1SQVJ

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqvJ00
4U3FJ 2BCCJ 1NU1J 1NTKJ 1SQBJ 1SQQJ 1EZVI 3CX5I 1BCCJ 3L72J 1NTZJ 1KYOI 1SQPJ 1BE3J 1SQVJ 3L74J 1BGYJ 3L73J 3L71J 3TGUJ 1KB9I 1L0NJ 1P84I 1SQXJ 3CXHI 2FYUJ 3H1JJ 3CWBJ 1NTMJ 2IBZI 3BCCJ 5KLVJ 1PP9J 1L0LJ 3H1LJ 3H1HJ 3L75J 4D6TJ 3L70J 4PD4I 3H1KJ 3H1IJ
chains in the Genus database with same CATH superfamily
5CCHC 3NFQA 5APYA 1L4AB 5APVA 3VOPA 3Q3DA 1S5LH 1QLED 4W80A 1Q86Q 1X0TA 3I56P 4WVZA 4LGDE 4LLHA 2WSFH 5AW5B 2RH0A 1LTJA 1VQ6P 1LT9C 1KYOD 1PL5A 1VQ7P 2KP8A 1HTLC 1YHQP 1TU3F 3H6PA 2XNDH 4RKUJ 3L71E 4IFDK 3HRNA 3L72D 2LXBA 5AW3B 4UB6E 1BCCD 4PJ0H 2FYZA 4RJTA 2WPRA 1U7JA 1YJ9P 3KZIH 2NPSB 3V2RA 3L72G 3TK1A 1KYOI 1NU1D 1SQXK 5KJ7D 2V7QJ 2YKPA 5KTBA 1BE3D 1SQVD 5GTHE 2LXCB 3A0BE 4U3FG 1NU1G 1JY3N 2B87A 1NTKE 3MGNA 1EXIA 1WRGA 3P7KA 1BE3G 1JB0J 1SQVG 1SQPJ 1YTZT 3JSVC 1RE3A 5KAIE 3G9RA 3AEDC 2YO2A 1S72P 1L0LK 2N1TC 1NAFA 2B89A 1PV3A 4N78D 4KHXA 1ZN5A 1AVOA 1JY3O 3D6YA 3O6QA 5AW7B 3GHGB 1J2JB 3P8CE 4DT0A 4NPEA 1HBWA 3MP7B 2KXPB 3V2NA 1J1DB 1RQUA 4H13C 1SS1A 3PJSK 2FXMA 3KQGA 1LJ2A 2R32A 3M0DC 1GK4A 3H1LD 2WSEJ 3IR9A 4PD4E 3CPWO 1JMMA 3TSIA 4H44C 1AQ5A 2A45I 1IK9A 3LIDA 3H1LG 3HD7B 3KHUA 4KT0J 5CJ0A 2P10A 1EC5A 3Q5PA 3FXDA 4WBAA 5AW2B 2V7QH 1VF5C 4Y28J 3H1JJ 2O3JA 3C1LA 1KN7A 5E79H 3IF4A 2AXTE 2YIUB 1EDLA 3R2PA 2FYUD 1G1JA 2WSCJ 1NGMB 2O01J 3CI9A 3H25A 2J5UA 2OTKE 2KS1B 4WY4A 3L70D 1FZFA 2LKMA 2FYUG 1M1JB 2G8YA 3L74D 5AVUB 3L73D 3TGUD 3L70G 2BCCJ 3WU2E 4YXWH 2FFDA 5AVRB 1RF1A 1GL2B 4I7ZB 4HYTB 1FZCA 3L74G 3L73G 3SFDC 4EI2A 3H32B 1EZVE 3BATA 1NOHA 3RK3E 1KB9H 1SLQA 3S9OA 1NU1K 4K35A 1A02F 2GUVA 1RY3A 4NPDA 2WSEH 2I1JA 1W2EA 3RL0g 3FXEA 1LTTC 1NTZE 4GT1A 3CX5H 1SQQD 3L36A 2K88A 2IPPA 1L4AC 4GOFA 1SQQG 3H1HD 3EFFK 3A5TA 1R5LA 2KNCA 2Q9IA 1EQ7A 2QIWA 3NTNA 1NTME 1RE4C 3OW2O 1P84H 2QE7H 2WSCH 3H1HG 1L0ND 3HE4B 3OA7A 2JR8A 3V2QA 2H43A 2KB7P 3L72J 1D7MA 3WUUA 5AVYB 5L8RJ 1HJ0A 4HKZH 2KIKA 1L0NG 2HODB 3HTKA 2QRXA 5GTIE 4BRYB 3G3ZA 3V6IA 3A2AA 2NPSC 1DD4A 1NU1J 2Q1KA 3GF3A 3AE4C 3V5BA 1LWUA 1BE3J 1SQVJ 2YMYA 1N8RQ 1ZR2A 2IBZD 4L75A 3JCUH 3JC22 5AVSB 1GMJA 2KI7B 2XNXA 2IBZG 1PP9D 2RN0A 4D6TD 5AW6B 5H2FE 2FXPA 2OQQA 5CCHA 3A0HE 3VMYA 1PP9G 3W68A 4D6TG 2BASA 3GHGC 3WUVA 2WQYC 1USEA 4IOIH 1FC2C 1FOSF 1JTHB 2ZXXA 3M06A 4OH8B 3BASA 1PIXA 3RK2B 3GLMA 3CCJP 1NAYA 1ZV8A 3H1LJ 4M3LA 1KQFB 2WTYA 5APUA 1GDTA 2JP3A 1DH3A 1ZP0C 2K9JA 3HD7C 2YXRB 1PPJE 3CWBE 5KLIC 4WWIA 1OMIA 2KZIA 4JPZB 5CJ4A 2E43A 1T2KC 1N7LA 2KSEA 1OZHA 4O9BA 1JO5A 3MD0A 1UIXA 2OGUA 1J1EB 1SQBD 2FYUJ 4BXLA 2Z4EA 2Y0EA 3BCCE 3HE5B 3L70J 3B4SA 2ZT9B 3PRJA 3CX5D 1SQBG 5KLVD 2OYHB 3Q5RA 2BEQD 1M1JC 4HJGH 2KK7A 4C7RA 2E76B 3L74J 3L73J 2IFMA 1KB9I 2AXTH 4TT3H 4N3YB 1GL2C 4I7ZC 3B5NC 1W2BO 1NVOA 1LP1B 1E79H 2WSFJ 3CX5I 