4KT0J

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
b'MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 12
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4kt0J00
4OGQB 1ZRTE 5KLIC 2FYNC 4H0LB 1S5LX 2WPVB 2D2CB 2QJKC 2YIUC 4RKUJ 5KKZC 2E74B 2WSEJ 4Y28J 2QSIA 5L8RJ 1Q90D 4PV1B 2QJPC 2WSFJ 2QIWA 3LW5J 4I7ZB 2K9YA 2QJYC 2WSCJ 4H44B 2E76B 2E75B 4H13B 1JB0J 4IL6X 2ZT9B 4KT0J 3C8VA 2O01J 1VF5B
chains in the Genus database with same CATH superfamily
1LJ2A 1VQNP 2OTKE 1SQBE 1BE3G 1YIJP 1EDLA 2BEQD 1JUNA 3H1JD 1NU1K 3N7NA 1GZLA 2M3BA 2KZIA 4GODA 3LW5J 3HD7D 1BSHA 1EZVI 1DIPA 5AW4B 1KILA 2IFNA 1JY2O 3P8MC 3GW6A 3L72E 1S5LX 5CBOA 2LKMA 1SFCC 1EZVD 2GUVA 2WWWA 1RF1C 1VQ6P 3LW5H 5AVWB 1PGQA 1SVFA 1USEA 3L74E 3TGUD 1Q82Q 3H32A 2P7JA 4PD4H 5AW9B 1GTWA 1SQQD 1PV3A 2FYNC 5KAFE 1OW6A 4Y99B 2FYUE 3E1IA 3O6QA 1IFJA 1SQBK 1YTZI 3M9QA 2OYOA 3C9IA 1AA0A 4I1LA 4ZKUA 3CX5I 4DT0A 3TF5A 1BGYJ 3RL0C 2E74B 4JPZB 1KILB 2V7QJ 2OYIC 1S4XA 4EIJA 4I7ZB 3CXHE 1OW8A 2WSCJ 1K05A 1HGZA 1HJBA 4C7RA 4H13B 2YO3A 1DH3A 1IFDA 3D71A 1USDA 1R5LA 1T8ZA 1BGYG 5AVZB 3WUTA 5AVYB 4JQ0D 4XFJA 1NYHA 2KXPB 3H32B 2V7QH 2FYZA 3RK2D 3RK3D 3AE1C 2W6AA 1HF9A 2AEMA 2FYUK 3Q5SA 2KNCA 1S72P 4UB8E 1L0NJ 3O6QB 1VQPP 1W5CE 2GUSA 2K9JA 4NPEA 1MFTA 4L76A 2HR3A 5BU5A 5AW8B 1KD1Q 3P32A 3Q2YA 3BRVB 3AEEC 2IBZI 1JB0J 1N8RQ 3L70J 2ITAA 2Z5IA 1L0NG 1T2KC 1QGKB 1ZR2A 3CLQA 3WU2E 1RQUA 1X79B 1T3UA 1PZQA 4W7YA 2QJPB 1P84E 1Y8AA 1KB9I 2IZ0A 5M1BA 1J1DC 4OH8B 2CPBA 3L70G 3HUSC 3U59A 2P58A 2O01H 1AQTA 5C39A 1KB9D 1NOHA 5KKZC 4MN4C 2BASA 3RL0D 1SFCA 2KNCB 3GMAA 2KP8A 2ZVNB 2P10A 2K9JB 1FZEA 2E43A 1J1EC 5GTHE 2J58A 3TNUA 1A02J 3G3ZA 3K5BA 3H1IG 4L73A 4ASVA 1VQ5P 4GOFA 5AW7B 3CWBJ 1JY3P 5E79E 3BATA 1PPJE 1EDJA 2CPSA 1FZBA 5CJ0A 1DX7A 3V5BA 2R3SA 4K3AA 4NPDA 1RE3C 2Q3EA 3KYQA 1KZUB 3L73E 3KZIE 1N73B 3AE9C 1VPCA 3CWBG 2C9NY 3RL0g 1SFCB 2Q7CA 3O8ZA 3PH0A 1YHQP 4H0LC 3IF4A 3CCLP 2XU6A 5L8RJ 5AW0B 2ZVOB 2WPSA 2XV5A 3TNUB 2W8ZA 3FWLA 3TK1A 3SSUA 1JY2N 3H25A 1MZ9A 1SS1A 5KJ7C 3VMYA 1NU1D 3M9BA 1FU1A 1ZRTD 1ZOYC 5K5GB 3CC4P 2E76B 1KYOI 1JMMA 1OW7A 1SQQJ 1LTTC 2Y0CA 1KYOD 1EZVG 1BCCD 1MV8A 4HB1A 1CI6A 3ITKA 3CI9A 1KV4A 3ABVC 3BASA 3CD6P 4H44B 3B5NB 4GOEA 1ZP0C 3EWKA 3D70A 2QA4P 1SQQG 4ZMDA 3HUSA 2YKQA 2B89A 4OGQD 1EXJA 1SQBD 3V2PA 1M1JA 2QIWA 4PV1C 1N86A 1KMIZ 1RE4C 2J5UA 3VMXA 1JCCA 2QEXP 2P1JA 3MUDC 3SWFA 3AEFC 1OWAA 1Y47A 3V2NA 1LTJC 3L72D 4DZOA 1HUCA 3CX5H 3H1HD 3MGNA 1R5SA 1BSNA 4L75A 3T97A 1SQPE 5KAIE 3L74D 3II6A 1CI6B 3JCUH 3P8CE 4LLHA 2IYOA 2Y0DA 2FYUD 2CK3H 1FJKA 3HUSB 1SP4A 3VN0A 2LR2A 3CCRP 2QRXA 1M1JB 1IFNA 2QJKC 1BDDA 2PFXA 2KIKA 1NTKE 2KSEA 3B8EB 2L91A 2QJYC 4EOTA 1J1EB 2BCCE 2E42A 2V4HA 1ZLLA 3CXHD 2FBWC 2FFDC 2OQQA 3CCVP 3BCCJ 1U7MA 1QL1A 2HLOA 3H1LJ 2JO1A 2IBZG 1SQPK 3HD7C 5KJ7A 2DW3A 1MKMA 3T97B 1SQVK 4PV1D 2OTJP 3MP7B 2AXTE 2NPSD 3USSA 2ZT9D 3BCCG 2A06E 3IR9A 3IN6A 3H1LG 1N7SA 3IAOA 3CC7P 3HE4A 1NTKK 2VRSA 1SQXE 1Q86Q 2R5DA 1IFIA 2ZJSE 5AW2B 1Y9BA 4H0LB 1OZHA 2GM4A 2FY8A 3G9RA 2WSEJ 2W6JH 4IL6H 1JTHA 1PL5A 2N9BA 1FAVA 4WY4A 3L75J 