4D6TG

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4d6tG00
4D6TG 1PPJG 5KLVG 3L73G 1NU1G 2BCCG 3L71G 3CX5H 4PD4H 1SQXG 1EZVG 3H1IG 1KB9H 1BCCG 1KYOH 1NTMG 3H1JG 3H1KG 2A06G 3H1LG 1SQBG 3CWBG 1PP9G 3H1HG 1SQVG 3L74G 3L72G 3TGUG 2FYUG 1P84H 3CXHH 3L75G 1NTKG 1NTZG 1L0LG 1SQPG 2IBZG 1L0NG 4U3FG 1SQQG 1BGYG 3L70G 3BCCG 1BE3G
chains in the Genus database with same CATH superfamily
3TGUE 2E74C 4GOFA 1JY2O 2I1KA 5KAIH 1NTMK 1R5LA 1N7SD 3B5NB 2QVAA 4PV1C 2P67A 2PGDA 2XDJA 1VPCA 3SWKA 3WUTA 2R5BA 2WPRA 5GTHH 2G3AA 1Y9BA 1LTJB 2IBZE 4PD4I 3Q2YA 2XV5A 4C7RA 3AE7C 3ZDMA 4B86A 2A06E 1SP4A 2ZVOB 1AQ5A 1SQXJ 3KZIE 1OIPA 2L91A 3OAKA 2FYZA 2FXOA 2W8ZA 1ZMEC 2ZT9D 5AVZB 4IFDK 2ZFCA 1PP9E 2BCCJ 3AE5C 1JY3P 2OYOA 1KILA 1Y47A 2K37A 1NTKJ 2JDIH 2M3EA 3HUSC 1BCCE 1FAVA 2AXTE 5B5EE 3RK2B 1EZVD 3L75E 1NTMD 1GU4A 3M0DA 3PHLA 3CXHE 3IFMA 1GD2E 3H1JJ 3CWBJ 1YHQP 3EFFK 1PGJA 3B5NA 1YJWP 2KLUA 3RK3E 1LWUB 2E43A 4M3LA 1SQBJ 1Z56A 2FFDB 2WSFJ 1LTJA 1S5LE 1QX8A 1KQGB 5E79H 3L70G 3CD6P 1H0TB 3RL0C 2JKVA 2W6AA 4YXWH 1U7JA 5AW5B 1L4AD 4KT0J 3AE2C 4H13B 1HTLC 1M56D 1USDA 1GMJA 3M9QA 5CCHC 2OTKE 1KB9H 4KJMA 3P8CE 2WVRA 1N73B 1URQC 2QIWA 5GTIH 1N86A 3AE4C 1S3JA 3V5BA 1RF0A 2AXCA 2O3JA 1NU1G 1X22A 2AEJA 4I7ZB 1S4XA 4WY4C 3M9HA 2KB7P 1MUUA 2KNCB 3VMAA 1ZW0A 3H1LG 4HYTB 2FYUJ 2MJZA 1SQXE 5AW0B 2FKWB 4Y99C 3BVHA 1SQQG 3MIWA 4Z1MH 4BRYA 1IC2A 1NTZE 1YTZT 1JEKA 3FGAD 2WSEJ 1U57A 1KQFB 1KD1Q 2N1TA 2BCCE 2H8PD 1LWUA 4OGQD 1SQPG 2RMZA 2E76C 3BCCD 3GG2A 4XA4A 1RF1B 1JY3O 1VQOP 2WITA 2FFDA 4L76A 5TJHA 5KJ7C 1NTKE 2H89C 2JWAA 1SQVK 1GK6A 3H1HD 2ZXEB 2O01J 3RK3C 3GHGC 2QG4A 1VF5B 1PPJE 2WQYC 1H0TA 2AEFA 3B8EB 4DZOA 1PGQA 1EQ7A 3GMAA 3H1JE 3CWBE 1L4AB 1T2KD 2PFXA 1KN7A 1HUCA 1JMMA 2I8DA 1PGPA 2BASA 3GW6A 2AEMA 2WPSA 4DT0A 4EYYQ 3CCLP 3CC7P 3NTNA 3JCUE 3A0BE 1NH4A 2QJKC 1L0NJ 1AVYA 3HE4A 1BGYG 5KLVG 1SQBE 3C1LA 3CXHI 3HD7A 1JO5A 2Q5UA 1N73A 2PP6A 5CCGC 5KLIB 3D71A 2YMYA 4GOEA 1LT1A 1Q2NA 2OTLP 4IFFA 1JB0J 1FZCC 1S5LX 3CC4P 2R32A 5CBNA 1LT9C 2JR8A 5AVQB 1YQ3C 3CCSP 2B9BA 1N7SC 2YMKA 4L75A 2WPQA 2ZVNB 1SFCB 2XZRA 2POHA 2QM7A 2XKMA 2W27A 3L73D 1KQLA 1IFPA 1LJ2A 1SVFA 3OJAB 1K9MQ 1EZVG 1SQVD 3KXDA 5AW8B 1NTMG 4K35A 3O6QB 2IFMA 3M06A 4N78E 5APUA 1H89A 1PGOA 1ZR2A 4QMAA 5APYA 1KFMA 4PD4E 1NHLA 2KK7A 1RH5B 1RQUA 2FYUE 1K05A 2W6JH 2KZJA 5AVUB 1TU3F 2KS1B 1VQKP 2WZ7A 1KILD 1KYOI 1M1JC 4L74A 3S1KA 2ZT9C 4UB8E 1D7MA 2E5TA 2KYVA 4O9BA 3W68A 3HE5B 1PIXA 2NZ2A 2KXPB 1S9KE 1KB9D 2H7HA 1P84H 2D2CD 4UB6H 3TF5A 1L0LJ 2Q1KA 3L70D 1FJKA 4W7YA 4I1LA 5KKZB 2P7JA 3N4XA 4IFMA 1BE3G 2W83C 5KAFE 1UIIA 3WU2H 4K3AA 3B5ND 4N6JA 1YI2P 3VMYA 2WSFH 1KC8Q 4RESB 4GDOA 1ZRTE 5BU5A 2VRSA 3GF3A 4RKUJ 3CX5E 5APXA 3VYIA 1SFCA 4GT1A 3AE3C 1S72P 3K5BA 1AFOA 3HTKB 1L0NE 1H8AA 3JSVC 3F5HA 3L72G 2YKPA 5KTBA 4EIJA 