4D6TG

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4d6tG00
1KB9H 3H1IG 1NTZG 3CX5H 1NTKG 4D6TG 4PD4H 3CWBG 1SQPG 3H1JG 5KLVG 1KYOH 1L0LG 4U3FG 3L70G 1BE3G 1BGYG 1BCCG 3L71G 3TGUG 2IBZG 1PPJG 2FYUG 3H1HG 2BCCG 1SQVG 3BCCG 3L75G 1L0NG 3L73G 1EZVG 3H1LG 1PP9G 1SQXG 1SQBG 3CXHH 1NTMG 3L72G 3H1KG 1NU1G 2A06G 3L74G 1P84H 1SQQG
chains in the Genus database with same CATH superfamily
1LP1A 5AVYB 3V2RA 2KSEA 1MFTA 3E1RA 3L73E 2MJZA 4H44D 3CC7P 1VQ6P 1M8OB 5AW8B 1PGOA 3CL3D 2QJKC 1BE3D 1HGZA 1KILA 5AVZB 1Q86Q 1TU3F 3L75D 4PV1C 2RH0A 4IL6X 2O01J 1DEBA 4IOIH 3CCEP 4H44B 3EFFK 3AE8C 3A7OA 1LWUA 2QRXA 1AQTA 1SS1A 1W2EA 1FZEA 3NFQA 2JEEA 3H6PA 2OYHC 2XKMA 1S1CX 1Q7YQ 1VL2A 2IFMA 1UIIA 1NTMG 3L72J 3P8CE 5DJTB 1EZVE 3D70A 4DOJA 2A06E 3EQ2A 5KJ7C 3L71G 2M8RA 4A7PA 3H1JE 2YIUC 4PJ0E 2KS1A 3CX5I 1XTGB 2WTYA 3KZIH 3C8VA 3VN0A 3CPWO 3FWLA 5CJ4A 3II6A 5AVXB 5APVA 1SQPJ 2LKMA 1LTJB 2FYUJ 1PPJD 3BRVB 4C46A 3BASA 1AQ5A 3RK2C 2K37A 3M0DA 3CCSP 1T2KD 5AW7B 3P8MC 1VQOP 1VQ8P 3D6ZA 3TGUJ 1JTHB 1K04A 2QEXP 3A0BH 5CCHD 1EC5A 1L4AB 1N7SD 2I1JA 4L75A 3S4RA 3KYQA 1J1EB 1SQQD 4D6TG 4WB4A 4UB8H 1ZRTD 1JMMA 3VMYA 2PFXA 1N7SB 1GTWA 2K88A 1N73B 2HFED 1SVFA 1SQXJ 2WSFJ 1PP9D 4Y99B 2JO1A 1UIXA 3CC2P 3EFGA 2ZFCA 2CPBA 4N78D 4NPFX 2QIWA 2PP6A 1VQ7P 5APUA 1HBWA 2O3JA 2KI7B 2W6BA 2FXPA 3Q5RA 1LTAC 2W6JH 1FZFA 3B5NB 2Q3IA 4H13D 1GK6A 1A02F 2OTKE 3CX5H 1IFMA 3M91A 2GUVA 3TSIA 2QVAA 1JY2N 1PGQA 1HGVA 1SQQK 3A0HE 4PD4D 4GOEA 5APQA 1DX7A 1OFCX 3H1LG 3G9RA 3Q5PA 1IJDB 2JJLA 3FGAD 1SQVD 2W90A 1LP1B 1GK4A 3M9BA 2PRRA 3L71J 1BGYD 3G3ZA 4HYTB 1YTZT 1M1JB 2AXCA 4JPZB 1KILB 2WQYC 1IC2A 4LLHA 3IFMA 1NTMD 2KB7P 1NWQA 4AQRD 1LWUB 2FFDC 4L74A 2L5GB 1YIJP 2BCCD 4XE5B 1KN7A 2QJYB 3CCJP 2E74D 2KZJA 3VMZA 1WT6A 3TK1A 4XA4A 1CW5A 1HF9A 3G4SP 3MUDC 1PV3A 3IR9A 1X22A 1RE3A 1BDCA 1YITP 2E74B 1FZBA 3GHGA 3CCVP 2ZJSE 3FXDA 1NU1J 2KS1B 3CCUP 1MV8A 4MN4C 5APSA 3UIAA 2K3RA 1NTZD 1NTKD 4LC1A 3HUSA 2G8YA 4KHXA 3U59A 1N7LA 1NTMK 4L73A 3MD0A 4DZOA 4DT0A 1DD3A 1NH4A 3SFEC 2M5AA 2KOGA 4IFDK 1GW4A 3HE4A 4D6TD 1LTSC 1ZRTE 2C0XA 5CBNA 1LNQA 2H89C 3L73J 4PD4I 2P1JA 1HJ0A 2Q1KA 4BWNA 1QGKB 4EIJA 5GTIH 5KKZC 3B8EB 1T6AA 1S5LE 5KAIE 1L0LD 4HJGH 1E79H 4ZKPA 1GL2A 1IFPA 1VF5D 2KYVA 1L0NG 3H1LJ 3M9HA 1Q81Q 1HTLC 1QL2A 4I6MC 1GMJA 3O6QA 5AW4B 1NKNA 3T97A 3RL0D 1SQXE 3ABVC 1BE3G 2QJPC 3WU2H 1GZLA 3RK3D 1NO4A 3CCLP 5AW3B 1T2KC 1X8YA 3L75G 5H2FH 1OZHA 1YHQP 1USDA 2LXBA 3RL0B 4JF7A 2XNDH 2YKQA 5CCHC 1YQ3C 1NOHA 5AVRB 3QWOC 2P10A 5GTHH 1N73C 5CCGC 2KXPB 1L0LK 4C7NA 3SWYA 1SLQA 5B5EH 1H89A 2Z4EA 1U7JA 4WBAA 2E5YA 2H8PD 4NPDA 5KLIC 1R5SA 1NTME 1OX3A 4CPGA 4DCKA 5CHXA 3LW5H 4QMAA 2N1TA 4KT0J 3W67A 2WPRA 1FU1A 3L71E 3HE5A 2D2CD 3JCUH 1JEKA 4XFJA 3HD7A 2P7JA 4PD4H 3K5BA 5B66H 5APYA 1JY3P 1JTHA 1BCCG 1PPJG 4H13C 2SPZA 