2QM8A 5APXA 1P84D 1RE4A 3Q1MA 5APYA 2R44A 1M8OB 1BCCE 2H88C 2YIUC 1LTBC 3MUDA 1T6AA 4PD4E 2YKOA 2POHA 3HTKA 1X9VA 3L75G 1Q7YQ 3L71J 5BVZA 5GTIH 1N7SB 3WUUA 5APTA 2XKMA 3A2AA 2YNYA 3VMZA 2W6BA 1SQXK 1VDFA 3HE4B 3RK2C 3RK3C 2D2CD 5H2FH 3SFDC 1W2EA 1H8AA 3C1LA 3L71G 1YITP 1M90Q 2H43A 4YPCA 1JTHB 5KLVJ 1PPJD 4WY4B 3M06A 1HGVA 3H1HE 4HKZH 3F89A 2WTYA 2WT7A 1ZW0A 1HTLC 1KORA 3A0HH 3LIEA 1AQ5A 3L73D 3VP9A 1SLQA 1VL2A 1ZN5A 3EFFK 2WSSH 5KLVG 3Q3DA 1SQBJ 2JWDA 2N9YB 2SPZA 3HD7A 2XNDH 2KLUA 1HVVA 4Z1MH 5B66H 4LC1A 1BDCA 3EFGA 4RO0A 1FE6A 1QL2A 3MZWB 4I2LC 4D6TD 1NTZJ 1GDTA 1QX8A 1S9KE 3L72J 4WWIA 2WSFJ 1SQBG 3HE5A 1FZGA 2N1TC 2K9YA 1PP9E 3RBXA 3R2PA 1IZNB 2R5BA 1VQOP 3VP8A 4L74A 1JCDA 5KLIC 2IYPA 3L74J 3W67A 1NTZG 2QG4A 3L70E 2QJYB 3L72G 2WSFH 3L4FA 2NZ2A 4RESB 2FYUJ 2WSCH 4GKGA 2Q6QA 5AVXB 2W90A 4BRYA 3QWOC 3H1KE 2PP6A 3B4SA 3L74G 3HD7B 1VQ8P 2H8PD 2KOGA 4W7ZA 2HODA 1FOSF 2W83C 2FYUG 3ZDMA 2HYNA 3E7KA 2JEEA 3P7KA 3HE5B 2A45I 1IK7A 3AE3C 4RKUJ 1H88A 2QSIA 1OX3A 3MIWA 1L4AD 1Q81Q 3GLMA 2JJLA 3G71P 1YJNP 1JNMA 1M56D 2OYHC 3PTZA 3CCEP 2Q9IA 1KC8Q 4U3FE 4PJ0H 2IDBA 1NAYA 1KILE 2KSJA 3AE7C 2FXPA 1SQPD 3CWBE 1OVVA 4C46A 1E5WA 3H1IJ 1RF1A 4BRYB 1SQVD 3CCUP 2N1TD 3P8CD 1K8AQ 1JY2P 5CCGC 1L2PA 3CCJP 1PGJA 3I55P 2RMZA 4IFDK 1CZQA 1NTKD 4OWFA 2OARA 1S2EA 1URQD 4YXDC 1G1JA 3PLNA 3B5ND 1N2DC 2BCCD 1M1KQ 4OGQC 3MHVA 5CMZA 3S4RA 3RK3B 2K37A 2FXOA 3AE8C 2YXQB 2OYIA 3PHLA 1CSBA 2AEFA 3L36A 3QH9A 1ZR4A 3V2QA 1RF1B 3H1JJ 1LTIC 2ZXXA 4DCKA 2B9BA 2A06D 5AVUB 1YI2P 1OVUA 1X22A 4AYCA 4D6TE 2FYNB 1QLED 3M0DC 2AEJA 1SQXD 1X8YA 1LT9C 2K88A 3H1JG 1G1IA 3M0AA 4B86A 3G6EP 1PGPA 2O1JA 4N6JA 2I1KA 2QVAA 4AUWA 1L0LE 1NHLA 3TGUJ 3CX5E 5CCGD 3L73J 3RL0B 4CPGA 2XZRA 3AE6C 1IC2A 2OYIB 1MUUA 5TJHA 1PPJG 1H89A 1NGMB 1UIXA 3JCUE 4PD4D 2OTLP 2Y0EA 1Z56A 4KT0J 1AFOA 3TGUG 1JM0A 2OYHA 3FXDA 3L73G 3A0BH 1FZCC 1NKZB 3KZIH 5AVVB 1QVFO 2O3JA 2J59M 4XA4A 3L35A 2G3AA 4K35A 2GA1A 2NPSC 2C9LY 2M3EA 2Q5UA 2WPRA 2ZT9C 2W27A 3JC22 2JR8A 1L0LK 1RHZB 1GL2D 3H6PA 4GDOA 2ZYGA 1LGHB 2O01N 1U7JA 2IBZE 1FS0E 2KLVA 3WUVA 1DEBA 4A7PA 1BGYD 1VF5D 3U1CA 4Y99C 1SQVE 5EFWB 4GT1A 2MKVA 2PAJA 3BCCE 3AE5C 2OYHB 1YJWP 1J1DB 4BXLA 1RE3A 3N4XA 3VMAA 2B88A 1D7MA 3H1LE 1E79H 4OVNF 2E75D 4WVZA 2WPVB 1HBWA 4DJGA 5KKZB 1ZXGA 1S3JA 3HRNA 1U57A 4WBAA 3OW2O 2E74C 3AECC 3CXHI 3TDKA 1S9KD 1PP9D 3OAKA 4IL6E 3VYIA 5KTBA 1RY3A 2ZFCA 4NPFX 1KTMA 2D2CC 1AJYA 4HJGH 3M0DA 1Q90D 4ZKPA 5APSA 4IFMA 2A45H 3L70D 2A45G 5CCHD 4OGQB 4UB6E 2Y9ZA 2KI7B 1NTME 2IX7C 3AEGC 1FDOA 2XDJA 3L75E 1KB9H 1PGOA 2KUBA 2OGUA 1NAFA 3A5TA 3H1KD 1BE3E 3CCSP 3CMEP 1KQFB 2IPPA 2M5AA 5H2FE 4YTPC 1NWQA 5TISH 1VQ4P 1IFMA 1H0TA 5DJTB 1FZAA 1P84I 3S1KA 1FZCA 3FX0A 3L71E 2QJPC 3A7OA 1Q2NA 5APUA 2JWAA 2R3CA 1M7LA 1YQ4C 5BU8B 2YMYA 2NPSA 1AVOA 5DJUB 1VQLP 1LNQA 2YXRB 2C0XA 1K04A 2HG5D 2P2UA 2WSEH 4U3FD 1XTCC 3GF3A 1NTMK 2E74D 1LTJA 1KILD 3CWBD 2KB7P 3V4QA 5B5EH 1S5LH 5KLVE 2PRRA 4H13D 1NO4A 5AW6B 2B87A 1SQXJ 1NU1J 3KPEA 2M5AB 2E5TA 2A06G 1H0TB 2UWJE 4IL6X 3B71A 3PP5A 2KS1A 3KQGA 2YO2A 1FZCB 1LTGC 1FDMA 1LP1A 1NJIQ 4KJMA 4BWNA 2K3RA 4KHXA 1SQXG 4C7NA 1NU1G 1WT6A 4PV1B 3BVHA 1BCCJ 5AW5B 3NMDA 2NPSB 2I1JA 1BGYE 2ZT9B 1NTZE 3C8VA 1N73C 2Q1KA 2HPCA 1PIXA 5KLVK 1LTJB 3AEAC 2FFDA 1L4AC 1KYOH 3HTKB 2ZYDA 1BCCG 1VQKP 1WMKA 1JY3O 4R4MA 2FKWB 1QVGO 3CCMP 2B87B 1JMBA 5AVSB 1GK6A 2WITA 4Y28J 1LWUC 3CC2P 1L0NE 2KS1B 1K9MQ 2E76C 2LXBA 1LP1B 3H1HJ 2RN0A 3SWYA 4C7NB 3L37A 2QJKB 1L0LD 4M3LA 1NTZK 1VQ7P 2WT7B 3AE4C 3CX5D 1X0TA 2Z4EA 2HFED 1GW3A 4PJ0E 3Q5PA 2HPCB 1URQC 4H44C 3SFEC 1FBMA 3B5NC 1IFPA 3H1HG 2FFDB 2D2CB 3Q5RA 5KAFH 1GW4A 1GD2E 1L0NK 1ZV8A 1PP9J 4ASWA 3H1IE 1JO5A 4XE5B 1SFCD 2I8DA 3U1AA 3GF7A 3GHGC 1IK9A 2WMMA 4QMAA 2O01J 3D6ZA 1PP9G 3WMM0 3CXHH 3MTUE 2YMKA 2P67A 4N78E 3LIDA 2IBZD 2JDIH 4JF7A 3GG2A 1ZMEC 1IJDB 5CHXA 3H1KJ 4EI2A 1EXIA 3A3YB 2RKLA 4ZNCA 4YXWH 2NRGA 3BCCD 2E76D 2KZJA 4EYYQ 1N73A 2YIUB 1M1JC 1AV1A 3H1LD 3F5HA 4UB8H 4O9BA 2HODB 3V4WA 3NTNA 1GU5A 1L4AA 2RH0A 3H1KG 3I5CA 1OVRA 1TU3F 3H1JE 4H44D 2M0BA 5CBNA 1KQSO 2IFMA 3M91A 4TT3H 3RK2B 1LT1A 1R8EA 2WPQA 3S9OA 4U3FJ 2KK7A 3WU2H 3IFMA 1LWUA 5APVA 1EZVE 2N1TA 1P84H 2H7HA 4JYBA 1GL2C 3AEDC 1GK4A 4TLFA 3TGUE 1NTMD 2FXMA 4U3FG 2XNXA 3L75D 1SQQE 3A0BE 1DEEG 1BE3D 1URQA 1YBKA 1OMIA 2K1AA 3E1RA 3FGAD 1VF5C 3B5NA 1VQMP 1HWTC 1T2KD 1L4AB 2AXCA 5AW1B 5GTHH 1G2CA 1KQLA 3PRJA 2KYVA 2IZ1A 1FDIA 5AW3B 3L71D 3G4SP 2E75C 4IFFA 3M9HA 3KDPB 2C0WA 4PD4I 1KFMA 1LWUB 5E79H 4AQRD 2N1TB 1PFIA 4JBZA 1FC2C 1EQ7A 1N7LA 3R4YA 1JY3N 5KLIB 3GHGA 1AVYA 2H89C 1SQQK 1N7SC 3RK3E 2Y9YA 5KLVD 4D6TJ 3TYYA 4W80A 1FZFA 2JKVA 1YQ3C 3FWNA 1URQB 5CCHC 4EDFA 1RF0C 3CPWO 3MD0A 1J2JB 2G8YA 1MFZA 1G2CB 1EDIA 5CCGA 1L0LJ 1M57D 3I56P 4D6TG 4WY4C 2WVRA 4U7JA 1RQVA 4I6MC 2WZ7A 4HH2A 3PJSK 2Z5HA 1NTZD 1L0LG 3VTPC 2WQYC 4H0LD 2E5YA 2ZXEB 3JSVC 3GHGB 3W68A 1T3JA 3VOPA 1DD4A 1KB9E 1KN7A 4R4LA 5APQA 1IO4A 1W2BO 1FJPA 1JEKA 2JP3A 5KJ7D 1GL2A 1HH0A 1HJ0A 1OFCX 3NXSA 3CCQP 1KILC 5TISE 1K73Q 3SWKA 1NVOA 4I7ZC 1CW5A 3RBZA 4RJTA 1L0ND 4H13C 1QEXA 1A02F 5APWA 1FOSE 1N7SD 2ZAEB 1SQPJ 3AEBC 1LT9A 2ZYAA 2O1KA 3KXDA 1RH5B 1EDKA 3D6YA 1LTSC 1SQVJ 2QM7A 3CL3D 3NFQA 3TSIA 1YJ9P 5B5EE 1S5LE 1NH4A 2PGDA 1EC5A 5GTIE 1SQPG 3OA7A 5KAIH 4WY4D 2L5GB 2QE7H 5CJ4A 2MJZA 1WRGA 1NTKJ 1SQVG 1GL2B 2R32A 2BCCJ 1LTAC 3KHUA 1DD3A 1GMJA 3EQ2A 3H1ID 1KFNA 3RGUA 5AVTB 3OJAB 4DOJA 1OXZA 1NTKG 1NU1E 5AVQB 1KQGB 1VF5B 5CCHA 1ZRTE 3V6IA 1OIPA 1RF0A 2YKPA 1S1CX 1LT9B 2BCCG 4WB4A 1YYCA 5AVRB 3A0HE 1UIIA 2M8RA 3AE2C 2Q3IA 4IOIH 3UIAA 1NTMJ 4N78D 1YTZT 4HYTB 2BEZF 2E75B 3BRTB 1VQ9P 1KYOE 2LXCB 1BE3J 3CMAP 4GIFA 1NKNA 4LGDE 4JYCA 1XTGB 5B66E 3FXEA 2AXTH 4N3YB 4UB6H 1GU4A 1NTMG 3V2RA 1JOCA
chains in the Genus database with same CATH topology
