1OFCX

Nucleosome recognition module of iswi atpase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
266
Chain Sequence
AVDAYFREALKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERENIELEEKERAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords ISWI PROTEIN
publication title Crystal Structure and Functional Analysis of a Nucleosome Recognition Module of the Remodeling Factor Iswi
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 103
structure length 266
sequence length 281
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09110 HAND HAND
X PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ofcX04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1ofcX01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 1ofcX03
1VF9A 2DA6A 3SFIA 1ETOA 3G1MA 5F27A 1MNMC 2AO9A 1CQTA 2HYJA 4V2GA 1MBGA 2DTZA 1FIAA 1JKRC 1OFCX 2EZHA 1IUFA 2Y31A 4JQ0D 3F0CA 2NVTJ 2DMNA 2EQRA 1AKHA 4CYCA 2ID6A 3HOUJ 2X6OA 2ME6A 3LSRA 1RKTA 1O4XA 3HOZJ 1AHDP 5BNGA 5C44J 3TP0A 1NK3P 2HXOA 1B72B 2EH3A 1Q1VA 3A03A 1UMQA 2DMUA 3A02A 3I4MJ 1IV6A 1GDTA 1TWGJ 1MSEC 2ELKA 2XGCA 4JPZB 1UHSA 2GM4A 2LKXA 1B72A 2MGQA 3FK7A 3S17J 3BG5A 2YU9J 1GV2A 1TWFJ 1FIPA 2VKEA 4MIMA 2JN6A 1ITYA 2EBIA 2NVQJ 1ETVA 4JX5A 1Z0XA 4UUSB 3D1NI 3HOVJ 3CMYA 1IG7A 2X48A 2R5ZB 1H88C 2OPTA 1QVUA 3BR6A 3ZQGA 2TRTA 4GFBA 1UG2A 4FCYA 3HB9A 3RZOJ 2LD5A 4DZJA 1GUUA 4M3FA 1P7JA 1Y1WJ 4M3EA 5E3MA 3JRHA 2R7ZJ 2DJNA 3BR0A 3SJMA 1HOMA 2CRGA 2O8KA 2R93J 4DYCA 1POGA 1WH5A 5IP9J 4A3EJ 1QPIA 3BR3A 4FISA 4A3GJ 2HQ5A 3S1MJ 1HLVA 4Y52J 2LK2A 3Q3SA 2CQQA 4EEFG 5M3MJ 2I10A 2XB5A 3FIWA 2L7FP 3IH2A 4MFEA 3HOXJ 2VI6A 3S16J 1IDYA 3OSFA 3MKLA 1PUFA 2LR8A 2PMZN 5EF6A 1QRYA 1U9OA 3WHBA 2MW8A 3C2BA 1YRNA 2CU7A 4D5CA 4IHXA 4HNVA 3FK6A 3HDDA 5K7ZA 2ME0A 3PM1A 5HODA 2XGDA 1FEXA 2ZB9A 4C3IJ 5DS9A 1VNDA 3GTLJ 1I6HJ 3LSJA 2DA2A 3TP3A 3JRAA 1H89C 3BR2A 1X2MA 1B8IB 2JA8J 2EZKA 2M34A 1ENHA 1JT6A 3GTKJ 5K7HA 1JTXA 5F0HA 5M3FJ 1FTTA 3QQAA 5IYCJ 4A3KJ 4BBRJ 2K9SA 1AU7A 1AKHB 4CYCB 4C2MJ 2FD5A 2GBYA 3DCFA 5E3NA 2Y0SN 2DN0A 3QPLA 3NARA 1ETYA 3RZDJ 1A6IA 2X9DA 5E3LA 5GPAA 3S2HJ 3A01A 3G1LA 3JRDA 1TWCJ 3OSGA 2KDZA 1X58A 1JKOC 4RDUA 4XICA 2QF7A 2R92J 5EZHA 2XPWA 3RKQA 3PO2J 1Z77A 3O8GA 2JA7J 1MBHA 3S2DJ 4BXXJ 3HM5A 1ZR2A 2OF7A 2L9RA 3GBGA 3OOUA 4Y7NJ 1MBFA 1D5YA 3SDGA 4MO7A 4OVNF 2MSYA 4D7NA 1JKQC 2YS9A 2W48A 5EG0A 2NS8A 2LFBA 3CCYA 5FLMJ 2H8RA 4FE4A 2E2IJ 2VKVA 4BKXA 3HOWJ 1VI0A 3GTGJ 2ECCA 3GTJJ 2WB1N 5FKKA 1MBEA 2E1OA 5J1YA 1ETXA 1I50J 2GLOA 3H3VK 2LY9A 5FLVA 3JRIA 1NTCA 2WAQN 1GV5A 1QVTA 1WPKA 1DU0A 3TW7A 2FX0A 2N8GA 3BG3A 2IAIA 2Y30A 4G12A 2EZLA 4NDLA 1T33A 3B6CA 4IHYA 1RKWA 3GTPJ 1DU6A 5JLXA 3GTQJ 3I4NJ 2O7OA 1SFOJ 3CQZJ 2JA5J 5FKOA 4JX6A 1IGNA 5E3OA 3BQYA 1LE8A 3S1QJ 2Y2ZA 5C4XJ 1BW6A 1K83J 4QTRA 2E2HJ 1TC3C 1IDZA 1PUFB 4AUXA 2ID3A 4JP0A 1ZTRA 3K7AJ 3BG9A 5M5XJ 4A3IJ 1YRNB 2M2EA 1P7IA 4XRSA 1F36A 3BR1A 1OCPA 1RESA 2DMPA 1G2HA 3LOCA 3QPSA 2FJ1A 2HDDA 1ZK8A 2HXIA 1HF0A 4DYQA 4V2FA 1WH7A 2K9QA 2L7ZA 2LP0A 4FTHA 2MG4A 1SANA 5F0CA 2E2JJ 2JWTA 1ETQA 3OIOA 3BR5A 1IJWC 9ANTA 3G1OA 3CDLA 4IEJA 3GTMJ 2DA5A 5IYDJ 2K40A 2KT0A 5F08A 1JGGA 4B3AA 1BW5A 2DA3A 1U78A 3ZQIA 2HOTA 2P81A 5C4JJ 3TEDA 3TW6A 5K7FA 3ZQFA 2L7MP 2DA7A 1I3QJ 5J1RA 3HEFA 4A93J 5EDNA 2FQ4A 1MSFC 2JK3A 3B6AA 3UKGA 1ETWA 5F04A 3FISA 4J19A 5JLWA 1OCTC 3A01B 4XK4A 3JRBA 2NVYJ 5DTDA 2DMTA 1MBJA 3K2AA 1WI3A 5GP9A 4AYBN 2VUMJ 4A69C 3ZQHA 4XIDA 2AHQA 5EYRA 3GTOJ 3Q0UA 1GT0C 2CQXA 3BT9A 1NK2P 4W97A 2EZIA 3BTIA 1H8AC 2E19A 1K61A 2K9NA 4C3JJ 5IOYA 1WCMJ 2DA1A 1LFBA 4L5EA 3JREA 3BTCA 4B1RA 2HOAA 2M8GX 2HI3A 3RQIA 5EGOA 5EG0B 2R5YA 5FKLA 3W6VA 1U8BA 1XC5A 1FTZA 2TCTA 3IH4A 3BQZA 2NS7A 4M3BA 2NVXJ 3ZQLA 1XS9A 5J3LA 2Y9YA 1HCRA 4JX4A 2ECBA 2LVSA 3HOYJ 5EZGA 1TWAJ 3VPRA 5IP7J 4A3BJ 4DCKA 1BA5A 2CJJA 1XG1A 4X6AJ 1JUPA 2M0CA 2QCOA 1GVDA 1TWHJ 5F0FA 4DW6A 1R9TJ 3ZQCA 4A3CJ 3O8HA 1OJLA 3LNQA 3BTLA 1JKPC 4C3HJ 1IRZA 1LE8B 5IYBJ 3FKIJ 3LSGA 4XRMA 2R0QC 2IEKA 1ZGWA 3S1NJ 1Y1VJ 3WHCA 3Q0WA 4BY1J 2O9LA 5IP6A 4BY7J 1HDPA 1HDDC 2VPRA 2WV1A 3ZOBA 5M5WJ 5C3EJ 5J1UA 2NOGA 4XRSG 1RPWA 1S7EA 4RBOA 3M3YJ 2H1KA 3S14J 5FJ8J 4I6ZA 2CUEA 3NAUA 3HKZN 1W0UA 1APLC 4AC0A 1A5JA 4M3DA 3MN2A 4QIWN 1ORKA 1JJ8C 2L0KA 1T56A 3L1PA 4S0HB 3M4OJ 2JA6J 4A3DJ 3IV5A 1EF4A 2IBDA 1ETKA 5IPAA 2LLKA 1U9NA 4I76A 5FKMA 4UUSA 2YUSA 3JRCA 1X2NA 2D5VA 4UUTA 2R5ZA 4A3FJ 3Q0VA 3JRFA 2M9HA 3S1RJ 2XPUA 1JUSA 3S15J 1MBKA 5FKNA 4FE7A 2XGEA 4A3LJ 3BTJA 4DYRA 2DA4A 2XRLA 4D7MA 4D5FA 1JT0A 4QSHA 4M6VA 1ZKGA 1IC8A 1WGXA 5GPCA 1MH4A 3IH3A 1RETA 5M5YJ 2G0EA 2B63J 3JR9A 4IHWA 1RR7A 3H0GJ 4M3GA 2COBA 1E3OC 2HOSA 2CUFA 1VFCA 4IHVA 1ZR4A 2Y9ZA 5EEAA 1BL0A 3DEWA 2DMQA 4MLOA 1LFUP 2JJ7A 3MVPA 4DZPA 4X1EA 5F1JA 3E7LA 2XSDC 4MFDA 1FJLA 2XPVA 3PO3J 1W0TA 4ABZA 1JUMA 2JMWA 3JRGA 4B4CA 5EGOB 2LTPA 2R5YB 1JTYA 3HBLA 4A3MJ 1F43A 1BJZA 3HGYA 4JYKA 5IOZA 1JJ6C 1MH3A 4LOCA 2XB0X 4W1UA 4BBSJ 1ZQ3P 2RAEA 3HGGA 4A3JJ 1B8IA 3LSPA
chains in the Genus database with same CATH superfamily
3L75J 2YMKA 1ZCJA 3CDHA 4GYGA 2ESHA 3I55I 3F89A 3BCCD 1ETOA 1H0TA 1T08B 1MNMC 1ZARA 4HRIA 3D5SC 2IBZD 4IM7A 4II3A 4KMFA 2AO9A 3WU1B 2ZJRF 2F48A 2W6JH 4D6TJ 2NRGA 2Q9IA 5B5EE 2X0LA 1JKRC 5KKZC 4KMUX 1JMMA 1KU7A 3C7JA 2EZHA 2X4HA 1G4DA 5J8CA 1EDKA 1SQPJ 2H88C 2JO1A 2NVTJ 2DMNA 5GTIE 5FLXK 1PGOA 3IC7A 4CYCA 2M5WA 3HE5A 2X6OA 1XMXA 3DLLF 4B48A 3CESA 3MIWA 3HOZJ 1O4XA 2QEXP 2XAGA 5AVQB 4UB6C 4OWRB 2XAUA 2H27A 5CJ4A 5C44J 1AV1A 1QL1A 3W2VA 1SQBD 3RK2C 3H1KJ 3A0HE 1Q81Q 1B72B 3GZ6A 3A03A 3FXDA 1PYVA 4F3QA 1UMQA 3S8PA 2V7FA 5DCMB 1GDTA 1JTHA 1X19A 3CMAI 2ELKA 1SD4A 4JPZB 1IXRC 4RO0A 1VQ6P 3VTPC 1T0FA 3R61A 3JTGA 1BIAA 2K3PA 2MGQA 4U0YA 2BBYA 4XORA 3IF4A 3BG5A 4LLLA 3TOAA 2N1TA 4KA4A 1RHZB 3AEEC 2K27A 5FLXZ 1GZLA 2VKEA 5L3EA 1ITYA 3B5NB 2EBIA 4IFMA 3GEZA 5CQEA 5IT3A 4OIRF 4FASD 1KYWA 3C1DA 4JX5A 1NJIQ 3O6QA 4Z2YA 1YJQA 2Q1ZB 5CJ9A 5B66C 2X48A 3HOVJ 3IQDB 1LWUB 2LOOA 3H1HG 2R5ZB 1H88C 2M0MA 2OA4A 4A2UA 2OPTA 2PJRB 3ZMTA 5BU5A 1N73C 2F4MB 3DWLE 3HUGA 3BR6A 3Q9SA 4OGQB 3RBZA 1YJWP 5FD6A 2TRTA 2Q8KA 5TGTA 1UG2A 4FCYA 3KP7A 3CF2A 2W6AA 4HH2A 2LD5A 3LQRA 2AEJA 1QNTA 3L71J 4G9YA 5J8FA 2RNJA 5E8GA 5GAEJ 5E3MA 2RKLA 4B3XA 2CPBA 2BEOA 1HOMA 2O8KA 3GHGA 4MNUA 1POGA 3EETA 3CX5D 3CCRP 5IP9J 6PAXA 2XIGA 1JXSA 2H1LA 1USEA 3IFMA 2HQ5A 4UXNA 5J4YA 4BHBA 3TDKA 2VASA 3AE2C 3H1HE 1MFZA 2FMYA 1HGVA 3LMMA 4EEFG 3B4SA 1HWTC 1Q2NA 5K5QA 2XB5A 3I59B 1X0TA 1X8YA 1E0EA 5E17F 3L75D 2DOFA 4E13A 4ENNA 3DQVC 3HOXJ 4OIOF 1F9NA 4OIPF 2CUZA 3M8FA 1R00A 3CCEI 1SLQA 1L0NJ 1VL2A 3HADA 3P8CD 2BCCG 1SAUA 1PUFA 3HZJA 2LR8A 5EF6A 3WTYC 1HBWA 1D3YA 5GAHJ 2BW3A 4D6TD 1S9KE 3N97A 1QRYA 3S32A 2EB7A 3KEOA 2CPSA 1K4TA 2W1OA 2CW7A 4EM2A 2ZXHA 4AM3A 3CCMI 4HNVA 2A68F 1WSUA 4RGRA 1FC2C 2R5DA 1WJEA 1N1GA 1VQLP 5K7ZA 2IA1A 2ME0A 3VFZA 4OQYA 1DEEG 2JPCA 5HODA 1NG7A 1Z91A 2CV1A 1U5TB 1NWQA 1LDKB 3K4JA 4L18B 2AXTH 4ENKA 1XN7A 2R5BA 3LFKA 4IL6E 4YXDC 3B71A 1LJ2A 1KMIZ 1NU1G 2YIUB 3AE5C 3H1KD 2LG4A 3LW5J 1FBQA 2P5VA 2V9KA 1N77A 4J00A 1P2FA 3HRUA 2BCCE 3BDDA 4U7JA 2KRCA 3OJAB 5AVSB 3SZPA 4MGRA 1FZAA 4PJNA 1X2MA 2LREA 3H1IJ 5APSA 4LJZF 2RVCA 2EZKA 3QAHA 3GWZA 3CCLI 2NOJB 2P7VB 4B3IA 4W7YA 3WU2H 2M8RA 2F5VA 2QM8A 1JTXA 3C7CB 1KA8A 1FP2A 3E7KA 2AXTC 5BPDA 3HTUA 3QQAA 2IT0A 1OW8A 2DTRA 5TISE 2WC2A 1EA3A 2BVLA 3E1SA 1LFPA 3N4MA 1NU1E 1MJBA 4HV6A 3PL8A 4BH9A 3OA7A 2VXZA 1JCCA 3HD7C 3FMQA 4CYCB 1IJDB 3HE5B 3A4CA 4HQEA 3FR7A 5E3NA 2MLKA 2Y0SN 3ZGKA 1WRGA 3RZDJ 1A6IA 2X9DA 2VBXA 5HDGA 5E3LA 1VTNC 4H4KC 3P7NA 3WU2C 4DLLA 5E20A 3S2HJ 3V4QA 4N9IA 3KYLA 1D0YA 3PFIA 1FSEA 3FXJA 3L71D 2WAQA 5DYMA 4RDUA 5BQTA 1M76A 4NC8A 2QF7A 3EDPA 1SQQK 2R92J 4IKFA 1K73Q 1JTHB 3BG6A 4IXAA 1YOVB 2WTYA 4L9JA 3DEUA 2FBIA 3LQQA 2ZXJA 4QPQA 5HS8A 4ZJZA 3I3LA 3F23A 1GMJA 3SXYA 3IRQA 1S8NA 2P4WA 5ICEA 2FYNB 5KLIC 3W6JB 4KICA 2IGMA 1K6OA 3CCVI 3SWFA 4N0BA 2KZVA 3HC7A 5M1BA 2XRNA 1HW5A 5D8KB 3OOUA 1N8RQ 2VBWA 3WODF 2PI0A 3BLYA 4Y28J 5KAFE 3L35A 3B73A 1AA7A 3G71I 2VC1A 2V26A 4OAYA 1KC8Q 4BQQA 1URQC 1L0ND 3O6QB 3V2NA 2PMUA 3DU6A 3CCYA 5FLMJ 1SFEA 3H1CA 4A12A 1NYHA 2IXSA 3CP8A 1DP3A 2K9MA 1UAAA 2IZ1A 1L0OC 1VI0A 2POHA 3HDHA 3HUGB 1FYLA 1YIJI 2K9YA 2WPVB 1MBEA 1PVEA 3CUQA 2WV0A 4A0YA 5LGTA 3OY9A 1ETXA 2PMZA 1HXDA 2NRAC 1OX3A 4QMAA 1M1JC 3H3VK 1IFIA 4ITVA 1W5CE 2Z5IA 1PGJA 2LY9A 4RB3C 5FLVA 3JRIA 1NTCA 1T3UA 4D9JA 1YJNI 2X1CA 2H6BA 1QVTA 5LRSA 3M0AA 3TW7A 3GHGB 2KQRA 2ZYDA 2Q1KA 2Z5HA 2W24A 1BOAA 2Y30A 2I76A 3K1MA 1X4PA 1X0XA 1WI9A 3GTPJ 1EXIA 1G59A 4XOTA 1NO4A 1LTJA 1KB9E 5CCHA 3HHGA 3H1ID 2O7OA 1I27A 3CQZJ 3L74J 1IGNA 3L6DA 3V8KA 2A6TA 1LE8A 4CSWA 3S1QJ 2VT2A 4ESBA 2KSJA 4ZYGA 1N86A 2MH2A 3RK3D 5B1AH 1TC3C 1X9VA 1PUFB 4WY4C 3FGAD 3HUSC 4EM1A 2BW3B 2ZVOB 3L36A 4Q48A 2ICWG 3K7AJ 2QSHX 4PDKA 3SFEC 3Q1MA 3GHYA 4JYCA 2VT3A 4XRSA 3RYPA 1QPMA 1F36A 1FPQA 2DMPA 4L0ZB 2X1DA 2KOGA 2V1UA 1JO5A 1K9MQ 1OIPA 2L02A 3QPSA 4H13C 1P92A 4L9VA 1E3PA 3ABUA 3BWGA 2QBYA 3CCUI 3CC4P 2CMPA 3TBIA 2W6BA 4I02A 3RL0C 4V2FA 4IPAA 1WH7A 1N2DC 5D4SA 2FYUG 3IN6A 3QOEA 2ELHA 5APUA 2HPCA 1QZYA 2K9QA 2YSRA 4M6XA 2L7ZA 3EUKL 3OIQA 2M5AA 1X22A 1WJAA 1SANA 5F0CA 3NWSA 3LWFA 4TLFA 1EKEA 3BR5A 4W80A 9ANTA 2V1NA 3G1OA 4IEJA 1W7PA 3OS1A 3GTMJ 1YONA 4E7JA 1Q1HA 4GWGA 3E6MA 2FOWA 4L0YB 5ICCA 3MD0A 4XQFA 1XSDA 3C18A 3PTZA 2QQ9A 4BE2A 1U78A 4OAZA 4MQVA 3WGGA 3ZQIA 2Q3EA 3RQSA 1SQBK 4AU7A 3CJRB 1KQSO 4XLCA 1NTZG 1V55H 4AVZA 1ZLJA 3O6BB 1F1ZA 2E35A 3CLOA 3OR2C 1M7LA 2FYUE 1BCCE 5A9TA 3G6EP 2M30A 2DT6A 1QMGA 2CQ7A 1W36C 4IFFA 3HPGA 2QJYC 4L73A 4N4NB 3SEZA 3Q3DA 1MSFC 2LYCA 2DYSH 3H9QA 4TV7A 3B6AA 3SHFA 3JSOA 3ECHA 2HODA 4CUGA 4YCAA 4MN4C 5F04A 3N7NA 3M1EA 4HDVA 1OCTC 3IAOA 4P1WA 4XK4A 2KP8A 3KCCA 3DTKA 1NGMB 1RUNA 3OIPA 4AYBN 1R5LA 2AEMA 1NTZE 1Z3YA 2OCCH 4YIIA 1MIJA 4A0ZA 4OH8B 1R1TA 1Z05A 3Q9VA 4MEYF 5GAGJ 5BU8B 4XA4A 1YLFA 3BT9A 3CCLP 4XLHA 3HOTA 5AVTB 4EGZA 1H8AC 2EFNA 2B9SA 1LFBA 1R4MB 1JM0A 1Y47A 3AG3H 2LKPA 2J5PA 2D2CD 4GIFA 5JE8A 4B1RA 2HOAA 2JVHA 4EVIA 3ZRGA 3QYFA 1PUEE 5HDNA 2HPIA 3ASNH 2ZJSE 4PFPA 2ZFWA 5H20A 2X85A 1B9MA 2BHZA 1XC5A 3TL4X 2TCTA 1K4SA 1FTZA 3SWYA 2H6CA 2FRHA 2VJ4A 1QVFO 1SMTA 3HSRA 1Z7UA 3MWMA 1YJ8A 3EYYA 4YELA 2STWA 5F1RA 3J7ZI 5J3LA 1UIIA 3HRNA 2ZVNB 2ECBA 2HR3A 2JPBA 3CUQB 3HOYJ 4PZJA 2QJPC 3H32A 1KS9A 2OQQA 3I5CA 4LFUA 2P8TA 4A3BJ 3ZWBA 4RM2A 4Q5SF 1BA5A 2WSFJ 2CJJA 4PJJA 2P6TA 2KYVA 3FXRA 4ZDOA 2HU9A 2LXCB 1JNMA 1NTMG 1XDSA 3CPWO 1S1CX 4PGGA 3FXKA 5CQGA 2AS5F 4C46A 3IUOA 2M0CA 4NNJA 3KQGA 3T97A 2KSEA 1L4AC 2Z16A 5F0FA 2HQNA 1G6NA 1V4RA 3ZQCA 1LJ8A 3HN2A 1OJLA 2VQLA 3LNQA 2WZ7A 3D70A 1LTJB 2OZUA 1LT9C 1YQ4C 4CZCA 3VOEA 5LEJA 3C3WA 3M8JA 1USTA 3E5UA 3DV8A 4RB0A 1LE8B 5IYBJ 4XRMA 1ZGWA 1DUXC 2VJJA 3Q2YA 2CQKA 2KLUA 4P5OA 1OYWA 4IJAA 1OR7A 3WHCA 4BY1J 1EZVD 1IF1A 2QM3A 3RKWA 3F5HA 1HDDC 1JY2O 4ZKUA 1UJ8A 1PP7U 3ZOBA 2WA0A 3E0JB 5C3EJ 3I0TA 3MKYB 1BGYE 2BHYA 3JAMK 1NTME 2O1KA 5F6FA 2WT7A 1S72I 1KILD 1YITI 4XRSG 2PJPA 2KJCA 2EWNA 1JEKA 5FJ8J 3NAUA 2XAJA 1JE8A 1W0UA 3M9AA 3CCSI 1APLC 1YHQI 2ZKZA 3HWRA 2YO2A 4QIWN 4JQFA 3A5TA 2QBYB 1PGPA 2IZ0A 4B3JA 3M4OJ 1Y0NA 2BXYA 1RH5B 1GXPA 1DEBA 2HPCB 2O8XA 3IV5A 1BIBA 3CZ6A 4MEXF 2M5AB 4N3YB 1EF4A 2DFEA 1ETKA 2L2OA 3BCBA 3ZMVA 2R7OA 5DD8A 3V8JA 5D6EA 4UUSA 3I56I 1W7PB 4EYYQ 2KHMA 2D5VA 4A3FJ 1IN5A 1R4NB 1HSJA 2DO7A 2FXMA 3R2PA 5KAIH 4ZKPA 5LD2C 3HRTA 5E79H 3KZZA 2BXZA 1V5GA 5APTA 4ZMDA 1JUSA 2OCEA 2VQHA 4Y15A 3S15J 5LEKA 2XAHA 3U1DA 2QLZA 3CJQB 3GFLA 5EEHA 2DJIA 1KV4A 2VJIA 3K4BA 3QU6A 4D5FA 4LLHA 5J6XA 1KONA 1VQ9P 1KU2A 3KZYA 1IC8A 1L0LK 4FT8A 3RPQA 4F91B 5GPCA 1PP8F 1UZCA 3IH3A 3GVAA 2WQYC 5M5YJ 2BCCJ 3WFIA 2HODB 1YI2P 1ZRTE 3HOSA 2E1MC 3JR9A 5KAIC 4IHWA 3HE4A 3TMOA 1P4XA 4CZZA 2HOSA 3H1JG 4RAFA 5EEGA 3I4PA 3RYRA 4CH7A 1VFCA 4IHVA 2EFOA 5K5GB 3CC7P 2VIXA 2V79A 3OV8A 4ZDLA 1V5FA 5D8LB 3G17A 1R8EA 3H6PA 5ICFA 1L0NK 3EQLF 3ABMH 4MHGA 4U7BA 3AE4C 1LFUP 4DZPA 5DJUB 1TW2A 2A45G 