1SQVJ

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqvJ00
1PP9J 5KLVJ 1BE3J 1BGYJ 3CWBJ 3H1HJ 4PD4I 1L0NJ 3H1JJ 1SQPJ 1SQVJ 1KB9I 1L0LJ 2BCCJ 1EZVI 1NTMJ 3CXHI 3BCCJ 3H1KJ 3L71J 1NU1J 1NTZJ 1KYOI 1P84I 3L72J 4U3FJ 1BCCJ 1NTKJ 3L75J 4D6TJ 2FYUJ 2IBZI 3TGUJ 3H1IJ 1SQBJ 3L73J 3H1LJ 1SQQJ 3CX5I 1SQXJ 3L74J 3L70J
chains in the Genus database with same CATH superfamily
1S5LH 2QA4P 3CC4P 1YHQP 2W27A 3CWBG 4WB4A 3AECC 5AVQB 3TYYA 4YXDC 2MJZA 2HPCB 4XFJA 1JY3O 3JCUE 4PD4I 1AJYA 4BXLA 3IR9A 4L73A 3RK2D 5C39A 1LT9A 1OMIA 1FOSE 4O9BA 4OVNF 1VQMP 4HH2A 1RF1C 2ZVOB 3CCEP 1VQNP 2QJPC 3MGNA 1CW5A 1NAFA 1VQ4P 3U1CA 1S72P 1EDJA 2OYIC 1IZNB 1SQXG 2LR2A 4EOTA 3HD7D 3M9QA 4YPCA 3KPEA 5KKZC 1PP9E 4ZNCA 2IFMA 1KMIZ 1K73Q 3SFDC 4EI2A 1ZN5A 1LTBC 1KQFB 3E1RA 3L72E 1GMJA 1USEA 1PP9D 2CPSA 2HG5D 4UB8H 1KILB 3L72D 1SQVK 1URQB 1NTZG 2LKMA 5H2FH 3FWNA 2YKOA 1VF5B 2YXQB 1LTTC 1NKNA 3RK3C 1X79B 3II6A 4NPDA 1MFTA 3A2AA 2K9JB 3CWBE 1T2KD 3BASA 3S9OA 1GTWA 1VPCA 1YTZI 3OA7A 4GODA 1NTMJ 4DZOA 1M1JB 3T97A 3RBZA 1EQ7A 2QRXA 1GL2C 2PRRA 1S5LE 2N1TA 3GHGB 4H0LB 1CSBA 3I56P 3CX5I 1W5CE 4U7JA 1AV1A 2QIWA 4WY4C 5KJ7A 2C9LY 1G2CA 4DOJA 5CCHC 1HVVA 1W2BO 3S4RA 2E74C 1LGHB 1HJ0A 1SQXE 4R4LA 3G71P 5AVZB 2KSJA 1J1EC 3L75G 1N7LA 4IFMA 2W90A 2G8YA 1SQXD 1IFJA 1IFIA 1SQPD 1H0TB 4C7NA 3L71D 4N78E 1LTIC 3HE4A 1FZEA 2E76D 3V5BA 1KTMA 4JBZA 1NTZE 2DW3A 3C1LA 2D2CD 3CWBJ 3L73G 2HODA 2B9BA 1FJKA 1S4XA 1LTJB 5AW0B 5B5EH 3USSA 1LT9C 2YIUB 1NTKJ 3M91A 1PGJA 3BCCG 1FZAA 3L36A 4CPGA 2Z5IA 4UB6H 2KOGA 2NPSD 3WUVA 2Y0DA 1GDTA 4UB8E 4Y28J 1L0NJ 1NVOA 1HTLC 1EXIA 1DD4A 1ZV8A 4WWIA 2P7JA 1XTGB 2W6BA 2UWJE 5B66H 2IZ0A 3V2PA 1QL1A 2XZRA 1HGZA 2XNDH 5CHXA 1VQOP 2KB7P 2C0XA 2XDJA 2BEQD 3LW5J 4PV1B 1RE4C 2Q6QA 1IFDA 3B4SA 2K1AA 3P32A 3HTKA 2H7HA 3FWLA 4H44B 2KS1B 2IBZG 2M0BA 5KLIB 4AYCA 1RF0A 1SQBG 3L75E 3A3YB 1NTZJ 1FZCB 4WBAA 3H1JG 1BCCJ 2OTKE 2BCCG 1K8AQ 3A0BH 3CCUP 1NO4A 1JM0A 1OVRA 3H1ID 4LGDE 3TNUB 2KYVA 3RK3D 3AE9C 3L73E 2ZT9C 5AW6B 1EDLA 1Y9BA 3I5CA 3S1KA 1M1KQ 1HH0A 3H1KG 2N1TC 3BCCE 1USDA 3L73D 2JWAA 5APYA 2FYUG 1SQQD 1FC2C 3C9IA 3D6ZA 1MZ9A 2P10A 2J5UA 5KJ7C 1NYHA 1KB9I 2H8PD 2CPBA 2JP3A 4JQ0D 1L0LD 4OGQD 1DIPA 1AQ5A 1GL2D 1EZVG 2BEZF 1PV3A 3HUSA 2O01J 1FZGA 4HKZH 1JCDA 3MIWA 3AEDC 3D71A 5B5EE 2WQYC 3RK2C 3CXHI 3H1HD 2IDBA 1SQXK 2E74D 1P84I 4UB6E 2JJLA 1LTSC 1SVFA 1OVVA 1SQPK 2QVAA 2XKMA 4W80A 3BVHA 3GW6A 1PGOA 3VOPA 3CC2P 5APSA 1RHZB 2A06G 2IBZE 2ITAA 3VMXA 1FE6A 2I1KA 3HD7C 2JWDA 5B66E 2Q5UA 4DCKA 2LXBA 1KFNA 1LJ2A 1KQLA 2YO2A 3TDKA 3H1JE 3E1IA 4D6TD 2IBZD 2BCCE 3V4QA 1Q81Q 1N73A 1SQBD 3VN0A 2QJYC 2FXMA 2HLOA 3H1JD 3BCCJ 1RY3A 2RKLA 2OYOA 3AEBC 3QH9A 2AEMA 1KILA 1KB9E 2Z5HA 2HR3A 1URQA 3RL0C 1U7JA 2E5TA 1ZW0A 2R3CA 2FYUE 4LC1A 1IK7A 3M0AA 1PPJD 3A0BE 3H1KD 3WUUA 5M1BA 