4D6TG

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4d6tG00
1BE3G 2BCCG 1EZVG 1NTMG 1SQPG 1L0NG 3L70G 3H1IG 3H1HG 1SQXG 3H1JG 4PD4H 4U3FG 1PPJG 3L74G 5KLVG 2A06G 3H1LG 3TGUG 3L75G 1PP9G 1L0LG 1KYOH 3CWBG 1SQVG 1NTZG 1NTKG 3CXHH 3BCCG 1BGYG 1P84H 1KB9H 3L72G 2FYUG 1NU1G 2IBZG 3CX5H 1BCCG 3L73G 3L71G 3H1KG 1SQBG 1SQQG 4D6TG
chains in the Genus database with same CATH superfamily
5AVTB 5KKZC 1AQTA 4PD4I 1JEKA 4GODA 1L4AC 1R5SA 3O6QA 1YJNP 1QVGO 1T2KD 1RE3C 2PP6A 5AW7B 3CX5E 1NO4A 4GIFA 5KLVK 1L0LE 1VF5D 5BU5A 1KQSO 3W67A 2QEXP 2KB7P 3FX0A 3IF4A 2OYOA 4IL6X 3CWBD 2BEZF 5GTHH 3EFGA 3H1LG 5CCGA 1YJ9P 2W6AA 3IN6A 1N7SD 1SFCC 5AVZB 4W80A 3CCEP 2WVRA 3H1KJ 2QG4A 1CI6A 3E1RA 3SWYA 4DJGA 2H7HA 1EDKA 3CXHH 1NYHA 2V4HA 1M1KQ 3V6IA 1S1CX 3HUSA 3Q5RA 2Y9ZA 1QEXA 1ZLLA 2Q3IA 2FYUK 2Z5HA 3CX5H 3L70J 2YIUC 3GF7A 2PRRA 1HGZA 2G8YA 2N1TB 3AEBC 2M3BA 1URQA 1KILC 1R5LA 1EZVD 1OWAA 1PP9E 2FYUE 3L4FA 4XE5B 5KLVJ 3PJSK 1KZUB 3CCJP 1H0TB 1NU1J 2B87A 1MFTA 4DT0A 3WU2E 1FZCB 3JCUH 4N78D 1PIXA 4GKGA 2Z4EA 1QL2A 2ZYAA 1VQ8P 2A06E 1W2EA 2OYIA 3KXDA 1JOCA 1N7SA 3Q1MA 1DEEG 4YXDC 1X8YA 3V4WA 1KFNA 3L74G 4H13B 1RF1C 5APQA 2BEQD 1FZFA 3E7KA 2E74B 3GF3A 3GLMA 1M8OB 4JQ0D 3L75G 1USDA 1FU1A 3AE8C 4KJMA 3TDKA 3EWKA 2KI7B 5KLIB 3CCQP 2OYHB 1ZOYC 1KN7A 3BCCG 3S9OA 2AEMA 3A0HE 4BRYA 3KHUA 4Z1MH 2YO3A 2QA4P 1XTGB 3G9RA 4ZKPA 3A0BE 1VF5C 2AEJA 1GMJA 2I1JA 2IBZI 2OGUA 2FY8A 2Q1KA 1FZAA 4GOFA 4BXLA 4D6TG 3CC4P 1ZV8A 2W27A 1YJWP 4CPGA 3C9IA 1W2BO 2FYUD 1KILB 3HTKA 3WUTA 2IBZD 2ZVNB 1HGVA 2WSCH 3A5TA 3Q5SA 2IPPA 2A45G 2FYNC 4HH2A 2P7JA 4C7RA 3HE5A 5KKZB 3N4XA 2B9BA 2P67A 2Q7CA 2ZVOB 1N73B 3HD7B 1KILE 1DEBA 2Q5UA 3CXHD 3GW6A 1SQBJ 3A0BH 3MHVA 4OVNF 3GHGA 1LTTC 2J59M 1KC8Q 1KYOH 1KTMA 1SQQE 1ZN5A 2A06D 2BCCE 3TNUA 2A45H 2BASA 3M0DC 3CCSP 2XDJA 3L72G 1GL2A 1QX8A 3VP8A 1SQBD 1EZVE 2OQQA 1LTSC 2C0XA 3AE6C 1EDLA 3A2AA 3WMM0 2OYIC 3D70A 4IFDK 4KHXA 4TLFA 1A02F 3CL3D 4L75A 5AVWB 1K05A 1RE4C 3O8ZA 2WPQA 1SQXD 2FYUJ 2LR2A 3PHLA 3VMXA 1L4AD 1NTMK 3HUSC 4D6TJ 2AXTE 1GU5A 1N73C 5DJTB 1VQOP 1IFNA 1KQLA 2IFMA 1MFZA 1Q90D 2N9BA 3B71A 1YHQP 4EYYQ 1SS1A 1IC2A 4PD4D 5AVUB 1NAFA 1LP1B 4NPDA 2JJLA 3MIWA 4AUWA 4H44B 1EDIA 3B5NB 1FDOA 3F89A 4UB6H 5CCHD 1DIPA 5CBNA 1X9VA 3M06A 4OGQC 3TSIA 1P84D 1GU4A 1NTKK 1NTZK 3MTUE 1BE3D 1FS0E 2KSJA 4RKUJ 2ZXXA 4XA4A 5CCGC 2E5YA 5AW1B 2LKMA 1VF5B 3Q2YA 3LW5H 2JEEA 1NTKD 1NTZD 1FDMA 2QE7H 1N86A 3BASA 1KB9D 3CCUP 2W8ZA 2OYHC 2ZT9D 5KLIC 3V5BA 1H8AA 1N8RQ 2YKQA 4EI2A 1FZCC 3L75J 4EDFA 2KZJA 3TGUJ 2E74C 3F5HA 2KLVA 2RKLA 3CMEP 3WUUA 1LTJA 5EFWB 1NU1D 2RH0A 2GA1A 2ZT9C 3RK2C 2YNYA 3H1JG 5KAIH 2XU6A 3FWNA 2IYOA 3FWLA 2IZ1A 3LIEA 5APVA 4IFFA 1G2CB 3CD6P 2A06G 2PGDA 2J5UA 3H32A 4U3FE 1P84I 1QGKB 2SPZA 2BCCJ 1S5LE 2L91A 5APYA 3VYIA 2GUVA 2CK3H 2OARA 1SQQD 3HE4B 