3G4SP 2JWAA 1OVRA 1P84D 2FXOA 5B5EH 3M0DA 5BU8B 3AE7C 4DOJA 2W6BA 1M56D 1JNMA 1SQQJ 1W5CE 1URQC 1FS0E 1EDIA 4DJGA 4HH2A 1P84I 4C7NA 1PGOA 3H1HJ 4GKGA 2XV5A 1Q2NA 1FDOA 3H1KE 1RHZB 4L74A 2WSSH 2M0BA 3L71G 1L0NJ 1HVVA 1SQXE 2WWWA 2JKVA 3CL3D 3IN6A 3HUSB 1JY3P 1KORA 1SQPK 3M9HA 1KILE 3MIWA 1NTKD 1AJYA 3MUDC 4AYCA 1GU4A 5DJUB 1NKNA 5TISE 1L0LE 2OYOA 2W90A 1MKMA 4OGQB 1NTKG 2N9BA 1JOCA 2K3RA 3OAKA 3FWNA 4H0LD 3M9BA 1CZQA 3P8CD 3AEEC 2FY8A 1PP9J 1ZLLA 4D6TJ 2B87B 5APTA 2PRRA 1FAVA 2E75D 1L4AA 1N7SC 4U3FD 1OIPA 1AQTA 4R4LA 1BGYE 4NPFX 3RL0D 5KLVK 3FGAD 4PD4D 4EOTA 1JUNA 2KYVA 1SP4A 1T6AA 1Y9BA 3O6QB 1JEKA 1RE4A 3RK2C 3IFMA 4PV1D 3A0HH 1OW7A 2P67A 4ZMDA 1QX8A 3P8MC 1HGVA 2KOGA 4WY4D 2Z5HA 1UIIA 1HF9A 3N7NA 1NYHA 3AE3C 3P32A 4JF7A 2NPSA 4L73A 2RKLA 3SSUA 3CC7P 2E75B 2JWDA 1YQ3C 1VDFA 1IO4A 1CI6A 1IFIA 2OTJP 3H1IE 1X9VA 1Y47A 2L91A 5AVZB 3SFEC 1J1EC 1SQBJ 3N4XA 1BCCE 4RESB 1VL2A 2E74D 2YO3A 5EFWB 1VQKP 1SFCD 2ZT9C 4XA4A 1DEEG 1GW3A 5KLVJ 1KQSO 1DX7A 2OYHC 2QG4A 1G1IA 1EZVD 3RK3D 2E76C 4WY4B 3Q2YA 4W7ZA 4ASWA 2ZXEB 1H8AA 3AE1C 1Q81Q 1QVGO 3O8ZA 1OVVA 4L76A 1AV1A 1EZVG 1NTZD 5B66E 3MHVA 3SWFA 2K1AA 3Q1MA 3B5ND 2FFDB 5CCGC 1RF1B 1EZVI 1FZCB 1DIPA 1NTZG 2K9YA 3BRVB 2ZJSE 1MV8A 4N78E 2Q5UA 1JM0A 1U57A 2OYIB 3W67A 2AEJA 1BSNA 1VQ4P 5KAFE 1NTMD 2D2CC 1RF0C 1PGPA 3CXHE 1S2EA 3PLNA 1KC8Q 3L71J 3CCUP 1GK6A 3ABVC 1NTMG 5K5GB 1N73C 1KILC 2OARA 3CD6P 1SFCA 5APXA 2KSJA 2ZVNB 5KKZB 1SQVK 2KNCB 4GODA 2GA1A 2YXQB 3AEAC 1M1JA 4JYBA 2YNYA 2WPVB 2AEFA 1OFCX 4LC1A 1QGKB 3HUSC 3L75E 4IL6E 2CPBA 1NTKJ 4OVNF 1QVFO 5CCHD 1LNQA 1ZMEC 3B5NA 3A7OA 3WMM0 2JJLA 3HTKB 1T3JA 1HGZA 1HJBA 2VRSA 3U59A 4OGQC 2XKMA 1G2CA 2KUBA 3S1KA 3T97B 3AE5C 1LWUB 1BSHA 2HYNA 3TGUE 1KV4A 3AE8C 1R8EA 1HUCA 1URQA 1KZUB 1S5LE 4U3FJ 5AW9B 1VQLP 3D6ZA 2Y9YA 4UB6H 3Q5SA 3L37A 3LIEA 4QMAA 4PJ0E 3E1IA 3CCLP 1FU1A 1PPJD 1DD3A 3CWBD 3HE4A 1K9MQ 4Y99B 1VQ9P 2FYUK 1PZQA 5GTHH 5CBNA 1PPJG 3CWBG 2QEXP 2YKQA 1A02J 3GF7A 1KD1Q 3A0BH 2IBZI 2WT7A 1OW8A 2N1TD 1LT1A 1Z56A 4BRYA 1VQMP 2O01N 3MUDA 2HFED 3BCCD 3KXDA 2QM7A 4IFFA 5KAIH 1XTCC 5KJ7C 3KPEA 5APQA 2K9JB 1J1DC 2JEEA 1LT9A 1M7LA 1AA0A 3BCCG 3GMAA 4ASVA 4H13D 1S9KE 1IK7A 4A7PA 4B86A 2WPQA 3BVHA 4OWFA 1M8OB 3E7KA 3TDKA 1GD2E 5APSA 2POHA 1H89A 2Y9ZA 2KZJA 1FDMA 4H44D 1N7SA 1AFOA 4YTPC 1M1KQ 2HG5D 1SQQK 4PD4H 2A06E 1NTZJ 2I1KA 1VF5D 2YIUC 2MJZA 5C39A 1RF1C 1HH0A 1PGJA 1YTZI 1BDDA 3I5CA 4K3AA 3PH0A 2N1TA 1H0TB 3SWYA 3H1KD 1GU5A 1NH4A 1L0NK 1ZRTD 2OYIC 2M3BA 5B66H 1IFNA 1AVYA 2H88C 3I55P 1NTMJ 2IFNA 1DEBA 1X22A 3H1KG 1VPCA 3NXSA 1EDJA 1LTGC 3R4YA 2PAJA 1NO4A 3OJAB 1X8YA 1SQPE 1YBKA 3TF5A 1FE6A 1SQXG 4I6MC 4C7NB 1NWQA 1RH5B 2R3SA 3AE2C 3EQ2A 2R3CA 2H89C 3WU2H 2QA4P 3EFGA 5BVZA 2C9LY 1L0LD 4I2LC 2IZ1A 5CBOA 5AVQB 1VQNP 3CMEP 2HPCB 2IZ0A 3G6EP 3CCEP 3TNUA 