1NU1G 2K9JA 1FJPA 4EYYQ 1EZVE 1N8RQ 4I6MC 1P84E 1BE3J 1J1DC 2E75C 3V2RA 1RF0C 1JCCA 2A45I 2H43A 5KAFE 5E79H 3GF7A 1EZVD 1GZLA 3RL0g 1OVUA 4GOEA 1NTMG 1ZXGA 2B87A 2P67A 3KYQA 1KV4A 1X8YA 1BDDA 3GHGA 2GM4A 3Q2YA 2BCCJ 1OFCX 2ZYAA 5AW7B 1DX7A 1PL5A 2A06E 3AE5C 1Q90D 3AEGC 1DD3A 3FGAD 2KP8A 2WPSA 2A06D 2WT7A 3I55P 3M06A 1SQQK 3LIEA 1NH4A 1L4AB 5CCGD 1K04A 5KLVK 2E76C 1L0LK 4K35A 4LLHA 2N1TD 3N7NA 3HUSC 1MFZA 2D2CC 1PFIA 2OTJP 5KJ7D 5DJTB 2JKVA 1LTJA 2W6JH 2O3JA 1MUUA 1NU1E 1NTKG 2K37A 1JTHB 2FYNC 2NPSC 1Q86Q 1E79H 5AVSB 3AE6C 3IFMA 3LW5H 1S2EA 2FYZA 1L0NG 3IF4A 1N86A 2WWWA 1CZQA 2AEFA 1D7MA 1NTME 5AVXB 3L70J 2OYHA 1N73C 2G3AA 1AA0A 4GKGA 4I2LC 4B86A 3CPWO 1SQBK 1QVGO 4RO0A 2QJKC 1KYOI 4XE5B 5KTBA 1NTMD 4YTPC 3OJAB 2P58A 4JF7A 3M0DA 1ZR2A 3CMEP 3HE5B 3PRJA 5E79E 3NFQA 1RF1B 1FDMA 2KS1A 1TU3F 3P7KA 1VQLP 2QJPB 2QM8A 1SFCD 4JPZB 1JY3N 2OYIB 3CX5H 2V4HA 5DJUB 4R4MA 4IL6X 1BCCG 4BRYA 1N7SD 2Q1KA 3RL0D 1U7MA 4GT1A 4TLFA 5KKZB 1XTCC 5TISH 1KFMA 1NU1J 5GTHE 2HYNA 5APWA 1RE3A 4PD4E 4GDOA 2WMMA 3PJSK 2O01H 2KZJA 1OWAA 3OAKA 3B5ND 2WSCJ 3P8CE 1VQPP 1NTKE 3GHGC 3O6QB 2E75D 3CWBD 2POHA 1NJIQ 2WTYA 1IFMA 5CCGA 2IX7C 5AVVB 4OGQC 3ZDMA 3AEAC 1VQ8P 1OXZA 1NTKD 1L0NE 3RK3B 1E5WA 4H13D 2JEEA 1L2PA 1H89A 1ZP0C 1PGQA 3HRNA 1KZUB 2QSIA 1JY2P 2QEXP 2ZJSE 4NPEA 2C9NY 3Q1MA 1CI6A 3CCJP 1GL2B 3AE8C 3WMM0 1QX8A 3N4XA 1T6AA 1DEEG 5GTIE 1U57A 4WY4B 3B8EB 2E74B 4Z1MH 2OGUA 1YQ4C 4N78D 1BCCE 2RH0A 4W7ZA 1H88A 1J1EB 3IAOA 1J2JB 4XA4A 1IFPA 1UIIA 1NTZD 3G6EP 2KNCA 1BCCD 1KC8Q 2H89C 2MKVA 2FXPA 2OYHC 2WZ7A 1LWUA 4EDFA 1AVYA 2FKWB 2L91A 4C46A 2M8RA 3TK1A 3CX5E 1SFCA 1Q82Q 1LP1A 1S9KE 3WUTA 5CMZA 3M0DC 1NTMK 2YXRB 1N7SA 3F5HA 1ZOYC 2M5AA 1N2DC 5TISE 4RESB 3CX5D 1LT9B 1S9KD 4N6JA 3Q5SA 2ZVNB 3MTUE 1KILE 1LT1A 1EC5A 1BE3G 3B71A 3E7KA 4BWNA 3TGUJ 2FFDA 1KILD 3B5NA 3LIDA 3UIAA 1KB9H 1URQD 1VF5D 5BU8B 1QLED 5AW2B 5APTA 2FBWC 3CCMP 1RE3C 3L75D 3CCSP 2XV5A 2WPQA 3MP7B 1JMMA 2P1JA 2VRSA 2R5DA 3VMZA 3NMDA 1P84H 5CCGC 1SP4A 1VL2A 5AW3B 5KAFH 1UIXA 1FOSF 2SPZA 3W68A 2KXPB 1NTKK 2RN0A 2WPRA 3L4FA 1VQ5P 3MUDA 4I7ZC 1GD2E 3BCCD 1SQVG 2OARA 1GW4A 3QWOC 2E5YA 3FX0A 3GLMA 3V2QA 3CCLP 3CC7P 1KN7A 4RKUJ 4DT0A 2ZT9B 1OX3A 3F89A 1K9MQ 1QVFO 3T97B 5CBNA 5APQA 2HPCA 2N1TB 1OW6A 4Y99C 1BE3E 1G2CB 2E42A 2J59M 2AEJA 1VQ7P 3MHVA 4A7PA 1BE3D 2Y0CA 3L70G 1IC2A 2PFXA 1IFNA 3H1IJ 1JY2O 2V7QJ 3RK2B 3V2NA 1NTZK 1HWTC 1EDIA 5AVYB 1LTGC 5K5GB 4C7NB 1IK9A 2A45H 4HB1A 3HE4B 1LWUC 2BCCD 1YJ9P 2QG4A 1SFCC 3BRVB 1VQ6P 1T3JA 4U3FG 2JO1A 3KXDA 4M3LA 3HD7B 3L74J 3VTPC 1N7SC 1KQGB 2WSCH 5KLVJ 1BSNA 3G9RA 3U1AA 1KB9D 5APVA 3K5BA 2P2UA 2QJYB 2J58A 3VP8A 2A45G 1SQVE 3SSUA 4EIJA 2KIKA 2FYUD 3EFGA 4PV1D 3CXHE 2FFDC 3B5NC 3KZIH 3H1HJ 1RH5B 2Y9YA 1A02F 3A0HH 4PJ0H 2YNYA 4TT3H 2N9YB 2KZIA 1M8OB 3MZWB 3RL0B 2OQQA 