5BU5A 3WUVA 2W27A 2NRGA 3RL0g 2R3CA 2W8ZA 1T8ZA 4N3YB 2NPSA 3H1IG 3N7NA 4ASWA 1NJIQ 1ZN5A 3NTNA 5KTBA 5APTA 4HB1A 1LT9A 4BXLA 1P84E 2OGUA 4IL6E 1EDLA 3NXSA 3GHGB 1SQQG 2ZT9D 1LT1A 2OQQA 4R4MA 3HUSB 4D6TE 4OGQD 1XTCC 3B5NA 1KC8Q 1EDJA 1PP9G 2WZ7A 2ZYGA 3SWFA 2M5AB 1LTGC 2IYPA 3PRJA 2C9NY 1S9KD 4OGQB 3HE4B 2OYIA 2FYZA 2OTLP 1PIXA 2OARA 2E74C 3L75J 3TNUA 1L0ND 1N8RQ 1GL2D 1S3JA 3D6YA 1IK9A 3AEDC 1ZOYC 2YO3A 2WSCJ 1M1JA 3KZIE 4H0LD 2IBZI 4OWFA 1GL2B 1KB9I 3RK3E 5C39A 1QLED 3S9OA 1SQBG 2ZYDA 1VQPP 1SQVG 1OVRA 2MKVA 3V4WA 2ITAA 3H1LE 5EFWB 3O6QB 2PGDA 3T97B 1BGYG 3Q3DA 4H0LB 1RF0A 4N6JA 4L76A 2XV5A 3L74D 1NGMB 2YXQB 3A0BE 1L0NK 2IZ1A 3O8ZA 3BVHA 5CMZA 5E79H 2BCCG 1OVVA 5BU8B 1WRGA 3V6IA 1KORA 3B71A 3MIWA 2N1TD 3H1KG 3OJAB 2FY8A 2P58A 2WPQA 4C7NB 4UB8E 4WY4A 1VF5C 1PGJA 2B87A 1BCCD 1PFIA 1Q90D 2N1TB 2E75C 2RN0A 3RL0C 1M7LA 2JKVA 2Y0EA 1L4AD 1SQQJ 3HE5B 3AEFC 2CPSA 3RK3C 1NTZG 1NTKG 2KZIA 3H1ID 1CSBA 2JWDA 3HD7B 3VYIA 2NPSD 2ZXEB 5TISH 1A02J 1VQMP 3CX5E 1RF1C 3SSUA 1KB9H 1FZCC 1LTTC 4W7YA 1RE4C 2NPSB 1JUNA 5CBOA 4U3FG 1VQ9P 2AEJA 3IF4A 1JMBA 2E42A 2QG4A 1KMIZ 1ZR2A 2R32A 4WVZA 3LW5J 1LT9B 4UB6H 2IPPA 3B5ND 1M90Q 1JNMA 4TT3H 1L0LG 2HR3A 1M57D 1VQ5P 4JBZA 3TGUD 2D2CC 1Q2NA 1RH5B 1BSHA 1OW6A 2Q7CA 2Q5UA 2YKPA 2JR8A 1RHZB 1FS0E 1L0NE 4YXWH 1IFDA 1BGYJ 1OVUA 4B86A 2R5BA 2WSEH 1S2EA 2LXCB 1RE3C 1PGPA 2OYIB 1NYHA 2KK7A 1NKZB 1BE3E 2E76D 2K9JA 3TNUB 1NTMJ 1KILD 1SQBD 2E5TA 1KTMA 1QVFO 3L75E 1SFCA 3HUSC 2XZRA 1JB0J 1K73Q 1URQA 2IX7C 1KQLA 3AE7C 3PJSK 2BCCJ 2V7QH 1N86A 2E76B 3IAOA 1FOSF 1P84H 2ZT9C 3AEEC 3GLMA 2GA1A 3CWBD 2IBZG 1J1DC 1JCCA 4I7ZC 4KJMA 1DH3A 2AXTH 2R5DA 2FYNB 5K5GB 4U7JA 4IFFA 2P67A 1KYOI 5AVUB 3H1KD 3KHUA 2Y0DA 1U7MA 4GIFA 1FZGA 1PL5A 3IN6A 4ZKUA 1SQBK 3CXHI 4WY4D 1SQVK 3E7KA 1BCCE 5GTIE 4H44C 1PPJE 2E43A 1N2DC 4D6TJ 1MZ9A 2JWAA 4H0LC 5KLVG 5AW9B 3BATA 4WY4B 3L70D 1IFIA 3H1IE 3WUUA 3H1HD 2ZXXA 2B87B 4EDFA 1ZMEC 3AE5C 1CI6A 4PV1D 4JQ0D 2R3SA 4OVNF 1L0LJ 3WU2E 3KDPB 1CZQA 3H32A 2WSSH 3CMAP 1SQQE 2O01H 4U3FD 1GU4A 2QJKB 2O1KA 5H2FE 2QM8A 3D71A 3KXDA 3BCCD 2IYOA 2B9BA 1AFOA 4PV1B 1PP9E 2FFDA 1IO4A 1LTJC 3SWKA 5CJ0A 5GTHE 1RY3A 3VP9A 4N78E 1NTZK 1NTKK 1U57A 5AVSB 1FE6A 1AV1A 2LR2A 3OA7A 1D7MA 1MFZA 3MUDA 1KYOH 2Y9YA 1HWTC 1HJBA 1G2CA 1L4AC 1EDKA 1YBKA 3L73D 2QA4P 4ZNCA 3JCUE 1FOSE 3CXHH 5AW0B 1J1EC 4RJTA 3RK2D 1OW8A 4PD4E 2WT7A 1Q82Q 2NPSC 5B66E 3FWNA 1KILE 1SQBE 4EYYQ 1N7SC 4YPCA 1SQVE 1QL1A 1DIPA 1SFCD 3FXEA 1JY3N 3VP8A 3TYYA 3CLQA 1URQD 3RK2B 1BGYE 2B89A 4Y99C 3RGUA 1BDDA 3L74G 2CK3H 1H88A 2K9JB 3CMEP 1SFCB 4BRYA 2YMKA 1URQB 2IBZD 3P8CD 3B5NC 1KB9D 2FXOA 1GU5A 2WITA 1EZVD 3AE1C 2WPSA 1KQFB 2BCCE 1LJ2A 2A06D 1S5LX 2J5UA 3H1JD 3H1KE 2KSJA 2OYIC 2Y9ZA 3VMAA 3CCRP 4C7RA 5APWA 2WSEJ 3L72G 2P2UA 1Y9BA 1SP4A 1PZQA 2A45I 1KZUB 5KAFH 3B4SA 