2UWJE 4N6JA 1K73Q 4C46A 1L0LG 1USDA 3L71D 1RQVA 1L4AD 3LW5J 4AUWA 1KB9E 2XU6A 1LP1A 3RBZA 2FBWC 2J59M 5CHXA 1YIJP 3F5HA 2M8RA 2LR2A 1BGYD 3FX0A 4IL6H 5KLVE 2V4HA 1PFIA 3NMDA 3M9QA 1N86A 1LTJB 2R5DA 1S4XA 4UB8E 2Q6QA 1RF0A 1BGYG 3ITKA 3SWKA 5AW8B 3CC2P 3F89A 3H1JE 3KDPB 3E1RA 1BDCA 2YKOA 2NPSD 1WT6A 2CPSA 1N73A 1S3JA 1P84E 1KILA 4MN4C 2M5AA 3PHLA 1N2DC 5GTIH 1NHLA 4YPCA 3UIAA 1YJWP 3AEBC 2Z5IA 1IFPA 3CWBJ 2ZVOB 1Q82Q 2JDIH 4Y99C 1LGHB 1LTAC 3CCMP 1SQBK 3VYIA 2BCCE 1JY2N 3MZWB 3HUSA 3H1ID 1LTIC 1ZW0A 2WMMA 4R4MA 3WUTA 4GDOA 1L2PA 1EXJA 3BCCJ 3GW6A 3LW5H 1IC2A 5AVTB 3V2PA 2O1KA 1YI2P 3H1IG 1T3UA 3JCUE 1JY2O 4GIFA 2Y0DA 5H2FH 2FKWB 1LTSC 1BCCG 5AW0B 3VMXA 1FZGA 3AE6C 3U1AA 3G71P 2O1JA 2ZFCA 1OXZA 2P58A 2L5GB 4H0LB 3KYQA 1CI6B 3C9IA 2HR3A 4PD4I 3AEFC 1YITP 2ZAEB 2Q3EA 2WPSA 1K8AQ 4IFMA 4BWNA 2PFXA 1QL2A 1IFDA 3VMZA 1KMIZ 3HD7D 3L35A 1EDKA 3IAOA 1KYOE 3RL0B 1KQGB 1T2KD 2W6AA 1M57D 2IYPA 2IYOA 3L72E 1K04A 3CXHD 4DCKA 1NJIQ 2E5YA 4EDFA 4PV1B 3AEGC 1NKZB 2QJKB 2QJPB 3H1KJ 4U3FE 1NU1E 2W27A 2PP6A 2A45G 1ZR4A 3GHGA 1S1CX 1BE3E 1SQVE 3CXHI 1SQXJ 1XTGB 2QJYB 1ZOYC 2C9NY 5KJ7A 1GTWA 2PGDA 5KLIB 1GL2D 5AVWB 1QEXA 5M1BA 2N9YB 1NTKK 2KLVA 2G3AA 3L75D 2NZ2A 2W83C 5AW4B 2W8ZA 2YMKA 1FDIA 3GG2A 2M3EA 3AECC 4JYCA 4ZKUA 1YJNP 2QM8A 2E74B 1GW4A 1CSBA 1L0LJ 2WZ7A 3L75G 1SFCB 1FZBA 3HD7A 1IJDB 2R5BA 4YXDC 1URQD 3V4QA 2WVRA 3D70A 3RK3B 3FWLA 2AXCA 3CCVP 1MFTA 5B5EE 2C0XA 1T8ZA 5AVXB 3H1LE 2P7JA 3B71A 3PP5A 3B5NB 2KS1A 2MKVA 1BGYJ 3TGUG 3VP9A 2E5TA 2ITAA 4AQRD 4GOEA 1HWTC 1LTJC 2OYIA 1G2CB 3RBXA 4DZOA 2H7HA 1Q90D 2W6JH 1GL2A 1H88A 1URQB 2I8DA 2FYUE 3VN0A 1YYCA 3H32A 1PGQA 2J58A 3II6A 3L70E 4UB8H 4HB1A 4ZNCA 1ZXGA 4XFJA 2Q7CA 2FYNB 3PTZA 3CC4P 3L74E 3L73E 2ZYAA 4WB4A 5TISH 2KLUA 2QVAA 4Z1MH 1JCCA 3U1CA 2O01H 1E5WA 3CMAP 2GUSA 3H1IJ 4CPGA 1Q7YQ 1RE3C 1M90Q 1BCCJ 1S9KD 1N7SD 1U7MA 2WT7B 2ZYGA 2BEZF 3BRTB 1FOSE 2DW3A 4RO0A 2OTLP 3RK2D 3M91A 1JCDA 2QSIA 3T97A 1FJKA 1SQQE 1NTZK 1IFMA 4JBZA 3KZIE 3CCSP 4H0LC 1JMBA 1LT9B 2A06D 1OW6A 2P1JA 2HODA 2NRGA 2Q3IA 1IZNB 3M0AA 3H1HE 3AE9C 2A06G 1K05A 1OX3A 2E75C 4KJMA 3VP8A 4U7JA 3MTUE 3CCQP 2E42A 1NTMK 1N7SB 4IL6X 1L0NE 1KTMA 3RL0C 3A3YB 1FZEA 2IX7C 4JQ0D 1FZAA 2K37A 2RMZA 4PV1C 1MZ9A 2SPZA 4TLFA 5AW1B 2QJKC 1SVFA 3D71A 2HLOA 2QJPC 1KYOH 2WITA 2ZT9D 1SQPD 1QL1A 4WY4C 3CCRP 2ZYDA 2N1TB 1VQ5P 2E76D 4EIJA 2IBZE 3V4WA 1S5LX 2QJYC 1JTHA 4EYYQ 1SQPG 3QWOC 1GZLA 3L4FA 2FFDC 1PP9E 3L75J 4D6TE 5BU5A 1FZCC 3C8VA 1R5SA 5TJHA 3VTPC 4I1LA 5CMZA 5CCGD 4H13B 1KB9D 1VQOP 2IDBA 2E74C 1SFCC 1FBMA 5DJTB 2CK3H 4H44B 1SQXD 1CW5A 4ZKPA 5E79E 1FJPA 2D2CD 1WMKA 3RK3C 3B8EB 1Y8AA 5AVVB 3TGUJ 3TNUB 2P2UA 1KILD 5KLVG 5KAFH 1VF5B 3CXHH 3H1JD 3CLQA 3HE5A 2H8PD 5KKZC 1MFZA 2A45H 3VMAA 1H0TA 3QH9A 3K5BA 2OYHA 1VQPP 3RGUA 3H1JG 2R44A 2B88A 1KQLA 1OVUA 2JO1A 1OWAA 1LTBC 5APWA 3ZDMA 3S4RA 4W7YA 1SQBE 1X79B 2D2CB 1JY2P 2BCCD 2Y0CA 5CCGA 3USSA 1VQ8P 1MUUA 2XDJA 3CX5E 4OGQD 2AEMA 1N73B 1KILB 1LWUC 2BCCG 2FYNC 2M5AB 1ZRTE 2C0WA 2GM4A 2B9BA 1KFNA 2HPCA 3TYYA 1IFJA 4XE5B 3EWKA 1YQ4C 2XZRA 1KFMA