1P84D 3Q5RA 1M1JA 2QE7H 3H1LJ 4H13C 3R4YA 2R3SA 3AE7C 2B89A 5APXA 1T8ZA 1JEKA 4D6TJ 3L70E 1J1DB 2E75B 5GTHH 2ZYGA 1OIPA 2N9BA 2WPVB 4PD4H 1OW8A 1BGYJ 3L70D 2IFNA 1AQTA 2R5BA 3R2PA 2FY8A 3Q3DA 2WSEJ 3MUDC 2ZXEB 3H6PA 1H0TA 3CLQA 3VYIA 3BRTB 4AQRD 1GW3A 2Z4EA 4U3FE 2R44A 3GMAA 2WSFJ 1SQVJ 2Q3EA 1YTZT 1KYOH 3NTNA 3C8VA 2IYPA 2PP6A 3NXSA 2CK3H 4JYCA 2W8ZA 2E76B 4NPFX 1GU5A 1NU1D 3L35A 3HUSB 2D2CB 1Y47A 3CCVP 5APUA 5BVZA 5KAIH 3RBXA 2ZXXA 1VQ9P 1IJDB 5GTIH 1S5LX 5EFWB 4W7YA 3H32B 4IFFA 2Q7CA 2L5GB 3CI9A 2H88C 3PHLA 4KJMA 2Q3IA 2FYNB 2NPSB 4WVZA 1JNMA 1DH3A 3KZIE 1X22A 2K3RA 5CBOA 4IL6H 1KILC 3D6YA 3A0HE 4PJ0E 2O1JA 1GK6A 1X9VA 3TGUG 3PH0A 1URQC 1ZR4A 1VF5C 5AVUB 1PIXA 2XU6A 3Q5PA 1SQPG 4U3FJ 1RQUA 1N73B 3AE3C 3JC22 3L71G 1FZCA 3M9HA 3M9BA 1S1CX 1AFOA 2QJKB 4JYBA 1T3UA 2FYUK 4K3AA 1RE4A 1YIJP 3WU2E 3EFFK 3TNUA 1G1JA 1FZBA 1M1JC 3KHUA 3KDPB 3ABVC 3VP9A 4ZKPA 1NKZB 1YITP 4H0LC 2LXCB 4PD4D 2JR8A 3CD6P 1K05A 4ASVA 2NZ2A 3V6IA 2I8DA 3U59A 3P8CD 1KYOE 1R5LA 1FDIA 1L0ND 2AXTE 2B87B 1Y8AA 2KSEA 1KYOD 2V7QH 1L4AD 1M56D 1FZFA 1PP9J 4OGQB 2KI7B 3AE2C 1PGPA 2I1JA 3O8ZA 3TGUE 4N3YB 5KAIE 3L72J 1NAYA 5CJ0A 1AVOA 1SQPE 2O1KA 2WT7B 1LTJC 5AVWB 3TGUD 2YIUC 3L71E 5AW4B 4DJGA 3FXEA 3H1IG 2Y0EA 3GG2A 3AE1C 2YMKA 3L37A 4L75A 4MN4C 5AVTB 1JUNA 1FS0E 1KD1Q 1ZRTE 2C0WA 4IL6E 1JO5A 1NU1K 3GF3A 1FBMA 1WRGA 2KK7A 1ZRTD 2E43A 1NHLA 1WT6A 3HD7A 4HJGH 1SQQG 4IOIH 2JDIH 3L74G 5KLVG 3G3ZA 2GUVA 1L0LG 2AXCA 2W83C 3SWYA 2WSSH 4PV1C 1HBWA 1M7LA 4ASWA 1JOCA 2K9YA 4QMAA 4H44C 1YJWP 3H25A 5H2FE 5KLIC 3D70A 3H1HG 3CMAP 1NWQA 2OYHB 5CJ4A 1FZCC 3G4SP 1SQXJ 3CCRP 1WMKA 1RQVA 1SLQA 1X0TA 3PP5A 2YMYA 1A02J 5AW9B 1SQPJ 2OTLP 4GIFA 2WSEH 3H1LG 3L71J 2BASA 4KHXA 2PAJA 1S3JA 2IZ1A 1KORA 3ITKA 2ZAEB 1FAVA 4D6TG 3A7OA 3IN6A 2WSFH 3JSVC 1BSHA 1W2EA 1YJNP 2YKQA 3CXHH 3H1IE 2IPPA 1BGYG 3AEEC 4BRYB 2IBZI 3KQGA 1MKMA 4KT0J 3RK3E 4ZMDA 2GA1A 1L4AA 1FU1A 2WVRA 3VMAA 4H0LD 5AW8B 1SQQE 1PPJG 3L74E 1LNQA 5AW5B 5KLVE 1L0NK 3TF5A 2O01N 1HJBA 2M3BA 1L0LE 2W6AA 2Y9ZA 1JY3P 1G1IA 2KUBA 3CL3D 3L74D 3AEFC 5KLVD 1JTHA 1MV8A 1NGMB 5BU5A 4IFDK 3W67A 3MD0A 2RMZA 3H1HE 1PZQA 5L8RJ 4I7ZB 2Q9IA 4WY4D 1VQKP 5CCHD 2M3EA 3A5TA 2FXOA 1EZVI 1R5SA 4I1LA 3RGUA 3SWFA 3H1LE 3H32A 3L75J 3FXDA 3VMYA 5AW1B 1HF9A 3V4WA 2NPSA 1CI6B 4OWFA 4L76A 1R8EA 4GOFA 3H1LD 3EWKA 3HE5A 4D6TE 3SWKA 1JMBA 2HFED 4Y99B 1SQBE 1IO4A 1OZHA 1RF1A 1BGYE 1HUCA 3L73J 2IYOA 1SQQJ 2HODB 2OYIA 2ZFCA 1HGVA 1L0LJ 1BGYD 1VDFA 2KNCB 1NOHA 3JCUH 4ZKUA 1EDKA 1SS1A 4L74A 1Z56A 2ZYDA 1EXJA 3TSIA 2PGDA 1M57D 5AVRB 1PPJE 3H1KE 1LWUB 1YYCA 1SFCB 1YI2P 4C7RA 1LP1B 1SQVD 1LTAC 4H44D 1JY2N 1H8AA 3EQ2A 3O6QA 3CXHD 1N7SB 1ZLLA 1T2KC 2M5AB 1GU4A 1M90Q 2YO3A 4OH8B 1QEXA 4RJTA 2GUSA 2KLVA 1JB0J 2FFDB 3CCQP 2XNXA 2YKPA 3HTKB 3B5NB 1GK4A 1SQBJ 5TJHA 3WU2H 2B88A 1L4AC 1BDCA 3AE4C 2K88A 1Q7YQ 3H1JJ 1KQSO 2NRGA 3P8MC 2WITA 2QM7A 1PP9G 1GL2A 1QGKB 4H13B 1Q2NA 3OW2O 4AUWA 4HYTB 3L72G 1QL2A 4WY4A 3SFEC 4YXWH 1ZMEC 1YQ3C 1FDOA 5CCHA 3BATA 3PTZA 3H1KJ 2ZT9D 3PLNA 1DEBA 1OW7A 2FYUJ 2KLUA 4U3FD 2AXTH 1YBKA 2R32A