2G8YA 1OW7A 1PIXA 2BEQD 2H88C 2IDBA 2QJKC 3AEDC 2YIUC 1VF5D 3AEAC 1KILE 3AE7C 4XFJA 1NYHA 2FXPA 3Q1MA 2QJPC 2WSFJ 3GF7A 3LW5J 2MKVA 4U7JA 3AE1C 2K9YA 2QJYC 1RQVA 3ABVC 1HF9A 3AE5C 4H44B 1DIPA 3Q5SA 1WMKA 4R4MA 1YQ4C 1ZP0C 3EWKA 2O01J 3D70A 2FBWC 1OMIA 5KLIC 2OQQA 2E75D 3FGAD 1VF5C 3D6ZA 1S5LX 2WPVB 2YMKA 3AE6C 4OGQD 1EXJA 1U57A 1K04A 2JO1A 1DD3A 4Y28J 1GMJA 2E74C 2WQYC 4H0LD 2D2CD 3AECC 1ZMEC 3GF3A 2QIWA 4PV1C 3SFDC 1NGMB 2E74D 3Q2YA 1KMIZ 1MKMA 1UIXA 3T97B 1EXIA 2NZ2A 1FDIA 4PV1D 3AEEC 2J5UA 1DD4A 1JB0J 2E76C 3AE9C 4KT0J 2E75C 1VF5B 1KQGB 4R4LA 4YXDC 3RL0g 1ZRTE 2E76D 1PV3A 4H13D 2FYNC 2ZT9D 4OGQC 1S1CX 1OW6A 1RQUA 4H0LC 3AEFC 1KTMA 2D2CC 1AJYA 3IN6A 3O6QA 2JP3A 5L8RJ 3AE8C 1Q90D 3AE4C 3AE2C 1HJ0A 3IAOA 2G3AA 3Q5PA 4I7ZC 2BEZF 2E75B 4H44C 5M1BA 1KORA 4IL6X 3SFEC 3B71A 3R4YA 1TU3F 4H13C 2ZT9C 4H44D 4OGQB 1Y9BA 3H25A 2H89C 4H0LB 2D2CB 1IK7A 3AE3C 3RK3E 3AEGC 1FDOA 4RKUJ 1VL2A 3G9RA 2E74B 4TT3H 5KKZC 2WSEJ 2QSIA 1ZOYC 1R8EA 4GDOA 3GMAA 2V7QJ 4PV1B 3Q5RA 3Q3DA 3AEBC 3GLMA 3S9OA 4I7ZB 1YQ3C 1PL5A 1OW8A 2WSCJ 1K05A 2E76B 2P10A 4Z1MH 3D6YA 1KQFB 4H13B 2ZT9B 3C8VA 4YTPC 3D71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ B;  1ZRT E;  5KLI C;  2FYN C;  4H0L B;  1S5L X;  2WPV B;  2D2C B;  2QJK C;  2YIU C;  4RKU J;  5KKZ C;  2E74 B;  2WSE J;  4Y28 J;  2QSI A;  5L8R J;  1Q90 D;  4PV1 B;  2QJP C;  2WSF J;  2QIW A;  3LW5 J;  4I7Z B;  2K9Y A;  2QJY C;  2WSC J;  4H44 B;  2E76 B;  2E75 B;  4H13 B;  1JB0 J;  4IL6 X;  2ZT9 B;  4KT0 J;  3C8V A;  2O01 J;  1VF5 B; 
#chains in the Genus database with same CATH topology
 1LJ2 A;  1VQN P;  2OTK E;  1SQB E;  1BE3 G;  1YIJ P;  1EDL A;  2BEQ D;  1JUN A;  3H1J D;  1NU1 K;  3N7N A;  1GZL A;  2M3B A;  2KZI A;  4GOD A;  3LW5 J;  3HD7 D;  1BSH A;  1EZV I;  1DIP A;  5AW4 B;  1KIL A;  2IFN A;  1JY2 O;  3P8M C;  3GW6 A;  3L72 E;  1S5L X;  5CBO A;  2LKM A;  1SFC C;  1EZV D;  2GUV A;  2WWW A;  1RF1 C;  1VQ6 P;  3LW5 H;  5AVW B;  1PGQ A;  1SVF A;  1USE A;  3L74 E;  3TGU D;  1Q82 Q;  3H32 A;  2P7J A;  4PD4 H;  5AW9 B;  1GTW A;  1SQQ D;  1PV3 A;  2FYN C;  5KAF E;  1OW6 A;  4Y99 B;  2FYU E;  3E1I A;  3O6Q A;  1IFJ A;  1SQB K;  1YTZ I;  3M9Q A;  2OYO A;  3C9I A;  1AA0 A;  4I1L A;  4ZKU A;  3CX5 I;  4DT0 A;  3TF5 A;  1BGY J;  3RL0 C;  2E74 B;  4JPZ B;  1KIL B;  2V7Q J;  2OYI C;  1S4X A;  4EIJ A;  4I7Z B;  3CXH E;  1OW8 A;  2WSC J;  1K05 A;  1HGZ A;  1HJB A;  4C7R A;  4H13 B;  2YO3 A;  1DH3 A;  1IFD A;  3D71 A;  1USD A;  1R5L A;  1T8Z A;  1BGY G;  5AVZ B;  3WUT A;  5AVY B;  4JQ0 D;  4XFJ A;  1NYH A;  2KXP B;  3H32 B;  2V7Q H;  2FYZ A;  3RK2 D;  3RK3 D;  3AE1 C;  2W6A A;  1HF9 A;  2AEM A;  2FYU K;  3Q5S A;  2KNC A;  1S72 P;  4UB8 E;  1L0N J;  3O6Q B;  1VQP P;  1W5C E;  2GUS A;  2K9J A;  4NPE A;  1MFT A;  4L76 A;  2HR3 A;  5BU5 A;  5AW8 B;  1KD1 Q;  3P32 A;  3Q2Y A;  3BRV B;  3AEE C;  2IBZ I;  1JB0 J;  1N8R Q;  3L70 J;  2ITA A;  2Z5I A;  1L0N G;  1T2K C;  1QGK B;  1ZR2 A;  3CLQ A;  3WU2 E;  1RQU A;  1X79 B;  1T3U A;  1PZQ A;  4W7Y A;  2QJP B;  1P84 E;  1Y8A A;  1KB9 I;  2IZ0 A;  5M1B A;  1J1D C;  4OH8 B;  2CPB A;  3L70 G;  3HUS C;  3U59 A;  2P58 A;  2O01 H;  1AQT A;  5C39 A;  1KB9 D;  1NOH A;  5KKZ C;  4MN4 C;  2BAS A;  3RL0 D;  1SFC A;  2KNC B;  3GMA A;  2KP8 A;  2ZVN B;  2P10 A;  2K9J B;  1FZE A;  2E43 A;  1J1E C;  5GTH E;  2J58 A;  3TNU A;  1A02 J;  3G3Z A;  3K5B A;  3H1I G;  4L73 A;  4ASV A;  1VQ5 P;  4GOF A;  5AW7 B;  3CWB J;  1JY3 P;  5E79 E;  3BAT A;  1PPJ E;  1EDJ A;  2CPS A;  1FZB A;  5CJ0 A;  1DX7 A;  3V5B A;  2R3S A;  4K3A A;  4NPD A;  1RE3 C;  2Q3E A;  3KYQ A;  1KZU B;  3L73 E;  3KZI E;  1N73 B;  3AE9 C;  1VPC A;  3CWB G;  2C9N Y;  3RL0 g;  1SFC B;  2Q7C A;  3O8Z A;  3PH0 A;  1YHQ P;  4H0L C;  3IF4 A;  3CCL P;  2XU6 A;  5L8R J;  5AW0 B;  2ZVO B;  2WPS A;  2XV5 A;  3TNU B;  2W8Z A;  3FWL A;  3TK1 A;  3SSU A;  1JY2 N;  3H25 A;  1MZ9 A;  1SS1 A;  5KJ7 C;  3VMY A;  1NU1 D;  3M9B A;  1FU1 A;  1ZRT D;  1ZOY C;  5K5G B;  3CC4 P;  2E76 B;  1KYO I;  1JMM A;  1OW7 A;  1SQQ J;  1LTT C;  2Y0C A;  1KYO D;  1EZV G;  1BCC D;  1MV8 A;  4HB1 A;  1CI6 A;  3ITK A;  3CI9 A;  1KV4 A;  3ABV C;  3BAS A;  3CD6 P;  4H44 B;  3B5N B;  4GOE A;  1ZP0 C;  3EWK A;  3D70 A;  2QA4 P;  1SQQ G;  4ZMD A;  3HUS A;  2YKQ A;  2B89 A;  4OGQ D;  1EXJ A;  1SQB D;  3V2P A;  1M1J A;  2QIW A;  4PV1 C;  1N86 A;  1KMI Z;  1RE4 C;  2J5U A;  3VMX A;  1JCC A;  2QEX P;  2P1J A;  3MUD C;  3SWF A;  3AEF C;  1OWA A;  1Y47 A;  3V2N A;  1LTJ C;  3L72 D;  4DZO A;  1HUC A;  3CX5 H;  3H1H D;  3MGN A;  1R5S A;  1BSN A;  4L75 A;  3T97 A;  1SQP E;  5KAI E;  3L74 D;  3II6 A;  1CI6 B;  3JCU H;  3P8C E;  4LLH A;  2IYO A;  2Y0D A;  2FYU D;  2CK3 H;  1FJK A;  3HUS B;  1SP4 A;  3VN0 A;  2LR2 A;  3CCR P;  2QRX A;  1M1J B;  1IFN A;  2QJK C;  1BDD A;  2PFX A;  2KIK A;  1NTK E;  2KSE A;  3B8E B;  2L91 A;  2QJY C;  4EOT A;  1J1E B;  2BCC E;  2E42 A;  2V4H A;  1ZLL A;  3CXH D;  2FBW C;  2FFD C;  2OQQ A;  3CCV P;  3BCC J;  1U7M A;  1QL1 A;  2HLO A;  3H1L J;  2JO1 A;  2IBZ G;  1SQP K;  3HD7 C;  5KJ7 A;  2DW3 A;  1MKM A;  3T97 B;  1SQV K;  4PV1 D;  2OTJ P;  3MP7 B;  2AXT E;  2NPS D;  3USS A;  2ZT9 D;  3BCC G;  2A06 E;  3IR9 A;  3IN6 A;  3H1L G;  1N7S A;  3IAO A;  3CC7 P;  3HE4 A;  1NTK K;  2VRS A;  1SQX E;  1Q86 Q;  2R5D A;  1IFI A;  2ZJS E;  5AW2 B;  1Y9B A;  4H0L B;  1OZH A;  2GM4 A;  2FY8 A;  3G9R A;  2WSE J;  2W6J H;  4IL6 H;  1JTH A;  1PL5 A;  2N9B A;  1FAV A;  4WY4 A;  3L75 J;  2QM8 A;  5APX A;  1P84 D;  1RE4 A;  3Q1M A;  5APY A;  2R44 A;  1M8O B;  1BCC E;  2H88 C;  2YIU C;  1LTB C;  3MUD A;  1T6A A;  4PD4 E;  2YKO A;  2POH A;  3HTK A;  1X9V A;  3L75 G;  1Q7Y Q;  3L71 J;  5BVZ A;  5GTI H;  1N7S B;  3WUU A;  5APT A;  2XKM A;  3A2A A;  2YNY A;  3VMZ A;  2W6B A;  1SQX K;  1VDF A;  3HE4 B;  3RK2 C;  3RK3 C;  2D2C D;  5H2F H;  3SFD C;  1W2E A;  1H8A A;  3C1L A;  3L71 G;  1YIT P;  1M90 Q;  2H43 A;  4YPC A;  1JTH B;  5KLV J;  1PPJ D;  4WY4 B;  3M06 A;  1HGV A;  3H1H E;  4HKZ H;  3F89 A;  2WTY A;  2WT7 A;  1ZW0 A;  1HTL C;  1KOR A;  3A0H H;  3LIE A;  1AQ5 A;  3L73 D;  3VP9 A;  1SLQ A;  1VL2 A;  1ZN5 A;  3EFF K;  2WSS H;  5KLV G;  3Q3D A;  1SQB J;  2JWD A;  2N9Y B;  2SPZ A;  3HD7 A;  2XND H;  2KLU A;  1HVV A;  4Z1M H;  5B66 H;  4LC1 A;  1BDC A;  3EFG A;  4RO0 A;  1FE6 A;  1QL2 A;  3MZW B;  4I2L C;  4D6T D;  1NTZ J;  1GDT A;  1QX8 A;  1S9K E;  3L72 J;  4WWI A;  2WSF J;  1SQB G;  3HE5 A;  1FZG A;  2N1T C;  2K9Y A;  1PP9 E;  3RBX A;  3R2P A;  1IZN B;  2R5B A;  1VQO P;  3VP8 A;  4L74 A;  1JCD A;  5KLI C;  2IYP A;  3L74 