chains in the Genus database with same CATH topology
4U3FJ 2BCCJ 1NU1J 1NTKJ 1SQBJ 1SQQJ 1EZVI 3CX5I 1BCCJ 3L72J 1NTZJ 1KYOI 1SQPJ 1BE3J 1SQVJ 3L74J 1BGYJ 3L73J 3L71J 3TGUJ 1KB9I 1L0NJ 1P84I 1SQXJ 3CXHI 2FYUJ 3H1JJ 3CWBJ 1NTMJ 2IBZI 3BCCJ 5KLVJ 1PP9J 1L0LJ 3H1LJ 3H1HJ 3L75J 4D6TJ 3L70J 4PD4I 3H1KJ 3H1IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F J;  2BCC J;  1NU1 J;  1NTK J;  1SQB J;  1SQQ J;  1EZV I;  3CX5 I;  1BCC J;  3L72 J;  1NTZ J;  1KYO I;  1SQP J;  1BE3 J;  1SQV J;  3L74 J;  1BGY J;  3L73 J;  3L71 J;  3TGU J;  1KB9 I;  1L0N J;  1P84 I;  1SQX J;  3CXH I;  2FYU J;  3H1J J;  3CWB J;  1NTM J;  2IBZ I;  3BCC J;  5KLV J;  1PP9 J;  1L0L J;  3H1L J;  3H1H J;  3L75 J;  4D6T J;  3L70 J;  4PD4 I;  3H1K J;  3H1I J; 
#chains in the Genus database with same CATH topology
 5CCH C;  3NFQ A;  5APY A;  1L4A B;  5APV A;  3VOP A;  3Q3D A;  1S5L H;  1QLE D;  4W80 A;  1Q86 Q;  1X0T A;  3I56 P;  4WVZ A;  4LGD E;  4LLH A;  2WSF H;  5AW5 B;  2RH0 A;  1LTJ A;  1VQ6 P;  1LT9 C;  1KYO D;  1PL5 A;  1VQ7 P;  2KP8 A;  1HTL C;  1YHQ P;  1TU3 F;  3H6P A;  2XND H;  4RKU J;  3L71 E;  4IFD K;  3HRN A;  3L72 D;  2LXB A;  5AW3 B;  4UB6 E;  1BCC D;  4PJ0 H;  2FYZ A;  4RJT A;  2WPR A;  1U7J A;  1YJ9 P;  3KZI H;  2NPS B;  3V2R A;  3L72 G;  3TK1 A;  1KYO I;  1NU1 D;  1SQX K;  5KJ7 D;  2V7Q J;  2YKP A;  5KTB A;  1BE3 D;  1SQV D;  5GTH E;  2LXC B;  3A0B E;  4U3F G;  1NU1 G;  1JY3 N;  2B87 A;  1NTK E;  3MGN A;  1EXI A;  1WRG A;  3P7K A;  1BE3 G;  1JB0 J;  1SQV G;  1SQP J;  1YTZ T;  3JSV C;  1RE3 A;  5KAI E;  3G9R A;  3AED C;  2YO2 A;  1S72 P;  1L0L K;  2N1T C;  1NAF A;  2B89 A;  1PV3 A;  4N78 D;  4KHX A;  1ZN5 A;  1AVO A;  1JY3 O;  3D6Y A;  3O6Q A;  5AW7 B;  3GHG B;  1J2J B;  3P8C E;  4DT0 A;  4NPE A;  1HBW A;  3MP7 B;  2KXP B;  3V2N A;  1J1D B;  1RQU A;  4H13 C;  1SS1 A;  3PJS K;  2FXM A;  3KQG A;  1LJ2 A;  2R32 A;  3M0D C;  1GK4 A;  3H1L D;  2WSE J;  3IR9 A;  4PD4 E;  3CPW O;  1JMM A;  3TSI A;  4H44 C;  1AQ5 A;  2A45 I;  1IK9 A;  3LID A;  3H1L G;  3HD7 B;  3KHU A;  4KT0 J;  5CJ0 A;  2P10 A;  1EC5 A;  3Q5P A;  3FXD A;  4WBA A;  5AW2 B;  2V7Q H;  1VF5 C;  4Y28 J;  3H1J J;  2O3J A;  3C1L A;  1KN7 A;  5E79 H;  3IF4 A;  2AXT E;  2YIU B;  1EDL A;  3R2P A;  2FYU D;  1G1J A;  2WSC J;  1NGM B;  2O01 J;  3CI9 A;  3H25 A;  2J5U A;  2OTK E;  2KS1 B;  4WY4 A;  3L70 D;  1FZF A;  2LKM A;  2FYU G;  1M1J B;  2G8Y A;  3L74 D;  5AVU B;  3L73 D;  3TGU D;  3L70 G;  2BCC J;  3WU2 E;  4YXW H;  2FFD A;  5AVR B;  1RF1 A;  