2JDIH 4NC7A 1P84E 4XLPF 3C1LA 4U87A 2PMHA 2IS1A 4UB8H 1MMDA 3KEQA 2QE7H 1FP1D 4DOZA 2JSCA 4ENJA 1SQXG 3K9TA 4I98B 2KP6A 5KNLA 1GK4A 5H2FH 1RE4C 4H44B 4YXWH 2QA4P 2E74B 4B4CA 3WG9A 1F4KA 4ZZDA 3H1JE 3AL0C 3QODA 4ON0A 4A3MJ 1F43A 2WMMA 3QU3A 4KUHA 1G8XA 4JYKA 1FDOA 2R44A 5IOZA 3J7AY 1JJ6C 1QL2A 1OXZA 1LP1A 4WF2A 4HZFA 4DBRA 4BBSJ 3A0BH 4KT0J 1ZQ3P 1SFCB 2R7UA 3H32B 3B5ND 3LSPA 4RB1A 3P8MC 4I0BA 2DA6A 4HYTB 4IF4A 1MW7A 1QHGA 3BPXA 3ABLH 2C9LY 4UHTA 2HYGD 5HLIA 5K5OA 4XONA 5IY5H 1LTAC 5H2FC 3TO7A 4J0FA 4R79A 4DNCA 1SQXE 1ZELA 1CQTA 3KZIE 2R4GA 5E1WA 4IRIA 1FIAA 1YB4A 4E21A 1SVFA 3T97B 4AUWA 1PIXA 1G3SA 2KZJA 1OFCX 2PAJA 2ZMEA 1KQFB 3T0YA 4OGQD 2YNYA 3F0CA 2OZ6A 1MDMA 2CSOA 3E97A 2EQRA 3R6SA 3HOUJ 3A0BC 3LSRA 1S9KD 1VQ8P 1AHDP 1VQ4P 5HNFA 1H9GA 1MD0A 2QJKC 3TP0A 5HOOA 1RF0C 1UIXA 1KYOH 1CGPA 1IO4A 5FO5A 3FDYA 3CCQI 4WBAA 4Y17A 2RC4A 5ILVA 1VQOI 2MABA 4GYIA 3ZDMA 3I4MJ 1IV6A 2F5EA 2PLAA 2WT7B 2VC0A 1PPJG 2XGCA 1IO2A 3KIOA 3EFGA 4ETSA 3GMEA 3ITKA 4N9HA 2LKXA 2P7CB 4HF0A 3VOPA 1HJBA 2QUFA 3SZGA 2AXCA 1B72A 2BCCD 3FK7A 4DIQA 4OWFA 5CBOA 1YTYA 4XSZF 1BN5A 4MIMA 1YTZT 3FMSA 4RA2A 5AYVA 3LW5H 2ZFUA 3EGOA 3U2RA 2UWMA 1GD2E 4L74A 3FX3A 4G7OF 1D0ZA 4LLNA 3RCOA 5FB2A 1ODDA 1LSJA 3K4NA 4UUSB 4EJOA 1USDA 3MP7B 2GA2A 3QSGA 3Q5RA 5ERIA 2FF4A 2N1TC 1PPJE 4XBFA 1IL0A 3ZQGA 3OL4A 2FKWB 1QEXA 1GHCA 1QZZA 2PEXA 1V5EA 2RKHA 4G7ZF 2HZDA 2AXLA 4M3FA 1ZW0A 4N78D 2OU2A 2RNGA 2W8ZA 2O01N 3H5AA 2FFDC 4BDYA 3F3SA 4KT5C 3K6GA 3WTXC 3JRHA 1K04A 1IV8A 1AFOA 3BR0A 4D1QA 4R1NA 2CRGA 2R93J 2LXBA 2G7UA 4DYCA 5LGUA 2EK5A 4OL9A 2CUJA 3LIDA 1QPIA 1CSBA 3BR3A 4FISA 2R7QA 4ZYHA 4A3GJ 2OTJI 2M3EA 4BGDA 4B8XA 3VMAA 1DPRA 3HE4B 1USSA 2CO5A 2I10A 4CCOA 3C7DB 3PJSK 1LDDA 1YIOA 3IH2A 3TGUG 4GCVA 3AE1C 3RK3C 1J9IA 1MNEA 1RRJA 2FE3A 1XCVA 5AVWB 1IDYA 2O01H 2XAQA 3HHHA 3MKLA 2PP6A 3I56P 2J5UA 1X1AA 1YJ9I 3OYHA 4YTPC 4EZBA 1D7MA 1X3WB 5D5VB 3C2BA 3KYCB 2KIKA 2ZT9B 2FYUJ 4PD4H 4J0EA 1BCCJ 3FK6A 4OMZA 1LT1A 1I39A 3R4KA 2CGPA 5AW3B 2Y0SA 3OYMA 3HDDA 3OW2O 2BY2A 3PM1A 2LR2A 4ZH4F 2QYTA 2OYIC 2L9VA 1X1DA 2DOEA 2OTLI 2H43A 4G8XA 1MZBA 3VDXA 3X2QH 4BL0B 4GBJA 3L70G 3TGUE 1NHAA 1VNDA 1UG0A 1I6HJ 2CYYA 1CI6A 2IW5A 3F9KA 2IGOA 2R7DA 2VBYA 3FXOA 3LSJA 2MBFA 4EJUA 3WUTA 1TL8A 1B59A 1LP1B 1LEBA 1IFMA 1H89C 3BR2A 1N1EA 1SFUA 2E5ZA 1UELB 1S6LA 5GTHC 2O3FA 2Y0MA 5APXA 1RNLA 1J2JB 3GCMA 2Q5UA 1JT6A 3SFZA 3GTKJ 4RAYA 1W4MA 5KTBA 2EINH 1FTTA 5M3FJ 2QGUA 1SD5A 2HS5A 5LRRA 5KHDA 1KB9D 1SD7A 4AVPA 4WB4A 4BRYA 3ABTA 4M74A 3G4SP 3EUHA 1FOXA 5IYCJ 1PP9J 2ZMEB 3FHNA 4BBRJ 4UB6H 1Y8QB 1AU7A 1MDMB 1F5TA 3O2PE 3D6YA 3MTUE 4GOEA 4HBLA 4KT6A 4PCQA 2GBYA 5AIPA 3DCFA 3P9CA 3H2ZA 3PUFA 2OYOA 2A5WA 2B87A 1YTZI 1ETYA 3K0LA 3QP6A 5GPAA 3K1PA 1WDLA 4HF2A 1MJ9A 3A01A 4XNFA 4XOPA 4BE0A 2KLVA 3ZP5A 1TXGA 3KLOA 4KN7X 2YKOA 1ZHFA 4Y33A 2B7EA 3F3XA 3RKQA 1H8AA 3PO2J 1WDMA 1U3EM 1W2BO 3O8GA 2JA7J 2DPUA 3MFKA 5DUIA 1ZR2A 4PJLA 3H1LG 4LB6B 1R23A 2JWAA 2XKPA 3FXUA 2JUCA 2OQGA 3SFDC 2D2CC 4I1LA 4DGWB 1SAXA 4Y7NJ 1J59A 1MBFA 3DKXA 1D5YA 4W7ZA 1S5LH 5B66H 1GXQA 4CCJA 3BY6A 2GIVA 4EQQA 4CHUA 2KUBA 2H89C 3F8FA 3PJRA 3KPHA 5JR3A 2YS9A 2LFBA 4FHTA 4ESJA 1HKSA 2OD5A 2PX9A 1QLED 2E2IJ 2VKVA 4BKXA 1XSXA 1Z21A 2PBIA 4YG2F 2ZNZA 2L3DA 2EFWA 1BGYJ 1FZEA 1T6AA 2FYUD 2SPZA 2C6YA 1BCCD 2NPSA 1GVJA 2DAOA 2QQ8A 5FKKA 5JVTA 4R1HA 5J1YA 1ZG1A 3BZCA 5BMZA 1I50J 1HW2A 3QHAA 3FX0A 1PGQA 2GLOA 3H1LE 4RGSA 1OMIA 2QWWA 2IFMA 3JSVC 1AVYA 2HYFA 1S5LC 1UHMA 2RQPA 1KQGB 2AXTE 3SYTA 1R1UA 3CJTB 4ASNA 1ZRDA 1GV5A 1N7LA 1U0JA 3W67A 1DU0A 1ZG5A 1T95A 2P4QA 5FROA 1KGSA 2FX0A 5KLIB 2V1DA 3M9QA 2A6HF 1LVKA 3Q5FA 3TGNA 5LBQA 4O3MA 1FZCA 3TF5A 2A69F 2OYHA 2EZLA 4P9FA 5JVGF 4IHYA 3MZYA 2YXQB 4JBAA 3AFHA 2ZYAA 2JA2A 2JA5J 5AW6B 2Y2ZA 4O6JA 1L0LJ 2YXRB 5KJ7C 5AW2B 4U0VA 2IP2A 4XKVA 1FBSA 2OQRA 2DLLA 2Y69H 2Z2SB 1GLNA 1I3AA 2JVGA 4AUXA 3WE2A 5AW0B 1CF7A 2NXNB 1ZTRA 2W4SA 1PP9D 4LD5A 3V2RA 4GXOA 3BR1A 1SP4A 2XNDH 2GQQA 3MUDC 2WSCH 2LKMA 2FJ1A 1AA0A 3DFUA 4GO1A 5FD5A 1ZK8A 2NAZA 2KLOA 4DJAA 1RF1C 1HF0A 1NKZB 3D0SA 1CI6B 2GAUA 3T8TA 3FMRA 5DD4A 4AYBA 1MV8A 4IOIH 3TOBA 2DODA 4FTHA 2O3JA 2MG4A 3C8VA 3F8NA 4HLYA 1NH4A 4I09A 2P6SA 4G6TB 1FMVA 1M2WA 3WMM0 4IQJA 2OUMA 5D6FA 1J7KA 3GG2A 2I5UA 3OYAA 2GXAA 2Q2EA 5AIQA 2DA5A 2K86A 4C7RA 5IYDJ 2GUVA 1CW5A 3MD2A 2HVQA 4YFXF 5A9SA 1MKMA 2XSJC 1VQ5I 5CVRA 1IRXA 3CD6P 4WXCA 1LUJB 4B3AA 4E7SA 2HVRA 2KB7P 3BASA 3AE3C 3BZKA 1JHFA 1B4AA 2E7WA 2WSFH 1JY3N 2HOTA 3USSA 1S7AA 5CMZA 1VQKI 4BRYB 3K69A 5KVRA 2ESNA 3TEDA 2E76B 3LA2A 1FU1A 5K7FA 5HLGA 2HTSA 3FXEA 3A0HC 2L7MP 1I3QJ 4E7HA 5CYVA 1K6YA 3RDIA 3N4XA 2HG5D 3VYSB 3K4CA 2B87B 5DEQA 1AQTA 1BGYD 1OZHA 2E5TA 1ETWA 3RL0B 2OTLP 4M3LA 1FLIA 5JLWA 3CXHH 1RC9A 3AE7C 4IX7A 3A01B 2JTVA 3VWBA 1SQQG 3JRBA 2OTKE 3AEBC 5DTDA 4IRGA 4A6EA 1MBJA 5AVUB 3M06A 3K2AA 3ZCOA 5GP9A 5DM6F 2VUMJ 1VPCA 1RIOH 3L73J 2PGDA 3ZQHA 5CCHD 4XIDA 5A2QZ 2B88A 5EYRA 1SQXJ 3GTOJ 3Q0UA 3U1AA 1GT0C 2R32A 3OOPA 2E34A 3CTVA 4W97A 2E36A 3BTIA 4ZYEA 4N6JA 5L8RJ 4C3JJ 5CVJA 1M1KQ 3ERMA 3A7OA 2R7TA 3JREA 3OYBA 3TSIA 3V5BA 5HLTA 3HRMA 4XLEA 1L0LD 3L7WA 4NB5A 2M8GX 3CWBG 2ZXIA 1DLJA 3PHLA 3I71A 5EGOA 1S5LX 1SQQE 4PSWA 4AQRD 2IA0A 3W6ZA 1FOYA 1XDUA 4GRIA 1V3FA 1LTTC 1S3JA 2QJYB 3I55P 2NS7A 2YU3A 4JYBA 1VQMI 4XRFA 2NVXJ 1WZ2A 1N7SA 4CXFA 1HCRA 2EW2A 1M57D 2NPSB 4JX4A 3O3KA 1C0WA 1Q90D 3AG1H 4DCKA 1IW7F 4DOJA 1LNQA 2DDAA 3I5UA 4IOCF 1HBXG 1ACIA 1T8ZA 2YMYA 1LWUC 4X6AJ 2J59M 1ZRTD 3V7RA 1W7PD 2X6WA 5HDKA 1QX8A 5CLSA 1S7OA 3RIRA 1NTKG 3CWBE 2FMLA 2QIWA 3B8EB 1N75A 1DPUA 4IL6H 4OGQC 1FZCB 1YG2A 2DQLA 3W2AA 2Q7CA 1XGOA 2ZXEB 4A3CJ 2OYHB 3PDUA 2VKDA 3B02A 4XLAA 3JTHA 3LSIA 3O8HA 3I64A 2DFIA 1M8OB 1DDNA 3CMAP 1JI8A 2L4AA 3D71A 1U2WA 2J5OA 2MFZA 3FKIJ 3L09A 3FKJA 1E5WA 5CCGA 3GZ5A 1GU4A 5FRMA 2K7LA 4ZTJA 1OW7A 3BROA 4OMYA 1P84D 4PV1B 2O1JA 1TNSA 2XV5A 2WV1A 2RREA 5M5WJ 1CF7B 2NOGA 3FM5A 4IL6C 2HVSA 1NTKE 3P32A 1SS1A 1DGWY 1S7EA 4RBOA 2DW3A 3KFWX 2LKSA 3M3YJ 1WT6A 3UNGC 2X58A 3V4GA 1Y56A 1KFMA 2JSPA 4PFOA 4M3DA 3J81K 1GU5A 4LITA 3MEXA 2L0KA 3D5LA 1JY2N 4S0HB 4EMSA 1GL2A 2V7QJ 2F4OB 2KL4A 3MCZA 1ZN5A 3IKTA 2M8EA 4A3DJ 4HJGH 1L4AB 2QKLB 2A06G 1J75A 1V54H 2KKOA 3CDIA 5ILSA 3OYCA 2LLKA 3L73D 1TU3F 5FKMA 2UYYA 2HFED 2Q2EB 1SQXD 1U5TC 1X2NA 1M1EB 3I53A 1QQIA 5A9SB 1VQPI 3FM3A 4UUTA 1H0MA 2IBZI 4H44D 4K2EA 1EH8A 2IPQX 2E74D 1E2XA 1WRJA 3K70C 2YIUC 1EDJA 3S4RA 2M9HA 2XPUA 2KK7A 2ZFCA 4XE5B 1MBKA 2BEQD 1BOBA 4FE7A 4P55A 1T38A 4KFCA 3MZWB 3Q5SA 3BTJA 4RJTA 2KRFA 1HH0A 1BI3A 2D1VA 3QRFF 2XRLA 3J81Z 1HSTA 4FGWA 1B9NA 4OOIA 1JT0A 1R36A 1SFCD 3M0DA 1OPCA 1I1GA 4OINF 3PLRA 1N78A 1LGHB 2A06E 3TGUJ 3OS2A 3AEDC 1WGXA 1FJPA 3MZHA 3CCEP 2M87A 3GZNB 4XKWA 1RETA 4S3MA 3QYBA 2B63J 2FUG2 1O7FA 1RR7A 2CFXA 3H0GJ 5LGNA 5AW4B 2COBA 4WXDA 1U7MA 2L5GB 2G7HA 3CCMP 3WU0A 1LPQA 4X0GA 2AQFA 2FSWA 2IGNA 1ZR4A 3WFJA 1RY3A 4LB5A 1IAWA 2BZTA 3V42A 5KAFC 5EEAA 1BL0A 2DMQA 1OCOH 2W90A 4MLOA 3MVPA 5CVIA 5F1JA 4A5MA 3ZW9A 1EC5A 1ZGAA 2UZKA 2K88A 1FJLA 2FYUK 3S3NA 2CWEA 1J1DB 1Z9CA 4ABZA 3G3ZA 2RN7A 1KQLA 3VP8A 2H09A 4LG0A 4XLFA 1PPJD 2XZRA 3JW4A 1VF5C 1T0FC 5JHFA 1HW1A 1I6XA 3U1KA 5EGOB 1J1EB 1JTYA 4NPDA 2FYNC 1JUNA 3FWNA 2K9JA 2VQGA 4CDGA 4XKCA 3ZQ7A 1ZGJA 4BQNA 1D5VA 4LOCA 2E1MB 1N7SB 3R60A 4U0WA 3F6OA 2LH9A 5B3SH 2RAEA 3HGGA 4HX8A 3L75G 1T2KC 1VZ0A 1TZLA 1X1PA 2WAFA 1VQNI 3ZHBA 4RB2C 1VF9A 3SFIA 1BDDA 3CMEI 1HVVA 1KN7A 2NZ2A 3CX5I 4IQ4A 3FXLA 2KDOA 3GO5A 4D6TG 1YS6A 2DDBA 1VQ7I 1X1BA 3M8EA 3ZGYA 4H0LB 2HYJA 2W57A 2DTZA 4G94A 4V2GA 4C30A 2ZCWA 1L3LA 1IFPA 2RH0A 3ZMUA 1SQPG 1SFCA 2FA5A 3RK2D 1LTGC 4QWQA 4IL6X 5C39A 3K4MA 2E75B 1AKHA 2ID6A 2KJBA 2ME6A 1DLIA 4NUBA 4CA0A 4A5NA 5KAIE 3GHGC 3H1KG 5E79E 4BDZA 1DD4A 1NAFA 2KFDA 4OU0A 1Q1VA 4R4LA 1K7AA 2DT7B 3H1LJ 3II6A 3P8CE 1YBKA 3CCVP 3A02A 1R5ID 1SEUA 4D6TE 3OR1C 3ADOA 1FAVA 3SEQA 1H89A 1HUCA 3G71P 2BE5F 2DU9A 4MQ9F 1UHSA 1SQPE 2GM4A 4I7ZB 4PK4A 2VN2A 1Y8AA 3PRJA 3TGUD 1WHUA 1VPDA 1YW7A 3JCUH 4PZDA 4C2TA 2R7RA 3HIFA 4WWCA 3QPTA 2LBFA 4ZYDA 1MJAA 1GV2A 1TWFJ 2OJED 4Y99B 1GL2B 1FIPA 2EIMH 2JN6A 5E8IA 1AJYA 2WAEA 2JEEA 1YIJP 3MKWB 2LY1A 3IKVA 3N05A 1ZYRF 3W3CA 2XROA 1PV3A 2ZT9D 4EV0A 2WY7Q 1Z0XA 2O03A 3CMYA 1IG7A 1LTBC 2BYVE 3W6KB 2Z9OA 2CFOA 4NHJA 2HWVA 1YJNP 3H1HJ 2IDBA 3T5XA 3PIPF 3H9JA 1KQ0A 4CCKA 3JCUC 3OYKA 1Z56A 1E3HA 5CKTA 3DPUA 4BE1A 2R7SA 3L71G 4UB8E 3CX5H 1GUUA 2PFBA 5H2FE 2W00A 2M1BA 4M3EA 3V2PA 2R7ZJ 3VODA 1FOKA 3KP3A 2KISA 3AG4H 1X79B 3H9GA 3OYEA 3BJ6A 1A02F 2MC4A 3ABKH 3S1MJ 1M56D 2LDUA 3K96A 3A0BE 2LK2A 3IL2A 3JSPA 2XF6A 4FX0A 3MOGA 4KJMA 3FIWA 4HNUA 3CC2I 2JP3A 4MFEA 4RGXA 2VI6A 3RKXA 3PIOF 1KFNA 4JOMA 1L0NG 1BI2A 3L71E 4IO9F 5ICGA 2W27A 3ADPA 2DYRH 4AD9A 2PMZN 1SD6A 3F72A 2N1TB 3CCUP 2C9NY 2V6CA 4YPCA 1U9OA 4EM0B 1BC8C 5FGMA 3TNUA 1Q7YQ 1YRNA 4XLNF 2FXPA 2XUBA 2KIFA 2VXDA 4D5CA 3VYUB 1I36A 3AKZA 1KYOI 4BUPA 1LQ1A 3DPLC 2I1KA 1TLHB 2HQAA 4WWIA 1TW3A 2WITA 3MGNA 3AE8C 4LG0B 3ZXSA 2XGDA 2UV1A 3ABVC 1Z82A 1FC3A 2P10A 1FEXA 1Y9BA 1H88A 3M1CA 4C3IJ 3CUOA 4UVBA 5DS9A 3BCAA 1YVEI 2PN6A 5HS7A 3GTLJ 5CVUA 1KYOE 1L0NE 2K9JB 1NU1J 3H1LD 2ADUA 2Y75A 2R7WA 3OYIA 2IYPA 5AW5B 4RLQA 3JRAA 2EA2A 1A35A 3QWOC 2K85A 1UB9A 2L7KA 2JA8J 1YW9A 5KLVG 3DEEA 2X6YA 4B47A 3WE3A 1SVOA 4XR6A 3WTVC 5KJ7A 5K7HA 3DP7A 4E7LA 4A6DA 5F0HA 1NHLA 1O3SA 2K3RA 1J09A 2XVCA 1AVOA 1W2EA 4A3KJ 3CUQC 4M73A 3CMEP 1Q86Q 1XB4A 2ZXWH 3NFQA 3VSKA 1AKHB 2Z1DA 5H6QA 4ZDPA 1IFDA 4C2MJ 1O57A 3M9HA 3M91A 1BSHA 1QGKB 2KZGA 3H1HD 1YS7A 1KYZA 3P5JA 2DN0A 3QPLA 3F8MA 1TNTA 3NARA 5KLVE 1WPQA 1G3TA 2GA1A 4KITB 3G1LA 3JRDA 3KP2A 3RK3E 3OSGA 2IPPA 2KDZA 1X58A 1JKOC 1LTJC 2JKVA 4IVNA 1F12A 1EDIA 2XASA 1RE3A 5CCHC 1LVAA 1FYKA 2QEXI 4MTDA 2CS3A 2XPWA 3IHUA 2QRXA 4NPEA 2QM7A 1JMBA 1Z77A 3DKYA 1SQXK 1MBHA 3S2DJ 3CWBJ 2P0WA 3P9KA 1SMYF 3OYNA 1L2PA 3D6ZA 2PLYA 2LBFB 2D1HA 3E5XA 1B1BA 4BACA 1LTSC 5AW7B 1M90Q 2Y0EA 3SDGA 5TJHA 3WTTC 4OVNF 2ISYA 2OV7A 4PGHA 1VQ6I 1SVMA 4LIVA 1JKQC 4PD4I 3P9IA 5EG0A 1GTWA 2NS8A 1SC7A 3TDUC 2HYNA 2ETHA 3IAS2 1RZ4A 3KEYA 4KUGA 4PUSA 2YO3A 2H8RA 2FEZA 3PQJA 3DXJF 5D5XB 5DCFA 5BOXA 3F6VA 4FE4A 2JT1A 5HVQC 3HOWJ 3GTGJ 2WPSA 3GTJJ 2QQAA 2WB1N 4KYWA 4PD4E 1NTKJ 3PLNA 3ML6A 4AWXB 2M3BA 5KKZB 2E1OA 3DBHB 2ZO4A 1IZ1A 2ZJ2A 1BR1A 3OBBA 1J2XA 4E7KA 1U57A 4MTEA 2H8PD 3HD7A 1FZPB 2I8DA 5CJ0A 5L3GA 1TT5B 2F5DA 1WPKA 4KN4X 4Z6YA 3E5QA 1Z7LA 2RDPA 5HWSA 1P4WA 1NU1D 1Z6TA 1QGPA 2N8GA 4BHPA 3RK2B 4WK8F 1R5SA 4G12A 2ACJA 2GXGA 4NDLA 1T33A 3B6CA 4M9ZA 1RKWA 3GLXA 3BC8A 3HSFA 4B09A 1DU6A 3O8ZA 3L74G 5JLXA 3GTQJ 3GF2A 4EATA 1SFOJ 3CTAA 3V8LA 1O3QA 4BWNA 2KIMA 4JX6A 1KU3A 5CPRB 5E3OA 3I83A 2E76D 1YITP 1S72P 1DIPA 5C4XJ 2VOPA 2XKOA 5D5WB 3CCRI 2CV0A 1S29A 1IC2A 4JBZA 1IDZA 4QTRA 1HQCA 3CCSP 1YHQP 2L5QA 1LJ9A 2EILH 2YR2A 2DBBA 1BG6A 1P9QC 1YW8A 4ASWA 3KETA 2FBHA 4JP0A 3RSNA 3V2QA 2W25A 3GFJA 3TNUB 2VONA 2VJ5A 1YRNB 1EQ7A 2M2EA 1P7IA 3RL0D 4UB6E 4EOTA 1QBJA 2EV5A 1OCPA 1W5SA 3BZ6A 3LSHA 5AW9B 1OCRH 1URQA 1SQVG 2MC3A 3PUBA 3L2VA 4AYCA 2HDDA 4LK1F 2F5CA 2QSFX 3UR3C 3L74E 2WY8Q 4IHSA 4EJTA 4O9BA 1HGZA 4DYQA 2BASA 1JHHA 1KTMA 3PH0A 1IRFA 1N73B 3I54A 4BJTA 2R7XA 4M9XA 3RL0g 3FZVA 2LP0A 1KQ8A 5GTHH 4CCLA 2E2JJ 1ETQA 2P5LC 3A2AA 4BXUA 1M1JA 2J58A 2B0LA 2X51A 4BAYA 4ESFA 3C2GA 2A6EF 5KK1A 4H44C 2LF7A 3CWBD 2M4KA 2E74C 1XMKA 2KT0A 3QH9A 4IFDK 3S9OA 1JGGA 1FYMA 1FWZA 2O5RA 1EZVG 2DW4A 1KQ9A 3DBLB 3FBNB 1SQVE 2UWJE 4NBQA 2K02A 5LFAA 3ZN0A 3EFFK 4YFNF 5GADJ 2F6CA 3A2KA 3EQ2A 3OS0A 2RMZA 1D1BA 2FQ3A 1S5LE 5B66E 2G9WA 1OCZH 1T2KD 1NTZJ 4QPOA 2DXIA 2IFNA 3Q3CA 4M9SA 1OISA 2NPSD 2G8YA 2JZYA 1A31A 2DA7A 2ISZA 5DDGA 3BRVB 2W84A 3C7AA 3HEFA 4A93J 5EDNA 1EZVI 2YX7A 1OYYA 3KHUA 4WY4A 2JK3A 3HUSA 4OIQF 3UKGA 1NTKD 3FISA 4A7PA 2HZTA 4Y3OA 3R0JA 1FMWA 4RM3A 1OYIA 3L70E 2LC2A 4CCNA 3NEUA 4BJ6C 1EZVE 3LIEA 4FQGA 4M72A 1FE6A 2QSGX 2ZYGA 3HTKA 1ZOYC 3KPEA 3TK1A 1WI3A 3HTSB 3G9RA 1HF9A 3RI4A 1XD7A 3H3ZA 3V7CA 4BQOA 5BPIA 3WS7A 2GOXB 