3V6IA 1M1KQ 3A2AA 2YIUC 5DJTB 1G2CB 2Y0CA 3PLNA 1BDCA 3H1LD 4OVNF 2OYHC 1AA0A 3H1KJ 3AE8C 1IK7A 3Q5SA 3FWLA 2IX7C 2QE7H 2LR2A 1J1EC 3U59A 1H88A 3L71D 4D6TJ 1NU1J 1U7MA 1JOCA 1GDTA 2OGUA 4H0LB 1KFNA 2Y9ZA 1VQ5P 1QL1A 1JUNA 1X9VA 1NJIQ 2P10A 1SQPD 2P2UA 3KYQA 1YJ9P 1CSBA 5BU8B 1HWTC 3VMXA 2V7QH 1VL2A 2I1JA 1J1DB 1PL5A 5CJ0A 1R8EA 2N1TD 2Q6QA 2E75C 2C9NY 3BRVB 1BGYD 5KLVD 1KZUB 1LTSC 3HTKA 1QVGO 1KMIZ 2N9YB 3V2QA 3WMM0 1N7LA 3V2PA 3TSIA 2OYIB 1L0LE 1G2CA 3TK1A 3GHGB 4XE5B 1RY3A 3GLMA 2N9BA 1NTZJ 1Y8AA 3TNUA 2CPBA 2JEEA 1QVFO 4H13D 3R4YA 1ZR4A 1ZP0C 1JCCA 2C0WA 2HPCB 2DW3A 2KIKA 3L73G 1T2KC 1VQPP 3NMDA 3M9BA 3HD7D 1T6AA 3TGUG 1SQVG 4JF7A 1MFTA 1KQSO 2NPSC 1VQ7P 2O1JA 4U3FD 2QJPB 1FC2C 1K73Q 2Q9IA 1LTGC 3PH0A 4JYBA 1NAYA 3M0AA 1W2BO 4ZNCA 1NGMB 3H1ID 1E79H 1R5SA 2QRXA 1URQA 2G8YA 3CX5I 1E5WA 1P84D 4BRYB 2BEQD 1N8RQ 1WRGA 3H1KE 2ITAA 3BRTB 2N1TB 2GM4A 1YYCA 3W67A 3N7NA 4D6TE 3LW5H 1NU1E 1RE4C 2K9YA 3G6EP 1NAFA 2QA4P 3IR9A 2Z5HA 2CK3H 1FOSF 1VF5D 2M5AB 2KOGA 3L74J 2ZXXA 3CL3D 3AEEC 4LLHA 2OYIA 1BE3D 2FYNB 4H44C 3GHGA 3CPWO 2J59M 2CPSA 1G1IA 1BCCG 3HE4B 4KHXA 3HD7B 2HPCA 5TISE 3KZIH 3CCMP 1X0TA 5AVRB 1KILC 2FXPA 5AW3B 1Q7YQ 3R2PA 4LGDE 3QWOC 1WMKA 1KYOE 3MD0A 4L73A 1OW7A 4AYCA 3L72D 4PJ0E 2D2CC 1GL2C 3M0DC 3U1AA 2H88C 1YJNP 2E74D 1OFCX 1EDIA 1EDJA 4GODA 3CCQP 2WSSH 3L71G 3B5NC 2AXTH 5B5EH 1SFCD 2XNDH 2B87B 3H6PA 1S9KD 3I55P 3CXHH 5APSA 2RN0A 2M3BA 3JC22 1HBWA 2QJYB 3MUDA 2WSCH 1EXJA 1LTJC 5B66E 3D70A 2HYNA 3VOPA 5K5GB 1FJPA 2B88A 1FOSE 1KB9I 1OWAA 2M5AA 3BCCJ 1OX3A 3A0HE 1YITP 2O01N 1S5LH 1GW3A 5H2FE 3H1HJ 2O1KA 1RE3C 2LXCB 1NKNA 2PRRA 3SFDC 3SWYA 1SQXG 1MZ9A 1W5CE 1RF0C 5AW4B 1VQ4P 3AEAC 3GF7A 3ABVC 2R3SA 3CC2P 4YTPC 4AUWA 3RK2C 2YO3A 2GUVA 3L74E 2ZYGA 2E74B 4ZKUA 3AE9C 4IL6E 3T97A 4PV1B 1JY2N 3G9RA 1NTKG 1S2EA 4U3FG 3V2RA 1LWUC 1PPJG 2B87A 2KZIA 1Q82Q 1GK4A 3TDKA 2M8RA 3H1IG 3VTPC 3TGUD 3BASA 3H1JG 3SWFA 3CWBG 1FDOA 2FFDC 4I2LC 4RJTA 1MKMA 1CI6B 5AVSB 3OW2O 1IFDA 3I5CA 3L73J 1NYHA 3C9IA 3RBZA 4HKZH 3CLQA 3RL0D 4A7PA 1QEXA 1SQBG 4DJGA 4XFJA 4JBZA 2IBZD 1HJ0A 4H13C 3RGUA 4OWFA 5EFWB 1NWQA 2A06D 4H0LD 3L36A 2A45G 1BDDA 1N73C 1URQD 1DEEG 3G3ZA 1FZFA 5KAIE 3JCUH 3A0BH 4EOTA 3HUSB 4NPFX 4I7ZC 5AVXB 2IFNA 4JYCA 1PP9D 1QL2A 1ZOYC 3B4SA 3MZWB 5AW6B 3BCCE 2HODB 2IPPA 1M90Q 5M1BA 5GTHE 4R4LA 4LC1A 3KQGA 3L70J 3H1HE 3L4FA 3FXEA 2Z4EA 2MKVA 1LTTC 1BCCD 2A45H 1VQMP 2FBWC 3L75D 1XTCC 3CXHD 1NKZB 2E76D 3PP5A 1VQ8P 4ASVA 1RF1C 1DX7A 5APWA 5KJ7D 3AE1C 1SQXK 1CI6A 3TNUB 2B89A 3KDPB 3RK3D 1EZVI 1VF5C 1IO4A 1NTZK 1W2EA 3RL0B 2R5DA 1T3JA 1P84I 1L4AC 1FZGA 4PD4H 3NFQA 3VP9A 3USSA 4NPDA 2QM8A 3E1RA 2R44A 1DD4A 3H1LJ 3UIAA 2HFED 4U7JA 2KP8A 2WPVB 1NTKK 1PFIA 3Q5PA 5APTA 3QH9A 1URQB 1X8YA 3A5TA 1HJBA 1SQQJ 4JPZB 1MV8A 4W7ZA 5KLIC 1VQNP 2NPSA 3L71J 5L8RJ 2LXBA 