4KT0J

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 12
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4kt0J00
1VF5B 1S5LX 2E74B 2WSCJ 2WSEJ 2QIWA 3LW5J 2FYNC 5L8RJ 2K9YA 2QSIA 2ZT9B 4I7ZB 4OGQB 1JB0J 2WSFJ 5KKZC 4Y28J 5KLIC 4H44B 4RKUJ 2YIUC 2QJKC 4PV1B 1Q90D 4KT0J 2D2CB 2QJPC 3C8VA 4H0LB 2QJYC 1ZRTE 2E75B 2O01J 2E76B 4H13B 2WPVB 4IL6X
chains in the Genus database with same CATH superfamily
3H1HJ 2ZFCA 3CXHI 2OYHA 1N7SB 4PV1D 4EOTA 2ZVNB 2KSEA 1NTZD 3CC7P 1LT1A 4PD4D 3LW5H 1NTKG 2WPVB 3H1JJ 5GTIE 2H43A 4DZOA 1QEXA 1KB9H 3IAOA 4WVZA 3AEFC 1KZUB 4UB6H 1A02F 4IOIH 3A5TA 4H44B 1L0NK 3L71G 3VN0A 1HUCA 1ZOYC 4KHXA 4B86A 1FOSE 2V7QH 3I5CA 4GOFA 3MUDA 1NU1G 1KYOH 1S9KD 1Y47A 3H1HG 3L73D 1PP9E 1SQVK 1L4AB 4GT1A 1L0ND 2XNDH 1VQ6P 2E75B 3MD0A 1VQKP 1ZRTD 1VDFA 1JY3P 2C9LY 3KHUA 4I2LC 1AFOA 1VQLP 1VF5C 3H1JG 1M57D 1JCDA 3WU2H 3O6QA 1M56D 1KILB 1SQVD 1RH5B 2IBZI 2PGDA 1J1EC 2KOGA 3JCUE 2YMYA 5B66E 1NJIQ 1W2BO 2GUSA 4I7ZB 2W27A 3EWKA 3V2PA 2WPSA 1W5CE 3IR9A 1KTMA 3V4WA 1R5SA 4C7RA 1RE4C 2ZJSE 2RKLA 2M5AA 2CPSA 4W80A 3TNUA 1HF9A 5KKZB 3K5BA 2YIUB 3M9BA 1LWUA 2Y9YA 3CCQP 1LTGC 1RHZB 1VQPP 2QJYC 1N7SA 3CC4P 2OTJP 2YKPA 1JY3O 3HD7B 1BGYE 3M91A 3CL3D 2CPBA 3RL0B 1SQQE 2ZAEB 4OGQB 1BSHA 4Y28J 3AE2C 1S2EA 5AVTB 5KAIE 3TK1A 1PP9D 2PP6A 2Q1KA 1N8RQ 3H32B 5APSA 3TGUE 1EZVG 1EDLA 2WWWA 1LTSC 3TYYA 2FXPA 1AVOA 1GTWA 2D2CD 2Y9ZA 1WMKA 3CX5E 5AVQB 2A45I 2POHA 1GZLA 4YTPC 3CWBJ 3M06A 4IL6X 1RF1A 5KLIB 3L73J 3BCCE 2KS1B 1N7LA 1HVVA 1VQOP 3OW2O 1NTMK 2FYUE 3CI9A 2Q6QA 1FS0E 3M9HA 1G2CA 3AECC 5K5GB 2Z4EA 3SSUA 1YITP 1GU5A 1LTAC 1SQQK 1QL1A 4BWNA 3ITKA 1CSBA 3AEEC 5AW3B 1Z56A 1H8AA 3O8ZA 3BATA 5CCGC 3RK2D 1ZR4A 1BGYD 3CWBG 5E79E 3A0HH 1E79H 2FFDC 2Y0DA 3L73G 1SQQD 2L5GB 2K9JA 3R4YA 1AV1A 1PIXA 4PJ0E 2Q3IA 3RK2C 1XTCC 3H1HE 3HE5A 3TGUD 2P1JA 2WT7B 3HD7A 1W2EA 4YPCA 1FZCC 3RBZA 1N73C 2YNYA 3VYIA 4CPGA 2QM7A 2FYUK 2KLVA 3A0BH 3FXDA 3M0DA 1HH0A 1VF5B 4ZKUA 2KP8A 3BCCD 1X8YA 1NKNA 4R4MA 1J1EB 1U7MA 5AVRB 1Q86Q 1NTKK 2WSCH 2B87B 5CJ0A 5B5EE 1SFCA 2FYUD 3AE6C 3CCUP 3USSA 2ZVOB 2RH0A 3P32A 3H1LE 3AE3C 2SPZA 3MTUE 3L35A 4WBAA 2K1AA 3JC22 1QGKB 3KDPB 3I55P 3TF5A 2BEQD 1HBWA 1BDCA 2YXQB 2IFNA 1LTBC 1NU1K 1FE6A 4GODA 2W6JH 1GL2A 2QJYB 4RO0A 1LT9A 3CXHE 3II6A 3MP7B 1OW7A 2R44A 1JMBA 3L75E 1URQC 4K3AA 3KZIH 2BCCJ 1KQSO 3H1HD 1KQGB 1P84H 5KLVJ 2QA4P 1CZQA 2E76D 1BSNA 1H88A 2K88A 1BGYJ 5DJUB 1YJWP 3AEAC 1NHLA 4WY4C 1KILC 1R5LA 1AQ5A 2Y0EA 2E76C 3V2NA 3W68A 3GHGC 2IYPA 4H0LD 2N1TC 1SP4A 4JBZA 1ZP0C 2K37A 1T6AA 3AE8C 2DW3A 1FOSF 5TISH 2XKMA 3BVHA 2BCCG 3H1LD 5KTBA 1YQ4C 4EDFA 3BCCJ 1KORA 3HTKA 1FJKA 1L0LJ 5KLVG 3UIAA 3PLNA 1QLED 2RN0A 2B87A 3V2RA 2B89A 5CHXA 1BGYG 2AXCA 3EQ2A 5GTIH 2IBZE 2IYOA 1SQQG 4IFMA 3NMDA 1NH4A 5APVA 3CXHD 3V2QA 1EXIA 3MZWB 3FWLA 4HB1A 1AJYA 1FZGA 1X0TA 2FFDB 1HGZA 2FYNC 3CWBE 2M3EA 1KV4A 2ITAA 3L75D 4EYYQ 1FBMA 4AYCA 5GTHH 4LLHA 3RK2B 2LKMA 2WSSH 3WUUA 4N6JA 1S5LX 2O01N 3RGUA 2FXOA 1FZCB 1SFCD 2GM4A 1LTIC 3BCCG 1L0LG 3GW6A 5KLIC 2JKVA 2GA1A 3D71A 1KN7A 4KT0J 5AW6B 1Q82Q 2WSEH 4KJMA 3RK3E 