1JY2P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 13
structure length 44
sequence length 44
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2P00
1JY3O 3GHGB 2HLOA 3H32A 2HPCB 3HUSA 1LWUC 2HODA 1M1JA 1FZGA 1N73B 1LTJC 1RF1A 2A45G 1FZAA 1JY2N 2OYHB 1FZCA 2FFDC 2OYIC 1RF0A 3GHGA 2HPCA 1LT9C 1LWUB 2H43A 1FZBA 1JY2O 1JY3P 1W2EA 1N73A 1T3UA 1RE3A 1N86A 2XNXA 1M1JC 1LTJB 1RE4A 3E1IA 3HUSC 2Q9IA 2OYHA 1RF1C 2FFDA 2OYIB 2FFDB 1FZCC 1LT9B 1LWUA 1RF0C 2Z4EA 3BVHA 3GHGC 1JY2P 3HUSB 2A45H 2HODB 1LTJA 3H32B 1M1JB 1FZFA 1FZEA 1JY3N 1RE3C 2A45I 2OYIA 1RF1B 1N73C 2OYHC 1RE4C 1LT9A 1FZCB
chains in the Genus database with same CATH superfamily
1FDMA 5GTIH 1YHQP 1P84I 4W7YA 2R5BA 1K05A 3L75J 1AFOA 2IYPA 1URQB 3BCCJ 4TT3H 1FS0E 1RQVA 3MP7B 4L73A 4BRYB 2A06E 2OYIA 3WUUA 3PLNA 4DZOA 1YI2P 1SQXE 4JF7A 1NKZB 3VOPA 2RMZA 1EC5A 1RF0C 1OXZA 1QVGO 2IZ0A 1NTMD 1SQVG 3NMDA 1S5LX 2KNCA 1NTZE 3H1LJ 2J58A 1FDIA 1LT9C 4H0LC 4H44D 2E76D 3Q5RA 1LGHB 1NTKG 3QH9A 3KQGA 1Q90D 2B88A 1PGQA 4NPDA 2JP3A 2K1AA 2P1JA 1T2KD 1VQKP 4O9BA 1JOCA 1KYOH 3M0AA 4M3LA 2BCCJ 1WMKA 1N7SA 1YJNP 3CL3D 2R5DA 3UIAA 2M5AA 2BEZF 3H1HE 3C1LA 1DD4A 1QL2A 2HPCB 3FWLA 4UB8H 1NTKK 1KD1Q 2YNYA 1VQ8P 4WVZA 3SWKA 2FYZA 3VP8A 1FZEA 1LTIC 1FAVA 5KLVK 3A0BH 1LTBC 1GK4A 4GDOA 1ZR4A 5KJ7A 3RL0g 1VQLP 4RJTA 1L0NG 5APWA 4WBAA 4RO0A 2M8RA 1S72P 2HODA 5DJTB 3M9BA 1KORA 2KS1A 2B89A 1SQQE 3JSVC 3TGUD 4XFJA 5GTHE 2PRRA 2N9YB 1QLED 2WPSA 4R4MA 1RE4C 3B5NC 2V4HA 3D70A 1H88A 1DH3A 1JMMA 2OGUA 2LXBA 1JY2N 2YXRB 4IFFA 1RF0A 1LNQA 3EWKA 1ZMEC 1MKMA 3IR9A 2YIUB 1NTKJ 1L0NK 1PP9J 3G4SP 4GODA 3I55P 3WU2H 3CCRP 3FXEA 3MD0A 3P8CD 1NAFA 1Q82Q 5AVXB 3L73D 4EYYQ 1EDIA 3KHUA 5KLVJ 1GU5A 2Q3IA 3CXHH 2FFDB 1LP1A 2QJYB 2NPSA 3RK2B 1H89A 1GL2C 2QJPB 3HUSB 1KQFB 1VDFA 4PV1C 1HTLC 2E74D 1KB9D 4EDFA 1N73A 1RE3A 1SFCA 4Z1MH 2AEMA 2Q1KA 2OARA 2BEQD 3Q5PA 1NJIQ 4D6TJ 1USEA 1BCCG 1L4AD 3L75E 1ZP0C 2IPPA 2YIUC 1K8AQ 3BCCE 1KILC 2Q7CA 2E5TA 2FBWC 2ZAEB 1VPCA 1BDDA 2B87A 4DOJA 1L0NJ 3GMAA 1E5WA 1S9KD 1SQVD 2QA4P 5CCGC 2N1TC 3HTKA 1J2JB 3L74G 2QJYC 3CX5H 3CCVP 3HUSC 3D6ZA 1UIXA 3N4XA 2I1KA 3AE4C 3F89A 2JKVA 1CI6A 1RF1B 5AVTB 3VMYA 2FYUG 1M8OB 1BE3G 3U1AA 3H1LE 3WUVA 2OYHB 3BATA 1PPJD 3L71J 1JY2O 1KFNA 1NU1G 3H1KJ 4K3AA 1KYOD 1YQ4C 1SS1A 3B71A 3KXDA 5AW1B 2BCCE 3W67A 1NWQA 1JNMA 3AE3C 1Q86Q 1OVRA 4EIJA 4N78E 2OYIB 1CSBA 2I1JA 1GU4A 4PJ0H 3GF7A 3L72G 5CJ0A 2W6BA 4UB6E 2R3CA 1LTSC 2IBZE 1Q81Q 1FOSE 3RK3D 3AE9C 2JEEA 1VQ4P 3KZIE 1FE6A 5AVZB 1NU1K 4IFDK 1GL2A 1H0TA 2KOGA 5TISH 1TU3F 2R3SA 2POHA 3H32B 1ZOYC 2JR8A 3RGUA 4ASVA 1L0ND 1IK7A 1HJBA 4I1LA 1BCCJ 4GOEA 1IK9A 3LW5H 1EQ7A 1URQD 1SVFA 4JPZB 3V4QA 3S4RA 5GTIE 2H88C 4ASWA 1OW6A 2O01H 2AXTH 4ZKUA 1N7SB 3L36A 1KILA 5AVRB 3RL0B 2GM4A 2OYIC 1K04A 2M5AB 4DT0A 3L74J 2P10A 3BCCG 4Y99B 3EFGA 1MV8A 3AEAC 5CCGA 1YJWP 2N1TA 3PP5A 1KFMA 5KAIH 4JBZA 2ZVNB 4WY4C 1PL5A 2FYUJ 3O6QB 3SFEC 1BE3J 2H8PD 1LTJC 4KT0J 1VQPP 3VTPC 1FC2C 5APTA 4OGQB 3M0DC 1NTKE 3AE8C 4JQ0D 1NU1J 1KZUB 1IFIA 5AW8B 3G6EP 2WSCH 1IJDB 3H1LG 1KYOE 4IOIH 2WSEH 2E5YA 3I5CA 3LIDA 4IL6H 3R4YA 1WRGA 3RBXA 2YKQA 2HODB 3L72J 4YPCA 2P7JA 2KS1B 5AVUB 3H1HD 1BCCD 2YO2A 4Y99C 2WZ7A 1BGYJ 2IDBA 3CCUP 3TK1A 3K5BA 4UB8E 2K9JA 4D6TE 1GK6A 2GUVA 1L0LK 4OGQC 3A0HH 3L4FA 3NFQA 1X22A 1HWTC 1W2BO 2E75D 2IBZG 4RESB 2Z5IA 1X8YA 1SQPG 3A0BE 2XU6A 2W90A 5AW5B 1NHLA 3P8MC 4I2LC 4H0LB 1L0NE 3NXSA 3TNUA 2IBZI 3HRNA 5KJ7C 1JY3N 1JO5A 3CX5D 2OTKE 5CBOA 1VQ5P 2FYUD 4HYTB 5KAFH 1BE3D 2O01J 2QM8A 1JM0A 1RH5B 4YTPC 2NPSB 2Q9IA 1QX8A 2Y9YA 1SQQD 2Z4EA 1KB9I 3S1KA 3AE5C 2QJKC 3WMM0 3AEEC 3CCMP 2ZT9B 4ZNCA 2XZRA 2XKMA 1N73B 1GMJA 5APXA 1SQPK 1SFCB 3AE6C 2E42A 1ZLLA 3H1KE 2QVAA 