1VDFA 4UB8H 2E42A 4WY4B 1YBKA 2WSEH 3HUSA 4ZKPA 3IF4A 2NRGA 3L73E 3MP7B 1AQTA 3P8CD 1SQPJ 1L0NG 2WWWA 2IZ0A 2YXQB 5C39A 2YKOA 4Y99B 3IAOA 1SQVE 1LGHB 2HODA 1VQ9P 2O01H 1SQBK 3V4WA 5KAFH 1KYOD 2KSEA 1SFCC 1FBMA 1HVVA 3AEDC 5E79E 3V2NA 1GZLA 4OGQC 1FU1A 2E76B 1IJDB 1AV1A 1SQXD 5CHXA 3FX0A 1RE4A 1NO4A 3CX5H 5AVYB 4JQ0D 3II6A 1KILE 2HG5D 1NTZD 3RK3B 2YO2A 1JY3N 1A02J 2JJLA 2K1AA 1FDMA 2OTJP 2BCCD 1BGYJ 5KLVJ 1KB9E 1UIXA 1VQLP 1RQVA 2KLVA 1OVUA 5GTIE 3L70E 1NTKD 2ZYAA 1JMBA 1K8AQ 1PPJD 2QJKB 4WWIA 5CCHA 3CMAP 1L2PA 3H1JD 3CWBD 1N2DC 2FYUK 2HR3A 3U1CA 2RKLA 5BVZA 1ZLLA 1FZAA 3P7KA 2XU6A 4WY4A 5KKZC 5AW9B 1NOHA 2IBZG 2W90A 4U3FJ 4EDFA 1A02F 1FZCB 3VN0A 4YXDC 3H1IJ 2WTYA 1GL2A 1SQBD 1LT9B 1NTMJ 2A06G 3CCJP 2ZYDA 1N7SB 5APQA 1DD3A 1L0LG 3NXSA 2WT7B 1DIPA 3H1LE 2K9JB 2FY8A 3L74D 1OMIA 4IOIH 1OW8A 1SQQE 1IZNB 1PP9G 1YIJP 3L71E 3P8MC 1EDLA 5KJ7A 5AW1B 1IFNA 4R4MA 1SQPE 3BATA 3FXDA 1GU5A 4HB1A 3L75G 1L0NK 1M1JB 4N78D 1WT6A 2ZT9B 1SS1A 3S9OA 1BE3J 4PD4D 2Y9YA 1ZV8A 1T3UA 3MTUE 1HGVA 1NVOA 1RE3A 4H0LC 2FYUD 3H1KG 2K88A 3V4QA 2Z5IA 2JWDA 3A7OA 3H32B 5CMZA 5CCGA 1KORA 1JTHB 4N3YB 3T97B 4D6TG 1CZQA 1M57D 1T8ZA 2WMMA 3Q5RA 1DH3A 1LTAC 2JP3A 1LP1B 4PV1D 1FZCA 1BGYE 5KLVE 1HGZA 1J1DC 3L72J 4YPCA 1JM0A 5AVTB 1IK9A 1LT9A 2IBZI 1N7SA 1VQ6P 4Y28J 3D6ZA 2R3CA 2E75D 2C9LY 2QSIA 1BSHA 3RBXA 2WT7A 3CI9A 2K9JA 4C7NB 1FZEA 1QLED 2V7QJ 1YQ4C 1KTMA 2YIUB 4I6MC 1ZRTD 4TT3H 3CCVP 2Q7CA 2OYIC 3CX5D 4NPEA 2HLOA 1AJYA 1SLQA 4U3FE 2OYHB 2YXRB 4OH8B 4W80A 1L0ND 3PRJA 1FS0E 3HRNA 2PAJA 3H1IE 1EZVE 1LTBC 2ZAEB 1NTME 1OVRA 3LIEA 2OARA 1J1EB 3ITKA 2K3RA 2H43A 4CPGA 1X79B 1OXZA 4AQRD 1P84E 3AECC 1M1JA 3D6YA 4UB6E 2KI7B 2NPSD 1EDKA 2QJPC 1L0LK 3F89A 2RH0A 1NTZG 2GUSA 3WU2E 1EC5A 2KSJA 5TISH 2IYOA 3Q1MA 1MFZA 2M0BA 2BCCG 3H32A 2ZJSE 1KYOH 1JTHA 3I56P 1XTGB 1QGKB 3EWKA 1RHZB 4PJ0H 3G4SP 5AVVB 1LP1A 2KNCA 3EFGA 2N1TC 2SPZA 3AEBC 2GA1A 3O8ZA 4GKGA 3VP8A 1G1JA 3EQ2A 1AVOA 1LNQA 3MUDC 2E75B 5AVWB 4HJGH 3Q3DA 3L35A 1BE3E 3OA7A 3B71A 3L37A 1EXIA 1K04A 2KUBA 3G71P 1FDIA 3E7KA 4OGQB 2BEZF 5APVA 4WVZA 3AEFC 4GIFA 4WB4A 5AW2B 1Q81Q 1OW6A 4DOJA 4C7NA 1JY2P 3VMZA 4MN4C 1RF1A 3TGUJ 1SQVJ 5B66H 2Y0DA 3FWNA 1PV3A 2J58A 3WUVA 2Q3IA 3LW5J 3WUUA 2FYNC 1NU1K 4H44D 2OYHA 1ZN5A 1FZBA 3L72E 3LIDA 5CCHD 2LKMA 3A0HH 5DJUB 3S4RA 3HD7C 1L4AA 2IYPA 3L74G 3SFEC 1L0LD 2NPSB 1SQQK 5H2FH 2FXMA 3AEGC 2V4HA 4WY4D 3SSUA 1OZHA 5AW7B 3E1IA 1S1CX 2IZ1A 1LTIC 1GL2D 1SQPK 4RO0A 4WBAA 1OVVA 3H25A 3CMEP 1JCDA 3CCEP 2UWJE 1ZXGA 2Q3EA 1IFJA 5CJ4A 1JNMA 1DEBA 3RL0g 4ASWA 1GTWA 1M7LA 1PP9J 2FYUG 1Q90D 2XNXA 1USEA 2P1JA 4IL6H 2QJYC 2YNYA 1KV4A 1M8OB 3P32A 2J5UA 2QEXP 3H1KD 1BCCJ 1FE6A 2L5GB 2E5YA 2IDBA 3PTZA 3KHUA 3L75J 1CW5A 5KLVK 1YTZI 4TLFA 4D6TD 3KPEA 4EI2A 1NU1D 3O6QA 4HH2A 4ZMDA 3TYYA 4H44B 1HH0A 2WSCJ 1HF9A 5CBOA 4BWNA 4IL6X 3MHVA 3C8VA 3CCRP 1GW4A 1BSNA 2OQQA 1SQQD 1Q86Q 4DCKA 1PZQA 1KILB 1J2JB 1IFMA 4BXLA 3BCCG 2KS1A 2P58A 1IFIA 5CCGD 2YKQA 2JO1A 3A3YB 3CCUP 4C46A 2Y0EA 3IN6A 3H1HG 3MGNA 2C0XA 2A45I 3AE6C 2W6BA 3HE5A 2D2CB 1GL2B 3RK2D 3PJSK 3M91A