1ZLLA 4GT1A 2CQXA 2Z5UA 2WSEJ 1MFTA 3PSFA 3FF5A 5L3BA 1IK7A 2EZIA 4UV8A 2CQNA 2WPRA 1K61A 1QVGO 4PV1D 3SQNA 3DU5A 3KYDB 4JK1X 4EJVA 1JGSA 3ZMSA 2VOOA 3BTCA 2KXPB 5B1BH 5FWNA 3RJPA 2V7QH 3ZW8A 1P4AA 4K3AA 3J80K 4PZCA 5EG0B 2UXNA 2HDHA 3DLAA 3U1CA 2KMUA 3W2WA 4HKZH 4ZTFA 1K05A 3BQZA 2R7FA 3M07A 4M3BA 3S2WA 1Y39A 3ZQLA 2K4BA 1M66A 1XS9A 1UCRA 3E3VA 2FBKA 4AIDA 1D1CA 2HDWA 2Y9YA 2VPLA 3K6JA 1JB0J 2HFHA 1FDIA 1KORA 4ASVA 2A06D 1TWAJ 2ELJA 4E4HA 4HG2A 1L4AD 2D3TA 3HD7B 1B6AA 4KDPA 1TQPA 2A05A 1XG1A 3MHVA 1FJKA 1NG6A 1GW3A 1JUPA 1EV7A 1XGMA 1NTMJ 4HPQA 2WWWA 1J0RA 2GWRA 2ZJPF 2IX7C 3MAJA 4LGDE 1BDCA 1TWHJ 1S4XA 4FX4A 4PJ0H 1R9TJ 1EH7A 1W1WE 3J80Z 4D3DA 4I2LC 3C9IA 3CCQP 1VQOP 2COMA 4RS8A 3BTLA 4KUMA 4L5IA 4XN0A 4C3HJ 2R3CA 1IRZA 3DBRB 2I1JA 4F92B 2R0QC 1R6RA 5KCMA 3S1NJ 2RGVA 1Y1VJ 3WGIA 1BI1A 4BY7J 4HNTA 2BOLA 2DK5A 2VPRA 3IP4B 4LLGF 2HKXA 4F52A 2GXBA 4Y4RA 1IN4A 3W6UA 1ZXGA 1NTZD 3L9FA 1IXSB 1HC8A 1RPWA 4PJ0C 3D5RC 3CXHI 2H1KA 1T2KA 1URQB 2CUEA 2N9BA 3HKZN 3WU2E 4EDFA 2YPRA 2OC6A 2P2UA 3MN2A 1JJ8C 1YO5C 2V6EA 1T56A 4BJ5C 2LSOA 3GLLA 3HG9A 5TRDA 1N25A 3CXHE 1MMGA 1KILC 1OLTA 2JA6J 4KJZA 2WTBA 5B5EH 3H0DA 1U8RA 2BY3A 2ZT9C 3LSMA 3LAPA 2K5CA 1IN8A 3RPUD 4B43A 3NWTA 5IPAA 1M1JB 5GTIH 4IZZA 2RV8A 2QYOA 4U88A 3E6CC 4I76A 4OQZA 3JRCA 3CC4I 2FNPA 1AQ5A 2Z4EA 3Q0VA 1N73A 2Y48A 3DF8A 1JOCA 1L4AA 1UFMA 2PFXA 3A0HH 2OTJP 3FWLA 3NQOA 1AWCA 4Z1MH 2XGEA 4ZZLA 3WUVA 4CO8A 3V6IA 1N7SD 3WG7H 1LT9A 2OBPA 5B5EC 3WTUC 5MGBA 1OW6A 1NOHA 3V4WA 4M6VA 5GTIC 3VP9A 2K4JA 3IRRA 1NH3A 4BEHB 2P67A 3AEFC 1XCBA 2ZBKA 5FFZA 2EV6A 3EWKA 4WY4B 3HUSB 2TDXA 5A2QK 1EXJA 4PJMA 2HOEA 4E6KG 3OYJA 1YJ9P 4M3GA 4U7DA 4H0LD 3FBIB 1SQPD 2ZMEC 2CUFA 3G6EI 3H1JJ 3HTKB 4H13B 3SWKA 2EPFA 2XF5A 1ONVA 2E75D 4F55A 4CYDA 1FS0E 4B3HA 2GUSA 1STZA 5JI6A 5HLHA 1FZBA 2XAFA 3A1YA 3DEWA 3HPHA 1NTMD 1S2EA 1BE3G 5CCGD 4X1EA 1FOWA 4HYEA 3E7LA 2P5KA 3ZR8X 2VE8A 1SVLA 4MFDA 1ZP0C 2Q0OA 2XPVA 3LSKA 2E1CA 1WDKA 4CICA 5ILUA 2K1AA 1JUMA 3RQ4A 4DBQA 1R7JA 4BXLA 2E1NA 4GDOA 4AIHA 3JRGA 1TTYA 2ZSIB 2ITAA 1Z1DA 4A0XA 4LMYA 3S1KA 2FNAA 1IK9A 1BR2A 5H6RA 5KLVJ 2EIKH 1H0TB 2DFHA 3HBLA 3LA3A 2W7NA 2QQBA 3RPUA 2PG4A 1NU1K 2KIQA 3L2CA 2XB0X 3LL7A 1GL2D 1BE3E 2FYZA 2ZC2A 4A3JJ 3ONQA 3CCJI 1B8IA 4BQAA 2VBZA 2A07F 4KNYA 4E70A 3J7AO 2L01A 4BU2A 2WADA 2IS6A 2HLOA 3FXMA 4RESB 5HNHA 4HOBA 5DUKA 5DV5A 3REOA 4AIJA 4IHTA 3G1MA 5F27A 4JF7A 4N78E 1IN6A 2NVUB 3RBXA 3ZMZA 4H0EA 5AW1B 3CP2A 1MBGA 3VYRB 3B5NC 2EJRA 3QWLA 1F0YA 1WFXA 2Y31A 1IUFA 3DTEA 4Y13A 4GDFA 4JQ0D 1K79A 4HW0A 1H9TA 4U3FG 2O01J 5L3FA 3BG7A 1IFNA 1RKTA 2D2WA 4IRHA 1MZ9A 1ZLKA 1VF5B 2W82A 3MQ0A 5BNGA 1PZQA 1WVRA 1NK3P 1G1IA 1WP4A 2HXOA 4RGUA 2EH3A 1Z3XA 1A02J 5LLQA 3GFMA 2MD5A 2A3SA 4HLXA 2G3AA 2DMUA 4RLFA 2M45A 4RAZA 1TWGJ 1A36A 1MSEC 1XGSA 4P9UA 1RE4A 1KYOD 3VN0A 2P7JA 4DT0A 3L72G 3F8BA 4RKUJ 4N4OB 1ZG3A 4U3FE 4BNCA 4XFJA 3V7SA 1O7LA 5AVYB 1E17A 3S17J 3GF3A 2YU9J 2MYSA 2N1TD 1D0XA 4C7NA 4L9TA 5TISH 3ZQQA 3H1JD 2CVZA 2QJPB 2NVQJ 3OL3A 3OWTA 4I7HA 2V9VA 2FXOA 1ETVA 4HSTA 3OMYA 1VDFA 3BCCG 3D1NI 3GMAA 2E5YA 3IWFA 2HEOA 2IBZG 4LK0F 2ZJQF 3PNYA 4OM8A 2HTJA 5L3CA 1K78A 3OYFA 1KB9I 2KS1A 2PQ8A 4L76A 5AVVB 1QVUA 1PDNC 3L72E 4GFBA 2NNYA 3HB9A 1NTKK 3RZOJ 2MKVA 3GW6A 2L9NA 4DZJA 1P7JA 1LT9B 3LFUA 3KX2A 3EYIA 1Y1WJ 5FFXA 5TISC 1O3TA 3Q5PA 4L75A 5APVA 1LKXA 2VB6A 2I9PA 1ON2A 2DJNA 4HX7A 3L2RA 3SJMA 1BC7C 5KLVD 4ZNCA 3TDZC 1SQBG 1HKTA 1WH5A 4A3EJ 1E79H 3KLNA 1JY3P 3ULQB 3DTIA 1RF0A 2R3SA 3BCCE 1YQAA 1HLVA 4YFKF 1KU9A 1QHHD 4HSRA 2HDCA 2Y0CA 2IBZE 4Y52J 3L37A 3Q3SA 2CQQA 4BYYA 3EUHC 5M3MJ 2E76C 1X1CA 5KAFH 2L7FP 4HQMA 3DKWA 2WPQA 1VQ9I 3NRVA 3PNTA 1XTGB 4PZEA 3S16J 4TT3H 2L4MA 3ZN1A 3BATA 2M3AA 1SQVJ 3OSFA 2IS4A 1UHWA 1G2CA 1BR4A 4RAGA 4EI2A 1YI2I 1PL5A 3L2WA 3E6BA 2IRFG 1PFIA 1X4OA 4XN3A 4QLCU 1YRLA 3WHBA 2FBWC 1G3WA 2MW8A 1IXCA 1BCCG 2CU7A 3HRSA 4NQWA 1JY3O 4IHXA 1FSHA 1SQBE 2N9YB 1XPXA 3CC7I 1GK6A 1OCCH 4WX9A 1ZRFA 3CMMA 3CO7C 3L2QA 5J4VA 1EDLA 2CW0F 3FWEA 1RUOA 2XKMA 1DQUA 1QU3A 2E71A 4KIGA 2DK8A 2WTEA 1LB2A 2M4GA 1LEAA 2WWYA 1TBXA 2JRMA 2ZB9A 1YFHA 1YE9A 1Y0UA 2HGCA 3J7YJ 1EVYA 1ZV8A 4PD4D 1VQ5P 1OWAA 2PRRA 1MMAA 3L70J 1FOSF 2DA2A 3IAM2 4D3SA 3TP3A 1VQKP 2STTA 4KUEA 1YYVA 2QA4I 2CK3H 1KB9H 1B8IB 4K35A 2NYXA 4DZOA 2FFDA 1X0VA 1OVRA 3JCUE 2BY1A 4DQ2A 2M34A 1ENHA 2QZ8A 3BPVA 5CVVA 4Q47A 4D0PA 4E7ZA 5LHIA 2UXXA 1W5CC 3U9GA 1TQIA 1R58A 2FY8A 4XKBA 2AEFA 1T39A 1BBYA 1PP9G 3GF7A 3GXOA 3VYTB 1GW4A 2NPSC 4XSXF 1NTZK 3PP5A 5ED4A 2K9SA 4XM3A 4J01A 2H7HA 2F4IA 1A6QA 2W83C 3NTNA 4B44A 2FD5A 2WB1A 4EGYA 1ON1A 2HPMA 1MNDA 2KZIA 3TO6A 3NMDA 1FZCC 3MKZA 3FHZA 2WSCJ 3CX5E 2OYHC 4LG3A 1TWCJ 1XSVA 4R8HA 2JR8A 5JHUA 1R49A 3G0OA 1FNNA 4XICA 5BVZA 5EZHA 3L74D 1S9HA 3S93A 2XU6A 1FZGA 1VQ8I 3BVHA 3GLMA 1PP9E 1VQ4I 3PIDA 2OYIA 4P96A 1R5HA 2K9LA 3CCJP 3L75E 4BXXJ 5APYA 3AL0B 1WJBA 3HM5A 3KE2A 4F93B 4I0AA 4PV1C 2OF7A 1T8IA 3VSLA 2L9RA 3GBGA 4YEJA 4ENMA 1EVZA 1VQMP 1XTAA 4C7NB 5A9RA 4F7ZA 5E18F 3L2UA 3HL2A 3PQKA 4MO7A 2YKQA 3KXDA 2MSYA 4M6YA 4D7NA 3U21A 2E7XA 2VE9A 1SQVD 1YYCA 1ZREA 2W48A 4AIKA 2WVRA 1TQMA 1X3UA 5AVZB 1XGNA 5JFRA 1JY2P 1IZNB 2NS0A 4S05A 2GF2A 1BGYG 1K78B 1R1VA 2VKHA 2KS1B 2HKOA 2DFFA 2ECCA 2DCEA 3WGHA 1KZUB 5IT9K 3H1KE 1G3YA 3SSUA 1ZN2A 4CPGA 4YIFA 1FZFA 2JRTA 3ELKA 1I1SA 1ZRCA 1SQPK 5APWA 3R4YA 2CG4A 2E5NA 2VODA 4ZC3A 4L5JA 4FETA 3QPHA 4HEA2 2WAQN 2XDJA 3CJNA 1DH3A 3DPTA 2QJKB 1OKRA 1M75A 3L70D 1Y8RB 1REPC 3BG3A 1MUUA 2IAIA 1NTMK 1T3JA 3JC22 5KJ7D 4LC1A 2Q3IA 2BV6A 3A3YB 2CV2A 2E60A 4DYDA 3PFYA 4HAMA 2DOAA 5AVXB 2BY0A 3I4NJ 2K37A 1OVVA 3CO6C 1OQYA 1L0LG 4KIFA 4M71A 5FKOA 3GUDA 2BEZF 3BQYA 3G73A 3GFIA 3CF5F 1BW6A 1HTLC 1P6RA 4B86A 3BOQA 1K83J 2E43A 2E2HJ 1HJ0A 2FU4A 3WTSC 5IT9Z 1G2CB 4NC6A 4KISA 2XF7A 1YX3A 1SFXA 1YX5A 2ID3A 3H5RA 1QA6A 3B5NA 1J5YA 2Z3YA 3BG9A 5M5XJ 4A3IJ 4NQWB 1R71A 2WSEH 3WTWC 1RESA 4UVAA 5D4RA 1FBMA 2W85A 3T8RA 1G2HA 3LOCA 2MJZA 1FOSE 1FDMA 2XV4S 3ZWCA 1LTIC 2LRDA 3GYHX 3AECC 1XMAA 2QKMB 2EFQA 2HXIA 4BHCA 5APQA 4ZYAA 1VQPP 1L0LE 3HXLA 5FRNA 1MGTA 2WBMA 3VEPA 3JAMZ 5E1XA 2L54A 2V1XA 4DJGA 1Y6IA 3MZ8A 2YKPA 4D3FA 3E6DA 2JWTA 3S3MA 1J1DC 1ZMEC 4BXFA 3OIOA 5DJTB 4C9YA 2VL8A 3RGUA 1IJWC 1WJDA 2FFDB 3CDLA 3KP4A 3TYYA 2MA3A 2K40A 1J1EC 1WQ2A 5F08A 3CKYA 2KI7B 2VRSA 5TJJA 3AE9C 3CLQA 1RI7A 3ZWAA 1BW5A 1R5GA 2DA3A 1BM9A 2VQCA 2P81A 4UV9A 3H35A 2K3FA 1FBUA 4YIRX 1N7SC 2P58A 3QP5A 1EH6A 5C4JJ 3H1IG 4WVZA 5E79C 3TW6A 3ZPLA 4V19K 4WXHA 3ZQFA 2NNNA 1ZH5A 1BI0A 3PJGA 4GKGA 3RK3B 3GW2A 5J47A 1CZQA 5J1RA 2ZXXA 3AEGC 5AONA 3HD7D 1BJAA 4EJWA 2FQ4A 1RR8C 1P84I 1F17A 2Q6QA 2EV0A 4H0LC 2JWDA 4I99C 3G4SI 2DI3A 5J40A 1WKMA 4J19A 1KILA 3K4KA 3D1LA 1BE3J 2OARA 1K8AQ 3C2HA 1HKQA 3ISPA 3CI9A 2NVYJ 2BVMA 2DMTA 1SQQJ 2E75C 3MUDA 3K4LA 2IGKA 1IUYA 3L73G 3M7GA 4CGZA 2EFPA 2OYIB 3ROUA 4A69C 3L4FA 3K10A 4UVCA 3CXHD 3H1IE 2AHQA 4C2UA 1LSOA 5CCGC 3IR9A 1RF1A 2XC7A 3H92A 2RQQA 4G7HF 3RTRA 1NK2P 3PEFA 2A45I 4KIBA 4BS9A 2E19A 2K9NA 5IOYA 5EJCA 1WCMJ 2DA1A 4L5EA 4UUVA 3AAFA 1PGNA 2F2EA 3AG2H 2HI3A 3RQIA 2MH9A 2XHKA 4I7ZC 1VQNP 1QO0D 1WJCA 2R5YA 5FKLA 4UB8C 3BJOA 3W6VA 1U8BA 2LY2A 1G1JA 1URQD 4KHXA 3EUAA 3F21A 2KNCA 5KLVK 3IH4A 2JUGA 2EA4A 3L73E 3T1BA 3COAC 2LMDA 3BP8A 3H25A 1I5ZA 4Y99C 2WSSH 1GL2C 3OYDA 1VQ7P 3HKZA 1PJRA 2ZNYA 2LNBA 1ZAOA 1DGRM 2IYOA 2QVOA 5DM7F 2FXAA 2LVSA 2H8WA 2ZAEB 1LNWA 2M7AA 3G2BA 5EZGA 5L3DA 3VPRA 5IP7J 4GWKA 2QENA 2B89A 5CHXA 1NAYA 2OGUA 4U3FJ 3M9BA 2V9PA 4RMNA 3TQNA 2CW8A 3K2ZA 4I6MC 2QCOA 4NPFX 1GVDA 2UUZA 4GODA 5GTHE 4XMYA 1RQVA 1F14A 3QOPA 4DW6A 5K1YA 2MLGA 3FR8A 2KPMA 3WTZA 1NVOA 1D1AA 3L00A 1DX7A 1P84H 1JKPC 3PSIA 1JCDA 3OYGA 1DP7P 3M0DC 3H3UA 3LSGA 2IEKA 1YJWI 3VMZA 3DFGA 2EIJH 3Q0WA 3HSEA 2M7BA 2YX4A 2GZWA 4GGGA 1T98A 1HDPA 4XL9A 5IP6A 3QYEA 2O9LA 2L91A 3TO9A 5AW8B 4WY4D 2D2CB 2F5FA 1D8JA 1X3ZB 3ASOH 5J1UA 5DCMA 1NKNA 2GIZA 3S3OA 1OVUA 2QSIA 3S14J 4HB1A 4I6ZA 3E1IA 4Q4ZF 3E1RA 2A45H 4S04A 3OYLA 2L9SA 4H13D 5CBNA 2Z99A 3AE6C 2CH0A 4AC0A 2VLAA 1A5JA 1JDJA 1ORKA 2A61A 1RQUA 3BCCJ 3BRTB 1XX5A 3L1PA 1W5TA 3VMXA 1BE3D 2KRHA 3H36A 3R0AA 2OFPA 3F22A 4ANJA 3ERED 4GOFA 3RKYA 3KZIH 3VB2A 1T6SA 3GX4X 3K70D 1KZHA 4HX4A 2IA2A 2IBDA 4UNOA 1AOYA 1IFJA 1SQQD 2V4JC 4HV5A 3SZTA 3UIAA 4II2A 1IN7A 1U9NA 2BGCA 3LA7A 5E1ZB 5BS6A 4E7IA 2YUSA 1WJFA 1MMNA 1LWUA 2IJLA 2O6GE 4G6QA 2R5ZA 1M67A 4R4MA 2JJLA 2IVMA 2PJRA 4EIJA 3ECOA 3JRFA 2X6XA 1FT9A 1Z6RA 1SQBJ 3K5BA 2X1EA 3S1RJ 2RN0A 5FKNA 2D45A 1VQLI 1RE3C 5K5RA 3ZMDA 2DPDA 4A3LJ 1Q82Q 4HA8A 2O61A 4DYRA 2DA4A 3KZIC 4PSXA 3L72J 2H94A 3LSTA 4D7MA 3CC2P 4O5VA 1XTCC 5LHGA 4QSHA 3CD6I 1ZKGA 5D5UB 3KP5A 4IOAF 3ULKA 1YQ3C 2P1JA 5F64A 4L9NA 2M0BA 2XDVA 3W68A 1A04A 2A5YB 2ZSHB 2HQRA 1W36D 1MH4A 2QVAA 4LGWA 2LF8A 3MMYB 3HJEA 2G0EA 3DOJA 3BJAA 2JQ7A 1KILB 1E3OC 1SFCC 3I59A 2B9BA 3U59A 4HDUA 5LHHA 2IS2A 3VYIA 1U6GA 3P7KA 3IWZA 1BSNA 3I58A 4U3FD 1ULYA 1EJ9A 1SFKA 2HNHA 2V4HA 2Y9ZA 2FOKA 2DT5A 3KYQA 4BEHA 3OAKA 3VMYA 1SQVK 1KD1Q 1Z67A 3ESWB 3K1NA 3KP6A 4I2OA 1ERDA 3KDPB 2MD0A 4I01A 2R7VA 1RF1B 2KIUA 2JJ7A 1VF5D 4CCMA 4UY8I 2XGXA 1IRGA 3CL3D 4PJ0E 5EFWB 1FY7A 3F8CA 3HYIA 2AQEA 2XSDC 5HS9A 3PO3J 1TP4A 2C0XA 1W0TA 3I9V2 1MMSA 4E12A 1TT0A 4YRVA 1QZEA 2GOMA 3NXSA 1U7JA 3LAJA 4G6DA 1U5TA 1DD3A 2JMWA 1KILE 3AEAC 2QG4A 4LIUA 1R22A 2LTPA 1OR7C 3FXQA 4WCGA 3PNVA 2R5YB 1O3RA 3L72D 2C0WA 3TKYA 2Z33A 2KNCB 1WJ5A 2XNXA 2Y0DA 1BJZA 1WWXA 3H5NA 3HGYA 2E42A 1HA8A 1LDJA 1FX7A 1MH3A 2O0YA 1D8KA 2OAZA 4W1UA 3SDBA 3EPZA 3WUUA 1WMKA 4HF1A 5AVRB 2DQRA
chains in the Genus database with same CATH topology
1VF9A 2DA6A 3SFIA 1ZCJA 1ETOA 3G1MA 5F27A 1MNMC 4J0FA 4IM7A 2AO9A 1CQTA 3ZGYA 2HYJA 4V2GA 1MBGA 2DTZA 4E21A 1FIAA 1YB4A 1JKRC 1OFCX 1F0YA 2EZHA 1IUFA 2Y31A 4JQ0D 3F0CA 2NVTJ 2DMNA 1PGOA 2EQRA 1AKHA 4CYCA 2ID6A 3HOUJ 2X6OA 2ME6A 1DLIA 3LSRA 1RKTA 1O4XA 3HOZJ 1AHDP 5BNGA 5C44J 3TP0A 1NK3P 1WP4A 2HXOA 1B72B 2EH3A 1Q1VA 3A03A 1UMQA 2DMUA 3A02A 3I4MJ 1IV6A 2PLAA 3ADOA 1GDTA 1TWGJ 1MSEC 2ELKA 2XGCA 4JPZB 1UHSA 2GM4A 2LKXA 1VPDA 4PZDA 1B72A 2MGQA 3FK7A 3S17J 3BG5A 2YU9J 1GV2A 1TWFJ 1FIPA 2VKEA 4MIMA 2JN6A 1ITYA 5AYVA 2EBIA 3EGOA 2CVZA 2NVQJ 1ETVA 4JX5A 1Z0XA 1LSJA 4UUSB 3D1NI 1YJQA 3HOVJ 3CMYA 1IG7A 2X48A 3QSGA 3IQDB 4OM8A 2R5ZB 1H88C 2OPTA 1QVUA 3BR6A 1IL0A 3ZQGA 2TRTA 4GFBA 1UG2A 4FCYA 3HB9A 3RZOJ 2LD5A 4DZJA 1GUUA 4M3FA 1P7JA 2W8ZA 1Y1WJ 4M3EA 3F3SA 5E3MA 3JRHA 2I9PA 2R7ZJ 2DJNA 3BR0A 3SJMA 1HOMA 4R1NA 2CRGA 2O8KA 2R93J 4DYCA 1POGA 4OL9A 1WH5A 5IP9J 4A3EJ 1QPIA 3BR3A 4FISA 4A3GJ 2HQ5A 3S1MJ 1HLVA 3K96A 4Y52J 2LK2A 3Q3SA 2CQQA 4EEFG 3MOGA 5M3MJ 2I10A 2XB5A 3C7DB 3FIWA 2L7FP 3IH2A 4MFEA 4E13A 3HOXJ 2VI6A 4PZEA 3S16J 1IDYA 3OSFA 3HADA 3ADPA 3MKLA 1PUFA 2LR8A 2PMZN 5EF6A 1QRYA 1U9OA 1YRLA 3WHBA 4EZBA 2MW8A 3C2BA 1YRNA 2CU7A 4D5CA 4IHXA 1I36A 4HNVA 4J0EA 3FK6A 1N1GA 3HDDA 5K7ZA 2ME0A 3PM1A 4OQYA 2QYTA 5HODA 2XGDA 1Z82A 1FEXA 2ZB9A 1EVYA 4C3IJ 4GBJA 5DS9A 1VNDA 1YVEI 3GTLJ 1I6HJ 3LSJA 2DA2A 2IYPA 4D3SA 3TP3A 3JRAA 4KUEA 1H89C 3BR2A 1N1EA 1X2MA 1B8IB 2JA8J 1X0VA 2EZKA 2M34A 1ENHA 1JT6A 3GTKJ 5K7HA 4B3IA 1JTXA 5F0HA 5M3FJ 1FTTA 3C7CB 3QQAA 5IYCJ 4A3KJ 4BBRJ 2K9SA 1AU7A 1AKHB 4CYCB 4C2MJ 3H2ZA 2FD5A 2GBYA 3DCFA 3FR7A 5E3NA 2Y0SN 2DN0A 3QPLA 3NARA 1ETYA 3RZDJ 1A6IA 2X9DA 5E3LA 5GPAA 1WPQA 1WDLA 4DLLA 3S2HJ 3A01A 3G1LA 3JRDA 1TWCJ 3OSGA 2KDZA 1X58A 1JKOC 4RDUA 3G0OA 1M76A 4XICA 2QF7A 2JKVA 2R92J 1F12A 5EZHA 1TXGA 2XPWA 3PIDA 3RKQA 3PO2J 1WDMA 1Z77A 3O8GA 2JA7J 1MBHA 3S2DJ 4BXXJ 3HM5A 1ZR2A 2OF7A 2L9RA 3GBGA 1EVZA 3OOUA 4Y7NJ 1MBFA 1D5YA 3SDGA 5A9RA 4MO7A 4OVNF 2MSYA 4D7NA 1JKQC 2YS9A 2W48A 5EG0A 2NS8A 2LFBA 3CCYA 5FLMJ 4KUGA 2H8RA 4FE4A 2E2IJ 2VKVA 2GF2A 4BKXA 2IZ1A 3HOWJ 1VI0A 3GTGJ 3HDHA 2ECCA 3GTJJ 2WB1N 5FKKA 1MBEA 2E1OA 5J1YA 1ETXA 1I50J 3OBBA 3QHAA 1PGQA 2GLOA 3H3VK 1PGJA 2LY9A 5FLVA 3JRIA 1NTCA 2WAQN 1GV5A 1QVTA 1WPKA 1DU0A 3TW7A 2P4QA 5HWSA 1M75A 2ZYDA 2FX0A 2N8GA 3BG3A 2IAIA 2Y30A 4G12A 2EZLA 4NDLA 