4B86A 4L74A 2YIUB 1URQD 1J1DB 1YIJP 1K9MQ 1VQ4P 1BCCE 2QM8A 2FYNB 1CW5A 1WT6A 2GUSA 2E76C 3CWBJ 2UWJE 2HODA 3V2PA 3L75D 4C7NB 2KK7A 3GHGC 3L72D 3AE2C 1NAYA 4D6TE 3H1KG 3L37A 4IFMA 4LGDE 2HPCA 1EDJA 1QVFO 4O9BA 1SFCB 1J1EC 4WY4C 1GTWA 3M0AA 1OW6A 1HJBA 1AV1A 1NOHA 2QJYB 3KDPB 3FGAD 5AVRB 4ZKUA 1JM0A 1LTJB 3AE7C 1YITP 1M90Q 1KD1Q 1UIXA 4GDOA 4RESB 2KSEA 1Q2NA 1JMBA 5AW6B 2Y9YA 1BCCJ 2W6JH 1IK9A 3H1ID 3QH9A 3PRJA 4TT3H 1NTZG 1NTKG 2QJPC 3AEDC 3HRNA 2KOGA 4H13C 1FZGA 1KB9H 1SQXJ 2B89A 5H2FH 3FXDA 3BCCD 3NFQA 1Y9BA 5AW3B 2IX7C 2NPSC 3KYQA 5GTHE 1JY2P 3B5NA 3IFMA 3N7NA 1GW3A 1NU1E 1EZVG 3H1JJ 4I7ZB 3CX5I 4KT0J 3AE1C 1NTMG 4ZMDA 3CCMP 1IO4A 1BGYJ 2LXBA 2Z5IA 1JMMA 3E1IA 1PP9D 1YYCA 2FXPA 4JYBA 3CXHE 4WVZA 5GTIE 4IOIH 2R44A 3L75E 3PTZA 1GD2E 1OIPA 1PP9J 2KYVA 3I55P 2H88C 1FZCA 3C1LA 3H1LE 1S2EA 4N3YB 2Y0EA 5AVXB 1XTCC 3H1JD 5H2FE 3W68A 2C9NY 1M56D 3VP9A 3B8EB 3P8CE 1SLQA 2FBWC 1SQPD 4RJTA 1RQUA 3H1HD 3AEGC 2D2CD 3L71J 3WU2H 1YTZI 3JCUE 4A7PA 2FXOA 3H1KE 3TYYA 1GL2B 1FC2C 1WRGA 1JCCA 1CSBA 2QJKB 2QM7A 1EQ7A 1IFMA 3V2RA 3CC2P 4Y28J 1KV4A 3TNUB 1IFPA 1SFCA 1M57D 1K04A 3IAOA 1SP4A 1LGHB 2XV5A 1RH5B 3A7OA 3GHGB 5KJ7C 3G3ZA 1BCCD 3U59A 5TISH 2BCCG 2E76B 2JKVA 5CMZA 1LT1A 3HD7A 3TGUE 2HODB 4C7NA 5BVZA 1EZVI 3L35A 4PV1B 2K88A 3HE5B 3CCRP 1D7MA 1SQPG 1SQVE 3VOPA 1KILD 1DD4A 3H1HG 4OWFA 3D6ZA 3HTKB 3SWKA 2O3JA 3HE4A 1KILA 3WUVA 1FOSE 2E42A 1RF0A 4DCKA 3UIAA 1M7LA 2WPRA 3H32B 5APTA 2P10A 1G2CA 2NRGA 1ZRTD 1FZBA 1N7SC 1HVVA 1SFCD 2IZ0A 2KUBA 1VQ7P 1L0LK 5AVVB 3KQGA 1JY3N 2FKWB 2WSFH 4WB4A 4H0LB 3VTPC 1L0NJ 3U1CA 4NPEA 1NTMJ 1PFIA 3H1LJ 3GMAA 4UB8H 1SQQG 1NTZE 1NTKE 3CCVP 1S4XA 5BU8B 1OX3A 2KZIA 4K3AA 1FAVA 2IBZE 2FYZA 1KFMA 1T2KC 2P1JA 1X79B 1KYOE 3NXSA 1CZQA 1AFOA 1P84E 2W90A 3H1IG 1VQ6P 1N7SB 3G4SP 1NTMD 1L0ND 2OYIB 5AW2B 4PD4H 2WPVB 4DOJA 3MUDA 1NTME 2IYPA 1FJKA 1H0TA 1LP1A 3SSUA 4ZNCA 2FXMA 1JY2N 2L5GB 2N1TA 3RK3D 1SQPE 1SQVG 1RHZB 2YMKA 3HUSB 2AXTH 2ZFCA 1OXZA 1RY3A 1YQ3C 2V7QJ 2K9YA 5CBOA 1BDCA 3L73G 1CI6B 3D6YA 5AW0B 2P2UA 2VRSA 2WSFJ 2RN0A 3KZIH 4OH8B 4PD4E 4PJ0H 5K5GB 3LIDA 2KXPB 1PGPA 3EFFK 1Q82Q 2Q6QA 3V2NA 1GL2C 1T8ZA 4N78E 3SFEC 1L0NG 2KIKA 4IL6E 3ABVC 3JC22 1PPJD 2XNDH 3ZDMA 5KJ7A 1PV3A 4XFJA 1YI2P 3OA7A 1JNMA 3O6QB 5C39A 3OW2O 2WSEH 1RE4A 2R3SA 3M91A 1GK4A 1E79H 1T3UA 2M3EA 3L71D 1U7JA 1IK7A 2O01J 1N73A 3KZIE 3M0DA 1L0NK 4YPCA 1G1IA 1HUCA 5APUA 3V4QA 5B66E 1BGYG 1RF0C 4I2LC 3ITKA 2B88A 1RE3A 1R8EA 1JO5A 3BVHA 1HBWA 2K9JB 2WSSH 4IL6H 4DZOA 3CPWO 1Q7YQ 1NGMB 1A02J 1NVOA 2R5BA 2NPSB 1IFJA 2JR8A 2ZXEB 3RK3B 3AEEC 2RMZA 4WBAA 1ZP0C 1GK6A 1LT9A 4I6MC 4N6JA 2QIWA 1AA0A 2R3CA 2CPSA 1FJPA 2QJPB 3L70G 4BRYB 1S9KE 3H1JE 2OYHA 2WMMA 3BCCJ 1Q86Q 2AEFA 3G6EP 2AXCA 3L36A 2JWAA 3M9BA 4LC1A 5APSA 2A45I 5CHXA 3MGNA 1PPJE 2JWDA 1LNQA 3CMAP 1BDDA 1LTJC 