chains in the Genus database with same CATH topology
4D6TG 1PPJG 5KLVG 3L73G 1NU1G 2BCCG 3L71G 3CX5H 4PD4H 1SQXG 1EZVG 3H1IG 1KB9H 1BCCG 1KYOH 1NTMG 3H1JG 3H1KG 2A06G 3H1LG 1SQBG 3CWBG 1PP9G 3H1HG 1SQVG 3L74G 3L72G 3TGUG 2FYUG 1P84H 3CXHH 3L75G 1NTKG 1NTZG 1L0LG 1SQPG 2IBZG 1L0NG 4U3FG 1SQQG 1BGYG 3L70G 3BCCG 1BE3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T G;  1PPJ G;  5KLV G;  3L73 G;  1NU1 G;  2BCC G;  3L71 G;  3CX5 H;  4PD4 H;  1SQX G;  1EZV G;  3H1I G;  1KB9 H;  1BCC G;  1KYO H;  1NTM G;  3H1J G;  3H1K G;  2A06 G;  3H1L G;  1SQB G;  3CWB G;  1PP9 G;  3H1H G;  1SQV G;  3L74 G;  3L72 G;  3TGU G;  2FYU G;  1P84 H;  3CXH H;  3L75 G;  1NTK G;  1NTZ G;  1L0L G;  1SQP G;  2IBZ G;  1L0N G;  4U3F G;  1SQQ G;  1BGY G;  3L70 G;  3BCC G;  1BE3 G; 
#chains in the Genus database with same CATH topology
 3TGU E;  2E74 C;  4GOF A;  1JY2 O;  2I1K A;  5KAI H;  1NTM K;  1R5L A;  1N7S D;  3B5N B;  2QVA A;  4PV1 C;  2P67 A;  2PGD A;  2XDJ A;  1VPC A;  3SWK A;  3WUT A;  2R5B A;  2WPR A;  5GTH H;  2G3A A;  1Y9B A;  1LTJ B;  2IBZ E;  4PD4 I;  3Q2Y A;  2XV5 A;  4C7R A;  3AE7 C;  3ZDM A;  4B86 A;  2A06 E;  1SP4 A;  2ZVO B;  1AQ5 A;  1SQX J;  3KZI E;  1OIP A;  2L91 A;  3OAK A;  2FYZ A;  2FXO A;  2W8Z A;  1ZME C;  2ZT9 D;  5AVZ B;  4IFD K;  2ZFC A;  1PP9 E;  2BCC J;  3AE5 C;  1JY3 P;  2OYO A;  1KIL A;  1Y47 A;  2K37 A;  1NTK J;  2JDI H;  2M3E A;  3HUS C;  1BCC E;  1FAV A;  2AXT E;  5B5E E;  3RK2 B;  1EZV D;  3L75 E;  1NTM D;  1GU4 A;  3M0D A;  3PHL A;  3CXH E;  3IFM A;  1GD2 E;  3H1J J;  3CWB J;  1YHQ P;  3EFF K;  1PGJ A;  3B5N A;  1YJW P;  2KLU A;  3RK3 E;  1LWU B;  2E43 A;  4M3L A;  1SQB J;  1Z56 A;  2FFD B;  2WSF J;  1LTJ A;  1S5L E;  1QX8 A;  1KQG B;  5E79 H;  3L70 G;  3CD6 P;  1H0T B;  3RL0 C;  2JKV A;  2W6A A;  4YXW H;  1U7J A;  5AW5 B;  1L4A D;  4KT0 J;  3AE2 C;  4H13 B;  1HTL C;  1M56 D;  1USD A;  1GMJ A;  3M9Q A;  5CCH C;  2OTK E;  1KB9 H;  4KJM A;  3P8C E;  2WVR A;  1N73 B;  1URQ C;  2QIW A;  5GTI H;  1N86 A;  3AE4 C;  1S3J A;  3V5B A;  1RF0 A;  2AXC A;  2O3J A;  1NU1 G;  1X22 A;  2AEJ A;  4I7Z B;  1S4X A;  4WY4 C;  3M9H A;  2KB7 P;  1MUU A;  2KNC B;  3VMA A;  1ZW0 A;  3H1L G;  4HYT B;  2FYU J;  2MJZ A;  1SQX E;  5AW0 B;  2FKW B;  4Y99 C;  3BVH A;  1SQQ G;  3MIW A;  4Z1M H;  4BRY A;  1IC2 A;  1NTZ E;  1YTZ T;  1JEK A;  3FGA D;  2WSE J;  1U57 A;  1KQF B;  1KD1 Q;  2N1T A;  2BCC E;  2H8P D;  1LWU A;  4OGQ D;  1SQP G;  2RMZ A;  2E76 C;  3BCC D;  3GG2 A;  4XA4 A;  1RF1 B;  1JY3 O;  1VQO P;  2WIT A;  