1T33A 3B6CA 4IHYA 1RKWA 3GTPJ 1DU6A 1X0XA 4DYDA 2ZYAA 5JLXA 3GTQJ 3I4NJ 2O7OA 1SFOJ 3CQZJ 2JA5J 5FKOA 4JX6A 1IGNA 5E3OA 3I83A 3BQYA 1LE8A 3L6DA 3S1QJ 2Y2ZA 5C4XJ 1BW6A 1K83J 4QTRA 2E2HJ 1TC3C 1IDZA 1PUFB 1BG6A 4AUXA 2ID3A 4JP0A 1ZTRA 3K7AJ 3BG9A 5M5XJ 4A3IJ 1YRNB 2M2EA 1P7IA 4XRSA 3GHYA 1F36A 3BR1A 1OCPA 1RESA 2DMPA 1G2HA 3LOCA 3QPSA 2FJ1A 3ZWCA 3DFUA 2HDDA 1ZK8A 2HXIA 1HF0A 4DYQA 4V2FA 1WH7A 2K9QA 2L7ZA 2LP0A 4FTHA 2MG4A 1SANA 5F0CA 4D3FA 2E2JJ 2JWTA 1ETQA 3OIOA 1M2WA 3BR5A 1IJWC 9ANTA 3G1OA 3CDLA 4IEJA 3GTMJ 2DA5A 1YONA 5IYDJ 5A9SA 2K40A 2KT0A 4GWGA 5F08A 1JGGA 3CKYA 4B3AA 3ZWAA 1BW5A 2DA3A 1U78A 3ZQIA 2HOTA 3RQSA 2P81A 5C4JJ 3TEDA 3Q3CA 3TW6A 5K7FA 3ZQFA 2L7MP 3PJGA 5A9TA 2DA7A 1QMGA 1I3QJ 5J1RA 3C7AA 3HEFA 4A93J 5EDNA 2FQ4A 1MSFC 2JK3A 3B6AA 1F17A 4YCAA 3UKGA 1ETWA 5F04A 3FISA 4J19A 5JLWA 1OCTC 3A01B 4XK4A 3JRBA 2NVYJ 5DTDA 2DMTA 2ZYGA 1MBJA 3K2AA 1WI3A 5GP9A 4AYBN 2VUMJ 4A69C 2PGDA 3ZQHA 4XIDA 3WS7A 2AHQA 5EYRA 1LSOA 3GTOJ 3Q0UA 1GT0C 2CQXA 3BT9A 3CTVA 1NK2P 4W97A 3PEFA 2EZIA 3BTIA 1H8AC 2E19A 1K61A 2K9NA 4C3JJ 5IOYA 1WCMJ 2DA1A 1LFBA 4L5EA 3JREA 3BTCA 5FWNA 3ZHBA 5JE8A 4B1RA 2HOAA 1PGNA 3ZW8A 2M8GX 2HI3A 3RQIA 1DLJA 4PZCA 5EGOA 5EG0B 2R5YA 5FKLA 3W6VA 1U8BA 2HDHA 3W6ZA 1XC5A 1FTZA 2TCTA 3IH4A 3BQZA 2NS7A 4M3BA 1YJ8A 2NVXJ 3ZQLA 1M66A 1XS9A 5J3LA 2Y9YA 1HCRA 2EW2A 3K6JA 2IYOA 4JX4A 2ECBA 2LVSA 3HOYJ 5EZGA 1TWAJ 3VPRA 5IP7J 1KS9A 4GWKA 2D3TA 4A3BJ 4DCKA 3ZWBA 1BA5A 2CJJA 1XG1A 4X6AJ 1JUPA 2M0CA 2QCOA 1GVDA 1TWHJ 5F0FA 1F14A 4DW6A 1R9TJ 3ZQCA 4A3CJ 1LJ8A 3PDUA 3HN2A 3FR8A 3O8HA 4D3DA 1OJLA 3LNQA 3BTLA 1JKPC 4C3HJ 1IRZA 1LE8B 5IYBJ 3FKIJ 3LSGA 4XRMA 2R0QC 2IEKA 1ZGWA 3S1NJ 1Y1VJ 3WHCA 3Q0WA 4BY1J 2O9LA 5IP6A 4BY7J 1HDPA 1HDDC 2VPRA 3W6UA 2WV1A 3ZOBA 5M5WJ 5C3EJ 5J1UA 2NOGA 4XRSG 1RPWA 1S7EA 4RBOA 3M3YJ 2H1KA 3S14J 5FJ8J 4I6ZA 2CUEA 3NAUA 3HKZN 2X58A 1W0UA 1APLC 3HWRA 4AC0A 1A5JA 4M3DA 3MN2A 4QIWN 1ORKA 1JJ8C 2L0KA 1JDJA 1T56A 3L1PA 1PGPA 2IZ0A 4B3JA 4S0HB 3M4OJ 2OFPA 2JA6J 4A3DJ 3IV5A 2WTBA 1EF4A 2IBDA 1ETKA 5IPAA 2LLKA 1U9NA 4I76A 5FKMA 4UUSA 2UYYA 4OQZA 2YUSA 3JRCA 1X2NA 5A9SB 2D5VA 1M67A 4UUTA 2R5ZA 4A3FJ 3Q0VA 3JRFA 2M9HA 3S1RJ 2XPUA 1JUSA 3S15J 1MBKA 5FKNA 4FE7A 2XGEA 4A3LJ 3BTJA 4DYRA 2DA4A 2XRLA 4FGWA 4D7MA 4D5FA 5MGBA 1JT0A 4QSHA 4M6VA 1ZKGA 3ULKA 3PLRA 1IC8A 1WGXA 5GPCA 1MH4A 3IH3A 1RETA 4S3MA 5M5YJ 3WFIA 2G0EA 2B63J 3DOJA 3JR9A 4IHWA 1RR7A 3H0GJ 4M3GA 2COBA 1E3OC 2HOSA 2CUFA 1VFCA 4IHVA 3WFJA 1ZR4A 2Y9ZA 3G17A 4B3HA 5EEAA 1BL0A 3DEWA 2DMQA 2W90A 4MLOA 1LFUP 2JJ7A 3MVPA 4DZPA 4X1EA 5F1JA 3ZW9A 3E7LA 2XSDC 4MFDA 1FJLA 2XPVA 3PO3J 1W0TA 1WDKA 4ABZA 1JUMA 4E12A 2JMWA 3JRGA 4B4CA 5EGOB 2LTPA 2R5YB 1JTYA 3FWNA 3HBLA 4A3MJ 1F43A 1BJZA 3HGYA 4KUHA 4JYKA 5IOZA 1JJ6C 1MH3A 4LOCA 2XB0X 4W1UA 4BBSJ 1ZQ3P 2RAEA 3HGGA 4A3JJ 1B8IA 3LSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF9 A;  2DA6 A;  3SFI A;  1ETO A;  3G1M A;  5F27 A;  1MNM C;  2AO9 A;  1CQT A;  2HYJ A;  4V2G A;  1MBG A;  2DTZ A;  1FIA A;  1JKR C;  1OFC X;  2EZH A;  1IUF A;  2Y31 A;  4JQ0 D;  3F0C A;  2NVT J;  2DMN A;  2EQR A;  1AKH A;  4CYC A;  2ID6 A;  3HOU J;  2X6O A;  2ME6 A;  3LSR A;  1RKT A;  1O4X A;  3HOZ J;  1AHD P;  5BNG A;  5C44 J;  3TP0 A;  1NK3 P;  2HXO A;  1B72 B;  2EH3 A;  1Q1V A;  3A03 A;  1UMQ A;  2DMU A;  3A02 A;  3I4M J;  1IV6 A;  1GDT A;  1TWG J;  1MSE C;  2ELK A;  2XGC A;  4JPZ B;  1UHS A;  2GM4 A;  2LKX A;  1B72 A;  2MGQ A;  3FK7 A;  3S17 J;  3BG5 A;  2YU9 J;  1GV2 A;  1TWF J;  1FIP A;  2VKE A;  4MIM A;  2JN6 A;  1ITY A;  2EBI A;  2NVQ J;  1ETV A;  4JX5 A;  1Z0X A;  4UUS B;  3D1N I;  3HOV J;  3CMY A;  1IG7 A;  2X48 A;  2R5Z B;  1H88 C;  2OPT A;  1QVU A;  3BR6 A;  3ZQG A;  2TRT A;  4GFB A;  1UG2 A;  4FCY A;  3HB9 A;  3RZO J;  2LD5 A;  4DZJ A;  1GUU A;  4M3F A;  1P7J A;  1Y1W J;  4M3E A;  5E3M A;  3JRH A;  2R7Z J;  2DJN A;  3BR0 A;  3SJM A;  1HOM A;  2CRG A;  2O8K A;  2R93 J;  4DYC A;  1POG A;  1WH5 A;  5IP9 J;  4A3E J;  1QPI A;  3BR3 A;  4FIS A;  4A3G J;  2HQ5 A;  3S1M J;  1HLV A;  4Y52 J;  2LK2 A;  3Q3S A;  2CQQ A;  4EEF G;  5M3M J;  2I10 A;  2XB5 A;  3FIW A;  2L7F P;  3IH2 A;  4MFE A;  3HOX J;  2VI6 A;  3S16 J;  1IDY A;  3OSF A;  3MKL A;  1PUF A;  2LR8 A;  2PMZ N;  5EF6 A;  1QRY A;  1U9O A;  3WHB A;  2MW8 A;  3C2B A;  1YRN A;  2CU7 A;  4D5C A;  4IHX A;  4HNV A;  3FK6 A;  3HDD A;  5K7Z A;  2ME0 A;  3PM1 A;  5HOD A;  2XGD A;  1FEX A;  2ZB9 A;  4C3I J;  5DS9 A;  1VND A;  3GTL J;  1I6H J;  3LSJ A;  2DA2 A;  3TP3 A;  3JRA A;  1H89 C;  3BR2 A;  1X2M A;  1B8I B;  2JA8 J;  2EZK A;  2M34 A;  1ENH A;  1JT6 A;  3GTK J;  5K7H A;  1JTX A;  5F0H A;  5M3F J;  1FTT A;  3QQA A;  5IYC J;  4A3K J;  4BBR J;  2K9S A;  1AU7 A;  1AKH B;  4CYC B;  4C2M J;  2FD5 A;  2GBY A;  3DCF A;  5E3N A;  2Y0S N;  2DN0 A;  3QPL A;  3NAR A;  1ETY A;  3RZD J;  1A6I A;  2X9D A;  5E3L A;  5GPA A;  3S2H J;  3A01 A;  3G1L A;  3JRD A;  1TWC J;  3OSG A;  2KDZ A;  1X58 A;  1JKO C;  4RDU A;  4XIC A;  2QF7 A;  2R92 J;  5EZH A;  2XPW A;  3RKQ A;  3PO2 J;  1Z77 A;  3O8G A;  2JA7 J;  1MBH A;  3S2D J;  4BXX J;  3HM5 A;  1ZR2 A;  2OF7 A;  2L9R A;  3GBG A;  3OOU A;  4Y7N J;  1MBF A;  1D5Y A;  3SDG A;  4MO7 A;  4OVN F;  2MSY A;  4D7N A;  1JKQ C;  2YS9 A;  2W48 A;  5EG0 A;  2NS8 A;  2LFB A;  3CCY A;  5FLM J;  2H8R A;  4FE4 A;  2E2I J;  2VKV A;  4BKX A;  3HOW J;  1VI0 A;  3GTG J;  2ECC A;  3GTJ J;  2WB1 N;  5FKK A;  1MBE A;  2E1O A;  5J1Y A;  1ETX A;  1I50 J;  2GLO A;  3H3V K;  2LY9 A;  5FLV A;  3JRI A;  1NTC A;  2WAQ N;  1GV5 A;  1QVT A;  1WPK A;  1DU0 A;  3TW7 A;  2FX0 A;  2N8G A;  3BG3 A;  2IAI A;  2Y30 A;  4G12 A;  2EZL A;  4NDL A;  1T33 A;  3B6C A;  4IHY A;  1RKW A;  3GTP J;  1DU6 A;  5JLX A;  3GTQ J;  3I4N J;  2O7O A;  1SFO J;  3CQZ J;  2JA5 J;  5FKO A;  4JX6 A;  1IGN A;  5E3O A;  3BQY A;  1LE8 A;  3S1Q J;  2Y2Z A;  5C4X J;  1BW6 A;  1K83 J;  4QTR A;  2E2H J;  1TC3 C;  1IDZ A;  1PUF B;  4AUX A;  2ID3 A;  4JP0 A;  1ZTR A;  3K7A J;  3BG9 A;  5M5X J;  4A3I J;  1YRN B;  2M2E A;  1P7I A;  4XRS A;  1F36 A;  3BR1 A;  1OCP A;  1RES A;  2DMP A;  1G2H A;  3LOC A;  3QPS A;  2FJ1 A;  2HDD A;  1ZK8 A;  2HXI A;  1HF0 A;  4DYQ A;  4V2F A;  1WH7 A;  2K9Q A;  2L7Z A;  2LP0 A;  4FTH A;  2MG4 A;  1SAN A;  5F0C A;  2E2J J;  2JWT A;  1ETQ A;  3OIO A;  3BR5 A;  1IJW C;  9ANT A;  3G1O A;  3CDL A;  4IEJ A;  3GTM J;  2DA5 A;  5IYD J;  2K40 A;  2KT0 A;  5F08 A;  1JGG A;  4B3A A;  1BW5 A;  2DA3 A;  1U78 A;  3ZQI A;  2HOT A;  2P81 A;  5C4J J;  3TED A;  3TW6 A;  5K7F A;  3ZQF A;  2L7M P;  2DA7 A;  1I3Q J;  5J1R A;  3HEF A;  4A93 J;  5EDN A;  2FQ4 A;  1MSF C;  2JK3 A;  3B6A A;  3UKG A;  1ETW A;  5F04 A;  3FIS A;  4J19 A;  5JLW A;  1OCT C;  3A01 B;  4XK4 A;  3JRB A;  2NVY J;  5DTD A;  2DMT A;  1MBJ A;  3K2A A;  1WI3 A;  5GP9 A;  4AYB N;  2VUM J;  4A69 C;  3ZQH A;  4XID A;  2AHQ A;  5EYR A;  3GTO J;  3Q0U A;  1GT0 C;  2CQX A;  3BT9 A;  1NK2 P;  4W97 A;  2EZI A;  3BTI A;  1H8A C;  2E19 A;  1K61 A;  2K9N A;  4C3J J;  5IOY A;  1WCM J;  2DA1 A;  1LFB A;  4L5E A;  3JRE A;  3BTC A;  4B1R A;  2HOA A;  2M8G X;  2HI3 A;  3RQI A;  5EGO A;  5EG0 B;  2R5Y A;  5FKL A;  3W6V A;  1U8B A;  1XC5 A;  1FTZ A;  2TCT A;  3IH4 A;  3BQZ A;  2NS7 A;  4M3B A;  2NVX J;  3ZQL A;  1XS9 A;  5J3L A;  2Y9Y A;  1HCR A;  4JX4 A;  2ECB A;  2LVS A;  3HOY J;  5EZG A;  1TWA J;  3VPR A;  5IP7 J;  4A3B J;  4DCK A;  1BA5 A;  2CJJ A;  1XG1 A;  4X6A J;  1JUP A;  2M0C A;  2QCO A;  1GVD A;  1TWH J;  5F0F A;  4DW6 A;  1R9T J;  3ZQC A;  4A3C J;  3O8H A;  1OJL A;  3LNQ A;  3BTL A;  1JKP C;  4C3H J;  1IRZ A;  1LE8 B;  5IYB J;  3FKI J;  3LSG A;  4XRM A;  2R0Q C;  2IEK A;  1ZGW A;  3S1N J;  1Y1V J;  3WHC A;  3Q0W A;  4BY1 J;  2O9L A;  5IP6 A;  4BY7 J;  1HDP A;  1HDD C;  2VPR A;  2WV1 A;  3ZOB A;  5M5W J;  5C3E J;  5J1U A;  2NOG A;  4XRS G;  1RPW A;  1S7E A;  4RBO A;  3M3Y J;  2H1K A;  3S14 J;  5FJ8 J;  4I6Z A;  2CUE A;  3NAU A;  3HKZ N;  1W0U A;  1APL C;  4AC0 A;  1A5J A;  4M3D A;  3MN2 A;  4QIW N;  1ORK A;  1JJ8 C;  2L0K A;  1T56 A;  3L1P A;  4S0H B;  3M4O J;  2JA6 J;  4A3D J;  3IV5 A;  1EF4 A;  2IBD A;  1ETK A;  5IPA A;  2LLK A;  1U9N A;  4I76 A;  5FKM A;  4UUS A;  2YUS A;  3JRC A;  1X2N A;  2D5V A;  4UUT A;  2R5Z A;  4A3F J;  3Q0V A;  3JRF A;  2M9H A;  3S1R J;  2XPU A;  1JUS A;  3S15 J;  1MBK A;  5FKN A;  4FE7 A;  2XGE A;  4A3L J;  3BTJ A;  4DYR A;  2DA4 A;  2XRL A;  4D7M A;  4D5F A;  1JT0 A;  4QSH A;  4M6V A;  1ZKG A;  1IC8 A;  1WGX A;  5GPC A;  1MH4 A;  3IH3 A;  1RET A;  5M5Y J;  2G0E A;  2B63 J;  3JR9 A;  4IHW A;  1RR7 A;  3H0G J;  4M3G A;  2COB A;  1E3O C;  2HOS A;  2CUF A;  1VFC A;  4IHV A;  1ZR4 A;  2Y9Z A;  5EEA A;  1BL0 A;  3DEW A;  2DMQ A;  4MLO A;  1LFU P;  2JJ7 A;  3MVP A;  4DZP A;  4X1E A;  5F1J A;  3E7L A;  2XSD C;  4MFD A;  1FJL A;  2XPV A;  3PO3 J;  1W0T A;  4ABZ A;  1JUM A;  2JMW A;  3JRG A;  4B4C A;  5EGO B;  2LTP A;  2R5Y B;  1JTY A;  3HBL A;  4A3M J;  1F43 A;  1BJZ A;  3HGY A;  4JYK A;  5IOZ A;  1JJ6 C;  1MH3 A;  4LOC A;  2XB0 X;  4W1U A;  4BBS J;  1ZQ3 P;  2RAE A;  3HGG A;  4A3J J;  1B8I A;  3LSP A; 
#chains in the Genus database with same CATH topology
 3L75 J;  2YMK A;  1ZCJ A;  3CDH A;  4GYG A;  2ESH A;  3I55 I;  3F89 A;  3BCC D;  1ETO A;  1H0T A;  1T08 B;  1MNM C;  1ZAR A;  4HRI A;  3D5S C;  2IBZ D;  4IM7 A;  4II3 A;  4KMF A;  2AO9 A;  3WU1 B;  2ZJR F;  2F48 A;  2W6J H;  4D6T J;  2NRG A;  2Q9I A;  5B5E E;  2X0L A;  1JKR C;  5KKZ C;  4KMU X;  1JMM A;  1KU7 A;  3C7J A;  2EZH A;  2X4H A;  1G4D A;  5J8C A;  1EDK A;  1SQP J;  2H88 C;  2JO1 A;  2NVT J;  2DMN A;  5GTI E;  5FLX K;  1PGO A;  3IC7 A;  4CYC A;  2M5W A;  3HE5 A;  2X6O A;  1XMX A;  3DLL F;  4B48 A;  3CES A;  3MIW A;  3HOZ J;  1O4X A;  2QEX P;  2XAG A;  5AVQ B;  4UB6 C;  4OWR B;  2XAU A;  2H27 A;  5CJ4 A;  5C44 J;  1AV1 A;  1QL1 A;  3W2V A;  1SQB D;  3RK2 C;  3H1K J;  3A0H E;  1Q81 Q;  1B72 B;  3GZ6 A;  3A03 A;  3FXD A;  1PYV A;  4F3Q A;  1UMQ A;  3S8P A;  2V7F A;  5DCM B;  1GDT A;  1JTH A;  1X19 A;  3CMA I;  2ELK A;  1SD4 A;  4JPZ B;  1IXR C;  4RO0 A;  1VQ6 P;  3VTP C;  1T0F A;  3R61 A;  3JTG A;  1BIA A;  2K3P A;  2MGQ A;  4U0Y A;  2BBY A;  4XOR A;  3IF4 A;  3BG5 A;  4LLL A;  3TOA A;  2N1T A;  4KA4 A;  1RHZ B;  3AEE C;  2K27 A;  5FLX Z;  1GZL A;  2VKE A;  5L3E A;  1ITY A;  3B5N B;  2EBI A;  4IFM A;  3GEZ A;  5CQE A;  5IT3 A;  4OIR F;  4FAS D;  1KYW A;  3C1D A;  4JX5 A;  1NJI Q;  3O6Q A;  4Z2Y A;  1YJQ A;  2Q1Z B;  5CJ9 A;  5B66 C;  2X48 A;  3HOV J;  3IQD B;  1LWU B;  2LOO A;  3H1H G;  2R5Z B;  1H88 C;  2M0M A;  2OA4 A;  4A2U A;  2OPT A;  2PJR B;  3ZMT A;  5BU5 A;  1N73 C;  2F4M B;  3DWL E;  3HUG A;  3BR6 A;  3Q9S A;  4OGQ B;  3RBZ A;  1YJW P;  5FD6 A;  2TRT A;  2Q8K A;  5TGT A;  1UG2 A;  4FCY A;  3KP7 A;  3CF2 A;  2W6A A;  4HH2 A;  2LD5 A;  3LQR A;  2AEJ A;  1QNT A;  3L71 J;  4G9Y A;  5J8F A;  2RNJ A;  5E8G A;  5GAE J;  5E3M A;  2RKL A;  4B3X A;  2CPB A;  2BEO A;  1HOM A;  2O8K A;  3GHG A;  4MNU A;  1POG A;  3EET A;  3CX5 D;  3CCR P;  5IP9 J;  6PAX A;  2XIG A;  1JXS A;  2H1L A;  1USE A;  3IFM A;  2HQ5 A;  4UXN A;  5J4Y A;  4BHB A;  3TDK A;  2VAS A;  3AE2 C;  3H1H E;  1MFZ A;  2FMY A;  1HGV A;  3LMM A;  4EEF G;  3B4S A;  1HWT C;  1Q2N A;  5K5Q A;  2XB5 A;  3I59 B;  1X0T A;  1X8Y A;  1E0E A;  5E17 F;  3L75 D;  2DOF A;  4E13 A;  4ENN A;  3DQV C;  3HOX J;  4OIO F;  1F9N A;  4OIP F;  2CUZ A;  3M8F A;  1R00 A;  3CCE I;  1SLQ A;  1L0N J;  1VL2 A;  3HAD A;  3P8C D;  2BCC G;  1SAU A;  1PUF A;  3HZJ A;  2LR8 A;  5EF6 A;  3WTY C;  1HBW A;  1D3Y A;  5GAH J;  2BW3 A;  4D6T D;  1S9K E;  3N97 A;  1QRY A;  3S32 A;  2EB7 A;  3KEO A;  2CPS A;  1K4T A;  2W1O A;  2CW7 A;  4EM2 A;  2ZXH A;  4AM3 A;  3CCM I;  4HNV A;  2A68 F;  1WSU A;  4RGR A;  1FC2 C;  2R5D A;  1WJE A;  1N1G A;  1VQL P;  5K7Z A;  2IA1 A;  2ME0 A;  3VFZ A;  4OQY A;  1DEE G;  2JPC A;  5HOD A;  1NG7 A;  1Z91 A;  2CV1 A;  1U5T B;  1NWQ A;  1LDK B;  3K4J A;  4L18 B;  2AXT H;  4ENK A;  1XN7 A;  2R5B A;  3LFK A;  4IL6 E;  4YXD C;  3B71 A;  1LJ2 A;  1KMI Z;  1NU1 G;  2YIU B;  3AE5 C;  3H1K D;  2LG4 A;  3LW5 J;  1FBQ A;  2P5V A;  2V9K A;  1N77 A;  4J00 A;  1P2F A;  3HRU A;  2BCC E;  3BDD A;  4U7J A;  2KRC A;  3OJA B;  5AVS B;  3SZP A;  4MGR A;  1FZA A;  4PJN A;  1X2M A;  2LRE A;  3H1I J;  5APS A;  4LJZ F;  2RVC A;  2EZK A;  3QAH A;  3GWZ A;  3CCL I;  2NOJ B;  2P7V B;  4B3I A;  4W7Y A;  3WU2 H;  2M8R A;  2F5V A;  2QM8 A;  1JTX A;  3C7C B;  1KA8 A;  1FP2 A;  3E7K A;  2AXT C;  5BPD A;  3HTU A;  3QQA A;  2IT0 A;  1OW8 A;  2DTR A;  5TIS E;  2WC2 A;  1EA3 A;  2BVL A;  3E1S A;  1LFP A;  3N4M A;  1NU1 E;  1MJB A;  4HV6 A;  3PL8 A;  4BH9 A;  3OA7 A;  2VXZ A;  1JCC A;  3HD7 C;  3FMQ A;  4CYC B;  1IJD B;  3HE5 B;  3A4C A;  4HQE A;  3FR7 A;  5E3N A;  2MLK A;  2Y0S N;  3ZGK A;  1WRG A;  3RZD J;  1A6I A;  2X9D A;  2VBX A;  5HDG A;  5E3L A;  1VTN C;  4H4K C;  3P7N A;  3WU2 C;  4DLL A;  5E20 A;  3S2H J;  3V4Q A;  4N9I A;  3KYL A;  1D0Y A;  3PFI A;  1FSE A;  3FXJ A;  3L71 D;  2WAQ A;  5DYM A;  4RDU A;  5BQT A;  1M76 A;  4NC8 A;  2QF7 A;  3EDP A;  1SQQ K;  2R92 J;  4IKF A;  1K73 Q;  1JTH B;  3BG6 A;  4IXA A;  1YOV B;  2WTY A;  4L9J A;  3DEU A;  2FBI A;  3LQQ A;  2ZXJ A;  4QPQ A;  5HS8 A;  4ZJZ A;  3I3L A;  3F23 A;  1GMJ A;  3SXY A;  3IRQ A;  1S8N A;  2P4W A;  5ICE A;  2FYN B;  5KLI C;  3W6J B;  4KIC A;  2IGM A;  1K6O A;  3CCV I;  3SWF A;  4N0B A;  2KZV A;  3HC7 A;  5M1B A;  2XRN A;  1HW5 A;  5D8K B;  3OOU A;  1N8R Q;  2VBW A;  3WOD F;  2PI0 A;  3BLY A;  4Y28 J;  5KAF E;  3L35 A;  3B73 A;  1AA7 A;  3G71 I;  2VC1 A;  2V26 A;  4OAY A;  1KC8 Q;  4BQQ A;  1URQ C;  1L0N D;  3O6Q B;  3V2N A;  2PMU A;  3DU6 A;  3CCY A;  5FLM J;  1SFE A;  3H1C A;  4A12 A;  1NYH A;  2IXS A;  3CP8 A;  1DP3 A;  2K9M A;  1UAA A;  2IZ1 A;  1L0O C;  1VI0 A;  2POH A;  3HDH A;  3HUG B;  1FYL A;  1YIJ I;  2K9Y A;  2WPV B;  1MBE A;  1PVE A;  3CUQ A;  2WV0 A;  4A0Y A;  5LGT A;  3OY9 A;  1ETX A;  2PMZ A;  1HXD A;  2NRA C;  1OX3 A;  4QMA A;  1M1J C;  3H3V K;  1IFI A;  4ITV A;  1W5C E;  2Z5I A;  1PGJ A;  2LY9 A;  4RB3 C;  5FLV A;  3JRI A;  1NTC A;  1T3U A;  4D9J A;  1YJN I;  2X1C A;  2H6B A;  1QVT A;  5LRS A;  3M0A A;  3TW7 A;  3GHG B;  2KQR A;  2ZYD A;  2Q1K A;  2Z5H A;  2W24 A;  1BOA A;  2Y30 A;  2I76 A;  3K1M A;  1X4P A;  1X0X A;  1WI9 A;  3GTP J;  1EXI A;  1G59 A;  4XOT A;  1NO4 A;  1LTJ A;  1KB9 E;  5CCH A;  3HHG A;  3H1I D;  2O7O A;  1I27 A;  3CQZ J;  3L74 J;  1IGN A;  3L6D A;  3V8K A;  2A6T A;  1LE8 A;  4CSW A;  3S1Q J;  2VT2 A;  4ESB A;  2KSJ A;  4ZYG A;  1N86 A;  2MH2 A;  3RK3 D;  5B1A H;  1TC3 C;  1X9V A;  1PUF B;  4WY4 C;  3FGA D;  3HUS C;  4EM1 A;  2BW3 B;  2ZVO B;  3L36 A;  4Q48 A;  2ICW G;  3K7A J;  2QSH X;  4PDK A;  3SFE C;  3Q1M A;  3GHY A;  4JYC A;  2VT3 A;  4XRS A;  3RYP A;  1QPM A;  1F36 A;  1FPQ A;  2DMP A;  4L0Z B;  2X1D A;  2KOG A;  2V1U A;  1JO5 A;  1K9M Q;  1OIP A;  2L02 A;  3QPS A;  4H13 C;  1P92 A;  4L9V A;  1E3P A;  3ABU A;  3BWG A;  2QBY A;  3CCU I;  3CC4 P;  2CMP A;  3TBI A;  2W6B A;  4I02 A;  3RL0 C;  4V2F A;  4IPA A;  1WH7 A;  1N2D C;  5D4S A;  2FYU G;  3IN6 A;  3QOE A;  2ELH A;  5APU A;  2HPC A;  1QZY A;  2K9Q A;  2YSR A;  4M6X A;  2L7Z A;  3EUK L;  3OIQ A;  2M5A A;  1X22 A;  1WJA A;  1SAN A;  5F0C A;  3NWS A;  3LWF A;  4TLF A;  1EKE A;  3BR5 A;  4W80 A;  9ANT A;  2V1N A;  3G1O A;  4IEJ A;  1W7P A;  3OS1 A;  3GTM J;  1YON A;  4E7J A;  1Q1H A;  4GWG A;  3E6M A;  2FOW A;  4L0Y B;  5ICC A;  3MD0 A;  4XQF A;  1XSD A;  3C18 A;  3PTZ A;  2QQ9 A;  4BE2 A;  1U78 A;  4OAZ A;  4MQV A;  3WGG A;  3ZQI A;  2Q3E A;  3RQS A;  1SQB K;  4AU7 A;  3CJR B;  1KQS O;  4XLC A;  1NTZ G;  1V55 H;  4AVZ A;  1ZLJ A;  3O6B B;  1F1Z A;  2E35 A;  3CLO A;  3OR2 C;  1M7L A;  2FYU E;  1BCC E;  5A9T A;  3G6E P;  2M30 A;  2DT6 A;  1QMG A;  2CQ7 A;  1W36 C;  4IFF A;  3HPG A;  2QJY C;  4L73 A;  4N4N B;  3SEZ A;  3Q3D A;  1MSF C;  2LYC A;  2DYS H;  3H9Q A;  4TV7 A;  3B6A A;  3SHF A;  3JSO A;  3ECH A;  2HOD A;  4CUG A;  4YCA A;  4MN4 C;  5F04 A;  3N7N A;  3M1E A;  4HDV A;  1OCT C;  3IAO A;  4P1W A;  4XK4 A;  2KP8 A;  3KCC A;  3DTK A;  1NGM B;  1RUN A;  3OIP A;  4AYB N;  1R5L A;  2AEM A;  1NTZ E;  1Z3Y A;  2OCC H;  4YII A;  1MIJ A;  4A0Z A;  4OH8 B;  1R1T A;  1Z05 A;  3Q9V A;  4MEY F;  5GAG J;  5BU8 B;  4XA4 A;  1YLF A;  3BT9 A;  3CCL P;  4XLH A;  3HOT A;  5AVT B;  4EGZ A;  1H8A C;  2EFN A;  2B9S A;  1LFB A;  1R4M B;  1JM0 A;  1Y47 A;  3AG3 H;  2LKP A;  2J5P A;  2D2C D;  4GIF A;  5JE8 A;  4B1R A;  2HOA A;  2JVH A;  4EVI A;  3ZRG A;  3QYF A;  1PUE E;  5HDN A;  2HPI A;  3ASN H;  2ZJS E;  4PFP A;  2ZFW A;  5H20 A;  2X85 A;  1B9M A;  2BHZ A;  1XC5 A;  3TL4 X;  2TCT A;  1K4S A;  1FTZ A;  3SWY A;  2H6C A;  2FRH A;  2VJ4 A;  1QVF O;  1SMT A;  3HSR A;  1Z7U A;  3MWM A;  1YJ8 A;  3EYY A;  4YEL A;  2STW A;  5F1R A;  3J7Z I;  5J3L A;  1UII A;  3HRN A;  2ZVN B;  2ECB A;  2HR3 A;  2JPB A;  3CUQ B;  3HOY J;  4PZJ A;  2QJP C;  3H32 A;  1KS9 A;  2OQQ A;  3I5C A;  4LFU A;  2P8T A;  4A3B J;  3ZWB A;  4RM2 A;  4Q5S F;  1BA5 A;  2WSF J;  2CJJ A;  4PJJ A;  2P6T A;  2KYV A;  3FXR A;  4ZDO A;  2HU9 A;  2LXC B;  1JNM A;  1NTM G;  1XDS A;  3CPW O;  1S1C X;  4PGG A;  3FXK A;  5CQG A;  2AS5 F;  4C46 A;  3IUO A;  2M0C A;  4NNJ A;  3KQG A;  3T97 A;  2KSE A;  1L4A C;  2Z16 A;  5F0F A;  2HQN A;  1G6N A;  1V4R A;  3ZQC A;  1LJ8 A;  3HN2 A;  1OJL A;  2VQL A;  3LNQ A;  2WZ7 A;  3D70 A;  1LTJ B;  2OZU A;  1LT9 C;  1YQ4 C;  4CZC A;  3VOE A;  5LEJ A;  3C3W A;  3M8J A;  1UST A;  3E5U A;  3DV8 A;  4RB0 A;  1LE8 B;  5IYB J;  4XRM A;  1ZGW A;  1DUX C;  2VJJ A;  3Q2Y A;  2CQK A;  2KLU A;  4P5O A;  1OYW A;  4IJA A;  1OR7 A;  3WHC A;  4BY1 J;  1EZV D;  1IF1 A;  2QM3 A;  3RKW A;  3F5H A;  1HDD C;  1JY2 O;  4ZKU A;  1UJ8 A;  1PP7 U;  3ZOB A;  2WA0 A;  3E0J B;  5C3E J;  3I0T A;  3MKY B;  1BGY E;  2BHY A;  3JAM K;  1NTM E;  2O1K A;  5F6F A;  2WT7 A;  1S72 I;  1KIL D;  1YIT I;  4XRS G;  2PJP A;  2KJC A;  2EWN A;  1JEK A;  5FJ8 J;  3NAU A;  2XAJ A;  1JE8 A;  1W0U A;  3M9A A;  3CCS I;  1APL C;  1YHQ I;  2ZKZ A;  3HWR A;  2YO2 A;  4QIW N;  4JQF A;  3A5T A;  2QBY B;  1PGP A;  2IZ0 A;  4B3J A;  3M4O J;  1Y0N A;  2BXY A;  1RH5 B;  1GXP A;  1DEB A;  2HPC B;  2O8X A;  3IV5 A;  1BIB A;  3CZ6 A;  4MEX F;  2M5A B;  4N3Y B;  1EF4 A;  2DFE A;  1ETK A;  2L2O A;  3BCB A;  3ZMV A;  2R7O A;  5DD8 A;  3V8J A;  5D6E A;  4UUS A;  3I56 I;  1W7P B;  4EYY Q;  2KHM A;  2D5V A;  4A3F J;  1IN5 A;  1R4N B;  1HSJ A;  2DO7 A;  2FXM A;  3R2P A;  5KAI H;  4ZKP A;  5LD2 C;  3HRT A;  5E79 H;  3KZZ A;  2BXZ A;  1V5G A;  5APT A;  4ZMD A;  1JUS A;  2OCE A;  2VQH A;  4Y15 A;  3S15 J;  5LEK A;  2XAH A;  3U1D A;  2QLZ A;  3CJQ B;  3GFL A;  5EEH A;  2DJI A;  1KV4 A;  2VJI A;  3K4B A;  3QU6 A;  4D5F A;  4LLH A;  5J6X A;  1KON A;  1VQ9 P;  1KU2 A;  3KZY A;  1IC8 A;  1L0L K;  4FT8 A;  3RPQ A;  4F91 B;  5GPC A;  1PP8 F;  1UZC A;  3IH3 A;  3GVA A;  2WQY C;  5M5Y J;  2BCC J;  3WFI A;  2HOD B;  1YI2 P;  1ZRT E;  3HOS A;  2E1M C;  3JR9 A;  5KAI C;  4IHW A;  3HE4 A;  3TMO A;  1P4X A;  4CZZ A;  2HOS A;  3H1J G;  4RAF A;  5EEG A;  3I4P A;  3RYR A;  4CH7 A;  1VFC A;  4IHV A;  2EFO A;  5K5G B;  3CC7 P;  2VIX A;  2V79 A;  3OV8 A;  4ZDL A;  1V5F A;  5D8L B;  3G17 A;  1R8E A;  3H6P A;  5ICF A;  1L0N K;  3EQL F;  3ABM H;  4MHG A;  4U7B A;  3AE4 C;  1LFU P;  4DZP A;  5DJU B;  1TW2 A;  2A45 G;  2JDI H;  4NC7 A;  1P84 E;  4XLP F;  3C1L A;  4U87 A;  2PMH A;  2IS1 A;  4UB8 H;  1MMD A;  3KEQ A;  2QE7 H;  1FP1 D;  4DOZ A;  2JSC A;  4ENJ A;  1SQX G;  3K9T A;  4I98 B;  2KP6 A;  5KNL A;  1GK4 A;  5H2F H;  1RE4 C;  4H44 B;  4YXW H;  2QA4 P;  2E74 B;  4B4C A;  3WG9 A;  1F4K A;  4ZZD A;  3H1J E;  3AL0 C;  3QOD A;  4ON0 A;  4A3M J;  1F43 A;  2WMM A;  3QU3 A;  4KUH A;  1G8X A;  4JYK A;  1FDO A;  2R44 A;  5IOZ A;  3J7A Y;  1JJ6 C;  1QL2 A;  1OXZ A;  1LP1 A;  4WF2 A;  4HZF A;  4DBR A;  4BBS J;  3A0B H;  4KT0 J;  1ZQ3 P;  1SFC B;  2R7U A;  3H32 B;  3B5N D;  3LSP A;  4RB1 A;  3P8M C;  4I0B A;  2DA6 A;  4HYT B;  4IF4 A;  1MW7 A;  1QHG A;  3BPX A;  3ABL H;  2C9L Y;  4UHT A;  2HYG D;  5HLI A;  5K5O A;  4XON A;  5IY5 H;  1LTA C;  5H2F C;  3TO7 A;  4J0F A;  4R79 A;  4DNC A;  1SQX E;  1ZEL A;  1CQT A;  3KZI E;  2R4G A;  5E1W A;  4IRI A;  1FIA A;  1YB4 A;  4E21 A;  1SVF A;  3T97 B;  4AUW A;  1PIX A;  1G3S A;  2KZJ A;  1OFC X;  2PAJ A;  2ZME A;  1KQF B;  3T0Y A;  4OGQ D;  2YNY A;  3F0C A;  2OZ6 A;  1MDM A;  2CSO A;  3E97 A;  2EQR A;  3R6S A;  3HOU J;  3A0B C;  3LSR A;  1S9K D;  1VQ8 P;  1AHD P;  1VQ4 P;  5HNF A;  1H9G A;  1MD0 A;  2QJK C;  3TP0 A;  5HOO A;  1RF0 C;  1UIX A;  1KYO H;  1CGP A;  1IO4 A;  5FO5 A;  3FDY A;  3CCQ I;  4WBA A;  4Y17 A;  2RC4 A;  5ILV A;  1VQO I;  2MAB A;  4GYI A;  3ZDM A;  3I4M J;  1IV6 A;  2F5E A;  2PLA A;  2WT7 B;  2VC0 A;  1PPJ G;  2XGC A;  1IO2 A;  3KIO A;  3EFG A;  4ETS A;  3GME A;  3ITK A;  4N9H A;  2LKX A;  2P7C B;  4HF0 A;  3VOP A;  1HJB A;  2QUF A;  3SZG A;  2AXC A;  1B72 A;  2BCC D;  3FK7 A;  4DIQ A;  4OWF A;  5CBO A;  1YTY A;  4XSZ F;  1BN5 A;  4MIM A;  1YTZ T;  3FMS A;  4RA2 A;  5AYV A;  3LW5 H;  2ZFU A;  3EGO A;  3U2R A;  2UWM A;  1GD2 E;  4L74 A;  3FX3 A;  4G7O F;  1D0Z A;  4LLN A;  3RCO A;  5FB2 A;  1ODD A;  1LSJ A;  3K4N A;  4UUS B;  4EJO A;  1USD A;  3MP7 B;  2GA2 A;  3QSG A;  3Q5R A;  5ERI A;  2FF4 A;  2N1T C;  1PPJ E;  4XBF A;  1IL0 A;  3ZQG A;  3OL4 A;  2FKW B;  1QEX A;  1GHC A;  1QZZ A;  2PEX A;  1V5E A;  2RKH A;  4G7Z F;  2HZD A;  2AXL A;  4M3F A;  1ZW0 A;  4N78 D;  2OU2 A;  2RNG A;  2W8Z A;  2O01 N;  3H5A A;  2FFD C;  4BDY A;  3F3S A;  4KT5 C;  3K6G A;  3WTX C;  3JRH A;  1K04 A;  1IV8 A;  1AFO A;  3BR0 A;  4D1Q A;  4R1N A;  2CRG A;  2R93 J;  2LXB A;  2G7U A;  4DYC A;  5LGU A;  2EK5 A;  4OL9 A;  2CUJ A;  3LID A;  1QPI A;  1CSB A;  3BR3 A;  4FIS A;  2R7Q A;  4ZYH A;  4A3G J;  2OTJ I;  2M3E A;  4BGD A;  4B8X A;  3VMA A;  1DPR A;  3HE4 B;  1USS A;  2CO5 A;  2I10 A;  4CCO A;  3C7D B;  3PJS K;  1LDD A;  1YIO A;  3IH2 A;  3TGU G;  4GCV A;  3AE1 C;  3RK3 C;  1J9I A;  1MNE A;  1RRJ A;  2FE3 A;  1XCV A;  5AVW B;  1IDY A;  2O01 H;  2XAQ A;  3HHH A;  3MKL A;  2PP6 A;  3I56 P;  2J5U A;  1X1A A;  1YJ9 I;  3OYH A;  4YTP C;  4EZB A;  1D7M A;  1X3W B;  5D5V B;  3C2B A;  3KYC B;  2KIK A;  2ZT9 B;  2FYU J;  4PD4 H;  4J0E A;  1BCC J;  3FK6 A;  4OMZ A;  1LT1 A;  1I39 A;  3R4K A;  2CGP A;  5AW3 B;  2Y0S A;  3OYM A;  3HDD A;  3OW2 O;  2BY2 A;  3PM1 A;  2LR2 A;  4ZH4 F;  2QYT A;  2OYI C;  2L9V A;  1X1D A;  2DOE A;  2OTL I;  2H43 A;  4G8X A;  1MZB A;  3VDX A;  3X2Q H;  4BL0 B;  4GBJ A;  3L70 G;  3TGU E;  1NHA A;  1VND A;  1UG0 A;  1I6H J;  2CYY A;  1CI6 A;  2IW5 A;  3F9K A;  2IGO A;  2R7D A;  2VBY A;  3FXO A;  3LSJ A;  2MBF A;  4EJU A;  3WUT A;  1TL8 A;  1B59 A;  1LP1 B;  1LEB A;  1IFM A;  1H89 C;  3BR2 A;  1N1E A;  1SFU A;  2E5Z A;  1UEL B;  1S6L A;  5GTH C;  2O3F A;  2Y0M A;  5APX A;  1RNL A;  1J2J B;  3GCM A;  2Q5U A;  1JT6 A;  3SFZ A;  3GTK J;  4RAY A;  1W4M A;  5KTB A;  2EIN H;  1FTT A;  5M3F J;  2QGU A;  1SD5 A;  2HS5 A;  5LRR A;  5KHD A;  1KB9 D;  1SD7 A;  4AVP A;  4WB4 A;  4BRY A;  3ABT A;  4M74 A;  3G4S P;  3EUH A;  1FOX A;  5IYC J;  1PP9 J;  2ZME B;  3FHN A;  4BBR J;  4UB6 H;  1Y8Q B;  1AU7 A;  1MDM B;  1F5T A;  3O2P E;  3D6Y A;  3MTU E;  4GOE A;  4HBL A;  4KT6 A;  4PCQ A;  2GBY A;  5AIP A;  3DCF A;  3P9C A;  3H2Z A;  3PUF A;  2OYO A;  2A5W A;  2B87 A;  1YTZ I;  1ETY A;  3K0L A;  3QP6 A;  5GPA A;  3K1P A;  1WDL A;  4HF2 A;  1MJ9 A;  3A01 A;  4XNF A;  4XOP A;  4BE0 A;  2KLV A;  3ZP5 A;  1TXG A;  3KLO A;  4KN7 X;  2YKO A;  1ZHF A;  4Y33 A;  2B7E A;  3F3X A;  