1YBKA 3AE4C 1BE3E 1PL5A 3L74J 1U57A 4RO0A 3SFDC 1ZR2A 2YMYA 1SQVK 3FXEA 2WWWA 2K1AA 4YXWH 4OGQB 1GZLA 1KQFB 1G1JA 1SQQK 1NU1G 1NKZB 2WZ7A 1JTHA 1JY3P 3BCCE 1AVOA 2ZAEB 2B87B 2W83C 1J2JB 3OJAB 3R4YA 2E75D 3RBZA 3VMAA 2FFDC 1SQBG 1L0LJ 1URQB 1KB9I 2M8RA 2H89C 3TF5A 2PFXA 5CJ4A 3BRVB 3P8CD 4U7JA 3T97B 1BGYE 2I8DA 2CPBA 2QRXA 4AQRD 1X22A 2KS1A 5AVYB 5KJ7D 3L72J 1MV8A 2YO2A 1SQXG 3RL0C 1BSHA 1KB9E 1EXIA 2LXCB 4U3FG 2WT7B 2HPCB 2P58A 3CCLP 2KLUA 2GM4A 1IFDA 2WSCJ 1M1JC 1N2DC 1KQGB 3TGUG 2E43A 2XZRA 1SQQJ 2YKOA 1OVUA 5KLVD 1LTGC 2ZT9B 2BCCD 1DX7A 1OW8A 4UB6E 1VDFA 5TISE 4BWNA 1JCDA 4L76A 1W5CE 1DH3A 3G71P 2Y0CA 2DW3A 3B5ND 5GTIH 1KYOI 2J58A 3RL0B 2YKPA 4NPFX 1FOSF 5AVSB 5B5EE 4JF7A 3MD0A 3NTNA 1ZR4A 3I56P 3A3YB 1Q81Q 1SQVD 1EC5A 2H43A 1K8AQ 3VMYA 1S9KD 3AE3C 1T6AA 1GW4A 2PAJA 5AW5B 3TGUD 1NWQA 3AE5C 1OVRA 5APWA 2OTLP 4Y99B 3VN0A 1VQNP 1ZRTE 3A0HH 3CI9A 2HFED 4U3FD 2NPSD 3TK1A 4LLHA 3V2QA 1MUUA 5KAFH 3CWBE 3II6A 3S4RA 4WWIA 2E75B 2ZJSE 1NTZJ 1NTKJ 2HR3A 2W6BA 2XNXA 1T3JA 3M9HA 3B5NC 1PGQA 3IR9A 3Q5PA 5AW9B 3CXHI 1L0NE 1FZEA 1LT9C 2I1KA 2WITA 1LWUA 4H13D 3BRTB 1BE3J 1E5WA 2JDIH 3EQ2A 5E79H 5TJHA 5B5EH 2OTKE 2QVAA 1VQKP 2OTJP 4JYCA 2H8PD 3I5CA 2D2CC 3OAKA 1LTAC 4U3FJ 3K5BA 3P32A 1YTZT 3H25A 1ZXGA 1JY3O 4I1LA 3GG2A 3QWOC 2WTYA 2IDBA 1DD3A 4HYTB 2IBZG 1IZNB 1AJYA 3L71G 3LW5J 3RL0D 5KAFE 2XKMA 1RF1B 1VQLP 1SQVJ 2MKVA 1QL1A 1SQPK 2HYNA 3L73D 1L2PA 2YXQB 2G3AA 2ITAA 4W7ZA 2KNCA 2R5DA 4QMAA 3AE9C 5E79E 2ZYDA 3VMZA 1MZ9A 5KLVE 1VQ9P 4EOTA 2E75C 4PV1D 2FFDA 2N9YB 3RBXA 1NH4A 2C9LY 1QLED 2E76D 1Y47A 5CJ0A 3H1LD 2K3RA 2M5AA 4ASWA 1OFCX 5CCHA 5KLVG 1YQ4C 3HD7C 3L70E 1HTLC 4HKZH 4WY4B 3AECC 4UB8E 2Q9IA 3L74E 1IFIA 1HH0A 1RQVA 1S5LX 3H1IE 4M3LA 4H44D 1OMIA 1J1DC 5AW8B 3D71A 1FDIA 1Z56A 3L71E 3RL0g 4C46A 1L4AA 1P84H 3NMDA 5APXA 4HJGH 3C8VA 5DJUB 4YTPC 1VQPP 3PLNA 1M1JA 3RGUA 1IJDB 1OVVA 2KP8A 1TU3F 2V7QH 2QJYC 1L0LD 4H0LD 3RK2D 2WQYC 1OW7A 1VPCA 1Y8AA 2POHA 1ZW0A 2C0WA 3USSA 1GDTA 1J1EB 1VL2A 1SVFA 2E74D 2JO1A 3RK2B 1M1JB 3MP7B 3H6PA 5M1BA 2WT7A 1USEA 1H89A 1L4AB 2IFNA 2O01H 3CLQA 3PP5A 4WY4D 2KS1B 3L74D 1KORA 2N1TD 1PGJA 3T97A 1FE6A 1JB0J 1LJ2A 1BSNA 1N7LA 1PPJG 2HLOA 1PZQA 3AEAC 1PGOA 1NHLA 1S72P 1HWTC 5CCGD 4MN4C 1SQXE 4K35A 2YXRB 3MZWB 2M5AB 1L0LG 1URQC 1LTBC 4PJ0E 3CWBG 3SWFA 4OGQD 3RK3E 1HF9A 2QSIA 1JTHB 3AEFC 4WY4A 4L73A 3H1HJ 2FFDB 1SQPJ 4W7YA 1X0TA 3M9QA 3R2PA 1U7MA 2Y0DA 5KAIE 1NJIQ 3L73E 3MUDC 2FYUG 4R4LA 2QJKC 1SQBE 3JSVC 1BCCG 2KNCB 1LWUC 3KPEA 3L72E 4D6TD 1ZMEC 1JUNA 2N1TC 3CC7P 1H88A 1AVYA 2O1KA 3CX5D 1S5LH 3PH0A 1GL2D 1BE3G 2MJZA 3BATA 1RF1A 1KYOD 1BGYD 2JP3A 2ZYGA 1VQMP 1SQBK 1WMKA 2D2CB 2M0BA 5B66H 1KMIZ 4AYCA 4HB1A 1S3JA 3L70D 4EIJA 1HJ0A 2WSEJ 1NU1K 4H0LC 1FBMA 1JY2O 1MKMA 2NZ2A 2WPSA 5KTBA 1LT9B 4JPZB 1NKNA 2O1JA 3Q3DA 1OZHA 1LWUB 4I7ZC 1SQXK 1K73Q 3L73J 3H1KD 2NPSA 1LTIC 1PP9G 4GOEA 3RK3C 2Q3EA 1EXJA 3H1HE 2K9JA 1VQ5P 4H44C 5AW4B 2K37A 3P8MC 4GT1A 3H1IJ 4Y99C 5AVQB 4R4MA 1AQ5A 5CCHC 2HG5D 5L8RJ 3HD7D 3S1KA 4JBZA 3U1AA 3B4SA 4ASVA 3P7KA 2E5TA 2O01N 2R32A 1UIIA 4PV1C