2R5BA 5KJ7C 2FYUG 4C46A 5APTA 5BU5A 2WZ7A 3V6IA 2HYNA 2KZJA 1Q81Q 3JCUH 1GL2D 5B66H 1LTJC 1SS1A 1CI6A 2C9NY 3FGAD 5APXA 4WB4A 4JYBA 2HG5D 2J5UA 1YHQP 4M3LA 4PV1C 3M0AA 1USDA 2Z5IA 2Q5UA 2E5TA 2P2UA 2WSFJ 3VP9A 4YXDC 1H0TB 1Q90D 2IBZD 2E74D 5M1BA 3EFGA 3D6YA 2OYIA 3H1LJ 3B8EB 3CWBD 2O3JA 3CMEP 1CW5A 2ZXEB 5CCHA 1URQB 1OW8A 1MFTA 3L74E 1FAVA 1VPCA 1OX3A 1IJDB 4TLFA 3KPEA 5KAIH 3ABVC 5CCGA 3MGNA 1E5WA 5CMZA 4BRYA 2E5YA 3PTZA 3HE4B 2QG4A 1U7JA 4WY4B 3L75J 3U1CA 1IC2A 3AE9C 3H6PA 2E76B 1S5LE 5H2FE 2YKOA 3GHGB 2N1TB 1M1JC 5AW4B 4R4LA 3GF7A 1DD3A 5AW8B 3H1LG 1N73A 1M7LA 4H0LB 2WVRA 5CBOA 1JNMA 1LJ2A 4EI2A 2LXBA 2LXCB 5APQA 1LP1A 1OW6A 3D6ZA 1N2DC 1NKZB 5APYA 2BCCE 1AA0A 3G3ZA 1P84I 4Y99C 2OYOA 3Q5PA 2NPSD 3E1RA 3L72E 5KLVE 2G3AA 2OTLP 5AW7B 1DD4A 5L8RJ 1PGPA 2JO1A 3L75G 3Q3DA 1QVFO 4RKUJ 2YXRB 3VOPA 2FYNB 4U3FE 3B5ND 3WUTA 2R32A 5E79H 1YTZI 3RBXA 2XV5A 3WUVA 1AVYA 1LGHB 3L74D 4I6MC 4N78E 4UB8E 3L4FA 2FKWB 1NOHA 3B5NC 1FZFA 3KXDA 2H7HA 2M3BA 3H25A 4JF7A 1GMJA 3PRJA 1M1KQ 4ASWA 2I1JA 2Q3EA 2OYHC 1T2KD 1IFJA 1URQA 2D2CC 1L4AA 1L0LE 1PGOA 2JP3A 1S4XA 3VTPC 3CCJP 3AE5C 4HYTB 3CCMP 2P67A 1JMMA 4N3YB 1M90Q 1SQXE 2IPPA 5KLVK 3T97B 3OAKA 2IDBA 1EDIA 1KILA 4L73A 3E1IA 1LTJB 2H88C 2W83C 5CJ4A 1YJ9P 1OWAA 4A7PA 3A3YB 2KB7P 2BCCD 4PV1B 1KQLA 2IBZG 1S3JA 3CPWO 1GDTA 1MFZA 2H89C 5KLVD 4I1LA 3MUDC 3C1LA 3AEDC 1FZAA 2KNCB 3NTNA 3CXHH 4U3FD 4RESB 2B9BA 3SFDC 4HKZH 3Q5RA 3PJSK 5TJHA 1OVRA 1HWTC 1L0LK 1UIIA 4N78D 3QH9A 2WPQA 2QRXA 3LIEA 3CX5D 1JUNA 1KC8Q 3KQGA 2N9BA 2HLOA 1KB9I 4DT0A 2E43A 2WPRA 1S72P 3CLQA 3H32A 1L0LD 2CK3H 1EQ7A 3L74J 2NZ2A 2H8PD 1M1JB 3FX0A 3U1AA 2AXTE 4IL6E 2BEZF 4IFDK 1N7SD 4C7NB 1LWUC 1KYOI 2QVAA 2A45G 1FZBA 1DEBA 2KS1A 3VP8A 4ZKPA 4PD4H 1IFPA 1T3JA 2C0WA 4Y99B 3P8CE 3GG2A 4H44D 3T97A 1GK6A 1ZV8A 1FZEA 1LTJA 3VMZA 5BVZA 2MJZA 1MKMA 3A0HE 1M8OB 3L74G 1S1CX 1VQ9P 5AW1B 2HODB 1XTGB 2FBWC 1ZLLA 2PFXA 3G71P 1L4AD 3L72J 2E75D 1T3UA 4H13D 3LIDA 4JQ0D 4DJGA 2KK7A 3B5NB 1RF1C 2FYZA 3SFEC 2HPCB 4H13C 3A0BE 1NGMB 2V7QJ 2OYHB 1JCCA 1EDJA 1NAFA 4U3FJ 4XE5B 1OVUA 1WRGA 1SQBJ 2D2CB 3CCEP 3M9QA 4HH2A 5APUA 3CD6P 2WT7A 2ZYAA 1VL2A 2KZIA 4H0LC 1PPJE 3TSIA 5AVYB 3A2AA 1NWQA 1ZW0A 2PAJA 3ZDMA 1KFMA 4WWIA 1IK7A 1K04A 1EXJA 1HJ0A 3L72G 2QIWA 1KFNA 1A02J 2OQQA 3L70J 3P8CD 3BASA 2Q9IA 1SQXJ 2KIKA 3HUSC 3AE4C 2E42A 3HD7D 1RE4A 4U3FG 1SQBG 4OGQD 2A06E 4OWFA 4GDOA 2QSIA 2G8YA 1FC2C 3KZIE 3Q1MA 2M0BA 3CC2P 5AW9B 1P84E 2NRGA 3S9OA 2PRRA 5AVUB 1YTZT 4NPEA 3BRVB 2I8DA 3L70G 1SFCC 1JTHB 4QMAA 2IZ0A 3OA7A 1SQXG 2QJKB 3L71J 1L2PA 1Q2NA 1K73Q 2M5AB 1S5LH 1SQVE 3TNUB 2WQYC 5H2FH 1OZHA 1PPJD 2HPCA 1VQNP 1LWUB 1T8ZA 3KYQA 1YYCA 2V4HA 3QWOC 1GL2C 2OGUA 1LT9C 1NO4A 1IO4A 3S4RA 4ZNCA 2QJPC 2AEMA 1OMIA 2O01J 2FXMA 3CCRP 1EZVI 3R2PA 2QM8A 2E74C 1DX7A 3TDKA 2A06D 3G9RA 5AVWB 3GLMA 5KAFE 5AVVB 1FDIA 2GUVA 3H1KE 5GTHE 1VQMP 1DH3A 2JJLA 1P84D 1RE3C 1Q7YQ 1G1IA 1LTTC 1RF1B 1X22A 2FFDA 3PHLA 4UB8H 1YBKA 1FDMA 1VQ7P 1VF5D 4PD4I 4H13B 1BE3J 3CX5H 4K35A 4EIJA 3RK3D 2JWAA 4RJTA 1GW4A 1G2CB 2N9YB 1VQ4P 1RF0C 1FZCA 2J58A 2KLUA 3RK3C 3IF4A 1AQTA 1Y9BA 1BCCE 3Q2YA 1SLQA 1JO5A 1JTHA 1VQ5P 2R3SA 2P10A 1FU1A 3A7OA 1VQ8P 1KB9E 3EFFK 4NPDA 4UB6E 2WSCJ 4L75A 2K9JB 1YIJP 3HUSB 4D6TJ 1NTME 4DOJA 1SQPJ 2NPSC 1BE3G 3AEBC 1KD1Q 3HE5B 4TT3H 1IFDA 2ZXXA 1R8EA 1KYOE 1SQBE 1Y8AA 1H0TA 1NTZJ 4NPFX 3MHVA 1OIPA 3H1KD 2QEXP 4PJ0H 3D70A 5AVZB 2KUBA 2QE7H 4ASVA 1OXZA 1JY2N 1MV8A 1J2JB 4W7ZA 1KMIZ 4GKGA 2KYVA 1ZXGA 3Q5SA 3WU2E 2ZT9D 1J1DC 2WITA 5BU8B 1GU4A 3SWFA 1SFCB 5AW0B 3L70E 3F89A 1PPJG 5CBNA 3H1IE 1T2KC 5AW2B 4D6TG 3C8VA 2ZT9C 1SQPG 5AW5B 1JB0J 4OH8B 3HE4A 2WSFH 4WY4A 1YJNP 1L0NJ 5B5EH 4AUWA 2AXTH 4IL6H 1BCCD 1NTZG 4Z1MH 4HJGH 2O01H 3GHGA 1JOCA 2N1TA 1PV3A 2YO3A 1N86A 1GL2B 2O1KA 5CCHD 1KB9D 1LT9B 1SQBK 2OYIC 3L72D 1H89A 1TU3F 4DCKA 3FXEA 1PGQA 1K05A 1SQVJ 2QJPB 3G6EP 1JEKA 2UWJE 2A06G 5CCGD 1NTKE 5CCHC 1NTMD 2M8RA 3CMAP 1GW3A 1GD2E 2ZYDA 4W7YA 1GK4A 2E74B 2JWDA 2I1KA 2XZRA 3OJAB 1KYOD 1SQBD 2R5DA 2KSJA 1X9VA 3L71E 1NAYA 2W6BA 3HUSA 2C0XA 1PGJA 1YI2P 1L0NG 1FDOA 1PFIA 1SQXK 2W6AA 1NU1E 3CCLP 5AVSB 3S1KA 1KILE 1RQUA 3BRTB 5APWA 3JSVC 1JY2P 2QJKC 3H1KJ 3VMYA 1SQVG 3F5HA 2K3RA 2JEEA 2XU6A 3L70D 2Q7CA 4L76A 3G4SP 3H1ID 1OVVA 1DIPA 1SQXD 2JDIH 3H1JE 3VMXA 1LNQA 1YQ3C 3I56P 1PP9J 3RK3B 1USEA 3HTKB 2HR3A 1RY3A 1N7SC 1ZR2A 3NXSA 4YXWH 5EFWB 5KJ7A 4BXLA 2WSEJ 4MN4C 2WMMA 1IZNB 3AE1C 2R3CA 4JYCA 2FY8A 3VMAA 2RMZA 1NTKD 3B4SA 3P7KA 2NPSB 4H44C 1BCCJ 3CX5I 3LW5J 3H1KG 1BE3E 3NFQA 2IZ1A 4L74A 1URQD 1IFNA 1JY2O 3C9IA 1QVGO 1K9MQ 1OFCX 3RL0g 4LC1A 3L71D 1PP9G 3IFMA 3AE7C 3SWKA 1SVFA 1G1JA 2O1JA 1L4AC 1NTMJ 2K9YA 2AEJA 3GMAA 2L91A 2E75C 2KNCA 2IX7C 1NU1D 2LR2A 3V4QA 3V5BA 1JM0A 4WY4D 3CCSP 1KILD 1UIXA 1IFIA 2VRSA 3PH0A 1HJBA 1EZVE 1J1DB 1HGVA 3FWNA 2KI7B 1QL2A 3WMM0 4GIFA 3HRNA 2N1TD 3U59A 1NYHA 1SQQJ 4IFFA 1CI6B 1BDDA 2B88A 3P8MC 3W67A 1RE3A 2ZYGA 2ZT9B 3H1JD 1RQVA 3AEGC 1BCCG 4D6TE 2XNXA 1SQPE 2W8ZA 3TGUJ 4I7ZC 1NVOA 2AEFA 3GF3A 2XDJA 1MUUA 2Z5HA 1NTZE 3N4XA 1M1JA 4OVNF 3IN6A 4PD4E 1EDKA 5KKZC 3H1IJ 1RF0A 2YIUC 4LGDE 3CCVP 1NTMG 2J59M 4XA4A 2OYIB 5AVXB 4C7NA 2A45H 1K8AQ 4JPZB 3RL0D 1EC5A 4O9BA 4ZMDA 5C39A 2JR8A 1PZQA 2Y0CA 4GOEA 3HD7C 1BE3D 2FYUJ 1X79B 1QX8A 1U57A 3RL0C 1KQFB 5DJTB 4OGQC 2BASA 1FJPA 4BRYB 3M0DC 4XFJA 2KXPB 5KAFH 1S9KE 2P58A 1DEEG 3L73E 3O6QB 1JY3N 3TGUG 3E7KA 2MKVA 3PP5A 1NTKJ 1PL5A 2NPSA 2HFED 2IFMA 1L0NE 2YKQA 3B71A 1SQPK 1MZ9A 2HODA 4U7JA 1IK9A 1ZRTE 1WT6A 1IFMA 2OTKE 3H1IG 3L36A 3MIWA 1EZVD 3N7NA 4AQRD 1N73B 3SWYA 1D7MA 2WTYA 1ZMEC 3L37A 5KJ7D 1NTZK 2P7JA 3B5NA 2OARA 1ZN5A 2YO2A 1HTLC 1LP1B 2W90A 4D6TD 2YMKA 1SQPD 1NU1J 5TISE
chains in the Genus database with same CATH topology
1VF5B 1S5LX 3AEAC 2WSCJ 2WSEJ 1S1CX 1TU3F 3ABVC 3SFDC 4OGQD 3Q5RA 1K05A 4GDOA 2E76C 2QSIA 2G8YA 3IN6A 2FBWC 4I7ZB 2E74C 3EWKA 4PV1D 5KKZC 3G9RA 5KLIC 3AEBC 4R4MA 3GLMA 2YIUC 3AE1C 4H0LD 2E75D 3H25A 3D71A 3Q1MA 1KTMA 4KT0J 1GMJA 4H13D 4TT3H 1FDIA 1R8EA 3RK3E 3AE9C 2E76B 1ZP0C 3AECC 2WPVB 4H44C 2E74B 1HF9A 3AE8C 3LW5J 3S9OA 3AE6C 2D2CC 3D70A 3IAOA 3SFEC 2JP3A 4R4LA 4H13C 3AE3C 3AEFC 3GF7A 1NGMB 2V7QJ 1DD3A 3AE5C 4H44B 3RL0g 1U57A 1YQ4C 1KQFB 