1GL2 B;  4I7Z B;  4HYT B;  1FZC A;  3L74 G;  3L73 G;  3SFD C;  4EI2 A;  3H32 B;  1EZV E;  3BAT A;  1NOH A;  3RK3 E;  1KB9 H;  1SLQ A;  3S9O A;  1NU1 K;  4K35 A;  1A02 F;  2GUV A;  1RY3 A;  4NPD A;  2WSE H;  2I1J A;  1W2E A;  3RL0 g;  3FXE A;  1LTT C;  1NTZ E;  4GT1 A;  3CX5 H;  1SQQ D;  3L36 A;  2K88 A;  2IPP A;  1L4A C;  4GOF A;  1SQQ G;  3H1H D;  3EFF K;  3A5T A;  1R5L A;  2KNC A;  2Q9I A;  1EQ7 A;  2QIW A;  3NTN A;  1NTM E;  1RE4 C;  3OW2 O;  1P84 H;  2QE7 H;  2WSC H;  3H1H G;  1L0N D;  3HE4 B;  3OA7 A;  2JR8 A;  3V2Q A;  2H43 A;  2KB7 P;  3L72 J;  1D7M A;  3WUU A;  5AVY B;  5L8R J;  1HJ0 A;  4HKZ H;  2KIK A;  1L0N G;  2HOD B;  3HTK A;  2QRX A;  5GTI E;  4BRY B;  3G3Z A;  3V6I A;  3A2A A;  2NPS C;  1DD4 A;  1NU1 J;  2Q1K A;  3GF3 A;  3AE4 C;  3V5B A;  1LWU A;  1BE3 J;  1SQV J;  2YMY A;  1N8R Q;  1ZR2 A;  2IBZ D;  4L75 A;  3JCU H;  3JC2 2;  5AVS B;  1GMJ A;  2KI7 B;  2XNX A;  2IBZ G;  1PP9 D;  2RN0 A;  4D6T D;  5AW6 B;  5H2F E;  2FXP A;  2OQQ A;  5CCH A;  3A0H E;  3VMY A;  1PP9 G;  3W68 A;  4D6T G;  2BAS A;  3GHG C;  3WUV A;  2WQY C;  1USE A;  4IOI H;  1FC2 C;  1FOS F;  1JTH B;  2ZXX A;  3M06 A;  4OH8 B;  3BAS A;  1PIX A;  3RK2 B;  3GLM A;  3CCJ P;  1NAY A;  1ZV8 A;  3H1L J;  4M3L A;  1KQF B;  2WTY A;  5APU A;  1GDT A;  2JP3 A;  1DH3 A;  1ZP0 C;  2K9J A;  3HD7 C;  2YXR B;  1PPJ E;  3CWB E;  5KLI C;  4WWI A;  1OMI A;  2KZI A;  4JPZ B;  5CJ4 A;  2E43 A;  1T2K C;  1N7L A;  2KSE A;  1OZH A;  4O9B A;  1JO5 A;  3MD0 A;  1UIX A;  2OGU A;  1J1E B;  1SQB D;  2FYU J;  4BXL A;  2Z4E A;  2Y0E A;  3BCC E;  3HE5 B;  3L70 J;  3B4S A;  2ZT9 B;  3PRJ A;  3CX5 D;  1SQB G;  5KLV D;  2OYH B;  3Q5R A;  2BEQ D;  1M1J C;  4HJG H;  2KK7 A;  4C7R A;  2E76 B;  3L74 J;  3L73 J;  2IFM A;  1KB9 I;  2AXT H;  4TT3 H;  4N3Y B;  1GL2 C;  4I7Z C;  3B5N C;  1W2B O;  1NVO A;  1LP1 B;  1E79 H;  2WSF J;  3CX5 I;  3G4S P;  2JWA A;  1OVR A;  1P84 D;  2FXO A;  5B5E H;  3M0D A;  5BU8 B;  3AE7 C;  4DOJ A;  2W6B A;  1M56 D;  1JNM A;  1SQQ J;  1W5C E;  1URQ C;  1FS0 E;  1EDI A;  4DJG A;  4HH2 A;  1P84 I;  4C7N A;  1PGO A;  3H1H J;  4GKG A;  2XV5 A;  1Q2N A;  1FDO A;  3H1K E;  1RHZ B;  4L74 A;  2WSS H;  2M0B A;  3L71 G;  1L0N J;  1HVV A;  1SQX E;  2WWW A;  2JKV A;  3CL3 D;  3IN6 A;  3HUS B;  1JY3 P;  1KOR A;  1SQP K;  3M9H A;  1KIL E;  3MIW A;  1NTK D;  1AJY A;  3MUD C;  4AYC A;  1GU4 A;  5DJU B;  1NKN A;  5TIS E;  1L0L E;  2OYO A;  2W90 A;  1MKM A;  4OGQ B;  1NTK G;  2N9B A;  1JOC A;  2K3R A;  3OAK A;  3FWN A;  4H0L D;  3M9B A;  1CZQ A;  3P8C D;  3AEE C;  2FY8 A;  1PP9 J;  1ZLL A;  4D6T J;  2B87 B;  5APT A;  2PRR A;  1FAV A;  2E75 D;  1L4A A;  1N7S C;  4U3F D;  1OIP A;  1AQT A;  4R4L A;  1BGY E;  4NPF X;  3RL0 D;  5KLV K;  3FGA D;  4PD4 D;  4EOT A;  1JUN A;  2KYV