2FFD A;  4L76 A;  5TJH A;  5KJ7 C;  1NTK E;  2H89 C;  2JWA A;  1SQV K;  1GK6 A;  3H1H D;  2ZXE B;  2O01 J;  3RK3 C;  3GHG C;  2QG4 A;  1VF5 B;  1PPJ E;  2WQY C;  1H0T A;  2AEF A;  3B8E B;  4DZO A;  1PGQ A;  1EQ7 A;  3GMA A;  3H1J E;  3CWB E;  1L4A B;  1T2K D;  2PFX A;  1KN7 A;  1HUC A;  1JMM A;  2I8D A;  1PGP A;  2BAS A;  3GW6 A;  2AEM A;  2WPS A;  4DT0 A;  4EYY Q;  3CCL P;  3CC7 P;  3NTN A;  3JCU E;  3A0B E;  1NH4 A;  2QJK C;  1L0N J;  1AVY A;  3HE4 A;  1BGY G;  5KLV G;  1SQB E;  3C1L A;  3CXH I;  3HD7 A;  1JO5 A;  2Q5U A;  1N73 A;  2PP6 A;  5CCG C;  5KLI B;  3D71 A;  2YMY A;  4GOE A;  1LT1 A;  1Q2N A;  2OTL P;  4IFF A;  1JB0 J;  1FZC C;  1S5L X;  3CC4 P;  2R32 A;  5CBN A;  1LT9 C;  2JR8 A;  5AVQ B;  1YQ3 C;  3CCS P;  2B9B A;  1N7S C;  2YMK A;  4L75 A;  2WPQ A;  2ZVN B;  1SFC B;  2XZR A;  2POH A;  2QM7 A;  2XKM A;  2W27 A;  3L73 D;  1KQL A;  1IFP A;  1LJ2 A;  1SVF A;  3OJA B;  1K9M Q;  1EZV G;  1SQV D;  3KXD A;  5AW8 B;  1NTM G;  4K35 A;  3O6Q B;  2IFM A;  3M06 A;  4N78 E;  5APU A;  1H89 A;  1PGO A;  1ZR2 A;  4QMA A;  5APY A;  1KFM A;  4PD4 E;  1NHL A;  2KK7 A;  1RH5 B;  1RQU A;  2FYU E;  1K05 A;  2W6J H;  2KZJ A;  5AVU B;  1TU3 F;  2KS1 B;  1VQK P;  2WZ7 A;  1KIL D;  1KYO I;  1M1J C;  4L74 A;  3S1K A;  2ZT9 C;  4UB8 E;  1D7M A;  2E5T A;  2KYV A;  4O9B A;  3W68 A;  3HE5 B;  1PIX A;  2NZ2 A;  2KXP B;  1S9K E;  1KB9 D;  2H7H A;  1P84 H;  2D2C D;  4UB6 H;  3TF5 A;  1L0L J;  2Q1K A;  3L70 D;  1FJK A;  4W7Y A;  4I1L A;  5KKZ B;  2P7J A;  3N4X A;  4IFM A;  1BE3 G;  2W83 C;  5KAF E;  1UII A;  3WU2 H;  4K3A A;  3B5N D;  4N6J A;  1YI2 P;  3VMY A;  2WSF H;  1KC8 Q;  4RES B;  4GDO A;  1ZRT E;  5BU5 A;  2VRS A;  3GF3 A;  4RKU J;  3CX5 E;  5APX A;  3VYI A;  1SFC A;  4GT1 A;  3AE3 C;  1S72 P;  3K5B A;  1AFO A;  3HTK B;  1L0N E;  1H8A A;  3JSV C;  3F5H A;  3L72 G;  2YKP A;  5KTB A;  4EIJ A;  3V6I A;  1M1K Q;  3A2A A;  2YIU C;  5DJT B;  1G2C B;  2Y0C A;  3PLN A;  1BDC A;  3H1L D;  4OVN F;  2OYH C;  1AA0 A;  3H1K J;  3AE8 C;  1IK7 A;  3Q5S A;  3FWL A;  2IX7 C;  2QE7 H;  2LR2 A;  1J1E C;  3U59 A;  1H88 A;  3L71 D;  4D6T J;  1NU1 J;  1U7M A;  1JOC A;  1GDT A;  2OGU A;  4H0L B;  1KFN A;  2Y9Z A;  1VQ5 P;  1QL1 A;  1JUN A;  1X9V A;  1NJI Q;  2P10 A;  1SQP D;  2P2U A;  3KYQ A;  1YJ9 P;  1CSB A;  5BU8 B;  1HWT C;  3VMX A;  2V7Q H;  1VL2 A;  2I1J A;  1J1D B;  1PL5 A;  5CJ0 A;  1R8E A;  2N1T D;  2Q6Q A;  2E75 C;  2C9N Y;  3BRV B;  1BGY D;  5KLV D;  1KZU B;  1LTS C;  3HTK A;  1QVG O;  1KMI Z;  2N9Y B;  3V2Q A;  3WMM 0;  1N7L A;  3V2P A;  3TSI A;  2OYI B;  1L0L E;  1G2C A;  3TK1 A;  3GHG B;  4XE5 B;  1RY3 A;  3GLM A;  2N9B A;  1NTZ J;  1Y8A A;  3TNU A;  2CPB A;  2JEE A;  1QVF O;  4H13 D;  3R4Y A;  1ZR4 A;  1ZP0 C;  1JCC A;  2C0W A;  2HPC B;  2DW3 A;  