chains in the Genus database with same CATH topology
1BE3G 2BCCG 1EZVG 1NTMG 1SQPG 1L0NG 3L70G 3H1IG 3H1HG 1SQXG 3H1JG 4PD4H 4U3FG 1PPJG 3L74G 5KLVG 2A06G 3H1LG 3TGUG 3L75G 1PP9G 1L0LG 1KYOH 3CWBG 1SQVG 1NTZG 1NTKG 3CXHH 3BCCG 1BGYG 1P84H 1KB9H 3L72G 2FYUG 1NU1G 2IBZG 3CX5H 1BCCG 3L73G 3L71G 3H1KG 1SQBG 1SQQG 4D6TG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 G;  2BCC G;  1EZV G;  1NTM G;  1SQP G;  1L0N G;  3L70 G;  3H1I G;  3H1H G;  1SQX G;  3H1J G;  4PD4 H;  4U3F G;  1PPJ G;  3L74 G;  5KLV G;  2A06 G;  3H1L G;  3TGU G;  3L75 G;  1PP9 G;  1L0L G;  1KYO H;  3CWB G;  1SQV G;  1NTZ G;  1NTK G;  3CXH H;  3BCC G;  1BGY G;  1P84 H;  1KB9 H;  3L72 G;  2FYU G;  1NU1 G;  2IBZ G;  3CX5 H;  1BCC G;  3L73 G;  3L71 G;  3H1K G;  1SQB G;  1SQQ G;  4D6T G; 
#chains in the Genus database with same CATH topology
 5AVT B;  5KKZ C;  1AQT A;  4PD4 I;  1JEK A;  4GOD A;  1L4A C;  1R5S A;  3O6Q A;  1YJN P;  1QVG O;  1T2K D;  1RE3 C;  2PP6 A;  5AW7 B;  3CX5 E;  1NO4 A;  4GIF A;  5KLV K;  1L0L E;  1VF5 D;  5BU5 A;  1KQS O;  3W67 A;  2QEX P;  2KB7 P;  3FX0 A;  3IF4 A;  2OYO A;  4IL6 X;  3CWB D;  2BEZ F;  5GTH H;  3EFG A;  3H1L G;  5CCG A;  1YJ9 P;  2W6A A;  3IN6 A;  1N7S D;  1SFC C;  5AVZ B;  4W80 A;  3CCE P;  2WVR A;  3H1K J;  2QG4 A;  1CI6 A;  3E1R A;  3SWY A;  4DJG A;  2H7H A;  1EDK A;  3CXH H;  1NYH A;  2V4H A;  1M1K Q;  3V6I A;  1S1C X;  3HUS A;  3Q5R A;  2Y9Z A;  1QEX A;  1ZLL A;  2Q3I A;  2FYU K;  2Z5H A;  3CX5 H;  3L70 J;  2YIU C;  3GF7 A;  2PRR A;  1HGZ A;  2G8Y A;  2N1T B;  3AEB C;  2M3B A;  1URQ A;  1KIL C;  1R5L A;  1EZV D;  1OWA A;  1PP9 E;  2FYU E;  3L4F A;  4XE5 B;  5KLV J;  3PJS K;  1KZU B;  3CCJ P;  1H0T B;  1NU1 J;  2B87 A;  1MFT A;  4DT0 A;  3WU2 E;  1FZC B;  3JCU H;  4N78 D;  1PIX A;  4GKG A;  2Z4E A;  1QL2 A;  2ZYA A;  1VQ8 P;  2A06 E;  1W2E A;  2OYI A;  3KXD A;  1JOC A;  1N7S A;  3Q1M A;  1DEE G;  4YXD C;  1X8Y A;  3V4W A;  1KFN A;  3L74 G;  4H13 B;  1RF1 C;  5APQ A;  2BEQ D;  1FZF A;  3E7K A;  2E74 B;  3GF3 A;  3GLM A;  1M8O B;  4JQ0 D;  3L75 G;  1USD A;  1FU1 A;  3AE8 C;  4KJM A;  3TDK A;  3EWK A;  2KI7 B;  5KLI B;  3CCQ P;  2OYH B;  1ZOY C;  1KN7 A;  3BCC G;  3S9O A;  2AEM A;  3A0H E;  4BRY A;  3KHU A;  4Z1M H;  2YO3 A;  2QA4 P;  1XTG B;  3G9R A;  4ZKP A;  3A0B E;  1VF5 C;  2AEJ A;  1GMJ A;  2I1J A;  2IBZ I;  2OGU A;  2FY8 A;  2Q1K A;  1FZA A;  4GOF A;  4BXL A;  4D6T G;  3CC4 P;  1ZV8 A;  2W27 A;  1YJW P;  4CPG A;  3C9I A;  1W2B O;  2FYU D;  1KIL B;  3HTK A;  3WUT A;  2IBZ D;  2ZVN B;  