3PHLA 5KLVD 1NTZE 2WVRA 1NTKE 1M1JC 2E76C 4WWIA 1IFNA 1KILC 4M3LA 2QSIA 1NAYA 3Q2YA 3F89A 5L8RJ 1KFNA 3L36A 1LWUC 1FDOA 1SQPG 2KLUA 2W83C 4HH2A 1YI2P 1E5WA 2FYUG 3JC22 5CCGA 2QJYC 3CCQP 1RF0C 4U3FE 1L0NJ 2N9YB 1AA0A 4R4LA 3JSVC 3AE3C 1ZLLA 5AVQB 1YQ4C 1CI6B 1BE3J 3P7KA 3TGUG 1JOCA 2W6AA 3H32B 1L0LE 3GMAA 5KLVK 3PP5A 5DJUB 4WY4C 5AW1B 5E79E 2Q6QA 2FFDB 4O9BA 3S1KA 1ZW0A 3Q1MA 3L74J 1EZVI 3M0DC 2XDJA 3LIDA 3CC4P 3BRTB 1R8EA 3NMDA 2A45H 4W7ZA 1G2CB 2O1JA 2GUSA 1YYCA 1H8AA 3CWBG 3R4YA 2WT7B 1GD2E 2HLOA 1BCCJ 2WMMA 5TISE 3U1AA 2IBZE 3A2AA 1KB9E 2KLVA 2V4HA 3H25A 1YJNP 3H1IJ 2J59M 2POHA 4K3AA 2VRSA 2UWJE 1NAFA 2BEZF 3AE4C 3HD7D 1IK7A 2BEQD 4BRYB 4TLFA 3MGNA 3AECC 1JY2O 2ZAEB 4UB6E 1K9MQ 2AEFA 4Y28J 3L72D 3HRNA 2J58A 2OTJP 1OWAA 4EI2A 5AVTB 2JP3A 5KKZB 3PH0A 3L70G 2GM4A 3H1HG 1EXJA 5KLVE 3AE9C 2H88C 1WMKA 1PP9J 1KYOD 3W68A 2M3EA 1NVOA 2N9BA 5AVVB 1VQ4P 1SFCC 1SQPD 3GF3A 1URQC 4ZMDA 3WMM0 3CXHD 2OYHA 2QJPB 2ZYAA 1M1KQ 2FYUD 1H0TA 2O01N 2WWWA 3BCCG 2HPCA 2HYNA 1DEEG 2RMZA 4PJ0H 5CCGD 1NU1G 2A45G 2FBWC 2R44A 1QVGO 2FXMA 5KJ7A 3OAKA 1W2BO 2KNCA 2H7HA 1IZNB 4DJGA 1S9KE 3L35A 1OW7A 1SQBJ 1R5LA 1LTBC 3U1CA 3AEBC 1SQVJ 4RKUJ 1ZV8A 1X79B 2HODA 3N4XA 2QE7H 1ZP0C 3SFDC 1Z56A 5KLIB 2OYOA 2AXTE 3I55P 3TDKA 1JM0A 3CCMP 1VDFA 4RESB 2Z5IA 2IZ0A 3L73G 1VQKP 1SQPK 3GHGC 1SQXD 1W5CE 3HTKA 3L37A 2ZVNB 1GW3A 3CWBJ 2FYUK 3MP7B 2XU6A 1S4XA 2NZ2A 1K8AQ 4H13B 3MHVA 4AYCA 3MZWB 3H1KJ 1RF1A 1G1IA 1FZCA 4GT1A 1RE4A 1X9VA 3M0AA 4OGQC 3L74E 1USEA 2KUBA 1EDIA 2Z5HA 1J2JB 5BVZA 5AW5B 1VQNP 3ZDMA 2HG5D 3PTZA 1Y8AA 1LGHB 3A5TA 1EZVG 2A06G 3G6EP 1VQLP 1JO5A 1NTZJ 1GDTA 1FDIA 1NTKJ 3I56P 2XNXA 3OW2O 3GF7A 1JY2P 4IFMA 3H1JG 3AE6C 3L70J 4OH8B 1SQXK 1S72P 3L71D 3H1HJ 1GL2C 3G71P 3A0HH 3E1IA 1K05A 1KFMA 3EWKA 4JYCA 1G1JA 3L72E 4U3FJ 1EQ7A 2KP8A 2L91A 4JYBA 3BCCJ 1HUCA 1JY3O 1QX8A 3WUTA 2K1AA 3VTPC 1MUUA 2WSCH 1L2PA 3ITKA 2C0WA 2YNYA 2M0BA 1KYOE 1OXZA 2BASA 1FJPA 4NPEA 3AE2C 1LTIC 1P84D 1SQPE 1VPCA 1NHLA 3CXHE 4LGDE 2FYUE 3C9IA 3USSA 1NU1D 1BSNA 1HH0A 2I1KA 1EXIA 2C9LY 2N1TC 1ZR4A 3LIEA 2OYHB 5KJ7D 3TGUE 1H0TB 5AW6B 5B5EE 2HPCB 4ASVA 1FZAA 3KQGA 3HD7C 4Z1MH 2IDBA 2H43A 4GDOA 4YXDC 2KNCB 3M06A 2K9YA 2YIUB 1FAVA 2E75D 1RQVA 4I2LC 1OMIA 1AJYA 1VF5B 2G3AA 1YTZI 2HODB 3RBZA 2Q3EA 1NU1K 3A3YB 5M1BA 1LT9C 3H1LD 1KD1Q 2E75B 2YO2A 5KAFE 3HTKB 1X0TA 4GODA 3H1JJ 3RK3B 1S5LH 5KAIH 4YTPC 3GG2A 3CWBE 1Y47A 2I8DA 3L4FA 4EOTA 1KQSO 3M9QA 1MKMA 5APXA 1FJKA 1T3UA 2WPVB 3Q5SA 5AVWB 1M56D 2KIKA 4GKGA 1YJWP 1RF1B 1IFJA 1LTJA 1FZCB 1T3JA 5KLVJ 1FBMA 3C1LA 3F5HA 2WSFH 3KPEA 3CI9A 1FDMA 1P84I 4AUWA 2DW3A 3MTUE 4RO0A 2Q9IA 4K35A 1RQUA 2Y0CA 3V2PA 1L4AA 1ZXGA 2D2CB 3GW6A 3L70E 2IFNA 2M3BA 3CD6P 1OIPA 3H1HE 1KV4A 2FKWB 4I1LA 2V7QJ 2YXRB 2JDIH 5CCHA 3V2QA 3AEAC 1N7SA 3PLNA 4GOFA 3CX5D 1N73A 2FYNC 3VOPA 1QEXA 1DD4A 3AEGC 1AVYA 3V5BA 2YKOA 3BCCE 5TJHA 1JCDA 1NU1E 1KQGB 4HKZH 4W80A 1HVVA 3V2NA 1AVOA 3I5CA 3FX0A 2ZVOB 5AW2B 2ZT9B 3VMXA 2YMYA 2B88A 2QM7A 3R2PA 3RBXA 1J1DB 1FC2C 4I7ZB 1YJ9P 2AEMA 2RKLA 3P32A 3TF5A 3QH9A 1SQXG 4IL6H 3V4QA 2PAJA
