1SQVJ

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqvJ00
3L70J 1NU1J 1L0LJ 3TGUJ 1BCCJ 3H1LJ 1NTMJ 3L75J 3H1IJ 5KLVJ 1SQPJ 3L72J 3L73J 1SQBJ 1NTKJ 3CX5I 4D6TJ 3H1KJ 1NTZJ 2BCCJ 1P84I 3BCCJ 3CWBJ 2IBZI 3H1JJ 1BGYJ 1KYOI 1SQVJ 1KB9I 1L0NJ 4U3FJ 1SQXJ 3CXHI 3L71J 1SQQJ 4PD4I 1PP9J 2FYUJ 3H1HJ 1BE3J 1EZVI 3L74J
chains in the Genus database with same CATH superfamily
1Q7YQ 3B5NC 3WU2H 3LW5H 5AVXB 1NU1D 4EI2A 3L75G 4PJ0H 2GUVA 4RESB 1SQPG 4I7ZB 1SQBD 4U7JA 2Q9IA 3V2RA 1WT6A 2ZFCA 2CPBA 3CWBD 1USDA 3H25A 3CXHH 1AQ5A 3PH0A 2N1TD 1GL2C 2ZYDA 1H0TB 1EXJA 2ZJSE 1N7LA 1EZVD 2W27A 3ITKA 1ZW0A 1RF0A 2V7QH 3MUDA 5KAIE 2OQQA 2LXCB 1LP1A 3P8CE 1PFIA 1BE3E 3CLQA 1JM0A 1BE3J 1GTWA 3CCVP 3H1HG 1GW4A 2GUSA 3JCUE 4EIJA 1KQLA 2P10A 4ASVA 1URQD 1JY2N 2KZIA 4K35A 1MUUA 1SQQE 1AA0A 1KYOE 2B87A 3CX5D 1SQQJ 1P84D 1N73A 1OVVA 1PIXA 1BE3G 5AW3B 1KB9D 1U57A 1KQFB 1JY3N 2KI7B 2JWAA 3TK1A 2HODA 2NPSA 1PPJE 1LWUB 1DEBA 5KLIB 3K5BA 4BXLA 2D2CB 1DEEG 1JO5A 2IBZG 1SQQG 2XV5A 3D71A 1LJ2A 2FFDB 2UWJE 2Z5IA 2WSEH 3RK3C 1S1CX 4GT1A 2J58A 5CCHD 2LR2A 1RF1B 1FJPA 1S9KE 4AYCA 1VQ4P 5CHXA 2QM8A 2P7JA 4DT0A 1Q90D 1IK7A 5BU5A 2IX7C 1N7SD 1SFCA 1RF0C 3MUDC 4DOJA 1X0TA 5AW7B 1OW7A 1IFNA 4PV1B 4RO0A 4BWNA 1HUCA 2QJKC 1RQUA 2JWDA 1CZQA 2DW3A 4YTPC 5DJUB 1NTKE 3Q3DA 1VQMP 1NTKJ 3KZIE 1YBKA 3T97B 1OW8A 1QLED 1UIXA 3II6A 3HE4A 2ZVNB 4WBAA 1PGJA 3AE5C 1HJ0A 1N73C 2WPSA 2AEFA 3L36A 1NTME 3EFGA 1NTMJ 4PD4D 3B5ND 1UIIA 2BCCE 1IZNB 1NTKG 1BSNA 2BCCJ 2NPSC 3BCCG 1NTMK 3R2PA 4ASWA 5AW2B 2E76C 1LNQA 1RH5B 1HGZA 3D6YA 1NO4A 1GL2D 1VQ5P 3U59A 1VQ6P 2QJYB 1HBWA 2W8ZA 2Z5HA 3BASA 2BCCG 5AW9B 4RKUJ 2YMKA 1FZCB 2HFED 5AVUB 3MP7B 3AE6C 2KK7A 2FYUD 1W5CE 5E79H 5KKZB 2KS1B 1BCCD 1SFCC 1FJKA 3H1JE 1K05A 2B9BA 2ZVOB 5B66H 1NHLA 3H1JJ 2K1AA 3M06A 1EZVI 2IBZD 3F89A 4Y99B 1JCDA 4C7NB 4DZOA 1VL2A 3GMAA 4WY4B 1L0LG 1LTSC 4I1LA 3SWFA 1M7LA 1PZQA 2XNDH 2I1JA 2ITAA 1T6AA 2XZRA 2QG4A 3H1JG 2E5YA 2KSEA 4U3FD 5B5EH 1SS1A 2K3RA 2W6BA 3H32A 5APSA 1KILA 2N1TB 4JYBA 3HE5B 3Q5SA 5GTIE 2QA4P 1RE4A 1EC5A 2JKVA 3CX5I 5AW4B 2QVAA 2FBWC 3H1KG 2OTKE 4TT3H 3A0BE 1KB9I 3MHVA 2M3EA 5TISE 2W90A 1L0ND 4WVZA 3L71D 5CMZA 1GD2E 4EDFA 1Z56A 5KAFE 5KLVG 3P8MC 1HJBA 3S1KA 3KYQA 1M1JA 2KB7P 1URQB 1OVUA 2Z4EA 3BRVB 2OTLP 1VQNP 1LTJB 2RKLA 1OMIA 3CXHD 1GW3A 3D70A 4L76A 2R3SA 2YKQA 1YTZT 1M1KQ 3WUVA 3BCCD 1LTGC 1EDKA 2WPRA 2W6JH 2NRGA 1S4XA 1FBMA 1LTAC 3M91A 3NXSA 5KJ7A 1VPCA 1KD1Q 3OJAB 3FXDA 1BDCA 3C9IA 3A0HE 1PGOA 2NPSD 1NTZK 3S4RA 3U1CA 1KILE 3W68A 2A06D 2AXTE 2WSFJ 3H1LG 3AE8C 2WT7A 3RBXA 1L2PA 1RE4C 1KMIZ 2C9NY 1IO4A 1NU1K 1N7SB 1GDTA 2A45I 1T3JA 3UIAA 1QL1A 4PD4I 1SQBK 1VF5C 3TF5A 4ZNCA 3HUSA 1VQPP 3M0DA 2XDJA 1X8YA 4H13C 1L0LD 3MD0A 3VOPA 1OW6A 2ZXXA 1FDMA 3G3ZA 1EDLA 1M1JC 3KHUA 1PGQA 4ZKPA 1KORA 2FY8A 1KZUB 