A;  1SP4 A;  1T6A A;  1Y9B A;  3O6Q B;  1JEK A;  1RE4 A;  3RK2 C;  3IFM A;  4PV1 D;  3A0H H;  1OW7 A;  2P67 A;  4ZMD A;  1QX8 A;  3P8M C;  1HGV A;  2KOG A;  4WY4 D;  2Z5H A;  1UII A;  1HF9 A;  3N7N A;  1NYH A;  3AE3 C;  3P32 A;  4JF7 A;  2NPS A;  4L73 A;  2RKL A;  3SSU A;  3CC7 P;  2E75 B;  2JWD A;  1YQ3 C;  1VDF A;  1IO4 A;  1CI6 A;  1IFI A;  2OTJ P;  3H1I E;  1X9V A;  1Y47 A;  2L91 A;  5AVZ B;  3SFE C;  1J1E C;  1SQB J;  3N4X A;  1BCC E;  4RES B;  1VL2 A;  2E74 D;  2YO3 A;  5EFW B;  1VQK P;  1SFC D;  2ZT9 C;  4XA4 A;  1DEE G;  1GW3 A;  5KLV J;  1KQS O;  1DX7 A;  2OYH C;  2QG4 A;  1G1I A;  1EZV D;  3RK3 D;  2E76 C;  4WY4 B;  3Q2Y A;  4W7Z A;  4ASW A;  2ZXE B;  1H8A A;  3AE1 C;  1Q81 Q;  1QVG O;  3O8Z A;  1OVV A;  4L76 A;  1AV1 A;  1EZV G;  1NTZ D;  5B66 E;  3MHV A;  3SWF A;  2K1A A;  3Q1M A;  3B5N D;  2FFD B;  5CCG C;  1RF1 B;  1EZV I;  1FZC B;  1DIP A;  1NTZ G;  2K9Y A;  3BRV B;  2ZJS E;  1MV8 A;  4N78 E;  2Q5U A;  1JM0 A;  1U57 A;  2OYI B;  3W67 A;  2AEJ A;  1BSN A;  1VQ4 P;  5KAF E;  1NTM D;  2D2C C;  1RF0 C;  1PGP A;  3CXH E;  1S2E A;  3PLN A;  1KC8 Q;  3L71 J;  3CCU P;  1GK6 A;  3ABV C;  1NTM G;  5K5G B;  1N73 C;  1KIL C;  2OAR A;  3CD6 P;  1SFC A;  5APX A;  2KSJ A;  2ZVN B;  5KKZ B;  1SQV K;  2KNC B;  4GOD A;  2GA1 A;  2YXQ B;  3AEA C;  1M1J A;  4JYB A;  2YNY A;  2WPV B;  2AEF A;  1OFC X;  4LC1 A;  1QGK B;  3HUS C;  3L75 E;  4IL6 E;  2CPB A;  1NTK J;  4OVN F;  1QVF O;  5CCH D;  1LNQ A;  1ZME C;  3B5N A;  3A7O A;  3WMM 0;  2JJL A;  3HTK B;  1T3J A;  1HGZ A;  1HJB A;  2VRS A;  3U59 A;  4OGQ C;  2XKM A;  1G2C A;  2KUB A;  3S1K A;  3T97 B;  3AE5 C;  1LWU B;  1BSH A;  2HYN A;  3TGU E;  1KV4 A;  3AE8 C;  1R8E A;  1HUC A;  1URQ A;  1KZU B;  1S5L E;  4U3F J;  5AW9 B;  1VQL P;  3D6Z A;  2Y9Y A;  4UB6 H;  3Q5S A;  3L37 A;  3LIE A;  4QMA A;  4PJ0 E;  3E1I A;  3CCL P;  1FU1 A;  1PPJ D;  1DD3 A;  3CWB D;  3HE4 A;  1K9M Q;  4Y99 B;  1VQ9 P;  2FYU K;  1PZQ A;  5GTH H;  5CBN A;  1PPJ G;  3CWB G;  2QEX P;  2YKQ A;  1A02 J;  3GF7 A;  1KD1 Q;  3A0B H;  2IBZ I;  2WT7 A;  1OW8 A;  2N1T D;  1LT1 A;  1Z56 A;  4BRY A;  1VQM P;  2O01 N;  3MUD A;  2HFE D;  3BCC D;  3KXD A;  2QM7 A;  4IFF A;  5KAI H;  1XTC C;  5KJ7 C;  3KPE A;  5APQ A;  2K9J B;  1J1D C;  2JEE A;  1LT9 A;  1M7L A;  1AA0 A;  3BCC G;  3GMA A;  4ASV A;  4H13 D;  1S9K E;  1IK7 A;  4A7P A;  4B86 A;  2WPQ A;  3BVH A;  4OWF A;  1M8O B;  3E7K A;  3TDK A;  1GD2 E;  5APS A;  2POH A;  1H89 A;  2Y9Z A;  2KZJ A;  1FDM A;  4H44 D;  1N7S A;  1AFO A;  4YTP C;  1M1K Q;  2HG5 D;  1SQQ K;  4PD4 H;  2A06 E;  1NTZ J;  2I1K A;  1VF5 D;  2YIU C;  2MJZ A;  5C39 A;  1RF1 C;  1HH0 A;  1PGJ A;  1YTZ I;  1BDD A;  3I5C A;  4K3A A;  3PH0 A;  2N1T A;  1H0T B;  3SWY A;  3H1K D;  1GU5 A;  1NH4 A;  1L0N K;  