4WY4A 2IZ1A 3GLMA 5E79H 1LTJA 4YXWH 3L72D 1NH4A 1CZQA 3M0DA 3WU2E 3E1RA 3M91A 1FZGA 1YYCA 2W8ZA 3G9RA 3RK2D 2B87B 3Q1MA 3TSIA 1L2PA 5BU5A 5CHXA 2WSCJ 1PP9G 3B8EB 3AE2C 2V7QH 3CXHE 1JEKA 2WSEJ 3HTKB 4EI2A 1DEEG 2NPSC 5KLVG 2KI7B 2AEFA 1FZBA 5AW2B 2G8YA 2FXPA 1CI6B 3Q3DA 2ZT9C 1QEXA 1IFNA 1FZFA 1N73C 1RE3C 1BCCE 1SFCC 4K35A 2QSIA 1KYOI 1AA0A 3B5NB 3SWFA 3L75D 1SQPJ 2O3JA 3N7NA 3OAKA 1FZCC 3KDPB 3BCCD 3H1JJ 4D6TG 1JY3O 2ZFCA 1QGKB 3V2NA 2JWDA 3L74E 4U3FG 1N8RQ 3VMXA 3AE7C 2P58A 1MUUA 5AVQB 1AJYA 3CX5E 3JC22 1JY2P 2KXPB 2FYUE 2R32A 1BE3E 1OFCX 1GL2B 1H0TB 1DIPA 3L70G 1BSHA 1AVOA 1NU1E 4PV1B 1LTTC 3H1LD 1VQOP 2D2CB 2Z5HA 3L35A 1EZVG 1JB0J 3M06A 3PJSK 3GW6A 1E79H 3IFMA 4TLFA 1KILE 5EFWB 4AYCA 2BCCD 1VF5B 3L71G 4GOFA 5L8RJ 3H1KG 2FY8A 2W6AA 3D71A 4N78D 3QWOC 3L72E 2WT7A 2A45H 1KILB 1USDA 4PJ0E 4B86A 2Y9ZA 3HD7A 2A45G 1BGYE 2V7QJ 3MUDC 1KTMA 1IZNB 2IBZD 4DJGA 3L37A 1S5LH 2N1TB 3GG2A 5TISE 1PGJA 2C9LY 2WPRA 2HFED 3GF3A 1IO4A 1T6AA 5H2FH 2O1JA 2D2CC 5CCHD 4QMAA 3OW2O 1M1JC 1N7SD 1LWUA 4XE5B 4PD4H 3RL0D 2YKOA 1VF5C 1DX7A 1RY3A 1KN7A 3H1IG 1SQXK 2AXTE 4KJMA 4H13B 1ZW0A 3CWBJ 2WPQA 1FZCA 3CPWO 2KK7A 1FBMA 4OH8B 4U3FJ 2PFXA 4DCKA 3MHVA 1FJKA 2IX7C 1EXJA 2GA1A 2O1KA 1NTZK 5C39A 5KAIE 3CLQA 1RHZB 2K9JB 1RQUA 1R5SA 3L70J 2P2UA 3LIEA 2JWAA 2PGDA 1JTHA 1PIXA 3AEDC 3CD6P 1NTKD 1PP9D 2PP6A 4NPFX 1M57D 2Q6QA 5APVA 1SQBG 3G3ZA 3IAOA 5B66H 1D7MA 2QE7H 5DJUB 1WT6A 1GZLA 5KLVD 2E76C 2MKVA 3CX5I 2KP8A 3TNUB 5APYA 5AW9B 1LT1A 1CW5A 2XNDH 2RKLA 4IL6E 4H13C 1EDKA 2J5UA 3M9HA 3AEBC 2NRGA 3VP9A 1SQXJ 4WWIA 4GIFA 2B9BA 3A3YB 3BRTB 1SQBK 3MUDA 2ZYGA 4D6TD 2Q3EA 1YJ9P 1YTZT 1IC2A 1LTAC 1NVOA 1SQPE 4WY4B 3A0HE 1NAYA 1W5CE 1BGYG 1S1CX 4H0LD 5KKZC 1Y8AA 5APSA 1K73Q 1LTJB 1HGVA 3H1JE 2KIKA 1NTMG 2KNCB 2KLUA 2NPSD 3H1IJ 3V2QA 1M1JA 3T97A 1ZXGA 2Y0EA 3SFDC 5KAFE 5BU8B 1FU1A 2K88A 2ZT9D 1MFTA 2J59M 1M56D 1FOSF 1EZVD 1KQSO 3HE5A 1FZAA 5AW4B 1G1IA 4JYBA 3L71D 1DD3A 5AVYB 3AEGC 3SWYA 3H1KD 1LTGC 1NTMK 2Q5UA 3ITKA 3CC2P 5B5EH 3C9IA 1AQTA 3EQ2A 4L75A 3CCSP 3CCLP 3VYIA 1GD2E 2K9YA 5TJHA 5E79E 1SQBJ 1SLQA 3F5HA 3GHGA 1VQ7P 1G1JA 3KYQA 1PP9E 4BXLA 2QIWA 2ZYDA 2FFDA 1N2DC 3G71P 1OX3A 1Z56A 3CXHD 5KLVE 3BASA 1L0LG 1JCDA 5APQA 3USSA 1FDOA 5AW3B 3FXDA 1N86A 1N7LA 4HJGH 2ZJSE 4NPEA 2YMYA 1SP4A 3V6IA 1OVVA 4W7ZA 3II6A 5AW0B 3B5ND 2HLOA 3H1ID 2QJKB 2LKMA 1JY3P 2LXCB 2QRXA 1NGMB 2ZXXA 2QM7A 3MIWA 1NTMJ 1U57A 2K37A 3CWBE 2UWJE 4I7ZB 1GTWA 4U3FE 2WT7B 2WWWA 5APUA 4LLHA 1GW3A 1BSNA 3L74D 4WB4A 2IFMA 3VN0A 1GL2D 1AQ5A 1EDLA 3H1JG 3HD7B 2KZIA 2DW3A 4ZMDA 4PV1D 1IFMA 1T8ZA 1OZHA 1KQLA 1P84H 3L70E 3P32A 3R2PA 3RK3B 3TYYA 1LP1B 5KTBA 4AQRD 1KB9H 4AUWA 4I6MC 1NU1D 1EZVE 1HGZA 2P67A 3IN6A 1J1EC 1KMIZ 4R4LA 2CPSA 1VF5D 1HBWA 4GKGA 3L71E 2BASA 1YIJP 1OVUA 4GT1A 2JJLA 1GDTA 1LWUB 3V2PA 1VQ9P 1KILD 1Q2NA 4BWNA 4I7ZC 5K5GB 3I56P 1FZCB 5AVWB 3PRJA 5AW7B 4CPGA 5CCGD 2N1TD 1UIIA 4Y28J 1L0LJ 2OTJP 4LC1A 1BGYD 1MFZA 3HD7C 1X9VA 1S5LE 1VQMP 1HUCA 3H32A 3RK3C 4N6JA 2Y0DA 3CC7P 1JTHB 2ZVOB 3TGUJ 5H2FE 1PGPA 2FXOA 5M1BA 3A7OA 1KC8Q 3HE4A 5CCHA 4H13D 4ZKPA 1G2CA 1YITP 2HR3A 3H1IE 4C7NA 2FYNB 1BDCA 1PGOA 2CPBA 1LWUC 1PPJG 4PD4E 1URQC 2AEJA 4HKZH 3JCUH 1HH0A 4U7JA 1SQVK 1L4AA 1AV1A 1IFDA 3A2AA 1ZN5A 3L73J 1VQ6P 2K3RA 3AECC 5CJ4A 1VQNP 2KSJA 3CWBG 3KPEA 3MZWB 3O6QA 3CCJP 3E1IA 2JO1A 1OW8A 2WSFH 2JDIH 4W80A 1SQBE 3CCEP 1OWAA 1NYHA 3Q2YA 1K9MQ 1L0LD 2E75B 1MZ9A 1HVVA 3AEFC 5B66E 4C7RA 2C0WA 4JYCA 4HH2A 2FYNC 2Y0CA 3CMAP 4IFMA 1M1JB 3T97B 1PV3A 2KB7P 2MJZA 3NTNA 2L91A 1KV4A 2PAJA 1EZVI 1AVYA 3HE5B 5AVSB 2A06G 4WY4D 1SQVJ 4MN4C 1JMBA 2W27A 2M3BA 2WMMA 2OTLP 1SQXG 4C46A 2WITA 3MGNA 4A7PA 1SQPD 1A02J 4RKUJ 1NTME 5AVVB 1U7JA 2WQYC 3S9OA 