5KTBA 2FXMA 3M0AA 3VP8A 1MKMA 3WMM0 3CX5E 5AW0B 1FU1A 3B5NB 4HYTB 3U1AA 3SSUA 1IFDA 1KB9E 3IF4A 3VMZA 2ZXEB 1M8OB 3JCUH 5KLVD 2HYNA 1GL2B 3L73G 4LC1A 5KJ7C 3RGUA 1H89A 3I56P 2POHA 5CJ0A 3IFMA 3KDPB 1FDIA 5APVA 1KYOH 3MIWA 3CD6P 4YPCA 1GU5A 1AVOA 2KZJA 1U7MA 3AE9C 4JPZB 2E43A 1Y9BA 2V4HA 3HUSC 4L74A 3H1IE 4O9BA 1QX8A 3TGUJ 1R8EA 5CCGA 2W6AA 3H1IJ 3M0DC 2H7HA 3E7KA 4XFJA 3M9BA 3L37A 1GZLA 3D6ZA 3SWYA 1QVFO 4NPDA 1G2CA 3TYYA 1YJWP 2HPCB 2FYNB 3AE1C 1FOSF 3AEGC 2OYOA 1BSHA 3IR9A 3PHLA 2J5UA 3TGUG 2YNYA 3H1IG 2IZ0A 3H1LD 1Q82Q 2QIWA 2YO2A 1DIPA 3CXHI 3RK3B 1HTLC 2BEQD 3PLNA 2JEEA 2WMMA 3KZIH 1SQVE 1SQVJ 2I8DA 4R4MA 1AQTA 4EYYQ 2O1KA 1VF5D 1SQXD 2E74C 1CI6A 1LP1B 1SQVK 1AV1A 2QJKB 3CL3D 3VYIA 4UB8E 2WTYA 4UB6H 3SWKA 4HKZH 1PP9E 1R5SA 3EFFK 1SQVG 1NH4A 1PP9J 5BVZA 3CCRP 1S3JA 3L74D 4WB4A 5CCGC 2B87B 2FYUK 1N73B 1M56D 4BRYA 5C39A 1AJYA 3GG2A 3W67A 3QH9A 1PP9G 2HODB 4OH8B 3AE3C 2NPSB 1T3UA 2PP6A 1NYHA 2MJZA 4U3FE 5KJ7D 2FFDA 4DJGA 1VQ9P 2Q5UA 5AVVB 1PPJG 2K9JB 2H88C 1QEXA 1H8AA 1SLQA 4H0LD 5AVQB 4IL6H 3QWOC 3KQGA 1KFNA 3CCJP 1L0NE 3L71E 1ZOYC 1L0NJ 2KXPB 3L71J 1FAVA 3VP9A 3OA7A 1NGMB 3LW5J 4PJ0E 1FZAA 2AEMA 1L0NK 1ZP0C 5GTIH 3L75D 3Q5PA 1SQPD 3BVHA 3BATA 2WZ7A 3A0BH 1HWTC 4TLFA 3L70E 1LT9A 1EDJA 3L70J 5TJHA 3G71P 3HE4B 2O1JA 5KAFH 1E79H 1AVYA 2RMZA 2IFMA 2V7QJ 2ZAEB 3P32A 2K88A 4KHXA 4ZMDA 2O01J 3FGAD 3AEEC 1HVVA 3JSVC 2OARA 3NMDA 3NFQA 1JCCA 3RL0C 1YI2P 3L70G 3L72E 3H1HD 3VMAA 1E5WA 3L72J 1DD3A 1K8AQ 1NTMG 1M90Q 1QVGO 3C8VA 2FFDC 1K04A 3AE2C 1S5LE 3FXEA 3P8CD 1BE3D 1KQGB 4D6TE 3L4FA 3L72G 2E74D 3RK2C 4D6TJ 5K5GB 2Q1KA 3I5CA 1R5LA 5BU8B 1N2DC 5M1BA 2Q7CA 2B89A 2KUBA 2OGUA 1ZRTD 1PGPA 1SQQD 1JOCA 1KYOD 1NOHA 4JYCA 4XA4A 2WSEJ 4IOIH 2AEJA 4D6TG 1BGYE 1GK4A 5AW1B 3V4WA 1BGYJ 4WY4A 2Q3IA 4LGDE 2PGDA 1LT9C 1Q81Q 1NWQA 1J1EC 3M9QA 4GDOA 1P84I 4AUWA 3H32B 3RK3D 2LXBA 1BGYG 1N86A 1HF9A 1IK9A 1QGKB 1VF5B 1ZLLA 3AE7C 2R5BA 3GHGA 4XE5B 1JTHA 4H13B 2BEZF 2E5TA 2FKWB 4IFFA 5GTHH 3IAOA 2M5AA 4DCKA 1USEA 3AEAC 4HJGH 1M1JB 1URQA 2E75C 1FS0E 1GU4A 1NTKD 2Q6QA 2I1KA 2P1JA 1YYCA 1ZN5A 4WWIA 5AVWB 1NTZE 2L5GB 3CPWO 3ZDMA 1NTZJ 1J1DC 2IFNA 4Y99C 2N9YB 3F5HA 5H2FH 3TSIA 1IFJA 3EWKA 2BCCD 2WWWA 4WY4C 2KYVA 2P58A 2ZYGA 2OYIA 1NU1E 3GF7A 3KPEA 1KFMA 1L4AA 1NU1J 5E79E 3A5TA 2E76D 2KNCA 1SQBE 3RL0D 1KILC 2H8PD 1SQBJ 3CCSP 1RHZB 4W7ZA 1Q86Q 3CWBE 2N9BA 4H0LB 3O6QA 5B66E 1NTZG 3CWBJ 2G8YA 4GOFA 3HTKA 1EXIA 4OGQC 2WT7B 3CCMP 1EZVE 2OYHB 3TDKA 1NU1G 3HRNA 4OVNF 3N4XA 1SQBG 3HUSB 2WPQA 1AFOA 3RK2D 1SFCD 4W80A 3CWBG 1SQXE 3GHGC 5APUA 1SQXJ 1FZGA 3H1JD 1YQ4C 2KLUA 1EZVG 1VDFA 1FDOA 1SQXK 2QJPC 1KV4A 1P84E 5KAIH 2Y9ZA 3H1KD 1SVFA 2Y0CA 4C7RA 5APXA 3VMXA 3TNUA 1YITP 3B5NA 1OZHA 5CBNA 3S9OA 3P7KA 2R32A 2Y9YA 1LTBC 1RE3A 4W7YA 2KIKA 4OWFA 2IBZI 5AVRB 1KYOI 1Q2NA 2Y0EA 