2KIK A;  3L73 G;  1T2K C;  1VQP P;  3NMD A;  3M9B A;  3HD7 D;  1T6A A;  3TGU G;  1SQV G;  4JF7 A;  1MFT A;  1KQS O;  2NPS C;  1VQ7 P;  2O1J A;  4U3F D;  2QJP B;  1FC2 C;  1K73 Q;  2Q9I A;  1LTG C;  3PH0 A;  4JYB A;  1NAY A;  3M0A A;  1W2B O;  4ZNC A;  1NGM B;  3H1I D;  1E79 H;  1R5S A;  2QRX A;  1URQ A;  2G8Y A;  3CX5 I;  1E5W A;  1P84 D;  4BRY B;  2BEQ D;  1N8R Q;  1WRG A;  3H1K E;  2ITA A;  3BRT B;  2N1T B;  2GM4 A;  1YYC A;  3W67 A;  3N7N A;  4D6T E;  3LW5 H;  1NU1 E;  1RE4 C;  2K9Y A;  3G6E P;  1NAF A;  2QA4 P;  3IR9 A;  2Z5H A;  2CK3 H;  1FOS F;  1VF5 D;  2M5A B;  2KOG A;  3L74 J;  2ZXX A;  3CL3 D;  3AEE C;  4LLH A;  2OYI A;  1BE3 D;  2FYN B;  4H44 C;  3GHG A;  3CPW O;  2J59 M;  2CPS A;  1G1I A;  1BCC G;  3HE4 B;  4KHX A;  3HD7 B;  2HPC A;  5TIS E;  3KZI H;  3CCM P;  1X0T A;  5AVR B;  1KIL C;  2FXP A;  5AW3 B;  1Q7Y Q;  3R2P A;  4LGD E;  3QWO C;  1WMK A;  1KYO E;  3MD0 A;  4L73 A;  1OW7 A;  4AYC A;  3L72 D;  4PJ0 E;  2D2C C;  1GL2 C;  3M0D C;  3U1A A;  2H88 C;  1YJN P;  2E74 D;  1OFC X;  1EDI A;  1EDJ A;  4GOD A;  3CCQ P;  2WSS H;  3L71 G;  3B5N C;  2AXT H;  5B5E H;  1SFC D;  2XND H;  2B87 B;  3H6P A;  1S9K D;  3I55 P;  3CXH H;  5APS A;  2RN0 A;  2M3B A;  3JC2 2;  1HBW A;  2QJY B;  3MUD A;  2WSC H;  1EXJ A;  1LTJ C;  5B66 E;  3D70 A;  2HYN A;  3VOP A;  5K5G B;  1FJP A;  2B88 A;  1FOS E;  1KB9 I;  1OWA A;  2M5A A;  3BCC J;  1OX3 A;  3A0H E;  1YIT P;  2O01 N;  1S5L H;  1GW3 A;  5H2F E;  3H1H J;  2O1K A;  1RE3 C;  2LXC B;  1NKN A;  2PRR A;  3SFD C;  3SWY A;  1SQX G;  1MZ9 A;  1W5C E;  1RF0 C;  5AW4 B;  1VQ4 P;  3AEA C;  3GF7 A;  3ABV C;  2R3S A;  3CC2 P;  4YTP C;  4AUW A;  3RK2 C;  2YO3 A;  2GUV A;  3L74 E;  2ZYG A;  2E74 B;  4ZKU A;  3AE9 C;  4IL6 E;  3T97 A;  4PV1 B;  1JY2 N;  3G9R A;  1NTK G;  1S2E A;  4U3F G;  3V2R A;  1LWU C;  1PPJ G;  2B87 A;  2KZI A;  1Q82 Q;  1GK4 A;  3TDK A;  2M8R A;  3H1I G;  3VTP C;  3TGU D;  3BAS A;  3H1J G;  3SWF A;  3CWB G;  1FDO A;  2FFD C;  4I2L C;  4RJT A;  1MKM A;  1CI6 B;  5AVS B;  3OW2 O;  1IFD A;  3I5C A;  3L73 J;  1NYH A;  3C9I A;  3RBZ A;  4HKZ H;  3CLQ A;  3RL0 D;  4A7P A;  1QEX A;  1SQB G;  4DJG A;  4XFJ A;  4JBZ A;  2IBZ D;  1HJ0 A;  4H13 C;  3RGU A;  4OWF A;  5EFW B;  1NWQ A;  2A06 D;  4H0L D;  3L36 A;  2A45 G;  1BDD A;  1N73 C;  1URQ D;  1DEE G;  3G3Z A;  1FZF A;  5KAI E;  3JCU H;  3A0B H;  4EOT A;  3HUS B;  4NPF X;  4I7Z C;  5AVX B;  2IFN A;  4JYC A;  1PP9 D;  1QL2 A;  1ZOY C;  3B4S A;  3MZW B;  5AW6 B;  3BCC E;  2HOD B;  2IPP A;  1M90 Q;  5M1B A;  5GTH E;  4R4L A;  4LC1 A;  3KQG A;  3L70 J;  3H1H E;  3L4F A;  3FXE A;  2Z4E A;  2MKV A;  1LTT C;  1BCC D;  2A45 H;  1VQM P;  2FBW C;  3L75 D;  1XTC C;  3CXH D;  1NKZ B;  2E76 D;  3PP5 A;  1VQ8 P;  4ASV A;  1RF1 C;  1DX7 A;  5APW A;  5KJ7 