2A45I 1LT9A 3H1JD 3U59A 3GHGB 3FWNA 2FXMA 2E75C 3PH0A 1YTZI 3FX0A 1NTZG 2H89C 3A5TA 2L5GB 1OIPA 1HF9A 1M1KQ 1P84D 3CXHI 4H44B 2E76B 2R44A 2WSSH 1URQA 2QG4A 2LR2A 1KQGB 1ZRTD 4BRYA 1R8EA 2ZXEB 2OYOA 1W2EA 2YO3A 3P7KA 2ITAA 1XTCC 2SPZA 1S4XA 3VMAA 4OVNF 1JUNA 5CBNA 3H1HG 2XDJA 4PD4I 2WVRA 4OGQD 5B5EE 3CCQP 1H8AA 2WSFJ 1DEBA 1JCCA 2KYVA 2M3EA 1HJ0A 3TDKA 2YMKA 3GHGC 2W83C 5KKZB 2E43A 3OJAB 5KJ7D 3V4WA 2KSEA 3RBZA 3EFFK 1L0LE 2XV5A 1R5LA 5CMZA 2FFDC 4YXDC 3B4SA 3RK2C 2H43A 4H44C 2QJPC 3CMEP 1NKNA 3M9QA 2ZYAA 3BVHA 2VRSA 4XA4A 1LJ2A 1T2KC 1T3UA 1YBKA 3CI9A 3V2RA 4IL6X 3TGUE 2WPVB 5GTHH 3OA7A 1Y9BA 2HPCA 2YKPA 1NOHA 1RE4A 1SQQG 3B5NA 3TF5A 3W68A 3H25A 2IFNA 2OQQA 2CK3H 4HB1A 3SSUA 3PTZA 4KHXA 3FGAD 3CWBD 2GUSA 1NTZJ 2I8DA 1M90Q 4U3FD 3HD7D 3VMZA 3P8CE 2C9NY 1U7MA 2FYUK 3L73E 1S3JA 1EXIA 1S2EA 2W6JH 1SQQK 1P84E 3L70D 2XNXA 1RF1C 2IYOA 1ZRTE 4OWFA 5KLIB 1KB9E 2OYHC 1SFCD 3H1HJ 3H6PA 3O8ZA 2NZ2A 1ZV8A 2KLVA 3HE4B 2E74B 1M7LA 1G2CB 5BVZA 4C7NB 2RH0A 1FJPA 2A06D 1J1DB 3PHLA 3L75G 3ZDMA 1L4AB 1SQXD 1QL1A 3U1CA 1NO4A 1S9KE 1SQVE 1T3JA 2FKWB 1Y47A 1X0TA 2N9BA 3HUSA 3CC4P 2HYNA 1IFPA 3AE1C 2RN0A 2H7HA 1NTZD 4L74A 5KLIC 1SQQJ 2QEXP 2M0BA 1ZR2A 1OMIA 2G3AA 3Q5SA 3WUTA 1PPJE 1IFJA 1YQ3C 1J1EB 2E74C 2YXQB 5CCHC 3TGUG 4PD4D 3ABVC 1N7SC 3JCUE 3RL0C 3D6YA 5AW6B 1J1DC 3V5BA 4LGDE 2KZJA 2BCCG 1PZQA 1A02F 1L4AC 3BRVB 3C8VA 2AXCA 1X79B 4L76A 2O01N 4UB6H 1XTGB 3E7KA 3RK3E 1PFIA 3KZIH 2HG5D 3L73G 2KUBA 1GW4A 4EOTA 1RF1A 1SQBD 3MTUE 1VL2A 2D2CD 3IF4A 1QVFO 2OYHA 3LW5J 2WTYA 1LT9B 1EDJA 1Q7YQ 1OW7A 4N3YB 2C0XA
chains in the Genus database with same CATH topology
2O1KA 1FDMA 1NTZK 3L36A 1KILA 1OWAA 3CLQA 5AVRB 3RL0B 2GM4A 4W7YA 2R5BA 2OYIC 1AFOA 2P2UA 1MZ9A 3LIEA 1HVVA 4C7RA 1URQB 2C0WA 4JYCA 1JTHA 4HH2A 4Y99B 3EFGA 1MV8A 4IFMA 5CCGA 2N1TA 3PP5A 2PP6A 1KFMA 1M1JB 2OYIA 4WY4C 5APVA 3G3ZA 2H8PD 1LTJC 4DZOA 3VTPC 2KB7P 5APTA 2MJZA 1WT6A 1GZLA 3NTNA 4JF7A 3M0DC 1NKZB 2PAJA 2KP8A 3TNUB 5APYA 3VOPA 1RF0C 1KZUB 1OXZA 5AW9B 1CW5A 3HE5B 5AVSB 1IFIA 4WY4D 5AW8B 3NMDA 2WSCH 3M9HA 2W27A 2M3BA 1IJDB 3VP9A 2J58A 4C46A 1LT9C 2WITA 2WSEH 3I5CA 1LGHB 3MGNA 3LIDA 1A02J 4GIFA 5AVVB 3KQGA 3A3YB 3BRTB 1WRGA 2YKQA 2HODB 1T2KD 2P1JA 1SQBK 2A45I 3MUDA 4O9BA 1JOCA 2P7JA 1LT9A 3U59A 3GHGB 3M0AA 2FXMA 5AVUB 4M3LA 1YTZT 1IC2A 1YTZI 1N7SA 2YO2A 1LTAC 4WY4B 3CL3D 4Y99C 2WZ7A 2R5DA 3TK1A 5APSA 2L5GB 3A5TA 1LTJB 3UIAA 1HGVA 1GK6A 1URQA 2GUVA 1L0LK 1QL2A 3L4FA 2HPCB 3NFQA 2NPSD 3V2QA 1HWTC 1M1JA 3T97A 2ZXEB 4RESB 2Z5IA 1NTKK 1X8YA 1W2EA 2YO3A 3P7KA 2XU6A 5BU8B 5AW5B 1NHLA 1FU1A 3P8MC 1XTCC 4I2LC 2YNYA 1JUNA 3NXSA 2J59M 2FYZA 3TNUA 3VP8A 3HRNA 1FZEA 1JY3N 5KJ7C 1FOSF 1JO5A 1LTIC 2XDJA 1FAVA 5KLVK 1H8AA 1LTBC 1GK4A 3HE5A 4HYTB 1DEBA 1JCCA 1FZAA 2QM8A 2KYVA 5AW4B 1ZR4A 1G1IA 4JYBA 2NPSB 5AVYB 5KJ7A 2Q9IA 3SWYA 1LTGC 1NTMK 2Q5UA 2Z4EA 3C9IA 3GHGC 2E43A 3OJAB 3EQ2A 5APWA 3WMM0 4WBAA 5KJ7D 2M8RA 3VYIA 3V4WA 2XZRA 1GD2E 2HODA 2XKMA 1N73B 5APXA 3M9BA 1SLQA 1SQPK 1SFCB 2XV5A 2E42A 1ZLLA 5CMZA 2FFDC 3GHGA 3RK2C 2H43A 1G1JA 3KYQA 1NKNA 3M9QA 4WY4A 3BVHA 2VRSA 2WPSA 4XA4A 1LTJA 2FFDA 1T2KC 1N2DC 1RE4C 1T3UA 1NH4A 3B5NC 1CZQA 3M0DA 1H88A 1Z56A 1DH3A 1JMMA 3M91A 1FZGA 1YYCA 3BASA 3CI9A 3V2RA 1JY2N 3OA7A 1JCDA 4IFFA 1RF0A 5APQA 2HPCA 2YKPA 3RK2D 1NOHA 5AW3B 1N86A 1N7LA 3TSIA 1RE4A 5BU5A 3B5NA 3IR9A 5CHXA 2YMYA 1SP4A 1L0NK 3B8EB 2IFNA 4W7ZA 3II6A 5AW0B 3HTKB 3B5ND 3MD0A 1NAFA 3P8CD 5AVXB 2HLOA 2NPSC 4KHXA 1GU5A 2GUSA 1FZBA 2LKMA 1JY3P 2Q3IA 5AW2B 3HD7D 1CI6B 3VMZA 2FFDB 3P8CE 2NPSA 3RK2B 1H89A 1GL2C 1IFNA 2FYUK 2QM7A 2C9NY 3HUSB 3MIWA 1VDFA 1FZFA 1N73C 1RE3C 1SFCC 1HTLC 1GTWA 3B5NB 1SQQK 3SWFA 2WT7B 2WWWA 1N73A 1RE3A 5APUA 2XNXA 