2NZ2A 2D2CB 1VF5D 4H0LB 1FDOA 2QJYC 4OGQC 3FGAD 1KMIZ 3AEEC 2BEQD 1ZOYC 1KORA 4H13B 3T97B 4XFJA 2BEZF 2J5UA 3AE7C 3Q5SA 4PV1C 2IDBA 1OW6A 3D6ZA 2ZT9D 2K9YA 3GMAA 1KILE 1RQUA 1VL2A 2E75C 4H0LC 2MKVA 2H88C 1PL5A 4OGQB 2WSFJ 4Y28J 4YXDC 2WQYC 3AE2C 1UIXA 2QJKC 3R4YA 4PV1B 3B71A 3Q5PA 1Q90D 1PIXA 2E74D 3C8VA 2ZT9C 4U7JA 5M1BA 1ZRTE 1OW7A 1EXIA 2E75B 1IK7A 1K04A 1JB0J 1EXJA 1AJYA 1HJ0A 2H89C 2G3AA 1NYHA 1DIPA 2QIWA 2FYNC 3D6YA 1DD4A 1Y9BA 5L8RJ 3Q2YA 2JO1A 1YQ3C 1ZMEC 2OQQA 2FXPA 4H44D 2ZT9B 1VF5C 1RQVA 3AEGC 4Z1MH 3Q3DA 2D2CD 1KQGB 1WMKA 3AEDC 4RKUJ 2P10A 3AE4C 3O6QA 1OW8A 2E76D 2QJPC 1PV3A 4I7ZC 1OMIA 4YTPC 2YMKA 2O01J 1MKMA 3GF3A 4IL6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 B;  1S5L X;  2E74 B;  2WSC J;  2WSE J;  2QIW A;  3LW5 J;  2FYN C;  5L8R J;  2K9Y A;  2QSI A;  2ZT9 B;  4I7Z B;  4OGQ B;  1JB0 J;  2WSF J;  5KKZ C;  4Y28 J;  5KLI C;  4H44 B;  4RKU J;  2YIU C;  2QJK C;  4PV1 B;  1Q90 D;  4KT0 J;  2D2C B;  2QJP C;  3C8V A;  4H0L B;  2QJY C;  1ZRT E;  2E75 B;  2O01 J;  2E76 B;  4H13 B;  2WPV B;  4IL6 X; 
#chains in the Genus database with same CATH topology
 3H1H J;  2ZFC A;  3CXH I;  2OYH A;  1N7S B;  4PV1 D;  4EOT A;  2ZVN B;  2KSE A;  1NTZ D;  3CC7 P;  1LT1 A;  4PD4 D;  3LW5 H;  1NTK G;  2WPV B;  3H1J J;  5GTI E;  2H43 A;  4DZO A;  1QEX A;  1KB9 H;  3IAO A;  4WVZ A;  3AEF C;  1KZU B;  4UB6 H;  1A02 F;  4IOI H;  3A5T A;  4H44 B;  1L0N K;  3L71 G;  3VN0 A;  1HUC A;  1ZOY C;  4KHX A;  4B86 A;  1FOS E;  2V7Q H;  3I5C A;  4GOF A;  3MUD A;  1NU1 G;  1KYO H;  1S9K D;  1Y47 A;  3H1H G;  3L73 D;  1PP9 E;  1SQV K;  1L4A B;  4GT1 A;  1L0N D;  2XND H;  1VQ6 P;  2E75 B;  3MD0 A;  1VQK P;  1ZRT D;  1VDF A;  1JY3 P;  2C9L Y;  3KHU A;  4I2L C;  1AFO A;  1VQL P;  1VF5 C;  3H1J G;  1M57 D;  1JCD A;  3WU2 H;  3O6Q A;  1M56 D;  1KIL B;  1SQV D;  1RH5 B;  2IBZ I;  2PGD A;  1J1E C;  2KOG A;  3JCU E;  2YMY A;  5B66 E;  1NJI Q;  1W2B O;  2GUS A;  4I7Z B;  2W27 A;  3EWK A;  3V2P A;  2WPS A;  1W5C E;  3IR9 A;  1KTM A;  3V4W A;  1R5S A;  4C7R A;  1RE4 C;  2ZJS E;  2RKL A;  2M5A A;  2CPS A;  4W80 A;  3TNU A;  1HF9 A;  5KKZ B;  3K5B A;  2YIU B;  3M9B A;  1LWU A;  2Y9Y A;  3CCQ P;  1LTG C;  1RHZ B;  1VQP P;  2QJY C;  1N7S A;  3CC4 P;  2OTJ P;  2YKP A;  1JY3 O;  3HD7 B;  1BGY E;  3M91 A;  3CL3 D;  2CPB A;  3RL0 B;  1SQQ E;  2ZAE B;  4OGQ B;  1BSH A;  4Y28 J;  3AE2 C;  1S2E A;  5AVT B;  5KAI E;  3TK1 A;  1PP9 D;  2PP6 A;  2Q1K A;  1N8R Q;  3H32 B;  5APS A;  3TGU E;  1EZV G;  1EDL A;  2WWW A;  1LTS C;  3TYY A;  2FXP A;  1AVO A;  1GTW A;  2D2C D;  2Y9Z A;  1WMK A;  3CX5 E;  5AVQ B;  2A45 I;  2POH A;  1GZL A;  4YTP C;  3CWB J;  3M06 A;  4IL6 X;  1RF1 A;  5KLI B;  3L73 J;  3BCC E;  2KS1 B;  1N7L A;  1HVV A;  1VQO P;  3OW2 O;  1NTM K;  2FYU E;  3CI9 A;  2Q6Q A;  1FS0 E;  3M9H A;  1G2C A;  3AEC C;  5K5G B;  2Z4E A;  3SSU A;  1YIT P;  1GU5 A;  1LTA C;  1SQQ K;  1QL1 A;  4BWN A;  3ITK A;  1CSB A;  3AEE C;  5AW3 B;  1Z56 A;  1H8A A;  3O8Z A;  3BAT A;  5CCG C;  3RK2 D;  1ZR4 A;  1BGY D;  3CWB G;  5E79 