J;  3W67 A;  1NTZ G;  2QG4 A;  3L70 E;  2QJY B;  3L72 G;  2WSF H;  3L4F A;  2NZ2 A;  4RES B;  2FYU J;  2WSC H;  4GKG A;  2Q6Q A;  5AVX B;  2W90 A;  4BRY A;  3QWO C;  3H1K E;  2PP6 A;  3B4S A;  3L74 G;  3HD7 B;  1VQ8 P;  2H8P D;  2KOG A;  4W7Z A;  2HOD A;  1FOS F;  2W83 C;  2FYU G;  3ZDM A;  2HYN A;  3E7K A;  2JEE A;  3P7K A;  3HE5 B;  2A45 I;  1IK7 A;  3AE3 C;  4RKU J;  1H88 A;  2QSI A;  1OX3 A;  3MIW A;  1L4A D;  1Q81 Q;  3GLM A;  2JJL A;  3G71 P;  1YJN P;  1JNM A;  1M56 D;  2OYH C;  3PTZ A;  3CCE P;  2Q9I A;  1KC8 Q;  4U3F E;  4PJ0 H;  2IDB A;  1NAY A;  1KIL E;  2KSJ A;  3AE7 C;  2FXP A;  1SQP D;  3CWB E;  1OVV A;  4C46 A;  1E5W A;  3H1I J;  1RF1 A;  4BRY B;  1SQV D;  3CCU P;  2N1T D;  3P8C D;  1K8A Q;  1JY2 P;  5CCG C;  1L2P A;  3CCJ P;  1PGJ A;  3I55 P;  2RMZ A;  4IFD K;  1CZQ A;  1NTK D;  4OWF A;  2OAR A;  1S2E A;  1URQ D;  4YXD C;  1G1J A;  3PLN A;  3B5N D;  1N2D C;  2BCC D;  1M1K Q;  4OGQ C;  3MHV A;  5CMZ A;  3S4R A;  3RK3 B;  2K37 A;  2FXO A;  3AE8 C;  2YXQ B;  2OYI A;  3PHL A;  1CSB A;  2AEF A;  3L36 A;  3QH9 A;  1ZR4 A;  3V2Q A;  1RF1 B;  3H1J J;  1LTI C;  2ZXX A;  4DCK A;  2B9B A;  2A06 D;  5AVU B;  1YI2 P;  1OVU A;  1X22 A;  4AYC A;  4D6T E;  2FYN B;  1QLE D;  3M0D C;  2AEJ A;  1SQX D;  1X8Y A;  1LT9 C;  2K88 A;  3H1J G;  1G1I A;  3M0A A;  4B86 A;  3G6E P;  1PGP A;  2O1J A;  4N6J A;  2I1K A;  2QVA A;  4AUW A;  1L0L E;  1NHL A;  3TGU J;  3CX5 E;  5CCG D;  3L73 J;  3RL0 B;  4CPG A;  2XZR A;  3AE6 C;  1IC2 A;  2OYI B;  1MUU A;  5TJH A;  1PPJ G;  1H89 A;  1NGM B;  1UIX A;  3JCU E;  4PD4 D;  2OTL P;  2Y0E A;  1Z56 A;  4KT0 J;  1AFO A;  3TGU G;  1JM0 A;  2OYH A;  3FXD A;  3L73 G;  3A0B H;  1FZC C;  1NKZ B;  3KZI H;  5AVV B;  1QVF O;  2O3J A;  2J59 M;  4XA4 A;  3L35 A;  2G3A A;  4K35 A;  2GA1 A;  2NPS C;  2C9L Y;  2M3E A;  2Q5U A;  2WPR A;  2ZT9 C;  2W27 A;  3JC2 2;  2JR8 A;  1L0L K;  1RHZ B;  1GL2 D;  3H6P A;  4GDO A;  2ZYG A;  1LGH B;  2O01 N;  1U7J A;  2IBZ E;  1FS0 E;  2KLV A;  3WUV A;  1DEB A;  4A7P A;  1BGY D;  1VF5 D;  3U1C A;  4Y99 C;  1SQV E;  5EFW B;  4GT1 A;  2MKV A;  2PAJ A;  3BCC E;  3AE5 C;  2OYH B;  1YJW P;  1J1D B;  4BXL A;  1RE3 A;  3N4X A;  3VMA A;  2B88 A;  1D7M A;  3H1L E;  1E79 H;  4OVN F;  2E75 D;  4WVZ A;  2WPV B;  1HBW A;  4DJG A;  5KKZ B;  1ZXG A;  1S3J A;  3HRN A;  1U57 A;  4WBA A;  3OW2 O;  2E74 C;  3AEC C;  3CXH I;  3TDK A;  1S9K D;  1PP9 D;  3OAK A;  4IL6 E;  3VYI A;  5KTB A;  1RY3 A;  2ZFC A;  4NPF X;  1KTM A;  2D2C C;  1AJY A;  4HJG H;  3M0D A;  1Q90 D;  4ZKP A;  5APS A;  4IFM A;  2A45 H;  3L70 D;  2A45 G;  5CCH D;  4OGQ B;  4UB6 E;  2Y9Z A;  2KI7 B;  1NTM E;  2IX7 C;  3AEG C;  1FDO A;  2XDJ A;  3L75 E;  1KB9 H;  1PGO A;  2KUB A;  2OGU A;  1NAF A;  3A5T A;  3H1K D;  1BE3 E;  3CCS P;  3CME P;  1KQF B;  2IPP A;  2M5A A;  5H2F E;  4YTP C;  1NWQ A;  5TIS H;  1VQ4 P;  1IFM A;  1H0T A;  5DJT B;  1FZA A;  1P84 I;  3S1K A;  1FZC A;  3FX0 A;  3L71 E;  2QJP C;  3A7O A;  1Q2N A;  5APU A;  2JWA A;  2R3C A;  1M7L A;  1YQ4 C;  5BU8 B;  2YMY A;  2NPS A;  1AVO