chains in the Genus database with same CATH topology
1KB9H 3H1IG 1NTZG 3CX5H 1NTKG 4D6TG 4PD4H 3CWBG 1SQPG 3H1JG 5KLVG 1KYOH 1L0LG 4U3FG 3L70G 1BE3G 1BGYG 1BCCG 3L71G 3TGUG 2IBZG 1PPJG 2FYUG 3H1HG 2BCCG 1SQVG 3BCCG 3L75G 1L0NG 3L73G 1EZVG 3H1LG 1PP9G 1SQXG 1SQBG 3CXHH 1NTMG 3L72G 3H1KG 1NU1G 2A06G 3L74G 1P84H 1SQQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 H;  3H1I G;  1NTZ G;  3CX5 H;  1NTK G;  4D6T G;  4PD4 H;  3CWB G;  1SQP G;  3H1J G;  5KLV G;  1KYO H;  1L0L G;  4U3F G;  3L70 G;  1BE3 G;  1BGY G;  1BCC G;  3L71 G;  3TGU G;  2IBZ G;  1PPJ G;  2FYU G;  3H1H G;  2BCC G;  1SQV G;  3BCC G;  3L75 G;  1L0N G;  3L73 G;  1EZV G;  3H1L G;  1PP9 G;  1SQX G;  1SQB G;  3CXH H;  1NTM G;  3L72 G;  3H1K G;  1NU1 G;  2A06 G;  3L74 G;  1P84 H;  1SQQ G; 
#chains in the Genus database with same CATH topology
 1LP1 A;  5AVY B;  3V2R A;  2KSE A;  1MFT A;  3E1R A;  3L73 E;  2MJZ A;  4H44 D;  3CC7 P;  1VQ6 P;  1M8O B;  5AW8 B;  1PGO A;  3CL3 D;  2QJK C;  1BE3 D;  1HGZ A;  1KIL A;  5AVZ B;  1Q86 Q;  1TU3 F;  3L75 D;  4PV1 C;  2RH0 A;  4IL6 X;  2O01 J;  1DEB A;  4IOI H;  3CCE P;  4H44 B;  3EFF K;  3AE8 C;  3A7O A;  1LWU A;  2QRX A;  1AQT A;  1SS1 A;  1W2E A;  1FZE A;  3NFQ A;  2JEE A;  3H6P A;  2OYH C;  2XKM A;  1S1C X;  1Q7Y Q;  1VL2 A;  2IFM A;  1UII A;  1NTM G;  3L72 J;  3P8C E;  5DJT B;  1EZV E;  3D70 A;  4DOJ A;  2A06 E;  3EQ2 A;  5KJ7 C;  3L71 G;  2M8R A;  4A7P A;  3H1J E;  2YIU C;  4PJ0 E;  2KS1 A;  3CX5 I;  1XTG B;  2WTY A;  3KZI H;  3C8V A;  3VN0 A;  3CPW O;  3FWL A;  5CJ4 A;  3II6 A;  5AVX B;  5APV A;  1SQP J;  2LKM A;  1LTJ B;  2FYU J;  1PPJ D;  3BRV B;  4C46 A;  3BAS A;  1AQ5 A;  3RK2 C;  2K37 A;  3M0D A;  3CCS P;  1T2K D;  5AW7 B;  3P8M C;  1VQO P;  1VQ8 P;  3D6Z A;  3TGU J;  1JTH B;  1K04 A;  2QEX P;  3A0B H;  5CCH D;  1EC5 A;  1L4A B;  1N7S D;  2I1J A;  4L75 A;  3S4R A;  3KYQ A;  1J1E B;  1SQQ D;  4D6T G;  4WB4 A;  4UB8 H;  1ZRT D;  1JMM A;  3VMY A;  2PFX A;  1N7S B;  1GTW A;  2K88 A;  1N73 B;  2HFE D;  1SVF A;  1SQX J;  2WSF J;  1PP9 D;  4Y99 B;  2JO1 A;  1UIX A;  3CC2 P;  3EFG A;  2ZFC A;  2CPB A;  4N78 D;  4NPF X;  2QIW A;  2PP6 A;  1VQ7 P;  5APU A;  1HBW A;  2O3J A;  2KI7 B;  2W6B A;  2FXP A;  3Q5R A;  1LTA C;  2W6J H;  1FZF A;  3B5N B;  2Q3I A;  4H13 D;  1GK6 A;  1A02 F;  2OTK E;  3CX5 H;  1IFM A;  3M91 A;  2GUV A;  3TSI A;  2QVA A;  1JY2 N;  1PGQ A;  1HGV A;  1SQQ K;  3A0H E;  4PD4 D;  4GOE A;  5APQ A;  1DX7 A;  1OFC X;  3H1L G;  3G9R A;  3Q5P A;  1IJD B;  2JJL A;  3FGA D;  1SQV D;  