI A;  3NAR A;  1Y1W J;  3UKG A;  3DOJ A;  1ZCJ A;  1WDK A;  3B6C A;  1VI0 A;  1POG A;  3FK7 A;  2M0C A;  3Q0U A;  5IYC J;  3JRI A;  1HF0 A;  1F43 A;  5M5W J;  2EZH A;  1MBH A;  2JWT A;  5J1Y A;  5EDN A;  3CTV A;  4YCA A;  1TC3 C;  3PO3 J;  2Y30 A;  3ZW8 A;  2GF2 A;  3HOY J;  1D5Y A;  3JRH A;  2OF7 A;  1S7E A;  5E3M A;  2O7O A;  1GVD A;  1BL0 A;  2DMT A;  2Y9Y A;  1F14 A;  1A5J A;  2VI6 A;  2K40 A;  4DZJ A;  1PGP A;  1H8A C;  1M76 A;  3O8H A;  1LJ8 A;  3LSR A;  2HYJ A;  1I50 J;  3G1L A;  4JYK A;  1H88 C;  4GFB A;  3WFJ A;  3BR6 A;  3VPR A;  1NTC A;  4JPZ B;  3MOG A;  2EH3 A;  2CRG A;  5C4X J;  2EBI A;  4ABZ A;  5BNG A;  1M66 A;  4XRS G;  3H3V K;  2EZI A;  5M3M J;  3QPS A;  2DA2 A;  5EGO B;  1X0V A;  1ZR4 A;  1WH5 A;  1KS9 A;  4IEJ A;  2FD5 A;  5E3O A;  3ADP A;  4D7N A;  2WAQ N;  5K7H A;  2WB1 N;  1JGG A;  3A03 A;  1AKH A;  5A9S B;  2TRT A;  3GBG A;  4C3J J;  5IYD J;  4S0H B;  2ID3 A;  4D5F A;  1ETK A;  1LFB A;  1PGN A;  4A3J J;  2JKV A;  1JTY A;  2LY9 A;  2ELK A;  2R5Z A;  1JUP A;  1RPW A;  2KT0 A;  3ZQH A;  2HOT A;  4E21 A;  3HEF A;  2E2H J;  3S14 J;  5J1U A;  3G17 A;  3SFI A;  2LTP A;  2JK3 A;  3S15 J;  1IL0 A;  3K2A A;  4B3H A;  4DW6 A;  1T33 A;  3A01 A;  1HCR A;  1HDP A;  3HDD A;  2XGD A;  1BA5 A;  1FTT A;  3Q0V A;  3BG3 A;  2GM4 A;  1CQT A;  9ANT A;  1WDL A;  1YJQ A;  1TWC J;  2Y31 A;  3S16 J;  4BBR J;  1RKT A;  3IV5 A;  1JTX A;  2JA6 J;  5C3E J;  5JE8 A;  3BTJ A;  3ZQF A;  1B72 B;  4DYQ A;  2LD5 A;  2RAE A;  5C44 J;  1B8I B;  1DU0 A;  1HLV A;  2NOG A;  3RQS A;  2IZ0 A;  4M3E A;  4A3E J;  4FGW A;  3ZWB A;  4PZD A;  2NVQ J;  3M3Y J;  1G2H A;  4MFE A;  2O8K A;  4FTH A;  2XSD C;  2JA8 J;  2E2J J;  1YJ8 A;  1WDM A;  4A3K J;  4BKX A;  1VPD A;  2HOA A;  4MFD A;  3Q3C A;  2DN0 A;  2X9D A;  4FIS A;  1RET A;  3HOV J;  1F0Y A;  2ZYG A;  3ZOB A;  2DTZ A;  4JP0 A;  2WV1 A;  3S1Q J;  2NVX J;  3DEW A;  3QQA A;  4JX4 A;  4E13 A;  2AO9 A;  1AU7 A;  1DLJ A;  3QHA A;  1ZTR A;  4A3G J;  1MBE A;  3HKZ N;  3O8G A;  4W97 A;  4QIW N;  4UUS B;  4PZC A;  4RDU A;  4D3D A;  2R5Y B;  3HOU J;  2Y2Z A;  3BT9 A;  1N1G A;  2Y0S N;  3JR9 A;  1Y1V J;  3ZQC A;  1ZR2 A;  1Z77 A;  1I3Q J;  5IP6 A;  2Y9Z A;  2LLK A;  1LE8 B;  3BG9 A;  4S3M A;  1LE8 A;  2FQ4 A;  1E3O C;  3TP0 A;  2XB5 A;  1JKQ C;  3W6U A;  2QCO A;  3H2Z A;  4V2F A;  2XGE A;  2FJ1 A;  3OIO A;  1JUM A;  1HOM A;  2DMP A;  2VKV A;  1RKW A;  2LVS A;  3JRG A;  1YRL A;  4OL9 A;  1OJL A;  4UUT A;  3BQZ A;  4MO7 A;  3DFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...