1SFCA 4LLHA 1GW3A 1RF1C 3N7NA 4WB4A 3OAKA 1FZCC 2OARA 2IFMA 3VN0A 1GL2D 3KDPB 1AQ5A 3HD7B 2OYHC 1SFCD 1JY3O 2ZFCA 1IFMA 3H6PA 3O8ZA 1T8ZA 1L4AD 1KQLA 1ZV8A 2IPPA 3P32A 3V2NA 3R2PA 3RK3B 2KLVA 3TYYA 3VMXA 3HE4B 1KILC 2Q7CA 5KTBA 1M7LA 1G2CB 4AQRD 1MUUA 4AUWA 4I6MC 5AVQB 5BVZA 1VPCA 4C7NB 1HGZA 1JY2P 2P67A 4DOJA 1J1EC 2CPSA 2R32A 1FJPA 1E5WA 1S9KD 1GL2B 1HBWA 5CCGC 2N1TC 4GKGA 3HTKA 1J1DB 2BASA 4GT1A 1J2JB 2JJLA 1GDTA 1LWUB 1LTTC 3V2PA 1L4AB 3HUSC 1KILD 2Z5HA 1QL1A 3U1CA 3N4XA 1NO4A 2I1KA 1S9KE 3L35A 1CI6A 1RF1B 5AVTB 3M06A 1T3JA 2FKWB 3VMYA 1FZCB 5AVWB 2N9BA 3U1AA 3HUSA 5AW7B 3IFMA 5CCGD 2N1TD 4AYCA 2OYHB 2HYNA 3BATA 4LC1A 1JY2O 1KFNA 2H7HA 2W6AA 1MFZA 3HD7C 4N78D 2WT7A 1X9VA 2A45H 1KILB 1ZR2A 5AW1B 1HUCA 1JNMA 1NWQA 1IFJA 3H32A 4B86A 3RK3C 4N6JA 3HD7A 2A45G 1J1EB 4EIJA 5CCHC 1JTHB 4N78E 3L37A 2N1TB 2OYIB 1N7SC 3A7OA 1CSBA 2I1JA 1GU4A 3HE4A 5CJ0A 2W6BA 5CCHA 4ZKPA 3RL0C 1G2CA 2R3CA 2C9LY 5AW6B 1J1DC 3V5BA 4C7NA 2WPRA 4LGDE 1LTSC 1FOSE 3RK3D 2CPBA 1LWUC 2HFED 1IO4A 1A02F 1L4AC 2JEEA 1URQC 3BRVB 5AVZB 1NU1K 1X79B 2O1JA 5CCHD 4IFDK 1GL2A 2KOGA 1M1JC 1XTGB 1HH0A 1N7SD 1LWUA 1SQVK 2POHA 1L4AA 1IFDA 4XE5B 3H32B 1PFIA 3A2AA 3RL0D 1ZN5A 2HG5D 2YKOA 1DX7A 1HJBA 1RY3A 4I1LA 1GW4A 1IK9A 1SQXK 4EOTA 1RF1A 3LW5H 5CJ4A 1EQ7A 2KSJA 1URQD 3MTUE 2WPQA 3KPEA 1FZCA 1SVFA 3V4QA 1FBMA 4OH8B 3E1IA 2OYHA 2WTYA 1LT9B 2WSFH 4W80A 2O01H 4ZKUA 1FJKA 2IX7C 4N3YB 2C0XA 1N7SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 O;  3GHG B;  2HLO A;  3H32 A;  2HPC B;  3HUS A;  1LWU C;  2HOD A;  1M1J A;  1FZG A;  1N73 B;  1LTJ C;  1RF1 A;  2A45 G;  1FZA A;  1JY2 N;  2OYH B;  1FZC A;  2FFD C;  2OYI C;  1RF0 A;  3GHG A;  2HPC A;  1LT9 C;  1LWU B;  2H43 A;  1FZB A;  1JY2 O;  1JY3 P;  1W2E A;  1N73 A;  1T3U A;  1RE3 A;  1N86 A;  2XNX A;  1M1J C;  1LTJ B;  1RE4 A;  3E1I A;  3HUS C;  2Q9I A;  2OYH A;  1RF1 C;  2FFD A;  2OYI B;  2FFD B;  1FZC C;  1LT9 B;  1LWU A;  1RF0 C;  2Z4E A;  3BVH A;  3GHG C;  1JY2 P;  3HUS B;  2A45 H;  2HOD B;  1LTJ A;  3H32 B;  1M1J B;  1FZF A;  1FZE A;  1JY3 N;  1RE3 C;  2A45 I;  2OYI A;  1RF1 B;  1N73 C;  2OYH C;  1RE4 C;  1LT9 A;  1FZC B; 
#chains in the Genus database with same CATH topology
 1FDM A;  5GTI H;  1YHQ P;  1P84 I;  4W7Y A;  2R5B A;  1K05 A;  3L75 J;  1AFO A;  2IYP A;  1URQ B;  3BCC J;  4TT3 H;  1FS0 E;  1RQV A;  3MP7 B;  4L73 A;  4BRY B;  2A06 E;  2OYI A;  3WUU A;  3PLN A;  4DZO A;  1YI2 P;  1SQX E;  4JF7 A;  1NKZ B;  3VOP A;  2RMZ A;  1EC5 A;  1RF0 C;  1OXZ A;  1QVG O;  2IZ0 A;  1NTM D;  1SQV G;  3NMD A;  1S5L X;  2KNC A;  1NTZ E;  3H1L J;  2J58 A;  1FDI A;  1LT9 C;  4H0L C;  4H44 D;  2E76 D;  3Q5R A;  1LGH B;  1NTK G;  3QH9 A;  3KQG A;  1Q90 D;  2B88 A;  1PGQ A;  4NPD A;  2JP3 A;  2K1A A;  2P1J A;  1T2K D;  1VQK P;  4O9B A;  1JOC A;  1KYO H;  3M0A A;  4M3L A;  2BCC J;  1WMK A;  1N7S A;  1YJN P;  3CL3 D;  2R5D A;  3UIA A;  2M5A A;  2BEZ F;  3H1H E;  3C1L A;  1DD4 A;  1QL2 A;  2HPC B;  3FWL A;  4UB8 H;  1NTK K;  1KD1 Q;  2YNY A;  1VQ8 P;  4WVZ A;  3SWK A;  2FYZ A;  3VP8 A;  1FZE A;  1LTI C;  1FAV A;  5KLV K;  3A0B H;  1LTB C;  1GK4 A;  4GDO A;  1ZR4 A;  5KJ7 A;  3RL0 g;  1VQL P;  4RJT A;  1L0N G;  5APW A;  4WBA A;  4RO0 A;  2M8R A;  1S72 P;  2HOD A;  5DJT B;  3M9B A;  1KOR A;  2KS1 A;  2B89 A;  1SQQ E;  3JSV C;  3TGU D;  4XFJ A;  5GTH E;  2PRR A;  2N9Y B;  1QLE D;  2WPS A;  4R4M A;  1RE4 C;  3B5N C;  2V4H A;  3D70 A;  1H88 A;  1DH3 A;  1JMM A;  2OGU A;  2LXB A;  1JY2 N;  2YXR B;  4IFF A;  1RF0 A;  1LNQ A;  3EWK A;  1ZME C;  1MKM A;  3IR9 A;  2YIU B;  1NTK J;  1L0N K;  1PP9 J;  3G4S P;  4GOD A;  3I55 P;  3WU2 H;  3CCR P;  3FXE A;  3MD0 A;  3P8C