2W90 A;  1LP1 B;  1GK4 A;  3M9B A;  2PRR A;  3L71 J;  1BGY D;  3G3Z A;  4HYT B;  1YTZ T;  1M1J B;  2AXC A;  4JPZ B;  1KIL B;  2WQY C;  1IC2 A;  4LLH A;  3IFM A;  1NTM D;  2KB7 P;  1NWQ A;  4AQR D;  1LWU B;  2FFD C;  4L74 A;  2L5G B;  1YIJ P;  2BCC D;  4XE5 B;  1KN7 A;  2QJY B;  3CCJ P;  2E74 D;  2KZJ A;  3VMZ A;  1WT6 A;  3TK1 A;  4XA4 A;  1CW5 A;  1HF9 A;  3G4S P;  3MUD C;  1PV3 A;  3IR9 A;  1X22 A;  1RE3 A;  1BDC A;  1YIT P;  2E74 B;  1FZB A;  3GHG A;  3CCV P;  2ZJS E;  3FXD A;  1NU1 J;  2KS1 B;  3CCU P;  1MV8 A;  4MN4 C;  5APS A;  3UIA A;  2K3R A;  1NTZ D;  1NTK D;  4LC1 A;  3HUS A;  2G8Y A;  4KHX A;  3U59 A;  1N7L A;  1NTM K;  4L73 A;  3MD0 A;  4DZO A;  4DT0 A;  1DD3 A;  1NH4 A;  3SFE C;  2M5A A;  2KOG A;  4IFD K;  1GW4 A;  3HE4 A;  4D6T D;  1LTS C;  1ZRT E;  2C0X A;  5CBN A;  1LNQ A;  2H89 C;  3L73 J;  4PD4 I;  2P1J A;  1HJ0 A;  2Q1K A;  4BWN A;  1QGK B;  4EIJ A;  5GTI H;  5KKZ C;  3B8E B;  1T6A A;  1S5L E;  5KAI E;  1L0L D;  4HJG H;  1E79 H;  4ZKP A;  1GL2 A;  1IFP A;  1VF5 D;  2KYV A;  1L0N G;  3H1L J;  3M9H A;  1Q81 Q;  1HTL C;  1QL2 A;  4I6M C;  1GMJ A;  3O6Q A;  5AW4 B;  1NKN A;  3T97 A;  3RL0 D;  1SQX E;  3ABV C;  1BE3 G;  2QJP C;  3WU2 H;  1GZL A;  3RK3 D;  1NO4 A;  3CCL P;  5AW3 B;  1T2K C;  1X8Y A;  3L75 G;  5H2F H;  1OZH A;  1YHQ P;  1USD A;  2LXB A;  3RL0 B;  4JF7 A;  2XND H;  2YKQ A;  5CCH C;  1YQ3 C;  1NOH A;  5AVR B;  3QWO C;  2P10 A;  5GTH H;  1N73 C;  5CCG C;  2KXP B;  1L0L K;  4C7N A;  3SWY A;  1SLQ A;  5B5E H;  1H89 A;  2Z4E A;  1U7J A;  4WBA A;  2E5Y A;  2H8P D;  4NPD A;  5KLI C;  1R5S A;  1NTM E;  1OX3 A;  4CPG A;  4DCK A;  5CHX A;  3LW5 H;  4QMA A;  2N1T A;  4KT0 J;  3W67 A;  2WPR A;  1FU1 A;  3L71 E;  3HE5 A;  2D2C D;  3JCU H;  1JEK A;  4XFJ A;  3HD7 A;  2P7J A;  4PD4 H;  3K5B A;  5B66 H;  5APY A;  1JY3 P;  1JTH A;  1BCC G;  1PPJ G;  4H13 C;  2SPZ A;  5BU5 A;  3WUV A;  2W27 A;  2NRG A;  3RL0 g;  2R3C A;  2W8Z A;  1T8Z A;  4N3Y B;  2NPS A;  3H1I G;  3N7N A;  4ASW A;  1NJI Q;  1ZN5 A;  3NTN A;  5KTB A;  5APT A;  4HB1 A;  1LT9 A;  4BXL A;  1P84 E;  2OGU A;  4IL6 E;  1EDL A;  3NXS A;  3GHG B;  1SQQ G;  2ZT9 D;  1LT1 A;  2OQQ A;  4R4M A;  3HUS B;  4D6T E;  4OGQ D;  1XTC C;  3B5N A;  1KC8 Q;  1EDJ A;  1PP9 G;  2WZ7 A;  2ZYG A;  3SWF A;  2M5A B;  1LTG C;  2IYP A;  3PRJ A;  2C9N Y;  1S9K D;  4OGQ B;  3HE4 B;  2OYI A;  2FYZ A;  2OTL P;  1PIX A;  2OAR A;  2E74 C;  3L75 J;  3TNU A;  1L0N D;  1N8R Q;  1GL2 D;  1S3J A;  3D6Y A;  1IK9 A;  3AED C;  1ZOY C;  2YO3 A;  2WSC J;  1M1J A;  3KZI E;  4H0L D;  2IBZ I;  4OWF A;  1GL2 B;  1KB9 I;  3RK3 E;  5C39 A;  1QLE D;  3S9O A;  1SQB G;  2ZYD A;  1VQP P;  1SQV G;  1OVR A;  2MKV A;  3V4W A;  2ITA A;  3H1L E;  5EFW B;  3O6Q B;  2PGD A;  3T97 B;  1BGY G;  3Q3D A;  4H0L B;  