3PJSK 2OYIC 1L4AC 1X79B 2PFXA 1WMKA 1VQKP 1CW5A 3Q1MA 3FX0A 3AE4C 1YIJP 2H89C 4K3AA 2YIUC 4H44C 2FYZA 2E74B 2SPZA 5APWA 5AVTB 3HD7A 3KXDA 1S72P 2WSCJ 3NTNA 3A3YB 4IL6X 1OXZA 1PV3A 1HH0A 2WQYC 4CPGA 1DX7A 3SFDC 3VMYA 1SQPE 1Y8AA 1SQPJ 2ZT9C 3ABVC 2M3BA 1G2CB 3SFEC 4KJMA 1SQPK 4PD4E 3CCUP 4HB1A 4Y28J 2XU6A 3V2NA 3B4SA 4C46A 2C0WA 4GKGA 1KILD 1RE3C 1KC8Q 1KN7A 1H0TA 3H1HE 2A45G 4OGQD 3H1HJ 3RL0g 2PRRA 1LGHB 3WUTA 1JMBA 4GIFA 4H13D 2O01H 1OWAA 1NVOA 2XKMA 3V6IA 1CI6B 2FYUE 4I6MC 1Y47A 2FYUJ 5L8RJ 1XTGB 1M57D 1BCCE 3HD7C 3CCQP 1BCCJ 1NKZB 1FE6A 3OAKA 1SP4A 3PTZA 1LTTC 3EQ2A 3L73D 1ZRTE 2IBZE 2H43A 3V2PA 1IFIA 3VTPC 2YO3A 1CSBA 1J2JB 2FYUG 4BRYB 2WPVB 3LIDA 1S5LH 2R44A 1WRGA 1LWUA 4GOEA 3FWNA 1BCCG 3A2AA 1K9MQ 1SQQK 2E76B 3RL0B 2FYNC 2L91A 3JC22 4HH2A 3GW6A 2O3JA 3N7NA 4U3FJ 3G9RA 4I7ZC 2QEXP 2FXOA 3MGNA 2C0XA 1L4AD 3RK3E 1RF1A 3GF3A 2K9JA 2KOGA 3C1LA 1VQ7P 1VQ8P 1NKNA 4H44D 3RK2B 2RN0A 1SFCB 4U3FG 2QE7H 3WU2E 2P2UA 4KT0J 3LIEA 3Q2YA 4N78D 3TGUD 3R4YA 3H1ID 2IPPA 1G1JA 2HR3A 3PP5A 2BASA 3CXHE 1L0NG 5TISH 3L71G 2IYOA 3T97A 3CC4P 1EDIA 2HG5D 3M9HA 3BCCE 2ZT9D 1LT9B 2KSJA 5AW8B 2R3CA 3BCCJ 4RJTA 4NPEA 1YHQP 1J1EB 2NZ2A 3CCLP 4L73A 1NTKK 2WITA 3VN0A 1LWUC 5KLIC 1JNMA 1T8ZA 1KQSO 2D2CC 4UB6E 3B71A 4IFDK 1OX3A 2A06E 1SQVD 1FZCA 3CCEP 2OTJP 1RF1C 5EFWB 3AECC 1X22A 2GA1A 3IN6A 3A0HH 2E75B 2KS1A 3G4SP 2R5DA 5APTA 1L0LE 1PP9D 1L0LJ 2A06G 3V5BA 1IFMA 4PV1C 2WSFH 3HD7D 2AXTH 5CCGD 3AEDC 4C7NA 1A02J 2FXPA 2XNXA 1L0LK 2B88A 2LKMA 4YXWH 1ZXGA 1J1DB 1PPJD 1G1IA 1IFPA 2KLVA 4ZKUA 4IL6E 2YMYA 3H1KE 4MN4C 1YTZI 2QSIA 3H1KJ 1JEKA 1T2KC 2YKPA 2O01N 3GLMA 1GK6A 2N1TA 2M0BA 1KILB 4R4LA 3HE5A 3RBZA 2Q3EA 4AQRD 1MFTA 5KLVE 3AEBC 4OGQB 5KLVJ 1S9KD 3MZWB 1FZBA 2WSSH 3CX5H 1PL5A 2M8RA 1P84H 3USSA 3FWLA 5KLVK 1KTMA 1KB9H 2E42A 2JR8A 2YXQB 1MV8A 1A02F 2QJYC 5AW5B 5CBOA 3GHGB 1JTHB 4LLHA 1FZCC 2M5AB 1RQVA 3A7OA 1JY2P 1N8RQ 1K73Q 1LTJA 5AVZB 2HLOA 2C9LY 2QJPB 3V2QA 5KKZC 1YJNP 1JY2O 1LT1A 4N6JA 1JY3P 3L70D 3CI9A 4N3YB 1DH3A 1NTMD 2CK3H 1U7JA 4EOTA 1S2EA 2P67A 1JY3O 4JBZA 4YXDC 2ZYAA 1BDDA 3H1LE 3OW2O 2QM7A 2WSCH 3H1LJ 4GODA 5AW6B 2OYIB 2JDIH 5CCHA 3L72D 1JUNA 1FC2C 1L4AB 2D2CD 5CJ4A 2KNCB 1VQOP 2IYPA 2N1TC 2GM4A 2YIUB 4H44B 1IC2A 3O6QB 1N7SA 3G6EP 3HTKB 2CPSA 1FZFA 2RH0A 2MKVA 1NJIQ 3WUUA 2OYHA 4D6TD 3I55P 2A45H 1FZEA 4PD4H 2JP3A 1ZMEC 5B5EE 3AEFC 1ZR2A 4I2LC 2K37A 2IZ1A 1EQ7A 1URQC 4PV1D 2Y0DA 4JF7A 1MZ9A 2ZT9B 1LTJC 1W2EA 3Q5RA 3L74E 1BGYD 1SQXG 3L74J 5AVYB 3L73E 1YJ9P 4Z1MH 4A7PA 4L75A 3L73J 2VRSA 3TNUB 4UB8H 1IJDB 1JMMA 3CC7P 3H6PA 2K9YA 3E1RA 3L35A 5GTHE 2WVRA 1H88A 1OIPA 1T2KD 1YQ3C 3BRTB 1GL2A 1TU3F 3V4QA 1S5LX 3L74G 4B86A 1ZV8A 2YKOA 2YXRB 3E1IA 4M3LA 1FOSE 5CCHC 1JB0J 3MTUE 1D7MA 2AXCA 1OVRA 1MFZA 1DD4A 2PAJA 1X9VA 4H0LC 1NAYA 3PRJA 1VQLP 1N7SC 2JO1A 4NPFX 3CC2P 5AVSB 5H2FE 1ZR4A 3HD7B 2E75D 2W83C 2OYHC 1LTIC 1W2BO 4IFMA 3O8ZA 3CMEP 1OFCX 3CMAP 4N78E 3TGUE 2JJLA 3L75E 1RY3A 2G3AA 2IDBA 3L75J 1HGVA 3B8EB 2J59M 2KP8A 5APYA 2HPCA 5DJTB 5APQA 1NTZD 1XTCC 2QRXA 1QL2A 4QMAA 1GMJA 4JQ0D 1NAFA 4WY4D