D;  1NAF A;  1Q82 Q;  5AVX B;  3L73 D;  4EYY Q;  1EDI A;  3KHU A;  5KLV J;  1GU5 A;  2Q3I A;  3CXH H;  2FFD B;  1LP1 A;  2QJY B;  2NPS A;  3RK2 B;  1H89 A;  1GL2 C;  2QJP B;  3HUS B;  1KQF B;  1VDF A;  4PV1 C;  1HTL C;  2E74 D;  1KB9 D;  4EDF A;  1N73 A;  1RE3 A;  1SFC A;  4Z1M H;  2AEM A;  2Q1K A;  2OAR A;  2BEQ D;  3Q5P A;  1NJI Q;  4D6T J;  1USE A;  1BCC G;  1L4A D;  3L75 E;  1ZP0 C;  2IPP A;  2YIU C;  1K8A Q;  3BCC E;  1KIL C;  2Q7C A;  2E5T A;  2FBW C;  2ZAE B;  1VPC A;  1BDD A;  2B87 A;  4DOJ A;  1L0N J;  3GMA A;  1E5W A;  1S9K D;  1SQV D;  2QA4 P;  5CCG C;  2N1T C;  3HTK A;  1J2J B;  3L74 G;  2QJY C;  3CX5 H;  3CCV P;  3HUS C;  3D6Z A;  1UIX A;  3N4X A;  2I1K A;  3AE4 C;  3F89 A;  2JKV A;  1CI6 A;  1RF1 B;  5AVT B;  3VMY A;  2FYU G;  1M8O B;  1BE3 G;  3U1A A;  3H1L E;  3WUV A;  2OYH B;  3BAT A;  1PPJ D;  3L71 J;  1JY2 O;  1KFN A;  1NU1 G;  3H1K J;  4K3A A;  1KYO D;  1YQ4 C;  1SS1 A;  3B71 A;  3KXD A;  5AW1 B;  2BCC E;  3W67 A;  1NWQ A;  1JNM A;  3AE3 C;  1Q86 Q;  1OVR A;  4EIJ A;  4N78 E;  2OYI B;  1CSB A;  2I1J A;  1GU4 A;  4PJ0 H;  3GF7 A;  3L72 G;  5CJ0 A;  2W6B A;  4UB6 E;  2R3C A;  1LTS C;  2IBZ E;  1Q81 Q;  1FOS E;  3RK3 D;  3AE9 C;  2JEE A;  1VQ4 P;  3KZI E;  1FE6 A;  5AVZ B;  1NU1 K;  4IFD K;  1GL2 A;  1H0T A;  2KOG A;  5TIS H;  1TU3 F;  2R3S A;  2POH A;  3H32 B;  1ZOY C;  2JR8 A;  3RGU A;  4ASV A;  1L0N D;  1IK7 A;  1HJB A;  4I1L A;  1BCC J;  4GOE A;  1IK9 A;  3LW5 H;  1EQ7 A;  1URQ D;  1SVF A;  4JPZ B;  3V4Q A;  3S4R A;  5GTI E;  2H88 C;  4ASW A;  1OW6 A;  2O01 H;  2AXT H;  4ZKU A;  1N7S B;  3L36 A;  1KIL A;  5AVR B;  3RL0 B;  2GM4 A;  2OYI C;  1K04 A;  2M5A B;  4DT0 A;  3L74 J;  2P10 A;  3BCC G;  4Y99 B;  3EFG A;  1MV8 A;  3AEA C;  5CCG A;  1YJW P;  2N1T A;  3PP5 A;  1KFM A;  5KAI H;  4JBZ A;  2ZVN B;  4WY4 C;  1PL5 A;  2FYU J;  3O6Q B;  3SFE C;  1BE3 J;  2H8P D;  1LTJ C;  4KT0 J;  1VQP P;  3VTP C;  1FC2 C;  5APT A;  4OGQ B;  3M0D C;  1NTK E;  3AE8 C;  4JQ0 D;  1NU1 J;  1KZU B;  1IFI A;  5AW8 B;  3G6E P;  2WSC H;  1IJD B;  3H1L G;  1KYO E;  4IOI H;  2WSE H;  2E5Y A;  3I5C A;  3LID A;  4IL6 H;  3R4Y A;  1WRG A;  3RBX A;  2YKQ A;  2HOD B;  3L72 J;  4YPC A;  2P7J A;  2KS1 B;  5AVU B;  3H1H D;  1BCC D;  2YO2 A;  4Y99 C;  2WZ7 A;  1BGY J;  2IDB A;  3CCU P;  3TK1 A;  3K5B A;  4UB8 E;  2K9J A;  4D6T E;  1GK6 A;  2GUV A;  1L0L K;  4OGQ C;  3A0H H;  3L4F A;  3NFQ A;  1X22 A;  1HWT C;  1W2B O;  2E75 D;  2IBZ G;  4RES B;  2Z5I A;  1X8Y A;  1SQP G;  3A0B E;  2XU6 A;  2W90 A;  5AW5 B;  1NHL A;  3P8M C;  4I2L C;  4H0L B;  1L0N E;  3NXS A;  3TNU A;  2IBZ I;  3HRN A;  5KJ7 C;  1JY3 N;  1JO5 A;  3CX5 D;  2OTK E;  5CBO A;  1VQ5 P;  2FYU D;  4HYT B;  5KAF H;  1BE3 D;  2O01 J;  2QM8 A;  1JM0 A;  1RH5 B;  4YTP C;  2NPS B;  2Q9I A;  1QX8 A;  2Y9Y A;  1SQQ D;  2Z4E A;  1KB9 I;  3S1K A;  3AE5 C;  2QJK C;  3WMM 0;  3AEE C;  3CCM P;  2ZT9 B;  4ZNC A;  2XZR A;  2XKM A;  1N73 B;  1GMJ A;  5APX A;  1SQP K;  1SFC B;  3AE6 C;  2E42 A;  1ZLL A;  3H1K E;  2QVA A;  4WY4 A;  2IZ1 A;  3GLM A;  5E79 H;  1LTJ A;  4YXW H;  3L72 D;  1NH4 A;  1CZQ A;  3M0D A;  3WU2 E;  3E1R A;  3M91 A;  1FZG A;  1YYC A;  2W8Z A;  3G9R A;  3RK2 D;  2B87 B;  3Q1M A;  3TSI A;  1L2P A;  5BU5 A;  5CHX A;  2WSC J;  1PP9 G;  3B8E B;  3AE2 C;  2V7Q H;  3CXH E;  1JEK A;  2WSE J;  3HTK B;  4EI2 A;  1DEE G;  2NPS C;  5KLV G;  2KI7 B;  2AEF A;  1FZB A;  5AW2 B;  2G8Y A;  2FXP A;  1CI6 B;  3Q3D A;  2ZT9 C;  1QEX A;  1IFN A;  1FZF A;  1N73 C;  1RE3 C;  1BCC E;  1SFC C;  4K35 A;  2QSI A;  1KYO I;  1AA0 A;  3B5N B;  3SWF A;  3L75 D;  1SQP J;  2O3J A;  3N7N A;  3OAK A;  1FZC C;  3KDP B;  3BCC D;  3H1J