chains in the Genus database with same CATH topology
1PP9J 5KLVJ 1BE3J 1BGYJ 3CWBJ 3H1HJ 4PD4I 1L0NJ 3H1JJ 1SQPJ 1SQVJ 1KB9I 1L0LJ 2BCCJ 1EZVI 1NTMJ 3CXHI 3BCCJ 3H1KJ 3L71J 1NU1J 1NTZJ 1KYOI 1P84I 3L72J 4U3FJ 1BCCJ 1NTKJ 3L75J 4D6TJ 2FYUJ 2IBZI 3TGUJ 3H1IJ 1SQBJ 3L73J 3H1LJ 1SQQJ 3CX5I 1SQXJ 3L74J 3L70J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 J;  5KLV J;  1BE3 J;  1BGY J;  3CWB J;  3H1H J;  4PD4 I;  1L0N J;  3H1J J;  1SQP J;  1SQV J;  1KB9 I;  1L0L J;  2BCC J;  1EZV I;  1NTM J;  3CXH I;  3BCC J;  3H1K J;  3L71 J;  1NU1 J;  1NTZ J;  1KYO I;  1P84 I;  3L72 J;  4U3F J;  1BCC J;  1NTK J;  3L75 J;  4D6T J;  2FYU J;  2IBZ I;  3TGU J;  3H1I J;  1SQB J;  3L73 J;  3H1L J;  1SQQ J;  3CX5 I;  1SQX J;  3L74 J;  3L70 J; 
#chains in the Genus database with same CATH topology
 1S5L H;  2QA4 P;  3CC4 P;  1YHQ P;  2W27 A;  3CWB G;  4WB4 A;  3AEC C;  5AVQ B;  3TYY A;  4YXD C;  2MJZ A;  2HPC B;  4XFJ A;  1JY3 O;  3JCU E;  4PD4 I;  1AJY A;  4BXL A;  3IR9 A;  4L73 A;  3RK2 D;  5C39 A;  1LT9 A;  1OMI A;  1FOS E;  4O9B A;  4OVN F;  1VQM P;  4HH2 A;  1RF1 C;  2ZVO B;  3CCE P;  1VQN P;  2QJP C;  3MGN A;  1CW5 A;  1NAF A;  1VQ4 P;  3U1C A;  1S72 P;  1EDJ A;  2OYI C;  1IZN B;  1SQX G;  2LR2 A;  4EOT A;  3HD7 D;  3M9Q A;  4YPC A;  3KPE A;  5KKZ C;  1PP9 E;  4ZNC A;  2IFM A;  1KMI Z;  1K73 Q;  3SFD C;  4EI2 A;  1ZN5 A;  1LTB C;  1KQF B;  3E1R A;  3L72 E;  1GMJ A;  1USE A;  1PP9 D;  2CPS A;  2HG5 D;  4UB8 H;  1KIL B;  3L72 D;  1SQV K;  1URQ B;  1NTZ G;  2LKM A;  5H2F H;  3FWN A;  2YKO A;  1VF5 B;  2YXQ B;  1LTT C;  1NKN A;  3RK3 C;  1X79 B;  3II6 A;  4NPD A;  1MFT A;  3A2A A;  2K9J B;  3CWB E;  1T2K D;  3BAS A;  3S9O A;  1GTW A;  1VPC A;  1YTZ I;  3OA7 A;  4GOD A;  1NTM J;  4DZO A;  1M1J B;  3T97 A;  3RBZ A;  1EQ7 A;  2QRX A;  1GL2 C;  2PRR A;  1S5L E;  2N1T A;  3GHG B;  4H0L B;  1CSB A;  3I56 P;  3CX5 I;  1W5C E;  4U7J A;  1AV1 A;  2QIW A;  4WY4 C;  5KJ7 A;  2C9L Y;  1G2C A;  4DOJ A;  5CCH C;  1HVV A;  1W2B O;  3S4R A;  2E74 C;  1LGH B;  1HJ0 A;  1SQX E;  4R4L A;  3G71 P;  5AVZ B;  2KSJ A;  1J1E C;  3L75 G;  1N7L A;  4IFM A;  2W90 A;  2G8Y A;  1SQX D;  1IFJ A;  1IFI A;  1SQP D;  1H0T B;  4C7N A;  3L71 D;  4N78 E;  1LTI C;  3HE4 A;  1FZE A;  2E76 D;  3V5B A;  1KTM A;  4JBZ A;  1NTZ E;  2DW3 A;  3C1L A;  2D2C D;  3CWB J;  3L73 G;  2HOD A;  2B9B A;  1FJK A;  1S4X A;  1LTJ B;  5AW0 B;  5B5E H;  3USS A;  1LT9 C;  2YIU B;  1NTK J;  3M91 A;  1PGJ A;  3BCC G;  1FZA A;  3L36 A;  4CPG A;  2Z5I A;  4UB6 