chains in the Genus database with same CATH topology
3L70J 1NU1J 1L0LJ 3TGUJ 1BCCJ 3H1LJ 1NTMJ 3L75J 3H1IJ 5KLVJ 1SQPJ 3L72J 3L73J 1SQBJ 1NTKJ 3CX5I 4D6TJ 3H1KJ 1NTZJ 2BCCJ 1P84I 3BCCJ 3CWBJ 2IBZI 3H1JJ 1BGYJ 1KYOI 1SQVJ 1KB9I 1L0NJ 4U3FJ 1SQXJ 3CXHI 3L71J 1SQQJ 4PD4I 1PP9J 2FYUJ 3H1HJ 1BE3J 1EZVI 3L74J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 J;  1NU1 J;  1L0L J;  3TGU J;  1BCC J;  3H1L J;  1NTM J;  3L75 J;  3H1I J;  5KLV J;  1SQP J;  3L72 J;  3L73 J;  1SQB J;  1NTK J;  3CX5 I;  4D6T J;  3H1K J;  1NTZ J;  2BCC J;  1P84 I;  3BCC J;  3CWB J;  2IBZ I;  3H1J J;  1BGY J;  1KYO I;  1SQV J;  1KB9 I;  1L0N J;  4U3F J;  1SQX J;  3CXH I;  3L71 J;  1SQQ J;  4PD4 I;  1PP9 J;  2FYU J;  3H1H J;  1BE3 J;  1EZV I;  3L74 J; 
#chains in the Genus database with same CATH topology
 1Q7Y Q;  3B5N C;  3WU2 H;  3LW5 H;  5AVX B;  1NU1 D;  4EI2 A;  3L75 G;  4PJ0 H;  2GUV A;  4RES B;  1SQP G;  4I7Z B;  1SQB D;  4U7J A;  2Q9I A;  3V2R A;  1WT6 A;  2ZFC A;  2CPB A;  3CWB D;  1USD A;  3H25 A;  3CXH H;  1AQ5 A;  3PH0 A;  2N1T D;  1GL2 C;  2ZYD A;  1H0T B;  1EXJ A;  2ZJS E;  1N7L A;  1EZV D;  2W27 A;  3ITK A;  1ZW0 A;  1RF0 A;  2V7Q H;  3MUD A;  5KAI E;  2OQQ A;  2LXC B;  1LP1 A;  3P8C E;  1PFI A;  1BE3 E;  3CLQ A;  1JM0 A;  1BE3 J;  1GTW A;  3CCV P;  3H1H G;  1GW4 A;  2GUS A;  3JCU E;  4EIJ A;  1KQL A;  2P10 A;  4ASV A;  1URQ D;  1JY2 N;  2KZI A;  4K35 A;  1MUU A;  1SQQ E;  1AA0 A;  1KYO E;  2B87 A;  3CX5 D;  1SQQ J;  1P84 D;  1N73 A;  1OVV A;  1PIX A;  1BE3 G;  5AW3 B;  1KB9 D;  1U57 A;  1KQF B;  1JY3 N;  2KI7 B;  2JWA A;  3TK1 A;  2HOD A;  2NPS A;  1PPJ E;  1LWU B;  1DEB A;  5KLI B;  3K5B A;  4BXL A;  2D2C B;  1DEE G;  1JO5 A;  2IBZ G;  1SQQ G;  2XV5 A;  3D71 A;  1LJ2 A;  2FFD B;  2UWJ E;  2Z5I A;  2WSE H;  3RK3 C;  1S1C X;  4GT1 A;  2J58 A;  5CCH D;  2LR2 A;  1RF1 B;  1FJP A;  1S9K E;  4AYC A;  1VQ4 P;  5CHX A;  2QM8 A;  2P7J A;  4DT0 A;  1Q90 D;  1IK7 A;  5BU5 A;  2IX7 C;  1N7S D;  1SFC A;  1RF0 C;  3MUD C;  4DOJ A;  1X0T A;  5AW7 B;  1OW7 A;  1IFN A;  4PV1 B;  4RO0 A;  4BWN A;  1HUC A;  2QJK C;  1RQU A;  2JWD A;  1CZQ A;  2DW3 A;  4YTP C;  5DJU B;  1NTK E;  3Q3D A;  1VQM P;  1NTK J;  3KZI E;  1YBK A;  3T97 B;  1OW8 A;  1QLE D;  1UIX A;  3II6 A;  3HE4 A;  2ZVN B;  4WBA A;  1PGJ A;  3AE5 C;  1HJ0 A;  1N73 C;  2WPS A;  2AEF A;  3L36 A;  1NTM E;  3EFG A;  1NTM J;  4PD4 D;  3B5N D;  1UII A;  2BCC E;  1IZN B;  1NTK G;  1BSN A;  2BCC J;  2NPS C;  3BCC G;  1NTM K;  3R2P A;  4ASW A;  5AW2 B;  2E76 