1HGV A;  2WSC H;  3A5T A;  3Q5S A;  2IPP A;  2A45 G;  2FYN C;  4HH2 A;  2P7J A;  4C7R A;  3HE5 A;  5KKZ B;  3N4X A;  2B9B A;  2P67 A;  2Q7C A;  2ZVO B;  1N73 B;  3HD7 B;  1KIL E;  1DEB A;  2Q5U A;  3CXH D;  3GW6 A;  1SQB J;  3A0B H;  3MHV A;  4OVN F;  3GHG A;  1LTT C;  2J59 M;  1KC8 Q;  1KYO H;  1KTM A;  1SQQ E;  1ZN5 A;  2A06 D;  2BCC E;  3TNU A;  2A45 H;  2BAS A;  3M0D C;  3CCS P;  2XDJ A;  3L72 G;  1GL2 A;  1QX8 A;  3VP8 A;  1SQB D;  1EZV E;  2OQQ A;  1LTS C;  2C0X A;  3AE6 C;  1EDL A;  3A2A A;  3WMM 0;  2OYI C;  3D70 A;  4IFD K;  4KHX A;  4TLF A;  1A02 F;  3CL3 D;  4L75 A;  5AVW B;  1K05 A;  1RE4 C;  3O8Z A;  2WPQ A;  1SQX D;  2FYU J;  2LR2 A;  3PHL A;  3VMX A;  1L4A D;  1NTM K;  3HUS C;  4D6T J;  2AXT E;  1GU5 A;  1N73 C;  5DJT B;  1VQO P;  1IFN A;  1KQL A;  2IFM A;  1MFZ A;  1Q90 D;  2N9B A;  3B71 A;  1YHQ P;  4EYY Q;  1SS1 A;  1IC2 A;  4PD4 D;  5AVU B;  1NAF A;  1LP1 B;  4NPD A;  2JJL A;  3MIW A;  4AUW A;  4H44 B;  1EDI A;  3B5N B;  1FDO A;  3F89 A;  4UB6 H;  5CCH D;  1DIP A;  5CBN A;  1X9V A;  3M06 A;  4OGQ C;  3TSI A;  1P84 D;  1GU4 A;  1NTK K;  1NTZ K;  3MTU E;  1BE3 D;  1FS0 E;  2KSJ A;  4RKU J;  2ZXX A;  4XA4 A;  5CCG C;  2E5Y A;  5AW1 B;  2LKM A;  1VF5 B;  3Q2Y A;  3LW5 H;  2JEE A;  1NTK D;  1NTZ D;  1FDM A;  2QE7 H;  1N86 A;  3BAS A;  1KB9 D;  3CCU P;  2W8Z A;  2OYH C;  2ZT9 D;  5KLI C;  3V5B A;  1H8A A;  1N8R Q;  2YKQ A;  4EI2 A;  1FZC C;  3L75 J;  4EDF A;  2KZJ A;  3TGU J;  2E74 C;  3F5H A;  2KLV A;  2RKL A;  3CME P;  3WUU A;  1LTJ A;  5EFW B;  1NU1 D;  2RH0 A;  2GA1 A;  2ZT9 C;  3RK2 C;  2YNY A;  3H1J G;  5KAI H;  2XU6 A;  3FWN A;  2IYO A;  3FWL A;  2IZ1 A;  3LIE A;  5APV A;  4IFF A;  1G2C B;  3CD6 P;  2A06 G;  2PGD A;  2J5U A;  3H32 A;  4U3F E;  1P84 I;  1QGK B;  2SPZ A;  2BCC J;  1S5L E;  2L91 A;  5APY A;  3VYI A;  2GUV A;  2CK3 H;  2OAR A;  1SQQ D;  3HE4 B;  4B86 A;  4L74 A;  2YIU B;  1URQ D;  1J1D B;  1YIJ P;  1K9M Q;  1VQ4 P;  1BCC E;  2QM8 A;  2FYN B;  1CW5 A;  1WT6 A;  2GUS A;  2E76 C;  3CWB J;  2UWJ E;  2HOD A;  3V2P A;  3L75 D;  4C7N B;  2KK7 A;  3GHG C;  3L72 D;  3AE2 C;  1NAY A;  4D6T E;  3H1K G;  3L37 A;  4IFM A;  4LGD E;  2HPC A;  1EDJ A;  1QVF O;  4O9B A;  1SFC B;  1J1E C;  4WY4 C;  1GTW A;  3M0A A;  1OW6 A;  1HJB A;  1AV1 A;  1NOH A;  2QJY B;  3KDP B;  3FGA D;  5AVR B;  4ZKU A;  1JM0 A;  1LTJ B;  3AE7 C;  1YIT P;  1M90 Q;  1KD1 Q;  1UIX A;  4GDO A;  4RES B;  2KSE A;  1Q2N A;  1JMB A;  5AW6 B;  2Y9Y A;  1BCC J;  2W6J H;  1IK9 A;  3H1I D;  3QH9 A;  3PRJ A;  4TT3 H;  1NTZ G;  1NTK G;  2QJP C;  3AED C;  3HRN A;  2KOG A;  4H13 C;  1FZG A;  1KB9 H;  1SQX J;  2B89 A;  5H2F H;  3FXD A;  3BCC D;  3NFQ A;  1Y9B A;  5AW3 B;  2IX7 C;  2NPS C;  3KYQ A;  5GTH E;  1JY2 P;  3B5N A;  3IFM A;  3N7N A;  1GW3 A;  