1ZRT D;  2OYI C;  2M3B A;  5B66 H;  1IFN A;  1AVY A;  2H88 C;  3I55 P;  1NTM J;  2IFN A;  1DEB A;  1X22 A;  3H1K G;  1VPC A;  3NXS A;  1EDJ A;  1LTG C;  3R4Y A;  2PAJ A;  1NO4 A;  3OJA B;  1X8Y A;  1SQP E;  1YBK A;  3TF5 A;  1FE6 A;  1SQX G;  4I6M C;  4C7N B;  1NWQ A;  1RH5 B;  2R3S A;  3AE2 C;  3EQ2 A;  2R3C A;  2H89 C;  3WU2 H;  2QA4 P;  3EFG A;  5BVZ A;  2C9L Y;  1L0L D;  4I2L C;  2IZ1 A;  5CBO A;  5AVQ B;  1VQN P;  3CME P;  2HPC B;  2IZ0 A;  3G6E P;  3CCE P;  3TNU A;  2UWJ E;  4N6J A;  1K73 Q;  4C46 A;  1L0L G;  1USD A;  3L71 D;  1RQV A;  1L4A D;  3LW5 J;  4AUW A;  1KB9 E;  2XU6 A;  1LP1 A;  3RBZ A;  2FBW C;  2J59 M;  5CHX A;  1YIJ P;  3F5H A;  2M8R A;  2LR2 A;  1BGY D;  3FX0 A;  4IL6 H;  5KLV E;  2V4H A;  1PFI A;  3NMD A;  3M9Q A;  1N86 A;  1LTJ B;  2R5D A;  1S4X A;  4UB8 E;  2Q6Q A;  1RF0 A;  1BGY G;  3ITK A;  3SWK A;  5AW8 B;  3CC2 P;  3F89 A;  3H1J E;  3KDP B;  3E1R A;  1BDC A;  2YKO A;  2NPS D;  1WT6 A;  2CPS A;  1N73 A;  1S3J A;  1P84 E;  1KIL A;  4MN4 C;  2M5A A;  3PHL A;  1N2D C;  5GTI H;  1NHL A;  4YPC A;  3UIA A;  1YJW P;  3AEB C;  2Z5I A;  1IFP A;  3CWB J;  2ZVO B;  1Q82 Q;  2JDI H;  4Y99 C;  1LGH B;  1LTA C;  3CCM P;  1SQB K;  3VYI A;  2BCC E;  1JY2 N;  3MZW B;  3HUS A;  3H1I D;  1LTI C;  1ZW0 A;  2WMM A;  4R4M A;  3WUT A;  4GDO A;  1L2P A;  1EXJ A;  3BCC J;  3GW6 A;  3LW5 H;  1IC2 A;  5AVT B;  3V2P A;  2O1K A;  1YI2 P;  3H1I G;  1T3U A;  3JCU E;  1JY2 O;  4GIF A;  2Y0D A;  5H2F H;  2FKW B;  1LTS C;  1BCC G;  5AW0 B;  3VMX A;  1FZG A;  3AE6 C;  3U1A A;  3G71 P;  2O1J A;  2ZFC A;  1OXZ A;  2P58 A;  2L5G B;  4H0L B;  3KYQ A;  1CI6 B;  3C9I A;  2HR3 A;  4PD4 I;  3AEF C;  1YIT P;  2ZAE B;  2Q3E A;  2WPS A;  1K8A Q;  4IFM A;  4BWN A;  2PFX A;  1QL2 A;  1IFD A;  3VMZ A;  1KMI Z;  3HD7 D;  3L35 A;  1EDK A;  3IAO A;  1KYO E;  3RL0 B;  1KQG B;  1T2K D;  2W6A A;  1M57 D;  2IYP A;  2IYO A;  3L72 E;  1K04 A;  3CXH D;  4DCK A;  1NJI Q;  2E5Y A;  4EDF A;  4PV1 B;  3AEG C;  1NKZ B;  2QJK B;  2QJP B;  3H1K J;  4U3F E;  1NU1 E;  2W27 A;  2PP6 A;  2A45 G;  1ZR4 A;  3GHG A;  1S1C X;  1BE3 E;  1SQV E;  3CXH I;  1SQX J;  1XTG B;  2QJY B;  1ZOY C;  2C9N Y;  5KJ7 A;  1GTW A;  2PGD A;  5KLI B;  1GL2 D;  5AVW B;  1QEX A;  5M1B A;  2N9Y B;  1NTK K;  2KLV A;  2G3A A;  3L75 D;  2NZ2 A;  2W83 C;  5AW4 B;  2W8Z A;  2YMK A;  1FDI A;  3GG2 A;  2M3E A;  3AEC C;  4JYC A;  4ZKU A;  1YJN P;  2QM8 A;  2E74 B;  1GW4 A;  1CSB A;  1L0L J;  2WZ7 A;  3L75 G;  1SFC B;  1FZB A;  3HD7 A;  1IJD B;  2R5B A;  4YXD C;  1URQ D;  3V4Q A;  2WVR A;  3D70 A;  3RK3 B;  3FWL A;  2AXC A;  3CCV P;  1MFT A;  5B5E E;  2C0X A;  1T8Z A;  5AVX B;  3H1L E;  2P7J A;  3B71 A;  3PP5 A;  3B5N B;  2KS1 A;  2MKV A;  1BGY J;  3TGU G;  3VP9 A;  2E5T A;  2ITA A;  4AQR D;  4GOE