C;  1LNQ A;  1RH5 B;  1HGZ A;  3D6Y A;  1NO4 A;  1GL2 D;  1VQ5 P;  3U59 A;  1VQ6 P;  2QJY B;  1HBW A;  2W8Z A;  2Z5H A;  3BAS A;  2BCC G;  5AW9 B;  4RKU J;  2YMK A;  1FZC B;  2HFE D;  5AVU B;  3MP7 B;  3AE6 C;  2KK7 A;  2FYU D;  1W5C E;  5E79 H;  5KKZ B;  2KS1 B;  1BCC D;  1SFC C;  1FJK A;  3H1J E;  1K05 A;  2B9B A;  2ZVO B;  5B66 H;  1NHL A;  3H1J J;  2K1A A;  3M06 A;  1EZV I;  2IBZ D;  3F89 A;  4Y99 B;  1JCD A;  4C7N B;  4DZO A;  1VL2 A;  3GMA A;  4WY4 B;  1L0L G;  1LTS C;  4I1L A;  3SWF A;  1M7L A;  1PZQ A;  2XND H;  2I1J A;  2ITA A;  1T6A A;  2XZR A;  2QG4 A;  3H1J G;  2E5Y A;  2KSE A;  4U3F D;  5B5E H;  1SS1 A;  2K3R A;  2W6B A;  3H32 A;  5APS A;  1KIL A;  2N1T B;  4JYB A;  3HE5 B;  3Q5S A;  5GTI E;  2QA4 P;  1RE4 A;  1EC5 A;  2JKV A;  3CX5 I;  5AW4 B;  2QVA A;  2FBW C;  3H1K G;  2OTK E;  4TT3 H;  3A0B E;  1KB9 I;  3MHV A;  2M3E A;  5TIS E;  2W90 A;  1L0N D;  4WVZ A;  3L71 D;  5CMZ A;  1GD2 E;  4EDF A;  1Z56 A;  5KAF E;  5KLV G;  3P8M C;  1HJB A;  3S1K A;  3KYQ A;  1M1J A;  2KB7 P;  1URQ B;  1OVU A;  2Z4E A;  3BRV B;  2OTL P;  1VQN P;  1LTJ B;  2RKL A;  1OMI A;  3CXH D;  1GW3 A;  3D70 A;  4L76 A;  2R3S A;  2YKQ A;  1YTZ T;  1M1K Q;  3WUV A;  3BCC D;  1LTG C;  1EDK A;  2WPR A;  2W6J H;  2NRG A;  1S4X A;  1FBM A;  1LTA C;  3M91 A;  3NXS A;  5KJ7 A;  1VPC A;  1KD1 Q;  3OJA B;  3FXD A;  1BDC A;  3C9I A;  3A0H E;  1PGO A;  2NPS D;  1NTZ K;  3S4R A;  3U1C A;  1KIL E;  3W68 A;  2A06 D;  2AXT E;  2WSF J;  3H1L G;  3AE8 C;  2WT7 A;  3RBX A;  1L2P A;  1RE4 C;  1KMI Z;  2C9N Y;  1IO4 A;  1NU1 K;  1N7S B;  1GDT A;  2A45 I;  1T3J A;  3UIA A;  1QL1 A;  4PD4 I;  1SQB K;  1VF5 C;  3TF5 A;  4ZNC A;  3HUS A;  1VQP P;  3M0D A;  2XDJ A;  1X8Y A;  4H13 C;  1L0L D;  3MD0 A;  3VOP A;  1OW6 A;  2ZXX A;  1FDM A;  3G3Z A;  1EDL A;  1M1J C;  3KHU A;  1PGQ A;  4ZKP A;  1KOR A;  2FY8 A;  1KZU B;  5KTB A;  2FXM A;  3M0A A;  3VP8 A;  1MKM A;  3WMM 0;  3CX5 E;  5AW0 B;  1FU1 A;  3B5N B;  4HYT B;  3U1A A;  3SSU A;  1IFD A;  1KB9 E;  3IF4 A;  3VMZ A;  2ZXE B;  1M8O B;  3JCU H;  5KLV D;  2HYN A;  1GL2 B;  3L73 G;  4LC1 A;  5KJ7 C;  3RGU A;  1H89 A;  3I56 P;  2POH A;  5CJ0 A;  3IFM A;  3KDP B;  1FDI A;  5APV A;  1KYO H;  3MIW A;  3CD6 P;  4YPC A;  1GU5 A;  1AVO A;  2KZJ A;  1U7M A;  3AE9 C;  4JPZ B;  2E43 A;  1Y9B A;  2V4H A;  3HUS C;  4L74 A;  3H1I E;  4O9B A;  1QX8 A;  3TGU J;  1R8E A;  5CCG A;  2W6A A;  3H1I J;  3M0D C;  2H7H A;  3E7K A;  4XFJ A;  3M9B A;  3L37 A;  1GZL A;  3D6Z A;  3SWY A;  1QVF O;  4NPD A;  1G2C A;  3TYY A;  1YJW P;  2HPC B;  2FYN B;  3AE1 C;  1FOS F;  3AEG C;  2OYO A;  1BSH A;  3IR9 A;  3PHL A;  2J5U A;  3TGU G;  2YNY A;  3H1I G;  2IZ0 A;  3H1L D;  1Q82 Q;  2QIW A;  2YO2 A;  1DIP A;  3CXH I;  3RK3 B;  1HTL C;  2BEQ D;  3PLN A;  2JEE A;  2WMM A;  3KZI H;  1SQV E;  1SQV J;  2I8D A;  4R4M A;  1AQT A;  4EYY Q;  2O1K A;  1VF5 D;  1SQX D;  2E74 C;  1CI6 A;  1LP1 B;  1SQV K;  1AV1 A;  2QJK B;  3CL3 D;  3VYI A;  4UB8 E;  2WTY A;  4UB6 H;  3SWK A;  4HKZ H;  1PP9 E;  1R5S A;  3EFF K;  1SQV G;  1NH4 A;  1PP9 J;  5BVZ A;  3CCR P;  1S3J A;  3L74 D;  4WB4 A;  5CCG C;  2B87 B;  2FYU K;  1N73 B;  1M56 D;  4BRY A;  5C39 A;  1AJY A;  3GG2 A;  3W67 A;  3QH9 A;  1PP9 G;  2HOD B;  4OH8 B;  3AE3 C;  2NPS B;  1T3U A;  2PP6 A;  1NYH A;  2MJZ A;  4U3F E;  5KJ7 D;  2FFD A;  4DJG A;  1VQ9 P;  2Q5U A;  5AVV B;  1PPJ G;  2K9J B;  2H88 C;  1QEX A;  1H8A A;  1SLQ A;  4H0L D;  5AVQ B;  4IL6 H;  3QWO C;  3KQG A;  1KFN A;  3CCJ P;  1L0N E;  3L71 E;  1ZOY C;  1L0N J;  2KXP B;  3L71 J;  1FAV A;  3VP9 A;  3OA7 A;  1NGM B;  3LW5 J;  4PJ0 E;  1FZA A;  2AEM A;  1L0N K;  1ZP0 C;  5GTI H;  3L75 D;  3Q5P A;  1SQP D;  3BVH A;  3BAT A;  2WZ7 A;  3A0B H;  1HWT C;  4TLF A;  3L70 E;  1LT9 A;  1EDJ A;  3L70 J;  5TJH A;  3G71 P;  3HE4 B;  2O1J A;  5KAF H;  1E79 H;  1AVY A;  2RMZ A;  2IFM A;  2V7Q J;  2ZAE B;  3P32 A;  2K88 A;  4KHX A;  4ZMD A;  2O01 J;  3FGA D;  3AEE C;  1HVV A;  3JSV C;  2OAR A;  3NMD A;  3NFQ A;  1JCC A;  3RL0 C;  1YI2 P;  3L70 G;  3L72 E;  3H1H D;  3VMA A;  1E5W A;  3L72 J;  1DD3 A;  1K8A Q;  1NTM G;  1M90 Q;  1QVG O;  3C8V A;  2FFD C;  1K04 A;  3AE2 C;  1S5L E;  3FXE A;  3P8C D;  1BE3 D;  1KQG B;  4D6T E;  3L4F A;  3L72 G;  2E74 D;  3RK2 C;  4D6T J;  5K5G B;  2Q1K A;  3I5C A;  1R5L A;  5BU8 B;  1N2D C;  5M1B A;  2Q7C A;  2B89 A;  2KUB A;  2OGU A;  1ZRT D;  1PGP A;  1SQQ D;  1JOC A;  1KYO D;  1NOH A;  4JYC A;  4XA4 A;  2WSE J;  4IOI H;  2AEJ A;  4D6T G;  1BGY E;  1GK4 A;  5AW1 B;  3V4W A;  1BGY J;  4WY4 A;  2Q3I A;  4LGD E;  2PGD A;  1LT9 C;  1Q81 Q;  1NWQ A;  1J1E C;  3M9Q A;  4GDO A;  1P84 I;  4AUW A;  3H32 B;  3RK3 D;  2LXB A;  1BGY G;  1N86 A;  1HF9 A;  1IK9 A;  1QGK B;  1VF5 B;  1ZLL A;  3AE7 C;  2R5B A;  3GHG A;  4XE5 B;  1JTH A;  4H13 B;  2BEZ F;  2E5T A;  2FKW B;  4IFF A;  5GTH H;  3IAO A;  2M5A A;  4DCK A;  1USE A;  3AEA C;  4HJG H;  1M1J B;  1URQ A;  2E75 C;  1FS0 E;  1GU4 A;  1NTK D;  2Q6Q A;  2I1K A;  2P1J A;  1YYC A;  1ZN5 A;  4WWI A;  5AVW B;  1NTZ E;  2L5G B;  3CPW O;  3ZDM A;  1NTZ J;  1J1D C;  2IFN A;  4Y99 C;  2N9Y B;  3F5H A;  5H2F H;  3TSI A;  1IFJ A;  3EWK A;  2BCC D;  2WWW A;  4WY4 C;  2KYV A;  2P58 A;  2ZYG A;  2OYI A;  1NU1 E;  3GF7 A;  3KPE A;  1KFM A;  1L4A A;  1NU1 J;  5E79 E;  3A5T A;  2E76 D;  2KNC A;  1SQB E;  3RL0 D;  1KIL C;  2H8P D;  1SQB J;  3CCS P;  1RHZ B;  4W7Z A;  1Q86 Q;  3CWB E;  2N9B A;  4H0L B;  3O6Q A;  5B66 E;  1NTZ G;  3CWB J;  2G8Y A;  4GOF A;  3HTK A;  1EXI A;  4OGQ C;  2WT7 B;  3CCM P;  1EZV E;  2OYH B;  3TDK A;  1NU1 G;  