H;  2KOG A;  2NPS D;  3WUV A;  2Y0D A;  1GDT A;  4UB8 E;  4Y28 J;  1L0N J;  1NVO A;  1HTL C;  1EXI A;  1DD4 A;  1ZV8 A;  4WWI A;  2P7J A;  1XTG B;  2W6B A;  2UWJ E;  5B66 H;  2IZ0 A;  3V2P A;  1QL1 A;  2XZR A;  1HGZ A;  2XND H;  5CHX A;  1VQO P;  2KB7 P;  2C0X A;  2XDJ A;  2BEQ D;  3LW5 J;  4PV1 B;  1RE4 C;  2Q6Q A;  1IFD A;  3B4S A;  2K1A A;  3P32 A;  3HTK A;  2H7H A;  3FWL A;  4H44 B;  2KS1 B;  2IBZ G;  2M0B A;  5KLI B;  4AYC A;  1RF0 A;  1SQB G;  3L75 E;  3A3Y B;  1NTZ J;  1FZC B;  4WBA A;  3H1J G;  1BCC J;  2OTK E;  2BCC G;  1K8A Q;  3A0B H;  3CCU P;  1NO4 A;  1JM0 A;  1OVR A;  3H1I D;  4LGD E;  3TNU B;  2KYV A;  3RK3 D;  3AE9 C;  3L73 E;  2ZT9 C;  5AW6 B;  1EDL A;  1Y9B A;  3I5C A;  3S1K A;  1M1K Q;  1HH0 A;  3H1K G;  2N1T C;  3BCC E;  1USD A;  3L73 D;  2JWA A;  5APY A;  2FYU G;  1SQQ D;  1FC2 C;  3C9I A;  3D6Z A;  1MZ9 A;  2P10 A;  2J5U A;  5KJ7 C;  1NYH A;  1KB9 I;  2H8P D;  2CPB A;  2JP3 A;  4JQ0 D;  1L0L D;  4OGQ D;  1DIP A;  1AQ5 A;  1GL2 D;  1EZV G;  2BEZ F;  1PV3 A;  3HUS A;  2O01 J;  1FZG A;  4HKZ H;  1JCD A;  3MIW A;  3AED C;  3D71 A;  5B5E E;  2WQY C;  3RK2 C;  3CXH I;  3H1H D;  2IDB A;  1SQX K;  2E74 D;  1P84 I;  4UB6 E;  2JJL A;  1LTS C;  1SVF A;  1OVV A;  1SQP K;  2QVA A;  2XKM A;  4W80 A;  3BVH A;  3GW6 A;  1PGO A;  3VOP A;  3CC2 P;  5APS A;  1RHZ B;  2A06 G;  2IBZ E;  2ITA A;  3VMX A;  1FE6 A;  2I1K A;  3HD7 C;  2JWD A;  5B66 E;  2Q5U A;  4DCK A;  2LXB A;  1KFN A;  1LJ2 A;  1KQL A;  2YO2 A;  3TDK A;  3H1J E;  3E1I A;  4D6T D;  2IBZ D;  2BCC E;  3V4Q A;  1Q81 Q;  1N73 A;  1SQB D;  3VN0 A;  2QJY C;  2FXM A;  2HLO A;  3H1J D;  3BCC J;  1RY3 A;  2RKL A;  2OYO A;  3AEB C;  3QH9 A;  2AEM A;  1KIL A;  1KB9 E;  2Z5H A;  2HR3 A;  1URQ A;  3RL0 C;  1U7J A;  2E5T A;  1ZW0 A;  2R3C A;  2FYU E;  4LC1 A;  1IK7 A;  3M0A A;  1PPJ D;  3A0B E;  3H1K D;  3WUU A;  5M1B A;  1NU1 G;  2K9J A;  1FJP A;  4EYY Q;  1EZV E;  1N8R Q;  4I6M C;  1P84 E;  1BE3 J;  1J1D C;  2E75 C;  3V2R A;  1RF0 C;  1JCC A;  2A45 I;  2H43 A;  5KAF E;  5E79 H;  3GF7 A;  1EZV D;  1GZL A;  3RL0 g;  1OVU A;  4GOE A;  1NTM G;  1ZXG A;  2B87 A;  2P67 A;  3KYQ A;  1KV4 A;  1X8Y A;  1BDD A;  3GHG A;  2GM4 A;  3Q2Y A;  2BCC J;  1OFC X;  2ZYA A;  5AW7 B;  1DX7 A;  1PL5 A;  2A06 E;  3AE5 C;  1Q90 D;  3AEG C;  1DD3 A;  3FGA D;  2KP8 A;  2WPS A;  2A06 D;  2WT7 A;  3I55 P;  3M06 A;  1SQQ K;  3LIE A;  1NH4 A;  1L4A B;  5CCG D;  1K04 A;  5KLV K;  2E76 C;  1L0L K;  4K35 A;  4LLH A;  2N1T D;  3N7N A;  3HUS C;  1MFZ A;  2D2C C;  1PFI A;  2OTJ P;  5KJ7 D;  5DJT B;  2JKV A;  1LTJ A;  2W6J H;  2O3J A;  1MUU A;  1NU1 E;  1NTK G;  2K37 A;  1JTH B;  2FYN C;  2NPS C;  1Q86 Q;  1E79 H;  5AVS B;  3AE6 C;  3IFM A;  3LW5 H;  1S2E A;  2FYZ A;  1L0N G;  3IF4 A;  1N86 A;  2WWW