E;  3A0H H;  1E79 H;  2FFD C;  2Y0D A;  3L73 G;  1SQQ D;  2L5G B;  2K9J A;  3R4Y A;  1AV1 A;  1PIX A;  4PJ0 E;  2Q3I A;  3RK2 C;  1XTC C;  3H1H E;  3HE5 A;  3TGU D;  2P1J A;  2WT7 B;  3HD7 A;  1W2E A;  4YPC A;  1FZC C;  3RBZ A;  1N73 C;  2YNY A;  3VYI A;  4CPG A;  2QM7 A;  2FYU K;  2KLV A;  3A0B H;  3FXD A;  3M0D A;  1HH0 A;  1VF5 B;  4ZKU A;  2KP8 A;  3BCC D;  1X8Y A;  1NKN A;  4R4M A;  1J1E B;  1U7M A;  5AVR B;  1Q86 Q;  1NTK K;  2WSC H;  2B87 B;  5CJ0 A;  5B5E E;  1SFC A;  2FYU D;  3AE6 C;  3CCU P;  3USS A;  2ZVO B;  2RH0 A;  3P32 A;  3H1L E;  3AE3 C;  2SPZ A;  3MTU E;  3L35 A;  4WBA A;  2K1A A;  3JC2 2;  1QGK B;  3KDP B;  3I55 P;  3TF5 A;  2BEQ D;  1HBW A;  1BDC A;  2YXQ B;  2IFN A;  1LTB C;  1NU1 K;  1FE6 A;  4GOD A;  2W6J H;  1GL2 A;  2QJY B;  4RO0 A;  1LT9 A;  3CXH E;  3II6 A;  3MP7 B;  1OW7 A;  2R44 A;  1JMB A;  3L75 E;  1URQ C;  4K3A A;  3KZI H;  2BCC J;  1KQS O;  3H1H D;  1KQG B;  1P84 H;  5KLV J;  2QA4 P;  1CZQ A;  2E76 D;  1BSN A;  1H88 A;  2K88 A;  1BGY J;  5DJU B;  1YJW P;  3AEA C;  1NHL A;  4WY4 C;  1KIL C;  1R5L A;  1AQ5 A;  2Y0E A;  2E76 C;  3V2N A;  3W68 A;  3GHG C;  2IYP A;  4H0L D;  2N1T C;  1SP4 A;  4JBZ A;  1ZP0 C;  2K37 A;  1T6A A;  3AE8 C;  2DW3 A;  1FOS F;  5TIS H;  2XKM A;  3BVH A;  2BCC G;  3H1L D;  5KTB A;  1YQ4 C;  4EDF A;  3BCC J;  1KOR A;  3HTK A;  1FJK A;  1L0L J;  5KLV G;  3UIA A;  3PLN A;  1QLE D;  2RN0 A;  2B87 A;  3V2R A;  2B89 A;  5CHX A;  1BGY G;  2AXC A;  3EQ2 A;  5GTI H;  2IBZ E;  2IYO A;  1SQQ G;  4IFM A;  3NMD A;  1NH4 A;  5APV A;  3CXH D;  3V2Q A;  1EXI A;  3MZW B;  3FWL A;  4HB1 A;  1AJY A;  1FZG A;  1X0T A;  2FFD B;  1HGZ A;  2FYN C;  3CWB E;  2M3E A;  1KV4 A;  2ITA A;  3L75 D;  4EYY Q;  1FBM A;  4AYC A;  5GTH H;  4LLH A;  3RK2 B;  2LKM A;  2WSS H;  3WUU A;  4N6J A;  1S5L X;  2O01 N;  3RGU A;  2FXO A;  1FZC B;  1SFC D;  2GM4 A;  1LTI C;  3BCC G;  1L0L G;  3GW6 A;  5KLI C;  2JKV A;  2GA1 A;  3D71 A;  1KN7 A;  4KT0 J;  5AW6 B;  1Q82 Q;  2WSE H;  4KJM A;  3RK3 E;  2R5B A;  5KJ7 C;  2FYU G;  4C46 A;  5APT A;  5BU5 A;  2WZ7 A;  3V6I A;  2HYN A;  2KZJ A;  1Q81 Q;  3JCU H;  1GL2 D;  5B66 H;  1LTJ C;  1SS1 A;  1CI6 A;  2C9N Y;  3FGA D;  5APX A;  4WB4 A;  4JYB A;  2HG5 D;  2J5U A;  1YHQ P;  4M3L A;  4PV1 C;  3M0A A;  1USD A;  2Z5I A;  2Q5U A;  2E5T A;  2P2U A;  2WSF J;  3VP9 A;  4YXD C;  1H0T B;  1Q90 D;  2IBZ D;  2E74 D;  5M1B A;  3EFG A;  3D6Y A;  2OYI A;  3H1L J;  3B8E B;  3CWB D;  2O3J A;  3CME P;  1CW5 A;  2ZXE B;  5CCH A;  1URQ B;  1OW8 A;  1MFT A;  3L74 E;  1FAV A;  1VPC A;  1OX3 A;  1IJD B;  4TLF A;  3KPE A;  5KAI H;  3ABV C;  5CCG A;  3MGN A;  1E5W A;  5CMZ A;  4BRY A;  2E5Y A;  3PTZ A;  3HE4 B;  2QG4 A;  1U7J A;  4WY4 B;  3L75 J;  3U1C A;  1IC2 A;  3AE9 C;  3H6P A;  2E76 B;  1S5L E;  5H2F E;  2YKO A;  3GHG B;  2N1T B;  1M1J C;  5AW4 B;  4R4L A;  3GF7 A;  1DD3 A;  5AW8 B;  3H1L G;  1N73 A;  1M7L A;  4H0L B;  2WVR A;  5CBO A;  1JNM A;  1LJ2 A;  4EI2 A;  2LXB A;  2LXC B;  5APQ A;  1LP1 A;  1OW6 A;  3D6Z A;  1N2D C;  1NKZ B;  5APY A;  