3HRN A;  4OVN F;  3N4X A;  1SQB G;  3HUS B;  2WPQ A;  1AFO A;  3RK2 D;  1SFC D;  4W80 A;  3CWB G;  1SQX E;  3GHG C;  5APU A;  1SQX J;  1FZG A;  3H1J D;  1YQ4 C;  2KLU A;  1EZV G;  1VDF A;  1FDO A;  1SQX K;  2QJP C;  1KV4 A;  1P84 E;  5KAI H;  2Y9Z A;  3H1K D;  1SVF A;  2Y0C A;  4C7R A;  5APX A;  3VMX A;  3TNU A;  1YIT P;  3B5N A;  1OZH A;  5CBN A;  3S9O A;  3P7K A;  2R32 A;  2Y9Y A;  1LTB C;  1RE3 A;  4W7Y A;  2KIK A;  4OWF A;  2IBZ I;  5AVR B;  1KYO I;  1Q2N A;  2Y0E A;  3PJS K;  2OYI C;  1L4A C;  1X79 B;  2PFX A;  1WMK A;  1VQK P;  1CW5 A;  3Q1M A;  3FX0 A;  3AE4 C;  1YIJ P;  2H89 C;  4K3A A;  2YIU C;  4H44 C;  2FYZ A;  2E74 B;  2SPZ A;  5APW A;  5AVT B;  3HD7 A;  3KXD A;  1S72 P;  2WSC J;  3NTN A;  3A3Y B;  4IL6 X;  1OXZ A;  1PV3 A;  1HH0 A;  2WQY C;  4CPG A;  1DX7 A;  3SFD C;  3VMY A;  1SQP E;  1Y8A A;  1SQP J;  2ZT9 C;  3ABV C;  2M3B A;  1G2C B;  3SFE C;  4KJM A;  1SQP K;  4PD4 E;  3CCU P;  4HB1 A;  4Y28 J;  2XU6 A;  3V2N A;  3B4S A;  4C46 A;  2C0W A;  4GKG A;  1KIL D;  1RE3 C;  1KC8 Q;  1KN7 A;  1H0T A;  3H1H E;  2A45 G;  4OGQ D;  3H1H J;  3RL0 g;  2PRR A;  1LGH B;  3WUT A;  1JMB A;  4GIF A;  4H13 D;  2O01 H;  1OWA A;  1NVO A;  2XKM A;  3V6I A;  1CI6 B;  2FYU E;  4I6M C;  1Y47 A;  2FYU J;  5L8R J;  1XTG B;  1M57 D;  1BCC E;  3HD7 C;  3CCQ P;  1BCC J;  1NKZ B;  1FE6 A;  3OAK A;  1SP4 A;  3PTZ A;  1LTT C;  3EQ2 A;  3L73 D;  1ZRT E;  2IBZ E;  2H43 A;  3V2P A;  1IFI A;  3VTP C;  2YO3 A;  1CSB A;  1J2J B;  2FYU G;  4BRY B;  2WPV B;  3LID A;  1S5L H;  2R44 A;  1WRG A;  1LWU A;  4GOE A;  3FWN A;  1BCC G;  3A2A A;  1K9M Q;  1SQQ K;  2E76 B;  3RL0 B;  2FYN C;  2L91 A;  3JC2 2;  4HH2 A;  3GW6 A;  2O3J A;  3N7N A;  4U3F J;  3G9R A;  4I7Z C;  2QEX P;  2FXO A;  3MGN A;  2C0X A;  1L4A D;  3RK3 E;  1RF1 A;  3GF3 A;  2K9J A;  2KOG A;  3C1L A;  1VQ7 P;  1VQ8 P;  1NKN A;  4H44 D;  3RK2 B;  2RN0 A;  1SFC B;  4U3F G;  2QE7 H;  3WU2 E;  2P2U A;  4KT0 J;  3LIE A;  3Q2Y A;  4N78 D;  3TGU D;  3R4Y A;  3H1I D;  2IPP A;  1G1J A;  2HR3 A;  3PP5 A;  2BAS A;  3CXH E;  1L0N G;  5TIS H;  3L71 G;  2IYO A;  3T97 A;  3CC4 P;  1EDI A;  2HG5 D;  3M9H A;  3BCC E;  2ZT9 D;  1LT9 B;  2KSJ A;  5AW8 B;  2R3C A;  3BCC J;  4RJT A;  4NPE A;  1YHQ P;  1J1E B;  2NZ2 A;  3CCL P;  4L73 A;  1NTK K;  2WIT A;  3VN0 A;  1LWU C;  5KLI C;  1JNM A;  1T8Z A;  1KQS O;  2D2C C;  4UB6 E;  3B71 A;  4IFD K;  1OX3 A;  2A06 E;  1SQV D;  1FZC A;  3CCE P;  2OTJ P;  1RF1 C;  5EFW B;  3AEC C;  1X22 A;  2GA1 A;  3IN6 A;  3A0H H;  2E75 B;  2KS1 A;  3G4S P;  2R5D A;  5APT A;  1L0L E;  1PP9 D;  1L0L J;  2A06 G;  3V5B A;  1IFM A;  4PV1 C;  2WSF H;  3HD7 D;  2AXT H;  5CCG D;  3AED C;  4C7N A;  1A02 J;  2FXP A;  2XNX A;  1L0L K;  2B88 A;  2LKM A;  4YXW H;  1ZXG A;  1J1D B;  1PPJ D;  1G1I