A;  1CZQ A;  2AEF A;  1D7M A;  1NTM E;  5AVX B;  3L70 J;  2OYH A;  1N73 C;  2G3A A;  1AA0 A;  4GKG A;  4I2L C;  4B86 A;  3CPW O;  1SQB K;  1QVG O;  4RO0 A;  2QJK C;  1KYO I;  4XE5 B;  5KTB A;  1NTM D;  4YTP C;  3OJA B;  2P58 A;  4JF7 A;  3M0D A;  1ZR2 A;  3CME P;  3HE5 B;  3PRJ A;  5E79 E;  3NFQ A;  1RF1 B;  1FDM A;  2KS1 A;  1TU3 F;  3P7K A;  1VQL P;  2QJP B;  2QM8 A;  1SFC D;  4JPZ B;  1JY3 N;  2OYI B;  3CX5 H;  2V4H A;  5DJU B;  4R4M A;  4IL6 X;  1BCC G;  4BRY A;  1N7S D;  2Q1K A;  3RL0 D;  1U7M A;  4GT1 A;  4TLF A;  5KKZ B;  1XTC C;  5TIS H;  1KFM A;  1NU1 J;  5GTH E;  2HYN A;  5APW A;  1RE3 A;  4PD4 E;  4GDO A;  2WMM A;  3PJS K;  2O01 H;  2KZJ A;  1OWA A;  3OAK A;  3B5N D;  2WSC J;  3P8C E;  1VQP P;  1NTK E;  3GHG C;  3O6Q B;  2E75 D;  3CWB D;  2POH A;  1NJI Q;  2WTY A;  1IFM A;  5CCG A;  2IX7 C;  5AVV B;  4OGQ C;  3ZDM A;  3AEA C;  1VQ8 P;  1OXZ A;  1NTK D;  1L0N E;  3RK3 B;  1E5W A;  4H13 D;  2JEE A;  1L2P A;  1H89 A;  1ZP0 C;  1PGQ A;  3HRN A;  1KZU B;  2QSI A;  1JY2 P;  2QEX P;  2ZJS E;  4NPE A;  2C9N Y;  3Q1M A;  1CI6 A;  3CCJ P;  1GL2 B;  3AE8 C;  3WMM 0;  1QX8 A;  3N4X A;  1T6A A;  1DEE G;  5GTI E;  1U57 A;  4WY4 B;  3B8E B;  2E74 B;  4Z1M H;  2OGU A;  1YQ4 C;  4N78 D;  1BCC E;  2RH0 A;  4W7Z A;  1H88 A;  1J1E B;  3IAO A;  1J2J B;  4XA4 A;  1IFP A;  1UII A;  1NTZ D;  3G6E P;  2KNC A;  1BCC D;  1KC8 Q;  2H89 C;  2MKV A;  2FXP A;  2OYH C;  2WZ7 A;  1LWU A;  4EDF A;  1AVY A;  2FKW B;  2L91 A;  4C46 A;  2M8R A;  3TK1 A;  3CX5 E;  1SFC A;  1Q82 Q;  1LP1 A;  1S9K E;  3WUT A;  5CMZ A;  3M0D C;  1NTM K;  2YXR B;  1N7S A;  3F5H A;  1ZOY C;  2M5A A;  1N2D C;  5TIS E;  4RES B;  3CX5 D;  1LT9 B;  1S9K D;  4N6J A;  3Q5S A;  2ZVN B;  3MTU E;  1KIL E;  1LT1 A;  1EC5 A;  1BE3 G;  3B71 A;  3E7K A;  4BWN A;  3TGU J;  2FFD A;  1KIL D;  3B5N A;  3LID A;  3UIA A;  1KB9 H;  1URQ D;  1VF5 D;  5BU8 B;  1QLE D;  5AW2 B;  5APT A;  2FBW C;  3CCM P;  1RE3 C;  3L75 D;  3CCS P;  2XV5 A;  2WPQ A;  3MP7 B;  1JMM A;  2P1J A;  2VRS A;  2R5D A;  3VMZ A;  3NMD A;  1P84 H;  5CCG C;  1SP4 A;  1VL2 A;  5AW3 B;  5KAF H;  1UIX A;  1FOS F;  2SPZ A;  3W68 A;  2KXP B;  1NTK K;  2RN0 A;  2WPR A;  3L4F A;  1VQ5 P;  3MUD A;  4I7Z C;  1GD2 E;  3BCC D;  1SQV G;  2OAR A;  1GW4 A;  3QWO C;  2E5Y A;  3FX0 A;  3GLM A;  3V2Q A;  3CCL P;  3CC7 P;  1KN7 A;  4RKU J;  4DT0 A;  2ZT9 B;  1OX3 A;  3F89 A;  1K9M Q;  1QVF O;  3T97 B;  5CBN A;  5APQ A;  2HPC A;  2N1T B;  1OW6 A;  4Y99 C;  1BE3 E;  1G2C B;  2E42 A;  2J59 M;  2AEJ A;  1VQ7 P;  3MHV A;  4A7P A;  1BE3 D;  2Y0C A;  3L70 G;  1IC2 A;  2PFX A;  1IFN A;  3H1I J;  1JY2 O;  2V7Q J;  3RK2 B;  3V2N A;  1NTZ K;  1HWT C;  1EDI A;  5AVY B;  1LTG C;  5K5G B;  4C7N B;  1IK9 A;  2A45 H;  4HB1 A;  3HE4 B;  1LWU C;  2BCC D;  