J;  4D6T G;  1JY3 O;  2ZFC A;  1QGK B;  3V2N A;  2JWD A;  3L74 E;  4U3F G;  1N8R Q;  3VMX A;  3AE7 C;  2P58 A;  1MUU A;  5AVQ B;  1AJY A;  3CX5 E;  3JC2 2;  1JY2 P;  2KXP B;  2FYU E;  2R32 A;  1BE3 E;  1OFC X;  1GL2 B;  1H0T B;  1DIP A;  3L70 G;  1BSH A;  1AVO A;  1NU1 E;  4PV1 B;  1LTT C;  3H1L D;  1VQO P;  2D2C B;  2Z5H A;  3L35 A;  1EZV G;  1JB0 J;  3M06 A;  3PJS K;  3GW6 A;  1E79 H;  3IFM A;  4TLF A;  1KIL E;  5EFW B;  4AYC A;  2BCC D;  1VF5 B;  3L71 G;  4GOF A;  5L8R J;  3H1K G;  2FY8 A;  2W6A A;  3D71 A;  4N78 D;  3QWO C;  3L72 E;  2WT7 A;  2A45 H;  1KIL B;  1USD A;  4PJ0 E;  4B86 A;  2Y9Z A;  3HD7 A;  2A45 G;  1BGY E;  2V7Q J;  3MUD C;  1KTM A;  1IZN B;  2IBZ D;  4DJG A;  3L37 A;  1S5L H;  2N1T B;  3GG2 A;  5TIS E;  1PGJ A;  2C9L Y;  2WPR A;  2HFE D;  3GF3 A;  1IO4 A;  1T6A A;  5H2F H;  2O1J A;  2D2C C;  5CCH D;  4QMA A;  3OW2 O;  1M1J C;  1N7S D;  1LWU A;  4XE5 B;  4PD4 H;  3RL0 D;  2YKO A;  1VF5 C;  1DX7 A;  1RY3 A;  1KN7 A;  3H1I G;  1SQX K;  2AXT E;  4KJM A;  4H13 B;  1ZW0 A;  3CWB J;  2WPQ A;  1FZC A;  3CPW O;  2KK7 A;  1FBM A;  4OH8 B;  4U3F J;  2PFX A;  4DCK A;  3MHV A;  1FJK A;  2IX7 C;  1EXJ A;  2GA1 A;  2O1K A;  1NTZ K;  5C39 A;  5KAI E;  3CLQ A;  1RHZ B;  2K9J B;  1RQU A;  1R5S A;  3L70 J;  2P2U A;  3LIE A;  2JWA A;  2PGD A;  1JTH A;  1PIX A;  3AED C;  3CD6 P;  1NTK D;  1PP9 D;  2PP6 A;  4NPF X;  1M57 D;  2Q6Q A;  5APV A;  1SQB G;  3G3Z A;  3IAO A;  5B66 H;  1D7M A;  2QE7 H;  5DJU B;  1WT6 A;  1GZL A;  5KLV D;  2E76 C;  2MKV A;  3CX5 I;  2KP8 A;  3TNU B;  5APY A;  5AW9 B;  1LT1 A;  1CW5 A;  2XND H;  2RKL A;  4IL6 E;  4H13 C;  1EDK A;  2J5U A;  3M9H A;  3AEB C;  2NRG A;  3VP9 A;  1SQX J;  4WWI A;  4GIF A;  2B9B A;  3A3Y B;  3BRT B;  1SQB K;  3MUD A;  2ZYG A;  4D6T D;  2Q3E A;  1YJ9 P;  1YTZ T;  1IC2 A;  1LTA C;  1NVO A;  1SQP E;  4WY4 B;  3A0H E;  1NAY A;  1W5C E;  1BGY G;  1S1C X;  4H0L D;  5KKZ C;  1Y8A A;  5APS A;  1K73 Q;  1LTJ B;  1HGV A;  3H1J E;  2KIK A;  1NTM G;  2KNC B;  2KLU A;  2NPS D;  3H1I J;  3V2Q A;  1M1J A;  3T97 A;  1ZXG A;  2Y0E A;  3SFD C;  5KAF E;  5BU8 B;  1FU1 A;  2K88 A;  2ZT9 D;  1MFT A;  2J59 M;  1M56 D;  1FOS F;  1EZV D;  1KQS O;  3HE5 A;  1FZA A;  5AW4 B;  1G1I A;  4JYB A;  3L71 D;  1DD3 A;  5AVY B;  3AEG C;  3SWY A;  3H1K D;  1LTG C;  1NTM K;  2Q5U A;  3ITK A;  3CC2 P;  5B5E H;  3C9I A;  1AQT A;  3EQ2 A;  4L75 A;  3CCS P;  3CCL P;  3VYI A;  1GD2 E;  2K9Y A;  5TJH A;  5E79 E;  1SQB J;  1SLQ A;  3F5H A;  3GHG A;  1VQ7 P;  1G1J A;  3KYQ A;  1PP9 E;  4BXL A;  2QIW A;  2ZYD A;  2FFD A;  1N2D C;  3G71 P;  1OX3 A;  1Z56 A;  3CXH D;  5KLV E;  3BAS A;  1L0L G;  1JCD A;  5APQ A;  3USS A;  1FDO A;  5AW3 B;  3FXD A;  1N86 A;  1N7L A;  4HJG H;  2ZJS E;  4NPE A;  2YMY A;  1SP4 A;  3V6I A;  1OVV A;  4W7Z A;  3II6 A;  5AW0 B;  3B5N D;  2HLO A;  3H1I D;  2QJK B;  2LKM A;  1JY3 P;  2LXC B;  2QRX A;  1NGM B;  2ZXX A;  2QM7 A;  3MIW A;  1NTM J;  1U57 A;  2K37 A;  3CWB E;  2UWJ E;  4I7Z B;  1GTW A;  4U3F E;  2WT7 B;  2WWW A;  5APU A;  4LLH A;  1GW3 A;  1BSN A;  3L74 D;  4WB4 A;  2IFM A;  3VN0 A;  1GL2 D;  1AQ5 A;  1EDL A;  3H1J G;  3HD7 B;  2KZI A;  2DW3 A;  4ZMD A;  4PV1 D;  1IFM A;  1T8Z A;  1OZH A;  1KQL A;  1P84 H;  3L70 E;  3P32 A;  3R2P A;  3RK3 B;  3TYY A;  1LP1 B;  5KTB A;  4AQR D;  1KB9 H;  4AUW A;  4I6M C;  1NU1 D;  1EZV E;  1HGZ A;  2P67 A;  3IN6 A;  1J1E C;  1KMI Z;  4R4L A;  2CPS A;  1VF5 D;  1HBW A;  4GKG A;  3L71 E;  2BAS A;  1YIJ P;  1OVU A;  4GT1 A;  2JJL A;  1GDT A;  1LWU B;  3V2P A;  1VQ9 P;  1KIL D;  1Q2N A;  4BWN A;  4I7Z C;  5K5G B;  3I56 P;  1FZC B;  5AVW B;  3PRJ A;  5AW7 B;  4CPG A;  5CCG D;  2N1T