1NU1 E;  1EZV G;  3H1J J;  4I7Z B;  3CX5 I;  4KT0 J;  3AE1 C;  1NTM G;  4ZMD A;  3CCM P;  1IO4 A;  1BGY J;  2LXB A;  2Z5I A;  1JMM A;  3E1I A;  1PP9 D;  1YYC A;  2FXP A;  4JYB A;  3CXH E;  4WVZ A;  5GTI E;  4IOI H;  2R44 A;  3L75 E;  3PTZ A;  1GD2 E;  1OIP A;  1PP9 J;  2KYV A;  3I55 P;  2H88 C;  1FZC A;  3C1L A;  3H1L E;  1S2E A;  4N3Y B;  2Y0E A;  5AVX B;  1XTC C;  3H1J D;  5H2F E;  3W68 A;  2C9N Y;  1M56 D;  3VP9 A;  3B8E B;  3P8C E;  1SLQ A;  2FBW C;  1SQP D;  4RJT A;  1RQU A;  3H1H D;  3AEG C;  2D2C D;  3L71 J;  3WU2 H;  1YTZ I;  3JCU E;  4A7P A;  2FXO A;  3H1K E;  3TYY A;  1GL2 B;  1FC2 C;  1WRG A;  1JCC A;  1CSB A;  2QJK B;  2QM7 A;  1EQ7 A;  1IFM A;  3V2R A;  3CC2 P;  4Y28 J;  1KV4 A;  3TNU B;  1IFP A;  1SFC A;  1M57 D;  1K04 A;  3IAO A;  1SP4 A;  1LGH B;  2XV5 A;  1RH5 B;  3A7O A;  3GHG B;  5KJ7 C;  3G3Z A;  1BCC D;  3U59 A;  5TIS H;  2BCC G;  2E76 B;  2JKV A;  5CMZ A;  1LT1 A;  3HD7 A;  3TGU E;  2HOD B;  4C7N A;  5BVZ A;  1EZV I;  3L35 A;  4PV1 B;  2K88 A;  3HE5 B;  3CCR P;  1D7M A;  1SQP G;  1SQV E;  3VOP A;  1KIL D;  1DD4 A;  3H1H G;  4OWF A;  3D6Z A;  3HTK B;  3SWK A;  2O3J A;  3HE4 A;  1KIL A;  3WUV A;  1FOS E;  2E42 A;  1RF0 A;  4DCK A;  3UIA A;  1M7L A;  2WPR A;  3H32 B;  5APT A;  2P10 A;  1G2C A;  2NRG A;  1ZRT D;  1FZB A;  1N7S C;  1HVV A;  1SFC D;  2IZ0 A;  2KUB A;  1VQ7 P;  1L0L K;  5AVV B;  3KQG A;  1JY3 N;  2FKW B;  2WSF H;  4WB4 A;  4H0L B;  3VTP C;  1L0N J;  3U1C A;  4NPE A;  1NTM J;  1PFI A;  3H1L J;  3GMA A;  4UB8 H;  1SQQ G;  1NTZ E;  1NTK E;  3CCV P;  1S4X A;  5BU8 B;  1OX3 A;  2KZI A;  4K3A A;  1FAV A;  2IBZ E;  2FYZ A;  1KFM A;  1T2K C;  2P1J A;  1X79 B;  1KYO E;  3NXS A;  1CZQ A;  1AFO A;  1P84 E;  2W90 A;  3H1I G;  1VQ6 P;  1N7S B;  3G4S P;  1NTM D;  1L0N D;  2OYI B;  5AW2 B;  4PD4 H;  2WPV B;  4DOJ A;  3MUD A;  1NTM E;  2IYP A;  1FJK A;  1H0T A;  1LP1 A;  3SSU A;  4ZNC A;  2FXM A;  1JY2 N;  2L5G B;  2N1T A;  3RK3 D;  1SQP E;  1SQV G;  1RHZ B;  2YMK A;  3HUS B;  2AXT H;  2ZFC A;  1OXZ A;  1RY3 A;  1YQ3 C;  2V7Q J;  2K9Y A;  5CBO A;  1BDC A;  3L73 G;  1CI6 B;  3D6Y A;  5AW0 B;  2P2U A;  2VRS A;  2WSF J;  2RN0 A;  3KZI H;  4OH8 B;  4PD4 E;  4PJ0 H;  5K5G B;  3LID A;  2KXP B;  1PGP A;  3EFF K;  1Q82 Q;  2Q6Q A;  3V2N A;  1GL2 C;  1T8Z A;  4N78 E;  3SFE C;  1L0N G;  2KIK A;  4IL6 E;  3ABV C;  3JC2 2;  1PPJ D;  2XND H;  3ZDM A;  5KJ7 A;  1PV3 A;  4XFJ A;  1YI2 P;  3OA7 A;  1JNM A;  3O6Q B;  5C39 A;  3OW2 O;  2WSE H;  1RE4 A;  2R3S A;  3M91 A;  1GK4 A;  1E79 H;  1T3U A;  2M3E A;  3L71 D;  1U7J A;  1IK7 A;  2O01 J;  1N73 A;  3KZI E;  3M0D A;  1L0N K;  4YPC A;  1G1I A;  1HUC A;  5APU A;  3V4Q A;  5B66 E;  1BGY G;  1RF0 C;  4I2L C;  3ITK A;  2B88 A;  1RE3 A;  1R8E A;  1JO5 A;  3BVH A;  1HBW A;  2K9J B;  2WSS