1YJ9 P;  2QG4 A;  1SFC C;  3BRV B;  1VQ6 P;  1T3J A;  4U3F G;  2JO1 A;  3KXD A;  4M3L A;  3HD7 B;  3L74 J;  3VTP C;  1N7S C;  1KQG B;  2WSC H;  5KLV J;  1BSN A;  3G9R A;  3U1A A;  1KB9 D;  5APV A;  3K5B A;  2P2U A;  2QJY B;  2J58 A;  3VP8 A;  2A45 G;  1SQV E;  3SSU A;  4EIJ A;  2KIK A;  2FYU D;  3EFG A;  4PV1 D;  3CXH E;  2FFD C;  3B5N C;  3KZI H;  3H1H J;  1RH5 B;  2Y9Y A;  1A02 F;  3A0H H;  4PJ0 H;  2YNY A;  4TT3 H;  2N9Y B;  2KZI A;  1M8O B;  3MZW B;  3RL0 B;  2OQQ A;  1P84 D;  3Q5R A;  1M1J A;  2QE7 H;  3H1L J;  4H13 C;  3R4Y A;  2R3S A;  3AE7 C;  2B89 A;  5APX A;  1T8Z A;  1JEK A;  4D6T J;  3L70 E;  1J1D B;  2E75 B;  5GTH H;  2ZYG A;  1OIP A;  2N9B A;  2WPV B;  4PD4 H;  1OW8 A;  1BGY J;  3L70 D;  2IFN A;  1AQT A;  2R5B A;  3R2P A;  2FY8 A;  3Q3D A;  2WSE J;  3MUD C;  2ZXE B;  3H6P A;  1H0T A;  3CLQ A;  3VYI A;  3BRT B;  4AQR D;  1GW3 A;  2Z4E A;  4U3F E;  2R44 A;  3GMA A;  2WSF J;  1SQV J;  2Q3E A;  1YTZ T;  1KYO H;  3NTN A;  3C8V A;  2IYP A;  2PP6 A;  3NXS A;  2CK3 H;  4JYC A;  2W8Z A;  2E76 B;  4NPF X;  1GU5 A;  1NU1 D;  3L35 A;  3HUS B;  2D2C B;  1Y47 A;  3CCV P;  5APU A;  5BVZ A;  5KAI H;  3RBX A;  2ZXX A;  1VQ9 P;  1IJD B;  5GTI H;  1S5L X;  5EFW B;  4W7Y A;  3H32 B;  4IFF A;  2Q7C A;  2L5G B;  3CI9 A;  2H88 C;  3PHL A;  4KJM A;  2Q3I A;  2FYN B;  2NPS B;  4WVZ A;  1JNM A;  1DH3 A;  3KZI E;  1X22 A;  2K3R A;  5CBO A;  4IL6 H;  1KIL C;  3D6Y A;  3A0H E;  4PJ0 E;  2O1J A;  1GK6 A;  1X9V A;  3TGU G;  3PH0 A;  1URQ C;  1ZR4 A;  1VF5 C;  5AVU B;  1PIX A;  2XU6 A;  3Q5P A;  1SQP G;  4U3F J;  1RQU A;  1N73 B;  3AE3 C;  3JC2 2;  3L71 G;  1FZC A;  3M9H A;  3M9B A;  1S1C X;  1AFO A;  2QJK B;  4JYB A;  1T3U A;  2FYU K;  4K3A A;  1RE4 A;  1YIJ P;  3WU2 E;  3EFF K;  3TNU A;  1G1J A;  1FZB A;  1M1J C;  3KHU A;  3KDP B;  3ABV C;  3VP9 A;  4ZKP A;  1NKZ B;  1YIT P;  4H0L C;  2LXC B;  4PD4 D;  2JR8 A;  3CD6 P;  1K05 A;  4ASV A;  2NZ2 A;  3V6I A;  2I8D A;  3U59 A;  3P8C D;  1KYO E;  1R5L A;  1FDI A;  1L0N D;  2AXT E;  2B87 B;  1Y8A A;  2KSE A;  1KYO D;  2V7Q H;  1L4A D;  1M56 D;  1FZF A;  1PP9 J;  4OGQ B;  2KI7 B;  3AE2 C;  1PGP A;  2I1J A;  3O8Z A;  3TGU E;  4N3Y B;  5KAI E;  3L72 J;  1NAY A;  5CJ0 A;  1AVO A;  1SQP E;  2O1K A;  2WT7 B;  1LTJ C;  5AVW B;  3TGU D;  2YIU C;  3L71 E;  5AW4 B;  4DJG A;  3FXE A;  3H1I G;  2Y0E A;  3GG2 A;  3AE1 C;  2YMK A;  3L37 A;  4L75 A;  4MN4 C;  5AVT B;  1JUN A;  1FS0 E;  1KD1 Q;  1ZRT E;  2C0W A;  4IL6 E;  1JO5 A;  1NU1 K;  3GF3 A;  1FBM A;  1WRG A;  2KK7 A;  1ZRT D;  2E43 A;  1NHL A;  1WT6 A;  3HD7 A;  4HJG H;  1SQQ G;  4IOI H;  2JDI H;  3L74 G;  5KLV G;  3G3Z A;  2GUV A;  1L0L G;  2AXC A;  2W83 C;  3SWY A;  2WSS H;  4PV1 C;  1HBW A;  1M7L A;  4ASW A;  1JOC A;  2K9Y A;  4QMA A;  4H44 C;  1YJW