D;  3AE1 C;  1SQX K;  1CI6 A;  3TNU B;  2B89 A;  3KDP B;  3RK3 D;  1EZV I;  1VF5 C;  1IO4 A;  1NTZ K;  1W2E A;  3RL0 B;  2R5D A;  1T3J A;  1P84 I;  1L4A C;  1FZG A;  4PD4 H;  3NFQ A;  3VP9 A;  3USS A;  4NPD A;  2QM8 A;  3E1R A;  2R44 A;  1DD4 A;  3H1L J;  3UIA A;  2HFE D;  4U7J A;  2KP8 A;  2WPV B;  1NTK K;  1PFI A;  3Q5P A;  5APT A;  3QH9 A;  1URQ B;  1X8Y A;  3A5T A;  1HJB A;  1SQQ J;  4JPZ B;  1MV8 A;  4W7Z A;  5KLI C;  1VQN P;  2NPS A;  3L71 J;  5L8R J;  2LXB A;  1VDF A;  4UB8 H;  2E42 A;  4WY4 B;  1YBK A;  2WSE H;  3HUS A;  4ZKP A;  3IF4 A;  2NRG A;  3L73 E;  3MP7 B;  1AQT A;  3P8C D;  1SQP J;  1L0N G;  2WWW A;  2IZ0 A;  2YXQ B;  5C39 A;  2YKO A;  4Y99 B;  3IAO A;  1SQV E;  1LGH B;  2HOD A;  1VQ9 P;  2O01 H;  1SQB K;  3V4W A;  5KAF H;  1KYO D;  2KSE A;  1SFC C;  1FBM A;  1HVV A;  3AED C;  5E79 E;  3V2N A;  1GZL A;  4OGQ C;  1FU1 A;  2E76 B;  1IJD B;  1AV1 A;  1SQX D;  5CHX A;  3FX0 A;  1RE4 A;  1NO4 A;  3CX5 H;  5AVY B;  4JQ0 D;  3II6 A;  1KIL E;  2HG5 D;  1NTZ D;  3RK3 B;  2YO2 A;  1JY3 N;  1A02 J;  2JJL A;  2K1A A;  1FDM A;  2OTJ P;  2BCC D;  1BGY J;  5KLV J;  1KB9 E;  1UIX A;  1VQL P;  1RQV A;  2KLV A;  1OVU A;  5GTI E;  3L70 E;  1NTK D;  2ZYA A;  1JMB A;  1K8A Q;  1PPJ D;  2QJK B;  4WWI A;  5CCH A;  3CMA P;  1L2P A;  3H1J D;  3CWB D;  1N2D C;  2FYU K;  2HR3 A;  3U1C A;  2RKL A;  5BVZ A;  1ZLL A;  1FZA A;  3P7K A;  2XU6 A;  4WY4 A;  5KKZ C;  5AW9 B;  1NOH A;  2IBZ G;  2W90 A;  4U3F J;  4EDF A;  1A02 F;  1FZC B;  3VN0 A;  4YXD C;  3H1I J;  2WTY A;  1GL2 A;  1SQB D;  1LT9 B;  1NTM J;  2A06 G;  3CCJ P;  2ZYD A;  1N7S B;  5APQ A;  1DD3 A;  1L0L G;  3NXS A;  2WT7 B;  1DIP A;  3H1L E;  2K9J B;  2FY8 A;  3L74 D;  1OMI A;  4IOI H;  1OW8 A;  1SQQ E;  1IZN B;  1PP9 G;  1YIJ P;  3L71 E;  3P8M C;  1EDL A;  5KJ7 A;  5AW1 B;  1IFN A;  4R4M A;  1SQP E;  3BAT A;  3FXD A;  1GU5 A;  4HB1 A;  3L75 G;  1L0N K;  1M1J B;  4N78 D;  1WT6 A;  2ZT9 B;  1SS1 A;  3S9O A;  1BE3 J;  4PD4 D;  2Y9Y A;  1ZV8 A;  1T3U A;  3MTU E;  1HGV A;  1NVO A;  1RE3 A;  4H0L C;  2FYU D;  3H1K G;  2K88 A;  3V4Q A;  2Z5I A;  2JWD A;  3A7O A;  3H32 B;  5CMZ A;  5CCG A;  1KOR A;  1JTH B;  4N3Y B;  3T97 B;  4D6T G;  1CZQ A;  1M57 D;  1T8Z A;  2WMM A;  3Q5R A;  1DH3 A;  1LTA C;  2JP3 A;  1LP1 B;  4PV1 D;  1FZC A;  1BGY E;  5KLV E;  1HGZ A;  1J1D C;  3L72 J;  4YPC A;  1JM0 A;  5AVT B;  1IK9 A;  1LT9 A;  2IBZ I;  1N7S A;  1VQ6 P;  4Y28 J;  3D6Z A;  2R3C A;  2E75 D;  2C9L Y;  2QSI A;  1BSH A;  3RBX A;  2WT7 A;  3CI9 A;  2K9J A;  4C7N B;  1FZE A;  1QLE D;  2V7Q J;  1YQ4 C;  1KTM A;  2YIU B;  4I6M C;  1ZRT D;  4TT3 H;  3CCV P;  2Q7C A;  2OYI C;  3CX5 D;  4NPE A;  2HLO A;  1AJY A;  1SLQ A;  4U3F E;  2OYH B;  2YXR B;  4OH8 B;  4W80 A;  1L0N D;  3PRJ A;  1FS0 E;  3HRN A;  2PAJ A;  3H1I E;  1EZV E;  1LTB C;  2ZAE B;  1NTM E;  1OVR A;  3LIE A;  2OAR A;  1J1E B;  3ITK A;  2K3R A;  2H43 A;  4CPG A;  1X79 B;  1OXZ A;  4AQR D;  1P84 E;  3AEC C;  1M1J A;  3D6Y A;  4UB6 E;  2KI7 B;  2NPS D;  1EDK A;  2QJP C;  1L0L K;  3F89 A;  2RH0 A;  1NTZ G;  2GUS A;  3WU2 E;  1EC5 A;  2KSJ A;  5TIS H;  2IYO A;  3Q1M A;  1MFZ A;  2M0B A;  2BCC G;  3H32 A;  2ZJS E;  1KYO H;  1JTH A;  3I56 P;  1XTG B;  1QGK B;  3EWK A;  1RHZ B;  4PJ0 H;  3G4S P;  5AVV B;  1LP1 A;  2KNC A;  3EFG A;  2N1T C;  2SPZ A;  3AEB C;  2GA1 A;  3O8Z A;  4GKG A;  3VP8 A;  1G1J A;  3EQ2 A;  1AVO A;  1LNQ A;  3MUD C;  2E75 B;  5AVW B;  4HJG H;  3Q3D A;  3L35 A;  1BE3 E;  3OA7 A;  3B71 A;  3L37 A;  1EXI A;  1K04 A;  2KUB A;  3G71 P;  1FDI A;  3E7K A;  4OGQ B;  2BEZ F;  5APV A;  4WVZ A;  3AEF C;  4GIF A;  4WB4 A;  5AW2 B;  1Q81 Q;  1OW6 A;  4DOJ A;  4C7N A;  1JY2 P;  3VMZ A;  4MN4 C;  1RF1 A;  3TGU J;  1SQV J;  5B66 H;  2Y0D A;  3FWN A;  1PV3 A;  2J58 A;  3WUV A;  2Q3I A;  3LW5 J;  3WUU A;  2FYN C;  1NU1 K;  4H44 D;  2OYH A;  1ZN5 A;  1FZB A;  3L72 E;  3LID A;  5CCH D;  2LKM A;  3A0H H;  5DJU B;  3S4R A;  3HD7 C;  1L4A A;  2IYP A;  3L74 G;  3SFE C;  1L0L D;  2NPS B;  1SQQ K;  5H2F H;  2FXM A;  3AEG C;  2V4H A;  4WY4 D;  3SSU A;  1OZH A;  5AW7 B;  3E1I A;  1S1C X;  2IZ1 A;  1LTI C;  1GL2 D;  1SQP K;  4RO0 A;  4WBA A;  1OVV A;  3H25 A;  3CME P;  1JCD A;  3CCE P;  2UWJ E;  1ZXG A;  2Q3E A;  1IFJ A;  5CJ4 A;  1JNM A;  1DEB A;  3RL0 g;  4ASW A;  1GTW A;  1M7L A;  1PP9 J;  2FYU G;  1Q90 D;  2XNX A;  1USE A;  2P1J A;  4IL6 H;  2QJY C;  2YNY A;  1KV4 A;  1M8O B;  3P32 A;  2J5U A;  2QEX P;  3H1K D;  1BCC J;  1FE6 A;  2L5G B;  2E5Y A;  2IDB A;  3PTZ A;  3KHU A;  3L75 J;  1CW5 A;  5KLV K;  1YTZ I;  4TLF A;  4D6T D;  3KPE A;  4EI2 A;  1NU1 D;  3O6Q A;  4HH2 A;  4ZMD A;  3TYY A;  4H44 B;  1HH0 A;  2WSC J;  1HF9 A;  5CBO A;  4BWN A;  4IL6 X;  3MHV A;  3C8V A;  3CCR P;  1GW4 A;  1BSN A;  2OQQ A;  1SQQ D;  1Q86 Q;  4DCK A;  1PZQ A;  1KIL B;  1J2J B;  1IFM A;  4BXL A;  3BCC G;  2KS1 A;  2P58 A;  1IFI A;  5CCG D;  2YKQ A;  2JO1 A;  3A3Y B;  3CCU P;  4C46 A;  2Y0E A;  3IN6 A;  3H1H G;  3MGN A;  2C0X A;  2A45 I;  3AE6 C;  2W6B A;  3HE5 A;  2D2C B;  1GL2 B;  3RK2 D;  3PJS K;  3M91 A; 
#chains in the Genus database with same CATH homology
 4D6T G;  1PPJ G;  5KLV G;  3L73 G;  1NU1 G;  2BCC G;  3L71 G;  3CX5 H;  4PD4 H;  1SQX G;  1EZV G;  3H1I G;  1KB9 H;  1BCC G;  1KYO H;  1NTM G;  3H1J G;  3H1K G;  2A06 G;  3H1L G;  1SQB G;  3CWB G;  1PP9 G;  3H1H G;  1SQV G;  3L74 G;  3L72 G;  3TGU G;  2FYU G;  1P84 H;  3CXH H;  3L75 G;  1NTK G;  1NTZ G;  1L0L G;  1SQP G;  2IBZ G;  1L0N G;  4U3F G;  1SQQ G;  1BGY G;  3L70 G;  3BCC G;  1BE3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...