H;  4IL6 H;  4DZO A;  3CPW O;  1Q7Y Q;  1NGM B;  1A02 J;  1NVO A;  2R5B A;  2NPS B;  1IFJ A;  2JR8 A;  2ZXE B;  3RK3 B;  3AEE C;  2RMZ A;  4WBA A;  1ZP0 C;  1GK6 A;  1LT9 A;  4I6M C;  4N6J A;  2QIW A;  1AA0 A;  2R3C A;  2CPS A;  1FJP A;  2QJP B;  3L70 G;  4BRY B;  1S9K E;  3H1J E;  2OYH A;  2WMM A;  3BCC J;  1Q86 Q;  2AEF A;  3G6E P;  2AXC A;  3L36 A;  2JWA A;  3M9B A;  4LC1 A;  5APS A;  2A45 I;  5CHX A;  3MGN A;  1PPJ E;  2JWD A;  1LNQ A;  3CMA P;  1BDD A;  1LTJ C;  1YBK A;  3AE4 C;  1BE3 E;  1PL5 A;  3L74 J;  1U57 A;  4RO0 A;  3SFD C;  1ZR2 A;  2YMY A;  1SQV K;  3FXE A;  2WWW A;  2K1A A;  4YXW H;  4OGQ B;  1GZL A;  1KQF B;  1G1J A;  1SQQ K;  1NU1 G;  1NKZ B;  2WZ7 A;  1JTH A;  1JY3 P;  3BCC E;  1AVO A;  2ZAE B;  2B87 B;  2W83 C;  1J2J B;  3OJA B;  3R4Y A;  2E75 D;  3RBZ A;  3VMA A;  2FFD C;  1SQB G;  1L0L J;  1URQ B;  1KB9 I;  2M8R A;  2H89 C;  3TF5 A;  2PFX A;  5CJ4 A;  3BRV B;  3P8C D;  4U7J A;  3T97 B;  1BGY E;  2I8D A;  2CPB A;  2QRX A;  4AQR D;  1X22 A;  2KS1 A;  5AVY B;  5KJ7 D;  3L72 J;  1MV8 A;  2YO2 A;  1SQX G;  3RL0 C;  1BSH A;  1KB9 E;  1EXI A;  2LXC B;  4U3F G;  2WT7 B;  2HPC B;  2P58 A;  3CCL P;  2KLU A;  2GM4 A;  1IFD A;  2WSC J;  1M1J C;  1N2D C;  1KQG B;  3TGU G;  2E43 A;  2XZR A;  1SQQ J;  2YKO A;  1OVU A;  5KLV D;  1LTG C;  2ZT9 B;  2BCC D;  1DX7 A;  1OW8 A;  4UB6 E;  1VDF A;  5TIS E;  4BWN A;  1JCD A;  4L76 A;  1W5C E;  1DH3 A;  3G71 P;  2Y0C A;  2DW3 A;  3B5N D;  5GTI H;  1KYO I;  2J58 A;  3RL0 B;  2YKP A;  4NPF X;  1FOS F;  5AVS B;  5B5E E;  4JF7 A;  3MD0 A;  3NTN A;  1ZR4 A;  3I56 P;  3A3Y B;  1Q81 Q;  1SQV D;  1EC5 A;  2H43 A;  1K8A Q;  3VMY A;  1S9K D;  3AE3 C;  1T6A A;  1GW4 A;  2PAJ A;  5AW5 B;  3TGU D;  1NWQ A;  3AE5 C;  1OVR A;  5APW A;  2OTL P;  4Y99 B;  3VN0 A;  1VQN P;  1ZRT E;  3A0H H;  3CI9 A;  2HFE D;  4U3F D;  2NPS D;  3TK1 A;  4LLH A;  3V2Q A;  1MUU A;  5KAF H;  3CWB E;  3II6 A;  3S4R A;  4WWI A;  2E75 B;  2ZJS E;  1NTZ J;  1NTK J;  2HR3 A;  2W6B A;  2XNX A;  1T3J A;  3M9H A;  3B5N C;  1PGQ A;  3IR9 A;  3Q5P A;  5AW9 B;  3CXH I;  1L0N E;  1FZE A;  1LT9 C;  2I1K A;  2WIT A;  1LWU A;  4H13 D;  3BRT B;  1BE3 J;  1E5W A;  2JDI H;  3EQ2 A;  5E79 H;  5TJH A;  5B5E H;  2OTK E;  2QVA A;  1VQK P;  2OTJ P;  4JYC A;  2H8P D;  3I5C A;  2D2C C;  3OAK A;  1LTA C;  4U3F J;  3K5B A;  3P32 A;  1YTZ T;  3H25 A;  1ZXG A;  1JY3 O;  4I1L A;  3GG2 A;  3QWO C;  2WTY A;  2IDB A;  1DD3 A;  4HYT B;  2IBZ G;  1IZN B;  1AJY A;  3L71 G;  3LW5 J;  3RL0 D;  5KAF E;  2XKM A;  1RF1 B;  1VQL P;  1SQV J;  2MKV A;  1QL1 A;  1SQP K;  2HYN A;  3L73 D;  1L2P A;  2YXQ B;  2G3A A;  2ITA A;  4W7Z A;  2KNC A;  2R5D A;  4QMA A;  3AE9 C;  5E79 E;  2ZYD A;  3VMZ A;  1MZ9 A;  5KLV E;  1VQ9 P;  4EOT A;  2E75 C;  4PV1 D;  2FFD A;  2N9Y