2BCC E;  1AA0 A;  3G3Z A;  1P84 I;  4Y99 C;  2OYO A;  3Q5P A;  2NPS D;  3E1R A;  3L72 E;  5KLV E;  2G3A A;  2OTL P;  5AW7 B;  1DD4 A;  5L8R J;  1PGP A;  2JO1 A;  3L75 G;  3Q3D A;  1QVF O;  4RKU J;  2YXR B;  3VOP A;  2FYN B;  4U3F E;  3B5N D;  3WUT A;  2R32 A;  5E79 H;  1YTZ I;  3RBX A;  2XV5 A;  3WUV A;  1AVY A;  1LGH B;  3L74 D;  4I6M C;  4N78 E;  4UB8 E;  3L4F A;  2FKW B;  1NOH A;  3B5N C;  1FZF A;  3KXD A;  2H7H A;  2M3B A;  3H25 A;  4JF7 A;  1GMJ A;  3PRJ A;  1M1K Q;  4ASW A;  2I1J A;  2Q3E A;  2OYH C;  1T2K D;  1IFJ A;  1URQ A;  2D2C C;  1L4A A;  1L0L E;  1PGO A;  2JP3 A;  1S4X A;  3VTP C;  3CCJ P;  3AE5 C;  4HYT B;  3CCM P;  2P67 A;  1JMM A;  4N3Y B;  1M90 Q;  1SQX E;  2IPP A;  5KLV K;  3T97 B;  3OAK A;  2IDB A;  1EDI A;  1KIL A;  4L73 A;  3E1I A;  1LTJ B;  2H88 C;  2W83 C;  5CJ4 A;  1YJ9 P;  1OWA A;  4A7P A;  3A3Y B;  2KB7 P;  2BCC D;  4PV1 B;  1KQL A;  2IBZ G;  1S3J A;  3CPW O;  1GDT A;  1MFZ A;  2H89 C;  5KLV D;  4I1L A;  3MUD C;  3C1L A;  3AED C;  1FZA A;  2KNC B;  3NTN A;  3CXH H;  4U3F D;  4RES B;  2B9B A;  3SFD C;  4HKZ H;  3Q5R A;  3PJS K;  5TJH A;  1OVR A;  1HWT C;  1L0L K;  1UII A;  4N78 D;  3QH9 A;  2WPQ A;  2QRX A;  3LIE A;  3CX5 D;  1JUN A;  1KC8 Q;  3KQG A;  2N9B A;  2HLO A;  1KB9 I;  4DT0 A;  2E43 A;  2WPR A;  1S72 P;  3CLQ A;  3H32 A;  1L0L D;  2CK3 H;  1EQ7 A;  3L74 J;  2NZ2 A;  2H8P D;  1M1J B;  3FX0 A;  3U1A A;  2AXT E;  4IL6 E;  2BEZ F;  4IFD K;  1N7S D;  4C7N B;  1LWU C;  1KYO I;  2QVA A;  2A45 G;  1FZB A;  1DEB A;  2KS1 A;  3VP8 A;  4ZKP A;  4PD4 H;  1IFP A;  1T3J A;  2C0W A;  4Y99 B;  3P8C E;  3GG2 A;  4H44 D;  3T97 A;  1GK6 A;  1ZV8 A;  1FZE A;  1LTJ A;  3VMZ A;  5BVZ A;  2MJZ A;  1MKM A;  3A0H E;  1M8O B;  3L74 G;  1S1C X;  1VQ9 P;  5AW1 B;  2HOD B;  1XTG B;  2FBW C;  1ZLL A;  2PFX A;  3G71 P;  1L4A D;  3L72 J;  2E75 D;  1T3U A;  4H13 D;  3LID A;  4JQ0 D;  4DJG A;  2KK7 A;  3B5N B;  1RF1 C;  2FYZ A;  3SFE C;  2HPC B;  4H13 C;  3A0B E;  1NGM B;  2V7Q J;  2OYH B;  1JCC A;  1EDJ A;  1NAF A;  4U3F J;  4XE5 B;  1OVU A;  1WRG A;  1SQB J;  2D2C B;  3CCE P;  3M9Q A;  4HH2 A;  5APU A;  3CD6 P;  2WT7 A;  2ZYA A;  1VL2 A;  2KZI A;  4H0L C;  1PPJ E;  3TSI A;  5AVY B;  3A2A A;  1NWQ A;  1ZW0 A;  2PAJ A;  3ZDM A;  1KFM A;  4WWI A;  1IK7 A;  1K04 A;  1EXJ A;  1HJ0 A;  3L72 G;  2QIW A;  1KFN A;  1A02 J;  2OQQ A;  3L70 J;  3P8C D;  3BAS A;  2Q9I A;  1SQX J;  2KIK A;  3HUS C;  3AE4 C;  2E42 A;  3HD7 D;  1RE4 A;  4U3F G;  1SQB G;  4OGQ D;  2A06 E;  4OWF A;  4GDO A;  2QSI A;  2G8Y A;  1FC2 C;  3KZI E;  3Q1M A;  2M0B A;  3CC2 P;  5AW9 B;  1P84 E;  2NRG A;  3S9O A;  2PRR A;  5AVU B;  1YTZ T;  4NPE A;  3BRV B;  2I8D A;  3L70 G;  1SFC C;  1JTH B;  4QMA A;  2IZ0 A;  3OA7 A;  1SQX G;  2QJK B;  3L71 J;  1L2P A;  1Q2N A;  1K73 Q;  2M5A B;  1S5L H;  1SQV E;  3TNU B;  2WQY C;  5H2F H;  1OZH A;  1PPJ D;  2HPC A;  1VQN P;  1LWU B;  1T8Z A;  3KYQ A;  1YYC A;  2V4H A;  3QWO C;  1GL2 C;  2OGU A;  1LT9 C;  1NO4 A;  1IO4 A;  3S4R A;  4ZNC A;  2QJP C;  2AEM A;  1OMI A;  2O01 J;  