D;  1UII A;  4Y28 J;  1L0L J;  2OTJ P;  4LC1 A;  1BGY D;  1MFZ A;  3HD7 C;  1X9V A;  1S5L E;  1VQM P;  1HUC A;  3H32 A;  3RK3 C;  4N6J A;  2Y0D A;  3CC7 P;  1JTH B;  2ZVO B;  3TGU J;  5H2F E;  1PGP A;  2FXO A;  5M1B A;  3A7O A;  1KC8 Q;  3HE4 A;  5CCH A;  4H13 D;  4ZKP A;  1G2C A;  1YIT P;  2HR3 A;  3H1I E;  4C7N A;  2FYN B;  1BDC A;  1PGO A;  2CPB A;  1LWU C;  1PPJ G;  4PD4 E;  1URQ C;  2AEJ A;  4HKZ H;  3JCU H;  1HH0 A;  4U7J A;  1SQV K;  1L4A A;  1AV1 A;  1IFD A;  3A2A A;  1ZN5 A;  3L73 J;  1VQ6 P;  2K3R A;  3AEC C;  5CJ4 A;  1VQN P;  2KSJ A;  3CWB G;  3KPE A;  3MZW B;  3O6Q A;  3CCJ P;  3E1I A;  2JO1 A;  1OW8 A;  2WSF H;  2JDI H;  4W80 A;  1SQB E;  3CCE P;  1OWA A;  1NYH A;  3Q2Y A;  1K9M Q;  1L0L D;  2E75 B;  1MZ9 A;  1HVV A;  3AEF C;  5B66 E;  4C7R A;  2C0W A;  4JYC A;  4HH2 A;  2FYN C;  2Y0C A;  3CMA P;  4IFM A;  1M1J B;  3T97 B;  1PV3 A;  2KB7 P;  2MJZ A;  3NTN A;  2L91 A;  1KV4 A;  2PAJ A;  1EZV I;  1AVY A;  3HE5 B;  5AVS B;  2A06 G;  4WY4 D;  1SQV J;  4MN4 C;  1JMB A;  2W27 A;  2M3B A;  2WMM A;  2OTL P;  1SQX G;  4C46 A;  2WIT A;  3MGN A;  4A7P A;  1SQP D;  1A02 J;  4RKU J;  1NTM E;  5AVV B;  1U7J A;  2WQY C;  3S9O A;  2A45 I;  1LT9 A;  3H1J D;  3U59 A;  3GHG B;  3FWN A;  2FXM A;  2E75 C;  3PH0 A;  1YTZ I;  3FX0 A;  1NTZ G;  2H89 C;  3A5T A;  2L5G B;  1OIP A;  1HF9 A;  1M1K Q;  1P84 D;  3CXH I;  4H44 B;  2E76 B;  2R44 A;  2WSS H;  1URQ A;  2QG4 A;  2LR2 A;  1KQG B;  1ZRT D;  4BRY A;  1R8E A;  2ZXE B;  2OYO A;  1W2E A;  2YO3 A;  3P7K A;  2ITA A;  1XTC C;  2SPZ A;  1S4X A;  3VMA A;  4OVN F;  1JUN A;  5CBN A;  3H1H G;  2XDJ A;  4PD4 I;  2WVR A;  4OGQ D;  5B5E E;  3CCQ P;  1H8A A;  2WSF J;  1DEB A;  1JCC A;  2KYV A;  2M3E A;  1HJ0 A;  3TDK A;  2YMK A;  3GHG C;  2W83 C;  5KKZ B;  2E43 A;  3OJA B;  5KJ7 D;  3V4W A;  2KSE A;  3RBZ A;  3EFF K;  1L0L E;  2XV5 A;  1R5L A;  5CMZ A;  2FFD C;  4YXD C;  3B4S A;  3RK2 C;  2H43 A;  4H44 C;  2QJP C;  3CME P;  1NKN A;  3M9Q A;  2ZYA A;  3BVH A;  2VRS A;  4XA4 A;  1LJ2 A;  1T2K C;  1T3U A;  1YBK A;  3CI9 A;  3V2R A;  4IL6 X;  3TGU E;  2WPV B;  5GTH H;  3OA7 A;  1Y9B A;  2HPC A;  2YKP A;  1NOH A;  1RE4 A;  1SQQ G;  3B5N A;  3TF5 A;  3W68 A;  3H25 A;  2IFN A;  2OQQ A;  2CK3 H;  4HB1 A;  3SSU A;  3PTZ A;  4KHX A;  3FGA D;  3CWB D;  2GUS A;  1NTZ J;  2I8D A;  1M90 Q;  4U3F D;  3HD7 D;  3VMZ A;  3P8C E;  2C9N Y;  1U7M A;  2FYU K;  3L73 E;  1S3J A;  1EXI A;  1S2E A;  2W6J H;  1SQQ K;  1P84 E;  3L70 D;  2XNX A;  1RF1 C;  2IYO A;  1ZRT E;  4OWF A;  5KLI B;  1KB9 E;  2OYH C;  1SFC D;  3H1H J;  3H6P A;  3O8Z A;  2NZ2 A;  1ZV8 A;  2KLV A;  3HE4 B;  2E74 B;  1M7L A;  1G2C B;  5BVZ A;  4C7N B;  2RH0 A;  1FJP A;  2A06 D;  1J1D B;  3PHL A;  3L75 G;  3ZDM A;  1L4A B;  1SQX D;  1QL1 A;  3U1C A;  1NO4 A;  1S9K E;  1SQV E;  1T3J A;  2FKW B;  1Y47 A;  1X0T A;  2N9B A;  3HUS A;  3CC4 P;  2HYN A;  1IFP A;  3AE1 C;  2RN0 A;  2H7H A;  1NTZ D;  4L74 A;  5KLI C;  1SQQ J;  2QEX P;  2M0B A;  1ZR2 A;  1OMI A;  2G3A A;  3Q5S A;  3WUT A;  1PPJ E;  1IFJ A;  1YQ3 C;  1J1E B;  2E74 C;  2YXQ B;  5CCH C;  3TGU G;  4PD4 D;  3ABV C;  1N7S C;  3JCU E;  3RL0 C;  3D6Y A;  5AW6 B;  1J1D C;  3V5B A;  4LGD E;  2KZJ A;  2BCC G;  1PZQ A;  1A02 F;  1L4A C;  3BRV B;  3C8V A;  2AXC A;  1X79 B;  4L76 A;  2O01 N;  4UB6 H;  1XTG B;  3E7K A;  3RK3 E;  1PFI A;  3KZI H;  2HG5 D;  3L73 G;  2KUB A;  1GW4 A;  4EOT A;  1RF1 A;  1SQB D;  3MTU E;  1VL2 A;  2D2C D;  3IF4 A;  1QVF O;  2OYH A;  3LW5 J;  2WTY A;  1LT9 B;  1EDJ A;  1Q7Y Q;  1OW7 A;  4N3Y B;  2C0X A; 
#chains in the Genus database with same CATH homology