3RKQ A;  1H8A A;  3PO2 J;  1WDM A;  1U3E M;  1W2B O;  3O8G A;  2JA7 J;  2DPU A;  3MFK A;  5DUI A;  1ZR2 A;  4PJL A;  3H1L G;  4LB6 B;  1R23 A;  2JWA A;  2XKP A;  3FXU A;  2JUC A;  2OQG A;  3SFD C;  2D2C C;  4I1L A;  4DGW B;  1SAX A;  4Y7N J;  1J59 A;  1MBF A;  3DKX A;  1D5Y A;  4W7Z A;  1S5L H;  5B66 H;  1GXQ A;  4CCJ A;  3BY6 A;  2GIV A;  4EQQ A;  4CHU A;  2KUB A;  2H89 C;  3F8F A;  3PJR A;  3KPH A;  5JR3 A;  2YS9 A;  2LFB A;  4FHT A;  4ESJ A;  1HKS A;  2OD5 A;  2PX9 A;  1QLE D;  2E2I J;  2VKV A;  4BKX A;  1XSX A;  1Z21 A;  2PBI A;  4YG2 F;  2ZNZ A;  2L3D A;  2EFW A;  1BGY J;  1FZE A;  1T6A A;  2FYU D;  2SPZ A;  2C6Y A;  1BCC D;  2NPS A;  1GVJ A;  2DAO A;  2QQ8 A;  5FKK A;  5JVT A;  4R1H A;  5J1Y A;  1ZG1 A;  3BZC A;  5BMZ A;  1I50 J;  1HW2 A;  3QHA A;  3FX0 A;  1PGQ A;  2GLO A;  3H1L E;  4RGS A;  1OMI A;  2QWW A;  2IFM A;  3JSV C;  1AVY A;  2HYF A;  1S5L C;  1UHM A;  2RQP A;  1KQG B;  2AXT E;  3SYT A;  1R1U A;  3CJT B;  4ASN A;  1ZRD A;  1GV5 A;  1N7L A;  1U0J A;  3W67 A;  1DU0 A;  1ZG5 A;  1T95 A;  2P4Q A;  5FRO A;  1KGS A;  2FX0 A;  5KLI B;  2V1D A;  3M9Q A;  2A6H F;  1LVK A;  3Q5F A;  3TGN A;  5LBQ A;  4O3M A;  1FZC A;  3TF5 A;  2A69 F;  2OYH A;  2EZL A;  4P9F A;  5JVG F;  4IHY A;  3MZY A;  2YXQ B;  4JBA A;  3AFH A;  2ZYA A;  2JA2 A;  2JA5 J;  5AW6 B;  2Y2Z A;  4O6J A;  1L0L J;  2YXR B;  5KJ7 C;  5AW2 B;  4U0V A;  2IP2 A;  4XKV A;  1FBS A;  2OQR A;  2DLL A;  2Y69 H;  2Z2S B;  1GLN A;  1I3A A;  2JVG A;  4AUX A;  3WE2 A;  5AW0 B;  1CF7 A;  2NXN B;  1ZTR A;  2W4S A;  1PP9 D;  4LD5 A;  3V2R A;  4GXO A;  3BR1 A;  1SP4 A;  2XND H;  2GQQ A;  3MUD C;  2WSC H;  2LKM A;  2FJ1 A;  1AA0 A;  3DFU A;  4GO1 A;  5FD5 A;  1ZK8 A;  2NAZ A;  2KLO A;  4DJA A;  1RF1 C;  1HF0 A;  1NKZ B;  3D0S A;  1CI6 B;  2GAU A;  3T8T A;  3FMR A;  5DD4 A;  4AYB A;  1MV8 A;  4IOI H;  3TOB A;  2DOD A;  4FTH A;  2O3J A;  2MG4 A;  3C8V A;  3F8N A;  4HLY A;  1NH4 A;  4I09 A;  2P6S A;  4G6T B;  1FMV A;  1M2W A;  3WMM 0;  4IQJ A;  2OUM A;  5D6F A;  1J7K A;  3GG2 A;  2I5U A;  3OYA A;  2GXA A;  2Q2E A;  5AIQ A;  2DA5 A;  2K86 A;  4C7R A;  5IYD J;  2GUV A;  1CW5 A;  3MD2 A;  2HVQ A;  4YFX F;  5A9S A;  1MKM A;  2XSJ C;  1VQ5 I;  5CVR A;  1IRX A;  3CD6 P;  4WXC A;  1LUJ B;  4B3A A;  4E7S A;  2HVR A;  2KB7 P;  3BAS A;  3AE3 C;  3BZK A;  1JHF A;  1B4A A;  2E7W A;  2WSF H;  1JY3 N;  2HOT A;  3USS A;  1S7A A;  5CMZ A;  1VQK I;  4BRY B;  3K69 A;  5KVR A;  2ESN A;  3TED A;  2E76 B;  3LA2 A;  1FU1 A;  5K7F A;  5HLG A;  2HTS A;  3FXE A;  3A0H C;  2L7M P;  1I3Q J;  4E7H A;  5CYV A;  1K6Y A;  3RDI A;  3N4X A;  2HG5 D;  3VYS B;  3K4C A;  2B87 B;  5DEQ A;  1AQT A;  1BGY D;  1OZH A;  2E5T A;  1ETW A;  3RL0 B;  2OTL P;  4M3L A;  1FLI A;  5JLW A;  3CXH H;  1RC9 A;  3AE7 C;  4IX7 A;  3A01 B;  2JTV A;  3VWB A;  1SQQ G;  3JRB A;  2OTK E;  3AEB C;  5DTD A;  4IRG A;  4A6E A;  1MBJ A;  5AVU B;  3M06 A;  3K2A A;  3ZCO A;  5GP9 A;  5DM6 F;  2VUM J;  1VPC A;  1RIO H;  3L73 J;  2PGD A;  3ZQH A;  5CCH D;  4XID A;  5A2Q Z;  2B88 A;  5EYR A;  1SQX J;  3GTO J;  3Q0U A;  3U1A A;  1GT0 C;  2R32 A;  3OOP A;  2E34 A;  3CTV A;  4W97 A;  2E36 A;  3BTI A;  4ZYE A;  4N6J A;  5L8R J;  4C3J J;  5CVJ A;  1M1K Q;  3ERM A;  3A7O A;  2R7T A;  3JRE A;  3OYB A;  3TSI A;  3V5B A;  5HLT A;  3HRM A;  4XLE A;  1L0L D;  3L7W A;  4NB5 A;  2M8G X;  3CWB G;  2ZXI A;  1DLJ A;  3PHL A;  3I71 A;  5EGO A;  1S5L X;  1SQQ E;  4PSW A;  4AQR D;  2IA0 A;  3W6Z A;  1FOY A;  1XDU A;  4GRI A;  1V3F A;  1LTT C;  1S3J A;  2QJY B;  3I55 P;  2NS7 A;  2YU3 A;  4JYB A;  1VQM I;  4XRF A;  2NVX J;  1WZ2 A;  1N7S A;  4CXF A;  1HCR A;  2EW2 A;  1M57 D;  2NPS B;  4JX4 A;  3O3K A;  1C0W A;  1Q90 D;  3AG1 H;  4DCK A;  1IW7 F;  4DOJ A;  1LNQ A;  2DDA A;  3I5U A;  4IOC F;  1HBX G;  1ACI A;  1T8Z A;  2YMY A;  1LWU C;  4X6A J;  2J59 M;  1ZRT D;  3V7R A;  1W7P D;  2X6W A;  5HDK A;  1QX8 A;  5CLS A;  1S7O A;  3RIR A;  1NTK G;  3CWB E;  2FML A;  2QIW A;  3B8E B;  1N75 A;  1DPU A;  4IL6 H;  4OGQ C;  1FZC B;  1YG2 A;  2DQL A;  3W2A A;  2Q7C A;  1XGO A;  2ZXE B;  4A3C J;  2OYH B;  3PDU A;  2VKD A;  3B02 A;  4XLA A;  3JTH A;  3LSI A;  3O8H A;  3I64 A;  2DFI A;  1M8O B;  1DDN A;  3CMA P;  1JI8 A;  2L4A A;  3D71 A;  1U2W A;  2J5O A;  2MFZ A;  3FKI J;  3L09 A;  3FKJ A;  1E5W A;  5CCG A;  3GZ5 A;  1GU4 A;  5FRM A;  2K7L A;  4ZTJ A;  1OW7 A;  3BRO A;  4OMY A;  1P84 D;  4PV1 B;  2O1J A;  1TNS A;  2XV5 A;  2WV1 A;  2RRE A;  5M5W J;  1CF7 B;  2NOG A;  3FM5 A;  4IL6 C;  2HVS A;  1NTK E;  3P32 A;  1SS1 A;  1DGW Y;  1S7E A;  4RBO A;  2DW3 A;  3KFW X;  2LKS A;  3M3Y J;  1WT6 A;  3UNG C;  2X58 A;  3V4G A;  1Y56 A;  1KFM A;  2JSP A;  4PFO A;  4M3D A;  3J81 K;  1GU5 A;  4LIT A;  3MEX A;  2L0K A;  3D5L A;  1JY2 N;  4S0H B;  4EMS A;  1GL2 A;  2V7Q J;  2F4O B;  2KL4 A;  3MCZ A;  1ZN5 A;  3IKT A;  2M8E A;  4A3D J;  4HJG H;  1L4A B;  2QKL B;  2A06 G;  1J75 A;  1V54 H;  2KKO A;  3CDI A;  5ILS A;  3OYC A;  2LLK A;  3L73 D;  1TU3 F;  5FKM A;  2UYY A;  2HFE D;  2Q2E B;  1SQX D;  1U5T C;  1X2N A;  1M1E B;  3I53 A;  1QQI A;  5A9S B;  1VQP I;  3FM3 A;  4UUT A;  1H0M A;  2IBZ I;  4H44 D;  4K2E A;  1EH8 A;  2IPQ X;  2E74 D;  1E2X A;  1WRJ A;  3K70 C;  2YIU C;  1EDJ A;  3S4R A;  2M9H A;  2XPU A;  2KK7 A;  2ZFC A;  4XE5 B;  1MBK A;  2BEQ D;  1BOB A;  4FE7 A;  4P55 A;  1T38 A;  4KFC A;  3MZW B;  3Q5S A;  3BTJ A;  4RJT A;  2KRF A;  1HH0 A;  1BI3 A;  2D1V A;  3QRF F;  2XRL A;  3J81 Z;  1HST A;  4FGW A;  1B9N A;  4OOI A;  1JT0 A;  1R36 A;  1SFC D;  3M0D A;  1OPC A;  1I1G A;  4OIN F;  3PLR A;  1N78 A;  1LGH B;  2A06 E;  3TGU J;  3OS2 A;  3AED C;  1WGX A;  1FJP A;  3MZH A;  3CCE P;  2M87 A;  3GZN B;  4XKW A;  1RET A;  4S3M A;  3QYB A;  2B63 J;  2FUG 2;  1O7F A;  1RR7 A;  2CFX A;  3H0G J;  5LGN A;  5AW4 B;  2COB A;  4WXD A;  1U7M A;  2L5G B;  2G7H A;  3CCM P;  3WU0 A;  1LPQ A;  4X0G A;  2AQF A;  2FSW A;  2IGN A;  1ZR4 A;  3WFJ A;  1RY3 A;  4LB5 A;  1IAW A;  2BZT A;  3V42 A;  5KAF C;  5EEA A;  1BL0 A;  2DMQ A;  1OCO H;  2W90 A;  4MLO A;  3MVP A;  5CVI A;  5F1J A;  4A5M A;  3ZW9 A;  1EC5 A;  1ZGA A;  2UZK A;  2K88 A;  1FJL A;  2FYU K;  3S3N A;  2CWE A;  1J1D B;  1Z9C A;  4ABZ A;  3G3Z A;  2RN7 A;  1KQL A;  3VP8 A;  2H09 A;  4LG0 A;  4XLF A;  1PPJ D;  2XZR A;  3JW4 A;  1VF5 C;  1T0F C;  5JHF A;  1HW1 A;  1I6X A;  3U1K A;  5EGO B;  1J1E B;  1JTY A;  4NPD A;  2FYN C;  1JUN A;  3FWN A;  2K9J A;  2VQG A;  4CDG A;  4XKC A;  3ZQ7 A;  1ZGJ A;  4BQN A;  1D5V A;  4LOC A;  2E1M B;  1N7S B;  3R60 A;  4U0W A;  3F6O A;  2LH9 A;  5B3S H;  2RAE A;  3HGG A;  4HX8 A;  3L75 G;  1T2K C;  1VZ0 A;  1TZL A;  1X1P A;  2WAF A;  1VQN I;  3ZHB A;  4RB2 C;  1VF9 A;  3SFI A;  1BDD A;  3CME I;  1HVV A;  1KN7 A;  2NZ2 A;  3CX5 I;  4IQ4 A;  3FXL A;  2KDO A;  3GO5 A;  4D6T G;  1YS6 A;  2DDB A;  1VQ7 I;  1X1B A;  3M8E A;  3ZGY A;  4H0L B;  2HYJ A;  2W57 A;  2DTZ A;  4G94 A;  4V2G A;  4C30 A;  2ZCW A;  1L3L A;  1IFP A;  2RH0 A;  3ZMU A;  1SQP G;  1SFC A;  2FA5 A;  3RK2 D;  1LTG C;  4QWQ A;  4IL6 X;  5C39 A;  3K4M A;  2E75 B;  1AKH A;  2ID6 A;  2KJB A;  2ME6 A;  1DLI A;  4NUB A;  4CA0 A;  4A5N A;  5KAI E;  3GHG C;  3H1K G;  5E79 E;  4BDZ A;  1DD4 A;  1NAF A;  2KFD A;  4OU0 A;  1Q1V A;  4R4L A;  1K7A A;  2DT7 B;  3H1L J;  3II6 A;  3P8C E;  1YBK A;  3CCV P;  3A02 A;  1R5I D;  1SEU A;  4D6T E;  3OR1 C;  3ADO A;  1FAV A;  3SEQ A;  1H89 A;  1HUC A;  3G71 P;  2BE5 F;  2DU9 A;  4MQ9 F;  1UHS A;  1SQP E;  2GM4 A;  4I7Z B;  4PK4 A;  2VN2 A;  1Y8A A;  3PRJ A;  3TGU D;  1WHU A;  1VPD A;  1YW7 A;  3JCU H;  4PZD A;  4C2T A;  2R7R A;  3HIF A;  4WWC A;  3QPT A;  2LBF A;  4ZYD A;  1MJA A;  1GV2 A;  1TWF J;  2OJE D;  4Y99 B;  1GL2 B;  1FIP A;  2EIM H;  2JN6 A;  5E8I A;  1AJY A;  2WAE A;  2JEE A;  1YIJ P;  3MKW B;  2LY1 A;  3IKV A;  3N05 A;  1ZYR F;  3W3C A;  2XRO A;  1PV3 A;  2ZT9 D;  4EV0 A;  2WY7 Q;  1Z0X A;  2O03 A;  3CMY A;  1IG7 A;  1LTB C;  2BYV E;  3W6K B;  2Z9O A;  2CFO A;  4NHJ A;  2HWV A;  1YJN P;  3H1H J;  2IDB A;  3T5X A;  3PIP F;  3H9J A;  1KQ0 A;  4CCK A;  3JCU C;  3OYK A;  1Z56 A;  1E3H A;  5CKT A;  3DPU A;  4BE1 A;  2R7S A;  3L71 G;  4UB8 E;  3CX5 H;  1GUU A;  2PFB A;  5H2F E;  2W00 A;  2M1B A;  4M3E A;  3V2P A;  2R7Z J;  3VOD A;  1FOK A;  3KP3 A;  2KIS A;  3AG4 H;  1X79 B;  3H9G A;  3OYE A;  3BJ6 A;  1A02 F;  2MC4 A;  3ABK H;  3S1M J;  1M56 D;  2LDU A;  3K96 A;  3A0B E;  2LK2 A;  3IL2 A;  3JSP A;  2XF6 A;  4FX0 A;  3MOG A;  4KJM A;  3FIW A;  4HNU A;  3CC2 I;  2JP3 A;  4MFE A;  4RGX A;  2VI6 A;  3RKX A;  3PIO F;  1KFN A;  4JOM A;  1L0N G;  1BI2 A;  3L71 E;  4IO9 F;  5ICG A;  2W27 A;  3ADP A;  2DYR H;  4AD9 A;  2PMZ N;  1SD6 A;  3F72 A;  2N1T B;  3CCU P;  2C9N Y;  2V6C A;  4YPC A;  1U9O A;  4EM0 B;  1BC8 C;  5FGM A;  3TNU A;  1Q7Y Q;  1YRN A;  4XLN F;  2FXP A;  2XUB A;  2KIF A;  2VXD A;  4D5C A;  3VYU B;  1I36 A;  3AKZ A;  1KYO I;  4BUP A;  1LQ1 A;  3DPL C;  2I1K A;  1TLH B;  2HQA A;  4WWI A;  1TW3 A;  2WIT A;  3MGN A;  3AE8 C;  4LG0 B;  3ZXS A;  2XGD A;  2UV1 A;  3ABV C;  1Z82 A;  1FC3 A;  2P10 A;  1FEX A;  1Y9B A;  1H88 A;  3M1C A;  4C3I J;  3CUO A;  4UVB A;  5DS9 A;  3BCA A;  1YVE I;  2PN6 A;  5HS7 A;  3GTL J;  5CVU A;  1KYO E;  1L0N E;  2K9J B;  1NU1 J;  3H1L D;  2ADU A;  2Y75 A;  2R7W A;  3OYI A;  2IYP A;  5AW5 B;  4RLQ A;  3JRA A;  2EA2 A;  1A35 A;  3QWO C;  2K85 A;  1UB9 A;  2L7K A;  2JA8 J;  1YW9 A;  5KLV G;  3DEE A;  2X6Y A;  4B47 A;  3WE3 A;  1SVO A;  4XR6 A;  3WTV C;  5KJ7 A;  5K7H A;  3DP7 A;  4E7L A;  4A6D A;  5F0H A;  1NHL A;  1O3S A;  2K3R A;  1J09 A;  2XVC A;  1AVO A;  1W2E A;  4A3K J;  3CUQ C;  4M73 A;  3CME P;  1Q86 Q;  1XB4 A;  2ZXW H;  3NFQ A;  3VSK A;  1AKH B;  2Z1D A;  5H6Q A;  4ZDP A;  1IFD A;  4C2M J;  1O57 A;  3M9H A;  3M91 A;  1BSH A;  1QGK B;  2KZG A;  3H1H D;  1YS7 A;  1KYZ A;  3P5J A;  2DN0 A;  3QPL A;  3F8M A;  1TNT A;  3NAR A;  5KLV E;  1WPQ A;  1G3T A;  2GA1 A;  4KIT B;  3G1L A;  3JRD A;  3KP2 A;  3RK3 E;  3OSG A;  2IPP A;  2KDZ A;  1X58 A;  1JKO C;  1LTJ C;  2JKV A;  4IVN A;  1F12 A;  1EDI A;  2XAS A;  1RE3 A;  5CCH C;  1LVA A;  1FYK A;  2QEX I;  4MTD A;  2CS3 A;  2XPW A;  3IHU A;  2QRX A;  4NPE A;  2QM7 A;  1JMB A;  1Z77 A;  3DKY A;  1SQX K;  1MBH A;  3S2D J;  3CWB J;  2P0W A;  3P9K A;  1SMY F;  3OYN A;  1L2P A;  3D6Z A;  2PLY A;  2LBF B;  2D1H A;  3E5X A;  1B1B A;  4BAC A;  1LTS C;  5AW7 B;  1M90 Q;  2Y0E A;  3SDG A;  5TJH A;  3WTT C;  4OVN F;  2ISY A;  2OV7 A;  4PGH A;  1VQ6 I;  1SVM A;  4LIV A;  1JKQ C;  4PD4 I;  3P9I A;  5EG0 A;  1GTW A;  2NS8 A;  1SC7 A;  3TDU C;  2HYN A;  2ETH A;  3IAS 2;  1RZ4 A;  3KEY A;  4KUG A;  4PUS A;  2YO3 A;  2H8R A;  2FEZ A;  3PQJ A;  3DXJ F;  5D5X B;  5DCF A;  5BOX A;  3F6V A;  4FE4 A;  2JT1 A;  5HVQ C;  3HOW J;  3GTG J;  2WPS A;  3GTJ J;  2QQA A;  2WB1 N;  4KYW A;  4PD4 E;  1NTK J;  3PLN A;  3ML6 A;  4AWX B;  2M3B A;  5KKZ B;  2E1O A;  3DBH B;  2ZO4 A;  1IZ1 A;  2ZJ2 A;  1BR1 A;  3OBB A;  1J2X A;  4E7K A;  1U57 A;  4MTE A;  2H8P D;  3HD7 A;  1FZP B;  2I8D A;  5CJ0 A;  5L3G A;  1TT5 B;  2F5D A;  1WPK A;  4KN4 X;  4Z6Y A;  3E5Q A;  1Z7L A;  2RDP A;  5HWS A;  1P4W A;  1NU1 D;  1Z6T A;  1QGP A;  2N8G A;  4BHP A;  3RK2 B;  4WK8 F;  1R5S A;  4G12 A;  2ACJ A;  2GXG A;  4NDL A;  1T33 A;  3B6C A;  4M9Z A;  1RKW A;  3GLX A;  3BC8 A;  3HSF A;  4B09 A;  1DU6 A;  3O8Z A;  3L74 G;  5JLX A;  3GTQ J;  3GF2 A;  4EAT A;  1SFO J;  3CTA A;  3V8L A;  1O3Q A;  4BWN A;  2KIM A;  4JX6 A;  1KU3 A;  5CPR B;  5E3O A;  3I83 A;  2E76 D;  1YIT P;  1S72 P;  1DIP A;  5C4X J;  2VOP A;  2XKO A;  5D5W B;  3CCR I;  2CV0 A;  1S29 A;  1IC2 A;  4JBZ A;  1IDZ A;  4QTR A;  1HQC A;  3CCS P;  1YHQ P;  2L5Q A;  1LJ9 A;  2EIL H;  2YR2 A;  2DBB A;  1BG6 A;  1P9Q C;  1YW8 A;  4ASW A;  3KET A;  2FBH A;  4JP0 A;  3RSN A;  