1RF0 A;  4N6J A;  4L76 A;  2XV5 A;  3L74 D;  1NGM B;  2YXQ B;  3A0B E;  1L0N K;  2IZ1 A;  3O8Z A;  3BVH A;  5CMZ A;  5E79 H;  2BCC G;  1OVV A;  5BU8 B;  1WRG A;  3V6I A;  1KOR A;  3B71 A;  3MIW A;  2N1T D;  3H1K G;  3OJA B;  2FY8 A;  2P58 A;  2WPQ A;  4C7N B;  4UB8 E;  4WY4 A;  1VF5 C;  1PGJ A;  2B87 A;  1BCC D;  1PFI A;  1Q90 D;  2N1T B;  2E75 C;  2RN0 A;  3RL0 C;  1M7L A;  2JKV A;  2Y0E A;  1L4A D;  1SQQ J;  3HE5 B;  3AEF C;  2CPS A;  3RK3 C;  1NTZ G;  1NTK G;  2KZI A;  3H1I D;  1CSB A;  2JWD A;  3HD7 B;  3VYI A;  2NPS D;  2ZXE B;  5TIS H;  1A02 J;  1VQM P;  3CX5 E;  1RF1 C;  3SSU A;  1KB9 H;  1FZC C;  1LTT C;  4W7Y A;  1RE4 C;  2NPS B;  1JUN A;  5CBO A;  4U3F G;  1VQ9 P;  2AEJ A;  3IF4 A;  1JMB A;  2E42 A;  2QG4 A;  1KMI Z;  1ZR2 A;  2R32 A;  4WVZ A;  3LW5 J;  1LT9 B;  4UB6 H;  2IPP A;  3B5N D;  1M90 Q;  1JNM A;  4TT3 H;  1L0L G;  2HR3 A;  1M57 D;  1VQ5 P;  4JBZ A;  3TGU D;  2D2C C;  1Q2N A;  1RH5 B;  1BSH A;  1OW6 A;  2Q7C A;  2Q5U A;  2YKP A;  2JR8 A;  1RHZ B;  1FS0 E;  1L0N E;  4YXW H;  1IFD A;  1BGY J;  1OVU A;  4B86 A;  2R5B A;  2WSE H;  1S2E A;  2LXC B;  1RE3 C;  1PGP A;  2OYI B;  1NYH A;  2KK7 A;  1NKZ B;  1BE3 E;  2E76 D;  2K9J A;  3TNU B;  1NTM J;  1KIL D;  1SQB D;  2E5T A;  1KTM A;  1QVF O;  3L75 E;  1SFC A;  3HUS C;  2XZR A;  1JB0 J;  1K73 Q;  1URQ A;  2IX7 C;  1KQL A;  3AE7 C;  3PJS K;  2BCC J;  2V7Q H;  1N86 A;  2E76 B;  3IAO A;  1FOS F;  1P84 H;  2ZT9 C;  3AEE C;  3GLM A;  2GA1 A;  3CWB D;  2IBZ G;  1J1D C;  1JCC A;  4I7Z C;  4KJM A;  1DH3 A;  2AXT H;  2R5D A;  2FYN B;  5K5G B;  4U7J A;  4IFF A;  2P67 A;  1KYO I;  5AVU B;  3H1K D;  3KHU A;  2Y0D A;  1U7M A;  4GIF A;  1FZG A;  1PL5 A;  3IN6 A;  4ZKU A;  1SQB K;  3CXH I;  4WY4 D;  1SQV K;  3E7K A;  1BCC E;  5GTI E;  4H44 C;  1PPJ E;  2E43 A;  1N2D C;  4D6T J;  1MZ9 A;  2JWA A;  4H0L C;  5KLV G;  5AW9 B;  3BAT A;  4WY4 B;  3L70 D;  1IFI A;  3H1I E;  3WUU A;  3H1H D;  2ZXX A;  2B87 B;  4EDF A;  1ZME C;  3AE5 C;  1CI6 A;  4PV1 D;  4JQ0 D;  2R3S A;  4OVN F;  1L0L J;  3WU2 E;  3KDP B;  1CZQ A;  3H32 A;  2WSS H;  3CMA P;  1SQQ E;  2O01 H;  4U3F D;  1GU4 A;  2QJK B;  2O1K A;  5H2F E;  2QM8 A;  3D71 A;  3KXD A;  3BCC D;  2IYO A;  2B9B A;  1AFO A;  4PV1 B;  1PP9 E;  2FFD A;  1IO4 A;  1LTJ C;  3SWK A;  5CJ0 A;  5GTH E;  1RY3 A;  3VP9 A;  4N78 E;  1NTZ K;  1NTK K;  1U57 A;  5AVS B;  1FE6 A;  1AV1 A;  2LR2 A;  3OA7 A;  1D7M A;  1MFZ A;  3MUD A;  1KYO H;  2Y9Y A;  1HWT C;  1HJB A;  1G2C A;  1L4A C;  1EDK A;  1YBK A;  3L73 D;  2QA4 P;  4ZNC A;  3JCU E;  1FOS E;  3CXH H;  5AW0 B;  1J1E C;  4RJT A;  3RK2 D;  1OW8 A;  4PD4 E;  2WT7 A;  1Q82 Q;  2NPS C;  5B66 E;  3FWN A;  1KIL E;  1SQB E;  4EYY Q;  1N7S C;  4YPC A;  1SQV E;  1QL1 A;  1DIP A;  1SFC D;  3FXE A;  1JY3 N;  3VP8 A;  3TYY