A;  1IFP A;  2KLV A;  4ZKU A;  4IL6 E;  2YMY A;  3H1K E;  4MN4 C;  1YTZ I;  2QSI A;  3H1K J;  1JEK A;  1T2K C;  2YKP A;  2O01 N;  3GLM A;  1GK6 A;  2N1T A;  2M0B A;  1KIL B;  4R4L A;  3HE5 A;  3RBZ A;  2Q3E A;  4AQR D;  1MFT A;  5KLV E;  3AEB C;  4OGQ B;  5KLV J;  1S9K D;  3MZW B;  1FZB A;  2WSS H;  3CX5 H;  1PL5 A;  2M8R A;  1P84 H;  3USS A;  3FWL A;  5KLV K;  1KTM A;  1KB9 H;  2E42 A;  2JR8 A;  2YXQ B;  1MV8 A;  1A02 F;  2QJY C;  5AW5 B;  5CBO A;  3GHG B;  1JTH B;  4LLH A;  1FZC C;  2M5A B;  1RQV A;  3A7O A;  1JY2 P;  1N8R Q;  1K73 Q;  1LTJ A;  5AVZ B;  2HLO A;  2C9L Y;  2QJP B;  3V2Q A;  5KKZ C;  1YJN P;  1JY2 O;  1LT1 A;  4N6J A;  1JY3 P;  3L70 D;  3CI9 A;  4N3Y B;  1DH3 A;  1NTM D;  2CK3 H;  1U7J A;  4EOT A;  1S2E A;  2P67 A;  1JY3 O;  4JBZ A;  4YXD C;  2ZYA A;  1BDD A;  3H1L E;  3OW2 O;  2QM7 A;  2WSC H;  3H1L J;  4GOD A;  5AW6 B;  2OYI B;  2JDI H;  5CCH A;  3L72 D;  1JUN A;  1FC2 C;  1L4A B;  2D2C D;  5CJ4 A;  2KNC B;  1VQO P;  2IYP A;  2N1T C;  2GM4 A;  2YIU B;  4H44 B;  1IC2 A;  3O6Q B;  1N7S A;  3G6E P;  3HTK B;  2CPS A;  1FZF A;  2RH0 A;  2MKV A;  1NJI Q;  3WUU A;  2OYH A;  4D6T D;  3I55 P;  2A45 H;  1FZE A;  4PD4 H;  2JP3 A;  1ZME C;  5B5E E;  3AEF C;  1ZR2 A;  4I2L C;  2K37 A;  2IZ1 A;  1EQ7 A;  1URQ C;  4PV1 D;  2Y0D A;  4JF7 A;  1MZ9 A;  2ZT9 B;  1LTJ C;  1W2E A;  3Q5R A;  3L74 E;  1BGY D;  1SQX G;  3L74 J;  5AVY B;  3L73 E;  1YJ9 P;  4Z1M H;  4A7P A;  4L75 A;  3L73 J;  2VRS A;  3TNU B;  4UB8 H;  1IJD B;  1JMM A;  3CC7 P;  3H6P A;  2K9Y A;  3E1R A;  3L35 A;  5GTH E;  2WVR A;  1H88 A;  1OIP A;  1T2K D;  1YQ3 C;  3BRT B;  1GL2 A;  1TU3 F;  3V4Q A;  1S5L X;  3L74 G;  4B86 A;  1ZV8 A;  2YKO A;  2YXR B;  3E1I A;  4M3L A;  1FOS E;  5CCH C;  1JB0 J;  3MTU E;  1D7M A;  2AXC A;  1OVR A;  1MFZ A;  1DD4 A;  2PAJ A;  1X9V A;  4H0L C;  1NAY A;  3PRJ A;  1VQL P;  1N7S C;  2JO1 A;  4NPF X;  3CC2 P;  5AVS B;  5H2F E;  1ZR4 A;  3HD7 B;  2E75 D;  2W83 C;  2OYH C;  1LTI C;  1W2B O;  4IFM A;  3O8Z A;  3CME P;  1OFC X;  3CMA P;  4N78 E;  3TGU E;  2JJL A;  3L75 E;  1RY3 A;  2G3A A;  2IDB A;  3L75 J;  1HGV A;  3B8E B;  2J59 M;  2KP8 A;  5APY A;  2HPC A;  5DJT B;  5APQ A;  1NTZ D;  1XTC C;  2QRX A;  1QL2 A;  4QMA A;  1GMJ A;  4JQ0 D;  1NAF A;  4WY4 D; 
#chains in the Genus database with same CATH homology
 3L70 J;  1NU1 J;  1L0L J;  3TGU J;  1BCC J;  3H1L J;  1NTM J;  3L75 J;  3H1I J;  5KLV J;  1SQP J;  3L72 J;  3L73 J;  1SQB J;  1NTK J;  3CX5 I;  4D6T J;  3H1K J;  1NTZ J;  2BCC J;  1P84 I;  3BCC J;  3CWB J;  2IBZ I;  3H1J J;  1BGY J;  1KYO I;  1SQV J;  1KB9 I;  1L0N J;  4U3F J;  1SQX J;  3CXH I;  3L71 J;  1SQQ J;  4PD4 I;  1PP9 J;  2FYU J;  3H1H J;  1BE3 J;  1EZV I;  3L74 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...