3V2Q A;  2W25 A;  3GFJ A;  3TNU B;  2VON A;  2VJ5 A;  1YRN B;  1EQ7 A;  2M2E A;  1P7I A;  3RL0 D;  4UB6 E;  4EOT A;  1QBJ A;  2EV5 A;  1OCP A;  1W5S A;  3BZ6 A;  3LSH A;  5AW9 B;  1OCR H;  1URQ A;  1SQV G;  2MC3 A;  3PUB A;  3L2V A;  4AYC A;  2HDD A;  4LK1 F;  2F5C A;  2QSF X;  3UR3 C;  3L74 E;  2WY8 Q;  4IHS A;  4EJT A;  4O9B A;  1HGZ A;  4DYQ A;  2BAS A;  1JHH A;  1KTM A;  3PH0 A;  1IRF A;  1N73 B;  3I54 A;  4BJT A;  2R7X A;  4M9X A;  3RL0 g;  3FZV A;  2LP0 A;  1KQ8 A;  5GTH H;  4CCL A;  2E2J J;  1ETQ A;  2P5L C;  3A2A A;  4BXU A;  1M1J A;  2J58 A;  2B0L A;  2X51 A;  4BAY A;  4ESF A;  3C2G A;  2A6E F;  5KK1 A;  4H44 C;  2LF7 A;  3CWB D;  2M4K A;  2E74 C;  1XMK A;  2KT0 A;  3QH9 A;  4IFD K;  3S9O A;  1JGG A;  1FYM A;  1FWZ A;  2O5R A;  1EZV G;  2DW4 A;  1KQ9 A;  3DBL B;  3FBN B;  1SQV E;  2UWJ E;  4NBQ A;  2K02 A;  5LFA A;  3ZN0 A;  3EFF K;  4YFN F;  5GAD J;  2F6C A;  3A2K A;  3EQ2 A;  3OS0 A;  2RMZ A;  1D1B A;  2FQ3 A;  1S5L E;  5B66 E;  2G9W A;  1OCZ H;  1T2K D;  1NTZ J;  4QPO A;  2DXI A;  2IFN A;  3Q3C A;  4M9S A;  1OIS A;  2NPS D;  2G8Y A;  2JZY A;  1A31 A;  2DA7 A;  2ISZ A;  5DDG A;  3BRV B;  2W84 A;  3C7A A;  3HEF A;  4A93 J;  5EDN A;  1EZV I;  2YX7 A;  1OYY A;  3KHU A;  4WY4 A;  2JK3 A;  3HUS A;  4OIQ F;  3UKG A;  1NTK D;  3FIS A;  4A7P A;  2HZT A;  4Y3O A;  3R0J A;  1FMW A;  4RM3 A;  1OYI A;  3L70 E;  2LC2 A;  4CCN A;  3NEU A;  4BJ6 C;  1EZV E;  3LIE A;  4FQG A;  4M72 A;  1FE6 A;  2QSG X;  2ZYG A;  3HTK A;  1ZOY C;  3KPE A;  3TK1 A;  1WI3 A;  3HTS B;  3G9R A;  1HF9 A;  3RI4 A;  1XD7 A;  3H3Z A;  3V7C A;  4BQO A;  5BPI A;  3WS7 A;  2GOX B;  1ZLL A;  4GT1 A;  2CQX A;  2Z5U A;  2WSE J;  1MFT A;  3PSF A;  3FF5 A;  5L3B A;  1IK7 A;  2EZI A;  4UV8 A;  2CQN A;  2WPR A;  1K61 A;  1QVG O;  4PV1 D;  3SQN A;  3DU5 A;  3KYD B;  4JK1 X;  4EJV A;  1JGS A;  3ZMS A;  2VOO A;  3BTC A;  2KXP B;  5B1B H;  5FWN A;  3RJP A;  2V7Q H;  3ZW8 A;  1P4A A;  4K3A A;  3J80 K;  4PZC A;  5EG0 B;  2UXN A;  2HDH A;  3DLA A;  3U1C A;  2KMU A;  3W2W A;  4HKZ H;  4ZTF A;  1K05 A;  3BQZ A;  2R7F A;  3M07 A;  4M3B A;  3S2W A;  1Y39 A;  3ZQL A;  2K4B A;  1M66 A;  1XS9 A;  1UCR A;  3E3V A;  2FBK A;  4AID A;  1D1C A;  2HDW A;  2Y9Y A;  2VPL A;  3K6J A;  1JB0 J;  2HFH A;  1FDI A;  1KOR A;  4ASV A;  2A06 D;  1TWA J;  2ELJ A;  4E4H A;  4HG2 A;  1L4A D;  2D3T A;  3HD7 B;  1B6A A;  4KDP A;  1TQP A;  2A05 A;  1XG1 A;  3MHV A;  1FJK A;  1NG6 A;  1GW3 A;  1JUP A;  1EV7 A;  1XGM A;  1NTM J;  4HPQ A;  2WWW A;  1J0R A;  2GWR A;  2ZJP F;  2IX7 C;  3MAJ A;  4LGD E;  1BDC A;  1TWH J;  1S4X A;  4FX4 A;  4PJ0 H;  1R9T J;  1EH7 A;  1W1W E;  3J80 Z;  4D3D A;  4I2L C;  3C9I A;  3CCQ P;  1VQO P;  2COM A;  4RS8 A;  3BTL A;  4KUM A;  4L5I A;  4XN0 A;  4C3H J;  2R3C A;  1IRZ A;  3DBR B;  2I1J A;  4F92 B;  2R0Q C;  1R6R A;  5KCM A;  3S1N J;  2RGV A;  1Y1V J;  3WGI A;  1BI1 A;  4BY7 J;  4HNT A;  2BOL A;  2DK5 A;  2VPR A;  3IP4 B;  4LLG F;  2HKX A;  4F52 A;  2GXB A;  4Y4R A;  1IN4 A;  3W6U A;  1ZXG A;  1NTZ D;  3L9F A;  1IXS B;  1HC8 A;  1RPW A;  4PJ0 C;  3D5R C;  3CXH I;  2H1K A;  1T2K A;  1URQ B;  2CUE A;  2N9B A;  3HKZ N;  3WU2 E;  4EDF A;  2YPR A;  2OC6 A;  2P2U A;  3MN2 A;  1JJ8 C;  1YO5 C;  2V6E A;  1T56 A;  4BJ5 C;  2LSO A;  3GLL A;  3HG9 A;  5TRD A;  1N25 A;  3CXH E;  1MMG A;  1KIL C;  1OLT A;  2JA6 J;  4KJZ A;  2WTB A;  5B5E H;  3H0D A;  1U8R A;  2BY3 A;  2ZT9 C;  3LSM A;  3LAP A;  2K5C A;  1IN8 A;  3RPU D;  4B43 A;  3NWT A;  5IPA A;  1M1J B;  5GTI H;  4IZZ A;  2RV8 A;  2QYO A;  4U88 A;  3E6C C;  4I76 A;  4OQZ A;  3JRC A;  3CC4 I;  2FNP A;  1AQ5 A;  2Z4E A;  3Q0V A;  1N73 A;  2Y48 A;  3DF8 A;  1JOC A;  1L4A A;  1UFM A;  2PFX A;  3A0H H;  2OTJ P;  3FWL A;  3NQO A;  1AWC A;  4Z1M H;  2XGE A;  4ZZL A;  3WUV A;  4CO8 A;  3V6I A;  1N7S D;  3WG7 H;  1LT9 A;  2OBP A;  5B5E C;  3WTU C;  5MGB A;  1OW6 A;  1NOH A;  3V4W A;  4M6V A;  5GTI C;  3VP9 A;  2K4J A;  3IRR A;  1NH3 A;  4BEH B;  2P67 A;  3AEF C;  1XCB A;  2ZBK A;  5FFZ A;  2EV6 A;  3EWK A;  4WY4 B;  3HUS B;  2TDX A;  5A2Q K;  1EXJ A;  4PJM A;  2HOE A;  4E6K G;  3OYJ A;  1YJ9 P;  4M3G A;  4U7D A;  4H0L D;  3FBI B;  1SQP D;  2ZME C;  2CUF A;  3G6E I;  3H1J J;  3HTK B;  4H13 B;  3SWK A;  2EPF A;  2XF5 A;  1ONV A;  2E75 D;  4F55 A;  4CYD A;  1FS0 E;  4B3H A;  2GUS A;  1STZ A;  5JI6 A;  5HLH A;  1FZB A;  2XAF A;  3A1Y A;  3DEW A;  3HPH A;  1NTM D;  1S2E A;  1BE3 G;  5CCG D;  4X1E A;  1FOW A;  4HYE A;  3E7L A;  2P5K A;  3ZR8 X;  2VE8 A;  1SVL A;  4MFD A;  1ZP0 C;  2Q0O A;  2XPV A;  3LSK A;  2E1C A;  1WDK A;  4CIC A;  5ILU A;  2K1A A;  1JUM A;  3RQ4 A;  4DBQ A;  1R7J A;  4BXL A;  2E1N A;  4GDO A;  4AIH A;  3JRG A;  1TTY A;  2ZSI B;  2ITA A;  1Z1D A;  4A0X A;  4LMY A;  3S1K A;  2FNA A;  1IK9 A;  1BR2 A;  5H6R A;  5KLV J;  2EIK H;  1H0T B;  2DFH A;  3HBL A;  3LA3 A;  2W7N A;  2QQB A;  3RPU A;  2PG4 A;  1NU1 K;  2KIQ A;  3L2C A;  2XB0 X;  3LL7 A;  1GL2 D;  1BE3 E;  2FYZ A;  2ZC2 A;  4A3J J;  3ONQ A;  3CCJ I;  1B8I A;  4BQA A;  2VBZ A;  2A07 F;  4KNY A;  4E70 A;  3J7A O;  2L01 A;  4BU2 A;  2WAD A;  2IS6 A;  2HLO A;  3FXM A;  4RES B;  5HNH A;  4HOB A;  5DUK A;  5DV5 A;  3REO A;  4AIJ A;  4IHT A;  3G1M A;  5F27 A;  4JF7 A;  4N78 E;  1IN6 A;  2NVU B;  3RBX A;  3ZMZ A;  4H0E A;  5AW1 B;  3CP2 A;  1MBG A;  3VYR B;  3B5N C;  2EJR A;  3QWL A;  1F0Y A;  1WFX A;  2Y31 A;  1IUF A;  3DTE A;  4Y13 A;  4GDF A;  4JQ0 D;  1K79 A;  4HW0 A;  1H9T A;  4U3F G;  2O01 J;  5L3F A;  3BG7 A;  1IFN A;  1RKT A;  2D2W A;  4IRH A;  1MZ9 A;  1ZLK A;  1VF5 B;  2W82 A;  3MQ0 A;  5BNG A;  1PZQ A;  1WVR A;  1NK3 P;  1G1I A;  1WP4 A;  2HXO A;  4RGU A;  2EH3 A;  1Z3X A;  1A02 J;  5LLQ A;  3GFM A;  2MD5 A;  2A3S A;  4HLX A;  2G3A A;  2DMU A;  4RLF A;  2M45 A;  4RAZ A;  1TWG J;  1A36 A;  1MSE C;  1XGS A;  4P9U A;  1RE4 A;  1KYO D;  3VN0 A;  2P7J A;  4DT0 A;  3L72 G;  3F8B A;  4RKU J;  4N4O B;  1ZG3 A;  4U3F E;  4BNC A;  4XFJ A;  3V7S A;  1O7L A;  5AVY B;  1E17 A;  3S17 J;  3GF3 A;  2YU9 J;  2MYS A;  2N1T D;  1D0X A;  4C7N A;  4L9T A;  5TIS H;  3ZQQ A;  3H1J D;  2CVZ A;  2QJP B;  2NVQ J;  3OL3 A;  3OWT A;  4I7H A;  2V9V A;  2FXO A;  1ETV A;  4HST A;  3OMY A;  1VDF A;  3BCC G;  3D1N I;  3GMA A;  2E5Y A;  3IWF A;  2HEO A;  2IBZ G;  4LK0 F;  2ZJQ F;  3PNY A;  4OM8 A;  2HTJ A;  5L3C A;  1K78 A;  3OYF A;  1KB9 I;  2KS1 A;  2PQ8 A;  4L76 A;  5AVV B;  1QVU A;  1PDN C;  3L72 E;  4GFB A;  2NNY A;  3HB9 A;  1NTK K;  3RZO J;  2MKV A;  3GW6 A;  2L9N A;  4DZJ A;  1P7J A;  1LT9 B;  3LFU A;  3KX2 A;  3EYI A;  1Y1W J;  5FFX A;  5TIS C;  1O3T A;  3Q5P A;  4L75 A;  5APV A;  1LKX A;  2VB6 A;  2I9P A;  1ON2 A;  2DJN A;  4HX7 A;  3L2R A;  3SJM A;  1BC7 C;  5KLV D;  4ZNC A;  3TDZ C;  1SQB G;  1HKT A;  1WH5 A;  4A3E J;  1E79 H;  3KLN A;  1JY3 P;  3ULQ B;  3DTI A;  1RF0 A;  2R3S A;  3BCC E;  1YQA A;  1HLV A;  4YFK F;  1KU9 A;  1QHH D;  4HSR A;  2HDC A;  2Y0C A;  2IBZ E;  4Y52 J;  3L37 A;  3Q3S A;  2CQQ A;  4BYY A;  3EUH C;  5M3M J;  2E76 C;  1X1C A;  5KAF H;  2L7F P;  4HQM A;  3DKW A;  2WPQ A;  1VQ9 I;  3NRV A;  3PNT A;  1XTG B;  4PZE A;  3S16 J;  4TT3 H;  2L4M A;  3ZN1 A;  3BAT A;  2M3A A;  1SQV J;  3OSF A;  2IS4 A;  1UHW A;  1G2C A;  1BR4 A;  4RAG A;  4EI2 A;  1YI2 I;  1PL5 A;  3L2W A;  3E6B A;  2IRF G;  1PFI A;  1X4O A;  4XN3 A;  4QLC U;  1YRL A;  3WHB A;  2FBW C;  1G3W A;  2MW8 A;  1IXC A;  1BCC G;  2CU7 A;  3HRS A;  4NQW A;  1JY3 O;  4IHX A;  1FSH A;  1SQB E;  2N9Y B;  1XPX A;  3CC7 I;  1GK6 A;  1OCC H;  4WX9 A;  1ZRF A;  3CMM A;  3CO7 C;  3L2Q A;  5J4V A;  1EDL A;  2CW0 F;  3FWE A;  1RUO A;  2XKM A;  1DQU A;  1QU3 A;  2E71 A;  4KIG A;  2DK8 A;  2WTE A;  1LB2 A;  2M4G A;  1LEA A;  2WWY A;  1TBX A;  2JRM A;  2ZB9 A;  1YFH A;  1YE9 A;  1Y0U A;  2HGC A;  3J7Y J;  1EVY A;  1ZV8 A;  4PD4 D;  1VQ5 P;  1OWA A;  2PRR A;  1MMA A;  3L70 J;  1FOS F;  2DA2 A;  3IAM 2;  4D3S A;  3TP3 A;  1VQK P;  2STT A;  4KUE A;  1YYV A;  2QA4 I;  2CK3 H;  1KB9 H;  1B8I B;  4K35 A;  2NYX A;  4DZO A;  2FFD A;  1X0V A;  1OVR A;  3JCU E;  2BY1 A;  4DQ2 A;  2M34 A;  1ENH A;  2QZ8 A;  3BPV A;  5CVV A;  4Q47 A;  4D0P A;  4E7Z A;  5LHI A;  2UXX A;  1W5C C;  3U9G A;  1TQI A;  1R58 A;  2FY8 A;  4XKB A;  2AEF A;  1T39 A;  1BBY A;  1PP9 G;  3GF7 A;  3GXO A;  3VYT B;  1GW4 A;  2NPS C;  4XSX F;  1NTZ K;  3PP5 A;  5ED4 A;  2K9S A;  4XM3 A;  4J01 A;  2H7H A;  2F4I A;  1A6Q A;  2W83 C;  3NTN A;  4B44 A;  2FD5 A;  2WB1 A;  4EGY A;  1ON1 A;  2HPM A;  1MND A;  2KZI A;  3TO6 A;  3NMD A;  1FZC C;  3MKZ A;  3FHZ A;  2WSC J;  3CX5 E;  2OYH C;  4LG3 A;  1TWC J;  1XSV A;  4R8H A;  2JR8 A;  5JHU A;  1R49 A;  3G0O A;  1FNN A;  4XIC A;  5BVZ A;  5EZH A;  3L74 D;  1S9H A;  3S93 A;  2XU6 A;  1FZG A;  1VQ8 I;  3BVH A;  3GLM A;  1PP9 E;  1VQ4 I;  3PID A;  2OYI A;  4P96 A;  1R5H A;  2K9L A;  3CCJ P;  3L75 E;  4BXX J;  5APY A;  3AL0 B;  1WJB A;  3HM5 A;  3KE2 A;  4F93 B;  4I0A A;  4PV1 C;  2OF7 A;  1T8I A;  3VSL A;  2L9R A;  3GBG A;  4YEJ A;  4ENM A;  1EVZ A;  1VQM P;  1XTA A;  4C7N B;  5A9R A;  4F7Z A;  5E18 F;  3L2U A;  3HL2 A;  3PQK A;  4MO7 A;  2YKQ A;  3KXD A;  2MSY A;  4M6Y A;  4D7N A;  3U21 A;  2E7X A;  2VE9 A;  1SQV D;  1YYC A;  1ZRE A;  2W48 A;  4AIK A;  2WVR A;  1TQM A;  1X3U A;  5AVZ B;  1XGN A;  5JFR A;  1JY2 P;  1IZN B;  2NS0 A;  4S05 A;  2GF2 A;  1BGY G;  1K78 B;  1R1V A;  2VKH A;  2KS1 B;  2HKO A;  2DFF A;  2ECC A;  2DCE A;  3WGH A;  1KZU B;  5IT9 K;  3H1K E;  1G3Y A;  3SSU A;  1ZN2 A;  4CPG A;  4YIF A;  1FZF A;  2JRT A;  3ELK A;  1I1S A;  1ZRC A;  1SQP K;  5APW A;  3R4Y A;  2CG4 A;  2E5N A;  2VOD A;  4ZC3 A;  4L5J A;  4FET A;  3QPH A;  4HEA 2;  2WAQ N;  2XDJ A;  3CJN A;  1DH3 A;  3DPT A;  2QJK B;  1OKR A;  1M75 A;  3L70 D;  1Y8R B;  1REP C;  3BG3 A;  1MUU A;  2IAI A;  1NTM K;  1T3J A;  3JC2 2;  5KJ7 D;  4LC1 A;  2Q3I A;  2BV6 A;  3A3Y B;  2CV2 A;  2E60 A;  4DYD A;  3PFY A;  4HAM A;  2DOA A;  5AVX B;  2BY0 A;  3I4N J;  2K37 A;  1OVV A;  3CO6 C;  1OQY A;  1L0L G;  4KIF A;  4M71 A;  5FKO A;  3GUD A;  2BEZ F;  3BQY A;  3G73 A;  3GFI A;  3CF5 F;  1BW6 A;  1HTL C;  1P6R A;  4B86 A;  3BOQ A;  1K83 J;  2E43 A;  2E2H J;  1HJ0 A;  2FU4 A;  3WTS C;  5IT9 Z;  1G2C B;  4NC6 A;  4KIS A;  2XF7 A;  1YX3 A;  1SFX A;  1YX5 A;  2ID3 A;  3H5R A;  1QA6 A;  3B5N A;  1J5Y A;  2Z3Y A;  3BG9 A;  5M5X J;  4A3I J;  4NQW B;  1R71 A;  2WSE H;  3WTW C;  1RES A;  4UVA A;  5D4R A;  1FBM A;  2W85 A;  3T8R A;  1G2H A;  3LOC A;  2MJZ A;  1FOS E;  1FDM A;  2XV4 S;  3ZWC A;  1LTI C;  2LRD A;  3GYH X;  3AEC C;  1XMA A;  2QKM B;  2EFQ A;  2HXI A;  4BHC A;  5APQ A;  4ZYA A;  1VQP P;  1L0L E;  3HXL A;  5FRN A;  1MGT A;  2WBM A;  3VEP A;  3JAM Z;  5E1X A;  2L54 A;  2V1X A;  4DJG A;  1Y6I A;  3MZ8 A;  2YKP A;  4D3F A;  3E6D A;  2JWT A;  3S3M A;  1J1D C;  1ZME C;  4BXF A;  3OIO A;  5DJT B;  4C9Y A;  2VL8 A;  3RGU A;  1IJW C;  1WJD A;  2FFD B;  3CDL A;  3KP4 A;  3TYY A;  2MA3 A;  2K40 A;  1J1E C;  1WQ2 A;  5F08 A;  3CKY A;  2KI7 B;  2VRS A;  5TJJ A;  3AE9 C;  3CLQ A;  1RI7 A;  3ZWA A;  1BW5 A;  1R5G A;  2DA3 A;  1BM9 A;  2VQC A;  2P81 A;  4UV9 A;  3H35 A;  2K3F A;  1FBU A;  4YIR X;  1N7S C;  2P58 A;  3QP5 A;  1EH6 A;  5C4J J;  3H1I G;  4WVZ A;  5E79 C;  3TW6 A;  3ZPL A;  4V19 K;  4WXH A;  3ZQF A;  2NNN A;  1ZH5 A;  1BI0 A;  3PJG A;  4GKG A;  3RK3 B;  3GW2 A;  5J47 A;  1CZQ A;  5J1R A;  2ZXX A;  3AEG C;  5AON A;  3HD7 D;  1BJA A;  4EJW A;  2FQ4 A;  1RR8 C;  1P84 I;  1F17 A;  2Q6Q A;  2EV0 A;  4H0L C;  2JWD A;  4I99 C;  3G4S I;  2DI3 A;  5J40 A;  1WKM A;  4J19 A;  1KIL A;  3K4K A;  3D1L A;  1BE3 J;  2OAR A;  1K8A Q;  3C2H A;  1HKQ A;  3ISP A;  3CI9 A;  2NVY J;  2BVM A;  2DMT A;  1SQQ J;  2E75 C;  3MUD A;  3K4L A;  2IGK A;  1IUY A;  3L73 G;  3M7G A;  4CGZ A;  2EFP A;  2OYI B;  3ROU A;  4A69 C;  3L4F