P;  3H25 A;  5H2F E;  5KLI C;  3D70 A;  3H1H G;  3CMA P;  1NWQ A;  2OYH B;  5CJ4 A;  1FZC C;  3G4S P;  1SQX J;  3CCR P;  1WMK A;  1RQV A;  1SLQ A;  1X0T A;  3PP5 A;  2YMY A;  1A02 J;  5AW9 B;  1SQP J;  2OTL P;  4GIF A;  2WSE H;  3H1L G;  3L71 J;  2BAS A;  4KHX A;  2PAJ A;  1S3J A;  2IZ1 A;  1KOR A;  3ITK A;  2ZAE B;  1FAV A;  4D6T G;  3A7O A;  3IN6 A;  2WSF H;  3JSV C;  1BSH A;  1W2E A;  1YJN P;  2YKQ A;  3CXH H;  3H1I E;  2IPP A;  1BGY G;  3AEE C;  4BRY B;  2IBZ I;  3KQG A;  1MKM A;  4KT0 J;  3RK3 E;  4ZMD A;  2GA1 A;  1L4A A;  1FU1 A;  2WVR A;  3VMA A;  4H0L D;  5AW8 B;  1SQQ E;  1PPJ G;  3L74 E;  1LNQ A;  5AW5 B;  5KLV E;  1L0N K;  3TF5 A;  2O01 N;  1HJB A;  2M3B A;  1L0L E;  2W6A A;  2Y9Z A;  1JY3 P;  1G1I A;  2KUB A;  3CL3 D;  3L74 D;  3AEF C;  5KLV D;  1JTH A;  1MV8 A;  1NGM B;  5BU5 A;  4IFD K;  3W67 A;  3MD0 A;  2RMZ A;  3H1H E;  1PZQ A;  5L8R J;  4I7Z B;  2Q9I A;  4WY4 D;  1VQK P;  5CCH D;  2M3E A;  3A5T A;  2FXO A;  1EZV I;  1R5S A;  4I1L A;  3RGU A;  3SWF A;  3H1L E;  3H32 A;  3L75 J;  3FXD A;  3VMY A;  5AW1 B;  1HF9 A;  3V4W A;  2NPS A;  1CI6 B;  4OWF A;  4L76 A;  1R8E A;  4GOF A;  3H1L D;  3EWK A;  3HE5 A;  4D6T E;  3SWK A;  1JMB A;  2HFE D;  4Y99 B;  1SQB E;  1IO4 A;  1OZH A;  1RF1 A;  1BGY E;  1HUC A;  3L73 J;  2IYO A;  1SQQ J;  2HOD B;  2OYI A;  2ZFC A;  1HGV A;  1L0L J;  1BGY D;  1VDF A;  2KNC B;  1NOH A;  3JCU H;  4ZKU A;  1EDK A;  1SS1 A;  4L74 A;  1Z56 A;  2ZYD A;  1EXJ A;  3TSI A;  2PGD A;  1M57 D;  5AVR B;  1PPJ E;  3H1K E;  1LWU B;  1YYC A;  1SFC B;  1YI2 P;  4C7R A;  1LP1 B;  1SQV D;  1LTA C;  4H44 D;  1JY2 N;  1H8A A;  3EQ2 A;  3O6Q A;  3CXH D;  1N7S B;  1ZLL A;  1T2K C;  2M5A B;  1GU4 A;  1M90 Q;  2YO3 A;  4OH8 B;  1QEX A;  4RJT A;  2GUS A;  2KLV A;  1JB0 J;  2FFD B;  3CCQ P;  2XNX A;  2YKP A;  3HTK B;  3B5N B;  1GK4 A;  1SQB J;  5TJH A;  3WU2 H;  2B88 A;  1L4A C;  1BDC A;  3AE4 C;  2K88 A;  1Q7Y Q;  3H1J J;  1KQS O;  2NRG A;  3P8M C;  2WIT A;  2QM7 A;  1PP9 G;  1GL2 A;  1QGK B;  4H13 B;  1Q2N A;  3OW2 O;  4AUW A;  4HYT B;  3L72 G;  1QL2 A;  4WY4 A;  3SFE C;  4YXW H;  1ZME C;  1YQ3 C;  1FDO A;  5CCH A;  3BAT A;  3PTZ A;  3H1K J;  2ZT9 D;  3PLN A;  1DEB A;  1OW7 A;  2FYU J;  2KLU A;  4U3F D;  2AXT H;  1YBK A;  2R32 A; 
#chains in the Genus database with same CATH homology
 1PP9 J;  5KLV J;  1BE3 J;  1BGY J;  3CWB J;  3H1H J;  4PD4 I;  1L0N J;  3H1J J;  1SQP J;  1SQV J;  1KB9 I;  1L0L J;  2BCC J;  1EZV I;  1NTM J;  3CXH I;  3BCC J;  3H1K J;  3L71 J;  1NU1 J;  1NTZ J;  1KYO I;  1P84 I;  3L72 J;  4U3F J;  1BCC J;  1NTK J;  3L75 J;  4D6T J;  2FYU J;  2IBZ I;  3TGU J;  3H1I J;  1SQB J;  3L73 J;  3H1L J;  1SQQ J;  3CX5 I;  1SQX J;  3L74 J;  3L70 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...