2FXM A;  3CCR P;  1EZV I;  3R2P A;  2QM8 A;  2E74 C;  1DX7 A;  3TDK A;  2A06 D;  3G9R A;  5AVW B;  3GLM A;  5KAF E;  5AVV B;  1FDI A;  2GUV A;  3H1K E;  5GTH E;  1VQM P;  1DH3 A;  2JJL A;  1P84 D;  1RE3 C;  1Q7Y Q;  1G1I A;  1LTT C;  1RF1 B;  1X22 A;  2FFD A;  3PHL A;  4UB8 H;  1YBK A;  1FDM A;  1VQ7 P;  1VF5 D;  4PD4 I;  4H13 B;  1BE3 J;  3CX5 H;  4K35 A;  4EIJ A;  3RK3 D;  2JWA A;  4RJT A;  1GW4 A;  1G2C B;  2N9Y B;  1VQ4 P;  1RF0 C;  1FZC A;  2J58 A;  2KLU A;  3RK3 C;  3IF4 A;  1AQT A;  1Y9B A;  1BCC E;  3Q2Y A;  1SLQ A;  1JO5 A;  1JTH A;  1VQ5 P;  2R3S A;  2P10 A;  1FU1 A;  3A7O A;  1VQ8 P;  1KB9 E;  3EFF K;  4NPD A;  4UB6 E;  2WSC J;  4L75 A;  2K9J B;  1YIJ P;  3HUS B;  4D6T J;  1NTM E;  4DOJ A;  1SQP J;  2NPS C;  1BE3 G;  3AEB C;  1KD1 Q;  3HE5 B;  4TT3 H;  1IFD A;  2ZXX A;  1R8E A;  1KYO E;  1SQB E;  1Y8A A;  1H0T A;  1NTZ J;  4NPF X;  3MHV A;  1OIP A;  3H1K D;  2QEX P;  4PJ0 H;  3D70 A;  5AVZ B;  2KUB A;  2QE7 H;  4ASV A;  1OXZ A;  1JY2 N;  1MV8 A;  1J2J B;  4W7Z A;  1KMI Z;  4GKG A;  2KYV A;  1ZXG A;  3Q5S A;  3WU2 E;  2ZT9 D;  1J1D C;  2WIT A;  5BU8 B;  1GU4 A;  3SWF A;  1SFC B;  5AW0 B;  3L70 E;  3F89 A;  1PPJ G;  5CBN A;  3H1I E;  1T2K C;  5AW2 B;  4D6T G;  3C8V A;  2ZT9 C;  1SQP G;  5AW5 B;  1JB0 J;  4OH8 B;  3HE4 A;  2WSF H;  4WY4 A;  1YJN P;  1L0N J;  5B5E H;  4AUW A;  2AXT H;  4IL6 H;  1BCC D;  1NTZ G;  4Z1M H;  4HJG H;  2O01 H;  3GHG A;  1JOC A;  2N1T A;  1PV3 A;  2YO3 A;  1N86 A;  1GL2 B;  2O1K A;  5CCH D;  1KB9 D;  1LT9 B;  1SQB K;  2OYI C;  3L72 D;  1H89 A;  1TU3 F;  4DCK A;  3FXE A;  1PGQ A;  1K05 A;  1SQV J;  2QJP B;  3G6E P;  1JEK A;  2UWJ E;  2A06 G;  5CCG D;  1NTK E;  5CCH C;  1NTM D;  2M8R A;  3CMA P;  1GW3 A;  1GD2 E;  2ZYD A;  4W7Y A;  1GK4 A;  2E74 B;  2JWD A;  2I1K A;  2XZR A;  3OJA B;  1KYO D;  1SQB D;  2R5D A;  2KSJ A;  1X9V A;  3L71 E;  1NAY A;  2W6B A;  3HUS A;  2C0X A;  1PGJ A;  1YI2 P;  1L0N G;  1FDO A;  1PFI A;  1SQX K;  2W6A A;  1NU1 E;  3CCL P;  5AVS B;  3S1K A;  1KIL E;  1RQU A;  3BRT B;  5APW A;  3JSV C;  1JY2 P;  2QJK C;  3H1K J;  3VMY A;  1SQV G;  3F5H A;  2K3R A;  2JEE A;  2XU6 A;  3L70 D;  2Q7C A;  4L76 A;  3G4S P;  3H1I D;  1OVV A;  1DIP A;  1SQX D;  2JDI H;  3H1J E;  3VMX A;  1LNQ A;  1YQ3 C;  3I56 P;  1PP9 J;  3RK3 B;  1USE A;  3HTK B;  2HR3 A;  1RY3 A;  1N7S C;  1ZR2 A;  3NXS A;  4YXW H;  5EFW B;  5KJ7 A;  4BXL A;  2WSE J;  4MN4 C;  2WMM A;  1IZN B;  3AE1 C;  2R3C A;  4JYC A;  2FY8 A;  3VMA A;  2RMZ A;  1NTK D;  3B4S A;  3P7K A;  2NPS B;  4H44 C;  1BCC J;  3CX5 I;  3LW5 J;  3H1K G;  1BE3 E;  3NFQ A;  2IZ1 A;  4L74 A;  1URQ D;  1IFN A;  1JY2 O;  3C9I A;  1QVG O;  1K9M Q;  1OFC X;  3RL0 g;  4LC1 A;  3L71 D;  1PP9 G;  3IFM A;  3AE7 C;  3SWK A;  1SVF A;  1G1J A;  2O1J A;  1L4A C;  1NTM J;  2K9Y A;  2AEJ A;  3GMA A;  2L91 A;  2E75 C;  2KNC A;  2IX7 C;  1NU1 D;  2LR2 A;  3V4Q A;  3V5B A;  1JM0 A;  4WY4 D;  3CCS P;  1KIL D;  1UIX A;  1IFI A;  2VRS A;  3PH0 A;  1HJB A;  1EZV E;  1J1D B;  1HGV A;  3FWN A;  2KI7 B;  1QL2 A;  3WMM 0;  4GIF