A;  3K10 A;  4UVC A;  3CXH D;  3H1I E;  2AHQ A;  4C2U A;  1LSO A;  5CCG C;  3IR9 A;  1RF1 A;  2XC7 A;  3H92 A;  2RQQ A;  4G7H F;  3RTR A;  1NK2 P;  3PEF A;  2A45 I;  4KIB A;  4BS9 A;  2E19 A;  2K9N A;  5IOY A;  5EJC A;  1WCM J;  2DA1 A;  4L5E A;  4UUV A;  3AAF A;  1PGN A;  2F2E A;  3AG2 H;  2HI3 A;  3RQI A;  2MH9 A;  2XHK A;  4I7Z C;  1VQN P;  1QO0 D;  1WJC A;  2R5Y A;  5FKL A;  4UB8 C;  3BJO A;  3W6V A;  1U8B A;  2LY2 A;  1G1J A;  1URQ D;  4KHX A;  3EUA A;  3F21 A;  2KNC A;  5KLV K;  3IH4 A;  2JUG A;  2EA4 A;  3L73 E;  3T1B A;  3COA C;  2LMD A;  3BP8 A;  3H25 A;  1I5Z A;  4Y99 C;  2WSS H;  1GL2 C;  3OYD A;  1VQ7 P;  3HKZ A;  1PJR A;  2ZNY A;  2LNB A;  1ZAO A;  1DGR M;  2IYO A;  2QVO A;  5DM7 F;  2FXA A;  2LVS A;  2H8W A;  2ZAE B;  1LNW A;  2M7A A;  3G2B A;  5EZG A;  5L3D A;  3VPR A;  5IP7 J;  4GWK A;  2QEN A;  2B89 A;  5CHX A;  1NAY A;  2OGU A;  4U3F J;  3M9B A;  2V9P A;  4RMN A;  3TQN A;  2CW8 A;  3K2Z A;  4I6M C;  2QCO A;  4NPF X;  1GVD A;  2UUZ A;  4GOD A;  5GTH E;  4XMY A;  1RQV A;  1F14 A;  3QOP A;  4DW6 A;  5K1Y A;  2MLG A;  3FR8 A;  2KPM A;  3WTZ A;  1NVO A;  1D1A A;  3L00 A;  1DX7 A;  1P84 H;  1JKP C;  3PSI A;  1JCD A;  3OYG A;  1DP7 P;  3M0D C;  3H3U A;  3LSG A;  2IEK A;  1YJW I;  3VMZ A;  3DFG A;  2EIJ H;  3Q0W A;  3HSE A;  2M7B A;  2YX4 A;  2GZW A;  4GGG A;  1T98 A;  1HDP A;  4XL9 A;  5IP6 A;  3QYE A;  2O9L A;  2L91 A;  3TO9 A;  5AW8 B;  4WY4 D;  2D2C B;  2F5F A;  1D8J A;  1X3Z B;  3ASO H;  5J1U A;  5DCM A;  1NKN A;  2GIZ A;  3S3O A;  1OVU A;  2QSI A;  3S14 J;  4HB1 A;  4I6Z A;  3E1I A;  4Q4Z F;  3E1R A;  2A45 H;  4S04 A;  3OYL A;  2L9S A;  4H13 D;  5CBN A;  2Z99 A;  3AE6 C;  2CH0 A;  4AC0 A;  2VLA A;  1A5J A;  1JDJ A;  1ORK A;  2A61 A;  1RQU A;  3BCC J;  3BRT B;  1XX5 A;  3L1P A;  1W5T A;  3VMX A;  1BE3 D;  2KRH A;  3H36 A;  3R0A A;  2OFP A;  3F22 A;  4ANJ A;  3ERE D;  4GOF A;  3RKY A;  3KZI H;  3VB2 A;  1T6S A;  3GX4 X;  3K70 D;  1KZH A;  4HX4 A;  2IA2 A;  2IBD A;  4UNO A;  1AOY A;  1IFJ A;  1SQQ D;  2V4J C;  4HV5 A;  3SZT A;  3UIA A;  4II2 A;  1IN7 A;  1U9N A;  2BGC A;  3LA7 A;  5E1Z B;  5BS6 A;  4E7I A;  2YUS A;  1WJF A;  1MMN A;  1LWU A;  2IJL A;  2O6G E;  4G6Q A;  2R5Z A;  1M67 A;  4R4M A;  2JJL A;  2IVM A;  2PJR A;  4EIJ A;  3ECO A;  3JRF A;  2X6X A;  1FT9 A;  1Z6R A;  1SQB J;  3K5B A;  2X1E A;  3S1R J;  2RN0 A;  5FKN A;  2D45 A;  1VQL I;  1RE3 C;  5K5R A;  3ZMD A;  2DPD A;  4A3L J;  1Q82 Q;  4HA8 A;  2O61 A;  4DYR A;  2DA4 A;  3KZI C;  4PSX A;  3L72 J;  2H94 A;  3LST A;  4D7M A;  3CC2 P;  4O5V A;  1XTC C;  5LHG A;  4QSH A;  3CD6 I;  1ZKG A;  5D5U B;  3KP5 A;  4IOA F;  3ULK A;  1YQ3 C;  2P1J A;  5F64 A;  4L9N A;  2M0B A;  2XDV A;  3W68 A;  1A04 A;  2A5Y B;  2ZSH B;  2HQR A;  1W36 D;  1MH4 A;  2QVA A;  4LGW A;  2LF8 A;  3MMY B;  3HJE A;  2G0E A;  3DOJ A;  3BJA A;  2JQ7 A;  1KIL B;  1E3O C;  1SFC C;  3I59 A;  2B9B A;  3U59 A;  4HDU A;  5LHH A;  2IS2 A;  3VYI A;  1U6G A;  3P7K A;  3IWZ A;  1BSN A;  3I58 A;  4U3F D;  1ULY A;  1EJ9 A;  1SFK A;  2HNH A;  2V4H A;  2Y9Z A;  2FOK A;  2DT5 A;  3KYQ A;  4BEH A;  3OAK A;  3VMY A;  1SQV K;  1KD1 Q;  1Z67 A;  3ESW B;  3K1N A;  3KP6 A;  4I2O A;  1ERD A;  3KDP B;  2MD0 A;  4I01 A;  2R7V A;  1RF1 B;  2KIU A;  2JJ7 A;  1VF5 D;  4CCM A;  4UY8 I;  2XGX A;  1IRG A;  3CL3 D;  4PJ0 E;  5EFW B;  1FY7 A;  3F8C A;  3HYI A;  2AQE A;  2XSD C;  5HS9 A;  3PO3 J;  1TP4 A;  2C0X A;  1W0T A;  3I9V 2;  1MMS A;  4E12 A;  1TT0 A;  4YRV A;  1QZE A;  2GOM A;  3NXS A;  1U7J A;  3LAJ A;  4G6D A;  1U5T A;  1DD3 A;  2JMW A;  1KIL E;  3AEA C;  2QG4 A;  4LIU A;  1R22 A;  2LTP A;  1OR7 C;  3FXQ A;  4WCG A;  3PNV A;  2R5Y B;  1O3R A;  3L72 D;  2C0W A;  3TKY A;  2Z33 A;  2KNC B;  1WJ5 A;  2XNX A;  2Y0D A;  1BJZ A;  1WWX A;  3H5N A;  3HGY A;  2E42 A;  1HA8 A;  1LDJ A;  1FX7 A;  1MH3 A;  2O0Y A;  1D8K A;  2OAZ A;  4W1U A;  3SDB A;  3EPZ A;  3WUU A;  1WMK A;  4HF1 A;  5AVR B;  2DQR A; 
#chains in the Genus database with same CATH homology
 1VF9 A;  2DA6 A;  3SFI A;  1ZCJ A;  1ETO A;  3G1M A;  5F27 A;  1MNM C;  4J0F A;  4IM7 A;  2AO9 A;  1CQT A;  3ZGY A;  2HYJ A;  4V2G A;  1MBG A;  2DTZ A;  4E21 A;  1FIA A;  1YB4 A;  1JKR C;  1OFC X;  1F0Y A;  2EZH A;  1IUF A;  2Y31 A;  4JQ0 D;  3F0C A;  2NVT J;  2DMN A;  1PGO A;  2EQR A;  1AKH A;  4CYC A;  2ID6 A;  3HOU J;  2X6O A;  2ME6 A;  1DLI A;  3LSR A;  1RKT A;  1O4X A;  3HOZ J;  1AHD P;  5BNG A;  5C44 J;  3TP0 A;  1NK3 P;  1WP4 A;  2HXO A;  1B72 B;  2EH3 A;  1Q1V A;  3A03 A;  1UMQ A;  2DMU A;  3A02 A;  3I4M J;  1IV6 A;  2PLA A;  3ADO A;  1GDT A;  1TWG J;  1MSE C;  2ELK A;  2XGC A;  4JPZ B;  1UHS A;  2GM4 A;  2LKX A;  1VPD A;  4PZD A;  1B72 A;  2MGQ A;  3FK7 A;  3S17 J;  3BG5 A;  2YU9 J;  1GV2 A;  1TWF J;  1FIP A;  2VKE A;  4MIM A;  2JN6 A;  1ITY A;  5AYV A;  2EBI A;  3EGO A;  2CVZ A;  2NVQ J;  1ETV A;  4JX5 A;  1Z0X A;  1LSJ A;  4UUS B;  3D1N I;  1YJQ A;  3HOV J;  3CMY A;  1IG7 A;  2X48 A;  3QSG A;  3IQD B;  4OM8 A;  2R5Z B;  1H88 C;  2OPT A;  1QVU A;  3BR6 A;  1IL0 A;  3ZQG A;  2TRT A;  4GFB A;  1UG2 A;  4FCY A;  3HB9 A;  3RZO J;  2LD5 A;  4DZJ A;  1GUU A;  4M3F A;  1P7J A;  2W8Z A;  1Y1W J;  4M3E A;  3F3S A;  5E3M A;  3JRH A;  2I9P A;  2R7Z J;  2DJN A;  3BR0 A;  3SJM A;  1HOM A;  4R1N A;  2CRG A;  2O8K A;  2R93 J;  4DYC A;  1POG A;  4OL9 A;  1WH5 A;  5IP9 J;  4A3E J;  1QPI A;  3BR3 A;  4FIS A;  4A3G J;  2HQ5 A;  3S1M J;  1HLV A;  3K96 A;  4Y52 J;  2LK2 A;  3Q3S A;  2CQQ A;  4EEF G;  3MOG A;  5M3M J;  2I10 A;  2XB5 A;  3C7D B;  3FIW A;  2L7F P;  3IH2 A;  4MFE A;  4E13 A;  3HOX J;  2VI6 A;  4PZE A;  3S16 J;  1IDY A;  3OSF A;  3HAD A;  3ADP A;  3MKL A;  1PUF A;  2LR8 A;  2PMZ N;  5EF6 A;  1QRY A;  1U9O A;  1YRL A;  3WHB A;  4EZB A;  2MW8 A;  3C2B A;  1YRN A;  2CU7 A;  4D5C A;  4IHX A;  1I36 A;  4HNV A;  4J0E A;  3FK6 A;  1N1G A;  3HDD A;  5K7Z A;  2ME0 A;  3PM1 A;  4OQY A;  2QYT A;  5HOD A;  2XGD A;  1Z82 A;  1FEX A;  2ZB9 A;  1EVY A;  4C3I J;  4GBJ A;  5DS9 A;  1VND A;  1YVE I;  3GTL J;  1I6H J;  3LSJ A;  2DA2 A;  2IYP A;  4D3S A;  3TP3 A;  3JRA A;  4KUE A;  1H89 C;  3BR2 A;  1N1E A;  1X2M A;  1B8I B;  2JA8 J;  1X0V A;  2EZK A;  2M34 A;  1ENH A;  1JT6 A;  3GTK J;  5K7H A;  4B3I A;  1JTX A;  5F0H A;  5M3F J;  1FTT A;  3C7C B;  3QQA A;  5IYC J;  4A3K J;  4BBR J;  2K9S A;  1AU7 A;  1AKH B;  4CYC B;  4C2M J;  3H2Z A;  2FD5 A;  2GBY A;  3DCF A;  3FR7 A;  5E3N A;  2Y0S N;  2DN0 A;  3QPL A;  3NAR A;  1ETY A;  3RZD J;  1A6I A;  2X9D A;  5E3L A;  5GPA A;  1WPQ A;  1WDL A;  4DLL A;  3S2H J;  3A01 A;  3G1L A;  3JRD A;  1TWC J;  3OSG A;  2KDZ A;  1X58 A;  1JKO C;  4RDU A;  3G0O A;  1M76 A;  4XIC A;  2QF7 A;  2JKV A;  2R92 J;  1F12 A;  5EZH A;  1TXG A;  2XPW A;  3PID A;  3RKQ A;  3PO2 J;  1WDM A;  1Z77 A;  3O8G A;  2JA7 J;  1MBH A;  3S2D J;  4BXX J;  3HM5 A;  1ZR2 A;  2OF7 A;  2L9R A;  3GBG A;  1EVZ A;  3OOU A;  4Y7N J;  1MBF A;  1D5Y A;  3SDG A;  5A9R A;  4MO7 A;  4OVN F;  2MSY A;  4D7N A;  1JKQ C;  2YS9 A;  2W48 A;  5EG0 A;  2NS8 A;  2LFB A;  3CCY A;  5FLM J;  4KUG A;  2H8R A;  4FE4 A;  2E2I J;  2VKV A;  2GF2 A;  4BKX A;  2IZ1 A;  3HOW J;  1VI0 A;  3GTG J;  3HDH A;  2ECC A;  3GTJ J;  2WB1 N;  5FKK A;  1MBE A;  2E1O A;  5J1Y A;  1ETX A;  1I50 J;  3OBB A;  3QHA A;  1PGQ A;  2GLO A;  3H3V K;  1PGJ A;  2LY9 A;  5FLV A;  3JRI A;  1NTC A;  2WAQ N;  1GV5 A;  1QVT A;  1WPK A;  1DU0 A;  3TW7 A;  2P4Q A;  5HWS A;  1M75 A;  2ZYD A;  2FX0 A;  2N8G A;  3BG3 A;  2IAI A;  2Y30 A;  4G12 A;  2EZL A;  4NDL A;  1T33 A;  3B6C A;  4IHY A;  1RKW A;  3GTP J;  1DU6 A;  1X0X A;  4DYD A;  2ZYA A;  5JLX A;  3GTQ J;  3I4N J;  2O7O A;  1SFO J;  3CQZ J;  2JA5 J;  5FKO A;  4JX6 A;  1IGN A;  5E3O A;  3I83 A;  3BQY A;  1LE8 A;  3L6D A;  3S1Q J;  2Y2Z A;  5C4X J;  1BW6 A;  1K83 J;  4QTR A;  2E2H J;  1TC3 C;  1IDZ A;  1PUF B;  1BG6 A;  4AUX A;  2ID3 A;  4JP0 A;  1ZTR A;  3K7A J;  3BG9 A;  5M5X J;  4A3I J;  1YRN B;  2M2E A;  1P7I A;  4XRS A;  3GHY A;  1F36 A;  3BR1 A;  1OCP A;  1RES A;  2DMP A;  1G2H A;  3LOC A;  3QPS A;  2FJ1 A;  3ZWC A;  3DFU A;  2HDD A;  1ZK8 A;  2HXI A;  1HF0 A;  4DYQ A;  4V2F A;  1WH7 A;  2K9Q A;  2L7Z A;  2LP0 A;  4FTH A;  2MG4 A;  1SAN A;  5F0C A;  4D3F A;  2E2J J;  2JWT A;  1ETQ A;  3OIO A;  1M2W A;  3BR5 A;  1IJW C;  9ANT A;  3G1O A;  3CDL A;  4IEJ A;  3GTM J;  2DA5 A;  1YON A;  5IYD J;  5A9S A;  2K40 A;  2KT0 A;  4GWG A;  5F08 A;  1JGG A;  3CKY A;  4B3A A;  3ZWA A;  1BW5 A;  2DA3 A;  1U78 A;  3ZQI A;  2HOT A;  3RQS A;  2P81 A;  5C4J J;  3TED A;  3Q3C A;  3TW6 A;  5K7F A;  3ZQF A;  2L7M P;  3PJG A;  5A9T A;  2DA7 A;  1QMG A;  1I3Q J;  5J1R A;  3C7A A;  3HEF A;  4A93 J;  5EDN A;  2FQ4 A;  1MSF C;  2JK3 A;  3B6A A;  1F17 A;  4YCA A;  3UKG A;  1ETW A;  5F04 A;  3FIS A;  4J19 A;  5JLW A;  1OCT C;  3A01 B;  4XK4 A;  3JRB A;  2NVY J;  5DTD A;  2DMT A;  2ZYG A;  1MBJ A;  3K2A A;  1WI3 A;  5GP9 A;  4AYB N;  2VUM J;  4A69 C;  2PGD A;  3ZQH A;  4XID A;  3WS7 A;  2AHQ A;  5EYR A;  1LSO A;  3GTO J;  3Q0U A;  1GT0 C;  2CQX A;  3BT9 A;  3CTV A;  1NK2 P;  4W97 A;  3PEF A;  2EZI A;  3BTI A;  1H8A C;  2E19 A;  1K61 A;  2K9N A;  4C3J J;  5IOY A;  1WCM J;  2DA1 A;  1LFB A;  4L5E A;  3JRE A;  3BTC A;  5FWN A;  3ZHB A;  5JE8 A;  4B1R A;  2HOA A;  1PGN A;  3ZW8 A;  2M8G X;  2HI3 A;  3RQI A;  1DLJ A;  4PZC A;  5EGO A;  5EG0 B;  2R5Y A;  5FKL A;  3W6V A;  1U8B A;  2HDH A;  3W6Z A;  1XC5 A;  1FTZ A;  2TCT A;  3IH4 A;  3BQZ A;  2NS7 A;  4M3B A;  1YJ8 A;  2NVX J;  3ZQL A;  1M66 A;  1XS9 A;  5J3L A;  2Y9Y A;  1HCR A;  2EW2 A;  3K6J A;  2IYO A;  4JX4 A;  2ECB A;  2LVS A;  3HOY J;  5EZG A;  1TWA J;  3VPR A;  5IP7 J;  1KS9 A;  4GWK A;  2D3T A;  4A3B J;  4DCK A;  3ZWB A;  1BA5 A;  2CJJ A;  1XG1 A;  4X6A J;  1JUP A;  2M0C A;  2QCO A;  1GVD A;  1TWH J;  5F0F A;  1F14 A;  4DW6 A;  1R9T J;  3ZQC A;  4A3C J;  1LJ8 A;  3PDU A;  3HN2 A;  3FR8 A;  3O8H A;  4D3D A;  1OJL A;  3LNQ A;  3BTL A;  1JKP C;  4C3H J;  1IRZ A;  1LE8 B;  5IYB J;  3FKI J;  3LSG A;  4XRM A;  2R0Q C;  2IEK A;  1ZGW A;  3S1N J;  1Y1V J;  3WHC A;  3Q0W A;  4BY1 J;  2O9L A;  5IP6 A;  4BY7 J;  1HDP A;  1HDD C;  2VPR A;  3W6U A;  2WV1 A;  3ZOB A;  5M5W J;  5C3E J;  5J1U A;  2NOG A;  4XRS G;  1RPW A;  1S7E A;  4RBO A;  3M3Y J;  2H1K A;  3S14 J;  5FJ8 J;  4I6Z A;  2CUE A;  3NAU A;  3HKZ N;  2X58 A;  1W0U A;  1APL C;  3HWR A;  4AC0 A;  1A5J A;  4M3D A;  3MN2 A;  4QIW N;  1ORK A;  1JJ8 C;  2L0K A;  1JDJ A;  1T56 A;  3L1P A;  1PGP A;  2IZ0 A;  4B3J A;  4S0H B;  3M4O J;  2OFP A;  2JA6 J;  4A3D J;  3IV5 A;  2WTB A;  1EF4 A;  2IBD A;  1ETK A;  5IPA A;  2LLK A;  1U9N A;  4I76 A;  5FKM A;  4UUS A;  2UYY A;  4OQZ A;  2YUS A;  3JRC A;  1X2N A;  5A9S B;  2D5V A;  1M67 A;  4UUT A;  2R5Z A;  4A3F J;  3Q0V A;  3JRF A;  2M9H A;  3S1R J;  2XPU A;  1JUS A;  3S15 J;  1MBK A;  5FKN A;  4FE7 A;  2XGE A;  4A3L J;  3BTJ A;  4DYR A;  2DA4 A;  2XRL A;  4FGW A;  4D7M A;  4D5F A;  5MGB A;  1JT0 A;  4QSH A;  4M6V A;  1ZKG A;  3ULK A;  3PLR A;  1IC8 A;  1WGX A;  5GPC A;  1MH4 A;  3IH3 A;  1RET A;  4S3M A;  5M5Y J;  3WFI A;  2G0E A;  2B63 J;  3DOJ A;  3JR9 A;  4IHW A;  1RR7 A;  3H0G J;  4M3G A;  2COB A;  1E3O C;  2HOS A;  2CUF A;  1VFC A;  4IHV A;  3WFJ A;  1ZR4 A;  2Y9Z A;  3G17 A;  4B3H A;  5EEA A;  1BL0 A;  3DEW A;  2DMQ A;  2W90 A;  4MLO A;  1LFU P;  2JJ7 A;  3MVP A;  4DZP A;  4X1E A;  5F1J A;  3ZW9 A;  3E7L A;  2XSD C;  4MFD A;  1FJL A;  2XPV A;  3PO3 J;  1W0T A;  1WDK A;  4ABZ A;  1JUM A;  4E12 A;  2JMW A;  3JRG A;  4B4C A;  5EGO B;  2LTP A;  2R5Y B;  1JTY A;  3FWN A;  3HBL A;  4A3M J;  1F43 A;  1BJZ A;  3HGY A;  4KUH A;  4JYK A;  5IOZ A;  1JJ6 C;  1MH3 A;  4LOC A;  2XB0 X;  4W1U A;  4BBS J;  1ZQ3 P;  2RAE A;  3HGG A;  4A3J J;  1B8I A;  3LSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...