A;  5DJU B;  1VQL P;  1LNQ A;  2YXR B;  2C0X A;  1K04 A;  2HG5 D;  2P2U A;  2WSE H;  4U3F D;  1XTC C;  3GF3 A;  1NTM K;  2E74 D;  1LTJ A;  1KIL D;  3CWB D;  2KB7 P;  3V4Q A;  5B5E H;  1S5L H;  5KLV E;  2PRR A;  4H13 D;  1NO4 A;  5AW6 B;  2B87 A;  1SQX J;  1NU1 J;  3KPE A;  2M5A B;  2E5T A;  2A06 G;  1H0T B;  2UWJ E;  4IL6 X;  3B71 A;  3PP5 A;  2KS1 A;  3KQG A;  2YO2 A;  1FZC B;  1LTG C;  1FDM A;  1LP1 A;  1NJI Q;  4KJM A;  4BWN A;  2K3R A;  4KHX A;  1SQX G;  4C7N A;  1NU1 G;  1WT6 A;  4PV1 B;  3BVH A;  1BCC J;  5AW5 B;  3NMD A;  2NPS B;  2I1J A;  1BGY E;  2ZT9 B;  1NTZ E;  3C8V A;  1N73 C;  2Q1K A;  2HPC A;  1PIX A;  5KLV K;  1LTJ B;  3AEA C;  2FFD A;  1L4A C;  1KYO H;  3HTK B;  2ZYD A;  1BCC G;  1VQK P;  1WMK A;  1JY3 O;  4R4M A;  2FKW B;  1QVG O;  3CCM P;  2B87 B;  1JMB A;  5AVS B;  1GK6 A;  2WIT A;  4Y28 J;  1LWU C;  3CC2 P;  1L0N E;  2KS1 B;  1K9M Q;  2E76 C;  2LXB A;  1LP1 B;  3H1H J;  2RN0 A;  3SWY A;  4C7N B;  3L37 A;  2QJK B;  1L0L D;  4M3L A;  1NTZ K;  1VQ7 P;  2WT7 B;  3AE4 C;  3CX5 D;  1X0T A;  2Z4E A;  2HFE D;  1GW3 A;  4PJ0 E;  3Q5P A;  2HPC B;  1URQ C;  4H44 C;  3SFE C;  1FBM A;  3B5N C;  1IFP A;  3H1H G;  2FFD B;  2D2C B;  3Q5R A;  5KAF H;  1GW4 A;  1GD2 E;  1L0N K;  1ZV8 A;  1PP9 J;  4ASW A;  3H1I E;  1JO5 A;  4XE5 B;  1SFC D;  2I8D A;  3U1A A;  3GF7 A;  3GHG C;  1IK9 A;  2WMM A;  4QMA A;  2O01 J;  3D6Z A;  1PP9 G;  3WMM 0;  3CXH H;  3MTU E;  2YMK A;  2P67 A;  4N78 E;  3LID A;  2IBZ D;  2JDI H;  4JF7 A;  3GG2 A;  1ZME C;  1IJD B;  5CHX A;  3H1K J;  4EI2 A;  1EXI A;  3A3Y B;  2RKL A;  4ZNC A;  4YXW H;  2NRG A;  3BCC D;  2E76 D;  2KZJ A;  4EYY Q;  1N73 A;  2YIU B;  1M1J C;  1AV1 A;  3H1L D;  3F5H A;  4UB8 H;  4O9B A;  2HOD B;  3V4W A;  3NTN A;  1GU5 A;  1L4A A;  2RH0 A;  3H1K G;  3I5C A;  1OVR A;  1TU3 F;  3H1J E;  4H44 D;  2M0B A;  5CBN A;  1KQS O;  2IFM A;  3M91 A;  4TT3 H;  3RK2 B;  1LT1 A;  1R8E A;  2WPQ A;  3S9O A;  4U3F J;  2KK7 A;  3WU2 H;  3IFM A;  1LWU A;  5APV A;  1EZV E;  2N1T A;  1P84 H;  2H7H A;  4JYB A;  1GL2 C;  3AED C;  1GK4 A;  4TLF A;  3TGU E;  1NTM D;  2FXM A;  4U3F G;  2XNX A;  3L75 D;  1SQQ E;  3A0B E;  1DEE G;  1BE3 D;  1URQ A;  1YBK A;  1OMI A;  2K1A A;  3E1R A;  3FGA D;  1VF5 C;  3B5N A;  1VQM P;  1HWT C;  1T2K D;  1L4A B;  2AXC A;  5AW1 B;  5GTH H;  1G2C A;  1KQL A;  3PRJ A;  2KYV A;  2IZ1 A;  1FDI A;  5AW3 B;  3L71 D;  3G4S P;  2E75 C;  4IFF A;  3M9H A;  3KDP B;  2C0W A;  4PD4 I;  1KFM A;  1LWU B;  5E79 H;  4AQR D;  2N1T B;  1PFI A;  4JBZ A;  1FC2 C;  1EQ7 A;  1N7L A;  3R4Y A;  1JY3 N;  5KLI B;  3GHG A;  1AVY A;  2H89 C;  1SQQ K;  1N7S C;  3RK3 E;  2Y9Y A;  5KLV D;  4D6T J;  3TYY A;  4W80 A;  1FZF A;  2JKV A;  1YQ3 C;  3FWN A;  1URQ B;  5CCH C;  4EDF A;  1RF0 C;  3CPW O;  3MD0 A;  1J2J B;  2G8Y A;  1MFZ A;  1G2C B;  1EDI A;  5CCG A;  1L0L J;  1M57 D;  3I56 P;  4D6T G;  4WY4 C;  2WVR A;  4U7J A;  1RQV A;  4I6M C;  2WZ7 A;  4HH2 A;  3PJS K;  2Z5H A;  1NTZ D;  1L0L G;  3VTP C;  2WQY C;  4H0L D;  2E5Y A;  2ZXE B;  3JSV C;  3GHG B;  3W68 A;  1T3J