A;  3HRN A;  2N1T D;  3U59 A;  1NYH A;  1SQQ J;  4IFF A;  1CI6 B;  1BDD A;  2B88 A;  3P8M C;  3W67 A;  1RE3 A;  2ZYG A;  2ZT9 B;  3H1J D;  1RQV A;  3AEG C;  1BCC G;  4D6T E;  2XNX A;  1SQP E;  2W8Z A;  3TGU J;  4I7Z C;  1NVO A;  2AEF A;  3GF3 A;  2XDJ A;  1MUU A;  2Z5H A;  1NTZ E;  3N4X A;  1M1J A;  4OVN F;  3IN6 A;  4PD4 E;  1EDK A;  5KKZ C;  3H1I J;  1RF0 A;  2YIU C;  4LGD E;  3CCV P;  1NTM G;  2J59 M;  4XA4 A;  2OYI B;  5AVX B;  4C7N A;  2A45 H;  1K8A Q;  4JPZ B;  3RL0 D;  1EC5 A;  4O9B A;  4ZMD A;  5C39 A;  2JR8 A;  1PZQ A;  2Y0C A;  4GOE A;  3HD7 C;  1BE3 D;  2FYU J;  1X79 B;  1QX8 A;  1U57 A;  3RL0 C;  1KQF B;  5DJT B;  4OGQ C;  2BAS A;  1FJP A;  4BRY B;  3M0D C;  4XFJ A;  2KXP B;  5KAF H;  1S9K E;  2P58 A;  1DEE G;  3L73 E;  3O6Q B;  1JY3 N;  3TGU G;  3E7K A;  2MKV A;  3PP5 A;  1NTK J;  1PL5 A;  2NPS A;  2HFE D;  2IFM A;  1L0N E;  2YKQ A;  3B71 A;  1SQP K;  1MZ9 A;  2HOD A;  4U7J A;  1IK9 A;  1ZRT E;  1WT6 A;  1IFM A;  2OTK E;  3H1I G;  3L36 A;  3MIW A;  1EZV D;  3N7N A;  4AQR D;  1N73 B;  3SWY A;  1D7M A;  2WTY A;  1ZME C;  3L37 A;  5KJ7 D;  1NTZ K;  2P7J A;  3B5N A;  2OAR A;  1ZN5 A;  2YO2 A;  1HTL C;  1LP1 B;  2W90 A;  4D6T D;  2YMK A;  1SQP D;  1NU1 J;  5TIS E; 
#chains in the Genus database with same CATH homology
 1VF5 B;  1S5L X;  3AEA C;  2WSC J;  2WSE J;  1S1C X;  1TU3 F;  3ABV C;  3SFD C;  4OGQ D;  3Q5R A;  1K05 A;  4GDO A;  2E76 C;  2QSI A;  2G8Y A;  3IN6 A;  2FBW C;  4I7Z B;  2E74 C;  3EWK A;  4PV1 D;  5KKZ C;  3G9R A;  5KLI C;  3AEB C;  4R4M A;  3GLM A;  2YIU C;  3AE1 C;  4H0L D;  2E75 D;  3H25 A;  3D71 A;  3Q1M A;  1KTM A;  4KT0 J;  1GMJ A;  4H13 D;  4TT3 H;  1FDI A;  1R8E A;  3RK3 E;  3AE9 C;  2E76 B;  1ZP0 C;  3AEC C;  2WPV B;  4H44 C;  2E74 B;  1HF9 A;  3AE8 C;  3LW5 J;  3S9O A;  3AE6 C;  2D2C C;  3D70 A;  3IAO A;  3SFE C;  2JP3 A;  4R4L A;  4H13 C;  3AE3 C;  3AEF C;  3GF7 A;  1NGM B;  2V7Q J;  1DD3 A;  3AE5 C;  4H44 B;  3RL0 g;  1U57 A;  1YQ4 C;  1KQF B;  2NZ2 A;  2D2C B;  1VF5 D;  4H0L B;  1FDO A;  2QJY C;  4OGQ C;  3FGA D;  1KMI Z;  3AEE C;  2BEQ D;  1ZOY C;  1KOR A;  4H13 B;  3T97 B;  4XFJ A;  2BEZ F;  2J5U A;  3AE7 C;  3Q5S A;  4PV1 C;  2IDB A;  1OW6 A;  3D6Z A;  2ZT9 D;  2K9Y A;  3GMA A;  1KIL E;  1RQU A;  1VL2 A;  2E75 C;  4H0L C;  2MKV A;  2H88 C;  1PL5 A;  4OGQ B;  2WSF J;  4Y28 J;  4YXD C;  2WQY C;  3AE2 C;  1UIX A;  2QJK C;  3R4Y A;  4PV1 B;  3B71 A;  3Q5P A;  1Q90 D;  1PIX A;  2E74 D;  3C8V A;  2ZT9 C;  4U7J A;  5M1B A;  1ZRT E;  1OW7 A;  1EXI A;  2E75 B;  1IK7 A;  1K04 A;  1JB0 J;  1EXJ A;  1AJY A;  1HJ0 A;  2H89 C;  2G3A A;  1NYH A;  1DIP A;  2QIW A;  2FYN C;  3D6Y A;  1DD4 A;  1Y9B A;  5L8R J;  3Q2Y A;  2JO1 A;  1YQ3 C;  1ZME C;  2OQQ A;  2FXP A;  4H44 D;  2ZT9 B;  1VF5 C;  1RQV A;  3AEG C;  4Z1M H;  3Q3D A;  2D2C D;  1KQG B;  1WMK A;  3AED C;  4RKU J;  2P10 A;  3AE4 C;  3O6Q A;  1OW8 A;  2E76 D;  2QJP C;  1PV3 A;  4I7Z C;  1OMI A;  4YTP C;  2YMK A;  2O01 J;  1MKM A;  3GF3 A;  4IL6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...