A;  3CLQ A;  1URQ D;  3RK2 B;  1BGY E;  2B89 A;  4Y99 C;  3RGU A;  1BDD A;  3L74 G;  2CK3 H;  1H88 A;  2K9J B;  3CME P;  1SFC B;  4BRY A;  2YMK A;  1URQ B;  2IBZ D;  3P8C D;  3B5N C;  1KB9 D;  2FXO A;  1GU5 A;  2WIT A;  1EZV D;  3AE1 C;  2WPS A;  1KQF B;  2BCC E;  1LJ2 A;  2A06 D;  1S5L X;  2J5U A;  3H1J D;  3H1K E;  2KSJ A;  2OYI C;  2Y9Z A;  3VMA A;  3CCR P;  4C7R A;  5APW A;  2WSE J;  3L72 G;  2P2U A;  1Y9B A;  1SP4 A;  1PZQ A;  2A45 I;  1KZU B;  5KAF H;  3B4S A;  3PHL A;  5KLV D;  1NTZ E;  2WVR A;  1NTK E;  1M1J C;  2E76 C;  4WWI A;  1IFN A;  1KIL C;  4M3L A;  2QSI A;  1NAY A;  3Q2Y A;  3F89 A;  5L8R J;  1KFN A;  3L36 A;  1LWU C;  1FDO A;  1SQP G;  2KLU A;  2W83 C;  4HH2 A;  1YI2 P;  1E5W A;  2FYU G;  3JC2 2;  5CCG A;  2QJY C;  3CCQ P;  1RF0 C;  4U3F E;  1L0N J;  2N9Y B;  1AA0 A;  4R4L A;  3JSV C;  3AE3 C;  1ZLL A;  5AVQ B;  1YQ4 C;  1CI6 B;  1BE3 J;  3P7K A;  3TGU G;  1JOC A;  2W6A A;  3H32 B;  1L0L E;  3GMA A;  5KLV K;  3PP5 A;  5DJU B;  4WY4 C;  5AW1 B;  5E79 E;  2Q6Q A;  2FFD B;  4O9B A;  3S1K A;  1ZW0 A;  3Q1M A;  3L74 J;  1EZV I;  3M0D C;  2XDJ A;  3LID A;  3CC4 P;  3BRT B;  1R8E A;  3NMD A;  2A45 H;  4W7Z A;  1G2C B;  2O1J A;  2GUS A;  1YYC A;  1H8A A;  3CWB G;  3R4Y A;  2WT7 B;  1GD2 E;  2HLO A;  1BCC J;  2WMM A;  5TIS E;  3U1A A;  2IBZ E;  3A2A A;  1KB9 E;  2KLV A;  2V4H A;  3H25 A;  1YJN P;  3H1I J;  2J59 M;  2POH A;  4K3A A;  2VRS A;  2UWJ E;  1NAF A;  2BEZ F;  3AE4 C;  3HD7 D;  1IK7 A;  2BEQ D;  4BRY B;  4TLF A;  3MGN A;  3AEC C;  1JY2 O;  2ZAE B;  4UB6 E;  1K9M Q;  2AEF A;  4Y28 J;  3L72 D;  3HRN A;  2J58 A;  2OTJ P;  1OWA A;  4EI2 A;  5AVT B;  2JP3 A;  5KKZ B;  3PH0 A;  3L70 G;  2GM4 A;  3H1H G;  1EXJ A;  5KLV E;  3AE9 C;  2H88 C;  1WMK A;  1PP9 J;  1KYO D;  3W68 A;  2M3E A;  1NVO A;  2N9B A;  5AVV B;  1VQ4 P;  1SFC C;  1SQP D;  3GF3 A;  1URQ C;  4ZMD A;  3WMM 0;  3CXH D;  2OYH A;  2QJP B;  2ZYA A;  1M1K Q;  2FYU D;  1H0T A;  2O01 N;  2WWW A;  3BCC G;  2HPC A;  2HYN A;  1DEE G;  2RMZ A;  4PJ0 H;  5CCG D;  1NU1 G;  2A45 G;  2FBW C;  2R44 A;  1QVG O;  2FXM A;  5KJ7 A;  3OAK A;  1W2B O;  2KNC A;  2H7H A;  1IZN B;  4DJG A;  1S9K E;  3L35 A;  1OW7 A;  1SQB J;  1R5L A;  1LTB C;  3U1C A;  3AEB C;  1SQV J;  4RKU J;  1ZV8 A;  1X79 B;  2HOD A;  3N4X A;  2QE7 H;  1ZP0 C;  3SFD C;  1Z56 A;  5KLI B;  2OYO A;  2AXT E;  3I55 P;  3TDK A;  1JM0 A;  3CCM P;  1VDF A;  4RES B;  2Z5I A;  2IZ0 A;  3L73 G;  1VQK P;  1SQP K;  3GHG C;  1SQX D;  1W5C E;  3HTK A;  3L37 A;  2ZVN B;  1GW3 A;  3CWB J;  2FYU K;  3MP7 B;  2XU6 A;  1S4X A;  2NZ2 A;  1K8A Q;  4H13 B;  3MHV A;  4AYC A;  3MZW B;  3H1K J;  1RF1 A;  1G1I A;  1FZC A;  4GT1 A;  1RE4 A;  1X9V A;  3M0A A;  4OGQ C;  3L74 E;  1USE A;  2KUB A;  1EDI A;  2Z5H A;  1J2J B;  5BVZ A;  5AW5 