B;  3RBX A;  1NH4 A;  2C9L Y;  1QLE D;  2E76 D;  1Y47 A;  5CJ0 A;  3H1L D;  2K3R A;  2M5A A;  4ASW A;  1OFC X;  5CCH A;  5KLV G;  1YQ4 C;  3HD7 C;  3L70 E;  1HTL C;  4HKZ H;  4WY4 B;  3AEC C;  4UB8 E;  2Q9I A;  3L74 E;  1IFI A;  1HH0 A;  1RQV A;  1S5L X;  3H1I E;  4M3L A;  4H44 D;  1OMI A;  1J1D C;  5AW8 B;  3D71 A;  1FDI A;  1Z56 A;  3L71 E;  3RL0 g;  4C46 A;  1L4A A;  1P84 H;  3NMD A;  5APX A;  4HJG H;  3C8V A;  5DJU B;  4YTP C;  1VQP P;  3PLN A;  1M1J A;  3RGU A;  1IJD B;  1OVV A;  2KP8 A;  1TU3 F;  2V7Q H;  2QJY C;  1L0L D;  4H0L D;  3RK2 D;  2WQY C;  1OW7 A;  1VPC A;  1Y8A A;  2POH A;  1ZW0 A;  2C0W A;  3USS A;  1GDT A;  1J1E B;  1VL2 A;  1SVF A;  2E74 D;  2JO1 A;  3RK2 B;  1M1J B;  3MP7 B;  3H6P A;  5M1B A;  2WT7 A;  1USE A;  1H89 A;  1L4A B;  2IFN A;  2O01 H;  3CLQ A;  3PP5 A;  4WY4 D;  2KS1 B;  3L74 D;  1KOR A;  2N1T D;  1PGJ A;  3T97 A;  1FE6 A;  1JB0 J;  1LJ2 A;  1BSN A;  1N7L A;  1PPJ G;  2HLO A;  1PZQ A;  3AEA C;  1PGO A;  1NHL A;  1S72 P;  1HWT C;  5CCG D;  4MN4 C;  1SQX E;  4K35 A;  2YXR B;  3MZW B;  2M5A B;  1L0L G;  1URQ C;  1LTB C;  4PJ0 E;  3CWB G;  3SWF A;  4OGQ D;  3RK3 E;  1HF9 A;  2QSI A;  1JTH B;  3AEF C;  4WY4 A;  4L73 A;  3H1H J;  2FFD B;  1SQP J;  4W7Y A;  1X0T A;  3M9Q A;  3R2P A;  1U7M A;  2Y0D A;  5KAI E;  1NJI Q;  3L73 E;  3MUD C;  2FYU G;  4R4L A;  2QJK C;  1SQB E;  3JSV C;  1BCC G;  2KNC B;  1LWU C;  3KPE A;  3L72 E;  4D6T D;  1ZME C;  1JUN A;  2N1T C;  3CC7 P;  1H88 A;  1AVY A;  2O1K A;  3CX5 D;  1S5L H;  3PH0 A;  1GL2 D;  1BE3 G;  2MJZ A;  3BAT A;  1RF1 A;  1KYO D;  1BGY D;  2JP3 A;  2ZYG A;  1VQM P;  1SQB K;  1WMK A;  2D2C B;  2M0B A;  5B66 H;  1KMI Z;  4AYC A;  4HB1 A;  1S3J A;  3L70 D;  4EIJ A;  1HJ0 A;  2WSE J;  1NU1 K;  4H0L C;  1FBM A;  1JY2 O;  1MKM A;  2NZ2 A;  2WPS A;  5KTB A;  1LT9 B;  4JPZ B;  1NKN A;  2O1J A;  3Q3D A;  1OZH A;  1LWU B;  4I7Z C;  1SQX K;  1K73 Q;  3L73 J;  3H1K D;  2NPS A;  1LTI C;  1PP9 G;  4GOE A;  3RK3 C;  2Q3E A;  1EXJ A;  3H1H E;  2K9J A;  1VQ5 P;  4H44 C;  5AW4 B;  2K37 A;  3P8M C;  4GT1 A;  3H1I J;  4Y99 C;  5AVQ B;  4R4M A;  1AQ5 A;  5CCH C;  2HG5 D;  5L8R J;  3HD7 D;  3S1K A;  4JBZ A;  3U1A A;  3B4S A;  4ASV A;  3P7K A;  2E5T A;  2O01 N;  2R32 A;  1UII A;  4PV1 C; 
#chains in the Genus database with same CATH homology
 1BE3 G;  2BCC G;  1EZV G;  1NTM G;  1SQP G;  1L0N G;  3L70 G;  3H1I G;  3H1H G;  1SQX G;  3H1J G;  4PD4 H;  4U3F G;  1PPJ G;  3L74 G;  5KLV G;  2A06 G;  3H1L G;  3TGU G;  3L75 G;  1PP9 G;  1L0L G;  1KYO H;  3CWB G;  1SQV G;  1NTZ G;  1NTK G;  3CXH H;  3BCC G;  1BGY G;  1P84 H;  1KB9 H;  3L72 G;  2FYU G;  1NU1 G;  2IBZ G;  3CX5 H;  1BCC G;  3L73 G;  3L71 G;  3H1K G;  1SQB G;  1SQQ G;  4D6T G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...