A;  1HWT C;  1LTJ C;  2OYI A;  1G2C B;  3RBX A;  4DZO A;  2H7H A;  1Q90 D;  2W6J H;  1GL2 A;  1H88 A;  1URQ B;  2I8D A;  2FYU E;  3VN0 A;  1YYC A;  3H32 A;  1PGQ A;  2J58 A;  3II6 A;  3L70 E;  4UB8 H;  4HB1 A;  4ZNC A;  1ZXG A;  4XFJ A;  2Q7C A;  2FYN B;  3PTZ A;  3CC4 P;  3L74 E;  3L73 E;  2ZYA A;  4WB4 A;  5TIS H;  2KLU A;  2QVA A;  4Z1M H;  1JCC A;  3U1C A;  2O01 H;  1E5W A;  3CMA P;  2GUS A;  3H1I J;  4CPG A;  1Q7Y Q;  1RE3 C;  1M90 Q;  1BCC J;  1S9K D;  1N7S D;  1U7M A;  2WT7 B;  2ZYG A;  2BEZ F;  3BRT B;  1FOS E;  2DW3 A;  4RO0 A;  2OTL P;  3RK2 D;  3M91 A;  1JCD A;  2QSI A;  3T97 A;  1FJK A;  1SQQ E;  1NTZ K;  1IFM A;  4JBZ A;  3KZI E;  3CCS P;  4H0L C;  1JMB A;  1LT9 B;  2A06 D;  1OW6 A;  2P1J A;  2HOD A;  2NRG A;  2Q3I A;  1IZN B;  3M0A A;  3H1H E;  3AE9 C;  2A06 G;  1K05 A;  1OX3 A;  2E75 C;  4KJM A;  3VP8 A;  4U7J A;  3MTU E;  3CCQ P;  2E42 A;  1NTM K;  1N7S B;  4IL6 X;  1L0N E;  1KTM A;  3RL0 C;  3A3Y B;  1FZE A;  2IX7 C;  4JQ0 D;  1FZA A;  2K37 A;  2RMZ A;  4PV1 C;  1MZ9 A;  2SPZ A;  4TLF A;  5AW1 B;  2QJK C;  1SVF A;  3D71 A;  2HLO A;  2QJP C;  1KYO H;  2WIT A;  2ZT9 D;  1SQP D;  1QL1 A;  4WY4 C;  3CCR P;  2ZYD A;  2N1T B;  1VQ5 P;  2E76 D;  4EIJ A;  2IBZ E;  3V4W A;  1S5L X;  2QJY C;  1JTH A;  4EYY Q;  1SQP G;  3QWO C;  1GZL A;  3L4F A;  2FFD C;  1PP9 E;  3L75 J;  4D6T E;  5BU5 A;  1FZC C;  3C8V A;  1R5S A;  5TJH A;  3VTP C;  4I1L A;  5CMZ A;  5CCG D;  4H13 B;  1KB9 D;  1VQO P;  2IDB A;  2E74 C;  1SFC C;  1FBM A;  5DJT B;  2CK3 H;  4H44 B;  1SQX D;  1CW5 A;  4ZKP A;  5E79 E;  1FJP A;  2D2C D;  1WMK A;  3RK3 C;  3B8E B;  1Y8A A;  5AVV B;  3TGU J;  3TNU B;  2P2U A;  1KIL D;  5KLV G;  5KAF H;  1VF5 B;  3CXH H;  3H1J D;  3CLQ A;  3HE5 A;  2H8P D;  5KKZ C;  1MFZ A;  2A45 H;  3VMA A;  1H0T A;  3QH9 A;  3K5B A;  2OYH A;  1VQP P;  3RGU A;  3H1J G;  2R44 A;  2B88 A;  1KQL A;  1OVU A;  2JO1 A;  1OWA A;  1LTB C;  5APW A;  3ZDM A;  3S4R A;  4W7Y A;  1SQB E;  1X79 B;  2D2C B;  1JY2 P;  2BCC D;  2Y0C A;  5CCG A;  3USS A;  1VQ8 P;  1MUU A;  2XDJ A;  3CX5 E;  4OGQ D;  2AEM A;  1N73 B;  1KIL B;  1LWU C;  2BCC G;  2FYN C;  2M5A B;  1ZRT E;  2C0W A;  2GM4 A;  2B9B A;  1KFN A;  2HPC A;  3TYY A;  1IFJ A;  4XE5 B;  3EWK A;  1YQ4 C;  2XZR A;  1KFM A; 
#chains in the Genus database with same CATH homology
 4U3F J;  2BCC J;  1NU1 J;  1NTK J;  1SQB J;  1SQQ J;  1EZV I;  3CX5 I;  1BCC J;  3L72 J;  1NTZ J;  1KYO I;  1SQP J;  1BE3 J;  1SQV J;  3L74 J;  1BGY J;  3L73 J;  3L71 J;  3TGU J;  1KB9 I;  1L0N J;  1P84 I;  1SQX J;  3CXH I;  2FYU J;  3H1J J;  3CWB J;  1NTM J;  2IBZ I;  3BCC J;  5KLV J;  1PP9 J;  1L0L J;  3H1L J;  3H1H J;  3L75 J;  4D6T J;  3L70 J;  4PD4 I;  3H1K J;  3H1I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...