B;  1VQN P;  3ZDM A;  2HG5 D;  3PTZ A;  1Y8A A;  1LGH B;  3A5T A;  1EZV G;  2A06 G;  3G6E P;  1VQL P;  1JO5 A;  1NTZ J;  1GDT A;  1FDI A;  1NTK J;  3I56 P;  2XNX A;  3OW2 O;  3GF7 A;  1JY2 P;  4IFM A;  3H1J G;  3AE6 C;  3L70 J;  4OH8 B;  1SQX K;  1S72 P;  3L71 D;  3H1H J;  1GL2 C;  3G71 P;  3A0H H;  3E1I A;  1K05 A;  1KFM A;  3EWK A;  4JYC A;  1G1J A;  3L72 E;  4U3F J;  1EQ7 A;  2KP8 A;  2L91 A;  4JYB A;  3BCC J;  1HUC A;  1JY3 O;  1QX8 A;  3WUT A;  2K1A A;  3VTP C;  1MUU A;  2WSC H;  1L2P A;  3ITK A;  2C0W A;  2YNY A;  2M0B A;  1KYO E;  1OXZ A;  2BAS A;  1FJP A;  4NPE A;  3AE2 C;  1LTI C;  1P84 D;  1SQP E;  1VPC A;  1NHL A;  3CXH E;  4LGD E;  2FYU E;  3C9I A;  3USS A;  1NU1 D;  1BSN A;  1HH0 A;  2I1K A;  1EXI A;  2C9L Y;  2N1T C;  1ZR4 A;  3LIE A;  2OYH B;  5KJ7 D;  3TGU E;  1H0T B;  5AW6 B;  5B5E E;  2HPC B;  4ASV A;  1FZA A;  3KQG A;  3HD7 C;  4Z1M H;  2IDB A;  2H43 A;  4GDO A;  4YXD C;  2KNC B;  3M06 A;  2K9Y A;  2YIU B;  1FAV A;  2E75 D;  1RQV A;  4I2L C;  1OMI A;  1AJY A;  1VF5 B;  2G3A A;  1YTZ I;  2HOD B;  3RBZ A;  2Q3E A;  1NU1 K;  3A3Y B;  5M1B A;  1LT9 C;  3H1L D;  1KD1 Q;  2E75 B;  2YO2 A;  5KAF E;  3HTK B;  1X0T A;  4GOD A;  3H1J J;  3RK3 B;  1S5L H;  5KAI H;  4YTP C;  3GG2 A;  3CWB E;  1Y47 A;  2I8D A;  3L4F A;  4EOT A;  1KQS O;  3M9Q A;  1MKM A;  5APX A;  1FJK A;  1T3U A;  2WPV B;  3Q5S A;  5AVW B;  1M56 D;  2KIK A;  4GKG A;  1YJW P;  1RF1 B;  1IFJ A;  1LTJ A;  1FZC B;  1T3J A;  5KLV J;  1FBM A;  3C1L A;  3F5H A;  2WSF H;  3KPE A;  3CI9 A;  1FDM A;  1P84 I;  4AUW A;  2DW3 A;  3MTU E;  4RO0 A;  2Q9I A;  4K35 A;  1RQU A;  2Y0C A;  3V2P A;  1L4A A;  1ZXG A;  2D2C B;  3GW6 A;  3L70 E;  2IFN A;  2M3B A;  3CD6 P;  1OIP A;  3H1H E;  1KV4 A;  2FKW B;  4I1L A;  2V7Q J;  2YXR B;  2JDI H;  5CCH A;  3V2Q A;  3AEA C;  1N7S A;  3PLN A;  4GOF A;  3CX5 D;  1N73 A;  2FYN C;  3VOP A;  1QEX A;  1DD4 A;  3AEG C;  1AVY A;  3V5B A;  2YKO A;  3BCC E;  5TJH A;  1JCD A;  1NU1 E;  1KQG B;  4HKZ H;  4W80 A;  1HVV A;  3V2N A;  1AVO A;  3I5C A;  3FX0 A;  2ZVO B;  5AW2 B;  2ZT9 B;  3VMX A;  2YMY A;  2B88 A;  2QM7 A;  3R2P A;  3RBX A;  1J1D B;  1FC2 C;  4I7Z B;  1YJ9 P;  2AEM A;  2RKL A;  3P32 A;  3TF5 A;  3QH9 A;  1SQX G;  4IL6 H;  3V4Q A;  2PAJ A; 
#chains in the Genus database with same CATH homology
 1KB9 H;  3H1I G;  1NTZ G;  3CX5 H;  1NTK G;  4D6T G;  4PD4 H;  3CWB G;  1SQP G;  3H1J G;  5KLV G;  1KYO H;  1L0L G;  4U3F G;  3L70 G;  1BE3 G;  1BGY G;  1BCC G;  3L71 G;  3TGU G;  2IBZ G;  1PPJ G;  2FYU G;  3H1H G;  2BCC G;  1SQV G;  3BCC G;  3L75 G;  1L0N G;  3L73 G;  1EZV G;  3H1L G;  1PP9 G;  1SQX G;  1SQB G;  3CXH H;  1NTM G;  3L72 G;  3H1K G;  1NU1 G;  2A06 G;  3L74 G;  1P84 H;  1SQQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...