A;  3VOP A;  1DD4 A;  1KB9 E;  1KN7 A;  4R4L A;  5APQ A;  1IO4 A;  1W2B O;  1FJP A;  1JEK A;  2JP3 A;  5KJ7 D;  1GL2 A;  1HH0 A;  1HJ0 A;  1OFC X;  3NXS A;  3CCQ P;  1KIL C;  5TIS E;  1K73 Q;  3SWK A;  1NVO A;  4I7Z C;  1CW5 A;  3RBZ A;  4RJT A;  1L0N D;  4H13 C;  1QEX A;  1A02 F;  5APW A;  1FOS E;  1N7S D;  2ZAE B;  1SQP J;  3AEB C;  1LT9 A;  2ZYA A;  2O1K A;  3KXD A;  1RH5 B;  1EDK A;  3D6Y A;  1LTS C;  1SQV J;  2QM7 A;  3CL3 D;  3NFQ A;  3TSI A;  1YJ9 P;  5B5E E;  1S5L E;  1NH4 A;  2PGD A;  1EC5 A;  5GTI E;  1SQP G;  3OA7 A;  5KAI H;  4WY4 D;  2L5G B;  2QE7 H;  5CJ4 A;  2MJZ A;  1WRG A;  1NTK J;  1SQV G;  1GL2 B;  2R32 A;  2BCC J;  1LTA C;  3KHU A;  1DD3 A;  1GMJ A;  3EQ2 A;  3H1I D;  1KFN A;  3RGU A;  5AVT B;  3OJA B;  4DOJ A;  1OXZ A;  1NTK G;  1NU1 E;  5AVQ B;  1KQG B;  1VF5 B;  5CCH A;  1ZRT E;  3V6I A;  1OIP A;  1RF0 A;  2YKP A;  1S1C X;  1LT9 B;  2BCC G;  4WB4 A;  1YYC A;  5AVR B;  3A0H E;  1UII A;  2M8R A;  3AE2 C;  2Q3I A;  4IOI H;  3UIA A;  1NTM J;  4N78 D;  1YTZ T;  4HYT B;  2BEZ F;  2E75 B;  3BRT B;  1VQ9 P;  1KYO E;  2LXC B;  1BE3 J;  3CMA P;  4GIF A;  1NKN A;  4LGD E;  4JYC A;  1XTG B;  5B66 E;  3FXE A;  2AXT H;  4N3Y B;  4UB6 H;  1GU4 A;  1NTM G;  3V2R A;  1JOC A; 
#chains in the Genus database with same CATH homology
 2G8Y A;  1OW7 A;  1PIX A;  2BEQ D;  2H88 C;  2IDB A;  2QJK C;  3AED C;  2YIU C;  1VF5 D;  3AEA C;  1KIL E;  3AE7 C;  4XFJ A;  1NYH A;  2FXP A;  3Q1M A;  2QJP C;  2WSF J;  3GF7 A;  3LW5 J;  2MKV A;  4U7J A;  3AE1 C;  2K9Y A;  2QJY C;  1RQV A;  3ABV C;  1HF9 A;  3AE5 C;  4H44 B;  1DIP A;  3Q5S A;  1WMK A;  4R4M A;  1YQ4 C;  1ZP0 C;  3EWK A;  2O01 J;  3D70 A;  2FBW C;  1OMI A;  5KLI C;  2OQQ A;  2E75 D;  3FGA D;  1VF5 C;  3D6Z A;  1S5L X;  2WPV B;  2YMK A;  3AE6 C;  4OGQ D;  1EXJ A;  1U57 A;  1K04 A;  2JO1 A;  1DD3 A;  4Y28 J;  1GMJ A;  2E74 C;  2WQY C;  4H0L D;  2D2C D;  3AEC C;  1ZME C;  3GF3 A;  2QIW A;  4PV1 C;  3SFD C;  1NGM B;  2E74 D;  3Q2Y A;  1KMI Z;  1MKM A;  1UIX A;  3T97 B;  1EXI A;  2NZ2 A;  1FDI A;  4PV1 D;  3AEE C;  2J5U A;  1DD4 A;  1JB0 J;  2E76 C;  3AE9 C;  4KT0 J;  2E75 C;  1VF5 B;  1KQG B;  4R4L A;  4YXD C;  3RL0 g;  1ZRT E;  2E76 D;  1PV3 A;  4H13 D;  2FYN C;  2ZT9 D;  4OGQ C;  1S1C X;  1OW6 A;  1RQU A;  4H0L C;  3AEF C;  1KTM A;  2D2C C;  1AJY A;  3IN6 A;  3O6Q A;  2JP3 A;  5L8R J;  3AE8 C;  1Q90 D;  3AE4 C;  3AE2 C;  1HJ0 A;  3IAO A;  2G3A A;  3Q5P A;  4I7Z C;  2BEZ F;  2E75 B;  4H44 C;  5M1B A;  1KOR A;  4IL6 X;  3SFE C;  3B71 A;  3R4Y A;  1TU3 F;  4H13 C;  2ZT9 C;  4H44 D;  4OGQ B;  1Y9B A;  3H25 A;  2H89 C;  4H0L B;  2D2C B;  1IK7 A;  3AE3 C;  3RK3 E;  3AEG C;  1FDO A;  4RKU J;  1VL2 A;  3G9R A;  2E74 B;  4TT3 H;  5KKZ C;  2WSE J;  2QSI A;  1ZOY C;  1R8E A;  4GDO A;  3GMA A;  2V7Q J;  4PV1 B;  3Q5R A;  3Q3D A;  3AEB C;  3GLM A;  3S9O A;  4I7Z B;  1YQ3 C;  1PL5 A;  1OW8 A;  2WSC J;  1K05 A;  2E76 B;  2P10 A;  4Z1M H;  3D6Y A;  1KQF B;  4H13 B;  2ZT9 B;  3C8V A;  4YTP C;  3D71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...