 2O1K A;  1FDM A;  1NTZ K;  3L36 A;  1KIL A;  1OWA A;  3CLQ A;  5AVR B;  3RL0 B;  2GM4 A;  4W7Y A;  2R5B A;  2OYI C;  1AFO A;  2P2U A;  1MZ9 A;  3LIE A;  1HVV A;  4C7R A;  1URQ B;  2C0W A;  4JYC A;  1JTH A;  4HH2 A;  4Y99 B;  3EFG A;  1MV8 A;  4IFM A;  5CCG A;  2N1T A;  3PP5 A;  2PP6 A;  1KFM A;  1M1J B;  2OYI A;  4WY4 C;  5APV A;  3G3Z A;  2H8P D;  1LTJ C;  4DZO A;  3VTP C;  2KB7 P;  5APT A;  2MJZ A;  1WT6 A;  1GZL A;  3NTN A;  4JF7 A;  3M0D C;  1NKZ B;  2PAJ A;  2KP8 A;  3TNU B;  5APY A;  3VOP A;  1RF0 C;  1KZU B;  1OXZ A;  5AW9 B;  1CW5 A;  3HE5 B;  5AVS B;  1IFI A;  4WY4 D;  5AW8 B;  3NMD A;  2WSC H;  3M9H A;  2W27 A;  2M3B A;  1IJD B;  3VP9 A;  2J58 A;  4C46 A;  1LT9 C;  2WIT A;  2WSE H;  3I5C A;  1LGH B;  3MGN A;  3LID A;  1A02 J;  4GIF A;  5AVV B;  3KQG A;  3A3Y B;  3BRT B;  1WRG A;  2YKQ A;  2HOD B;  1T2K D;  2P1J A;  1SQB K;  2A45 I;  3MUD A;  4O9B A;  1JOC A;  2P7J A;  1LT9 A;  3U59 A;  3GHG B;  3M0A A;  2FXM A;  5AVU B;  4M3L A;  1YTZ T;  1IC2 A;  1YTZ I;  1N7S A;  2YO2 A;  1LTA C;  4WY4 B;  3CL3 D;  4Y99 C;  2WZ7 A;  2R5D A;  3TK1 A;  5APS A;  2L5G B;  3A5T A;  1LTJ B;  3UIA A;  1HGV A;  1GK6 A;  1URQ A;  2GUV A;  1L0L K;  1QL2 A;  3L4F A;  2HPC B;  3NFQ A;  2NPS D;  3V2Q A;  1HWT C;  1M1J A;  3T97 A;  2ZXE B;  4RES B;  2Z5I A;  1NTK K;  1X8Y A;  1W2E A;  2YO3 A;  3P7K A;  2XU6 A;  5BU8 B;  5AW5 B;  1NHL A;  1FU1 A;  3P8M C;  1XTC C;  4I2L C;  2YNY A;  1JUN A;  3NXS A;  2J59 M;  2FYZ A;  3TNU A;  3VP8 A;  3HRN A;  1FZE A;  1JY3 N;  5KJ7 C;  1FOS F;  1JO5 A;  1LTI C;  2XDJ A;  1FAV A;  5KLV K;  1H8A A;  1LTB C;  1GK4 A;  3HE5 A;  4HYT B;  1DEB A;  1JCC A;  1FZA A;  2QM8 A;  2KYV A;  5AW4 B;  1ZR4 A;  1G1I A;  4JYB A;  2NPS B;  5AVY B;  5KJ7 A;  2Q9I A;  3SWY A;  1LTG C;  1NTM K;  2Q5U A;  2Z4E A;  3C9I A;  3GHG C;  2E43 A;  3OJA B;  3EQ2 A;  5APW A;  3WMM 0;  4WBA A;  5KJ7 D;  2M8R A;  3VYI A;  3V4W A;  2XZR A;  1GD2 E;  2HOD A;  2XKM A;  1N73 B;  5APX A;  3M9B A;  1SLQ A;  1SQP K;  1SFC B;  2XV5 A;  2E42 A;  1ZLL A;  5CMZ A;  2FFD C;  3GHG A;  3RK2 C;  2H43 A;  1G1J A;  3KYQ A;  1NKN A;  3M9Q A;  4WY4 A;  3BVH A;  2VRS A;  2WPS A;  4XA4 A;  1LTJ A;  2FFD A;  1T2K C;  1N2D C;  1RE4 C;  1T3U A;  1NH4 A;  3B5N C;  1CZQ A;  3M0D A;  1H88 A;  1Z56 A;  1DH3 A;  1JMM A;  3M91 A;  1FZG A;  1YYC A;  3BAS A;  3CI9 A;  3V2R A;  1JY2 N;  3OA7 A;  1JCD A;  4IFF A;  1RF0 A;  5APQ A;  2HPC A;  2YKP A;  3RK2 D;  1NOH A;  5AW3 B;  1N86 A;  1N7L A;  3TSI A;  1RE4 A;  5BU5 A;  3B5N A;  3IR9 A;  5CHX A;  2YMY A;  1SP4 A;  1L0N K;  3B8E B;  2IFN A;  4W7Z A;  3II6 A;  5AW0 B;  3HTK B;  3B5N D;  3MD0 A;  1NAF A;  3P8C D;  5AVX B;  2HLO A;  2NPS C;  4KHX A;  1GU5 A;  2GUS A;  1FZB A;  2LKM A;  1JY3 P;  2Q3I A;  5AW2 B;  3HD7 D;  1CI6 B;  3VMZ A;  2FFD B;  3P8C E;  2NPS A;  3RK2 B;  1H89 A;  1GL2 C;  1IFN A;  2FYU K;  2QM7 A;  2C9N Y;  3HUS B;  3MIW A;  1VDF A;  1FZF A;  1N73 C;  1RE3 C;  1SFC C;  1HTL C;  1GTW A;  3B5N B;  1SQQ K;  3SWF A;  2WT7 B;  2WWW A;  1N73 A;  1RE3 A;  5APU A;  2XNX A;  1SFC A;  4LLH A;  1GW3 A;  1RF1 C;  3N7N A;  4WB4 A;  3OAK A;  1FZC C;  2OAR A;  2IFM A;  3VN0 A;  1GL2 D;  3KDP B;  1AQ5 A;  3HD7 B;  2OYH C;  1SFC D;  1JY3 O;  2ZFC A;  1IFM A;  3H6P A;  3O8Z A;  1T8Z A;  1L4A D;  1KQL A;  1ZV8 A;  2IPP A;  3P32 A;  3V2N A;  3R2P A;  3RK3 B;  2KLV A;  3TYY A;  3VMX A;  3HE4 B;  1KIL C;  2Q7C A;  5KTB A;  1M7L A;  1G2C B;  4AQR D;  1MUU A;  4AUW A;  4I6M C;  5AVQ B;  5BVZ A;  1VPC A;  4C7N B;  1HGZ A;  1JY2 P;  2P67 A;  4DOJ A;  1J1E C;  2CPS A;  2R32 A;  1FJP A;  1E5W A;  1S9K D;  1GL2 B;  1HBW A;  5CCG C;  2N1T C;  4GKG A;  3HTK A;  1J1D B;  2BAS A;  4GT1 A;  1J2J B;  2JJL A;  1GDT A;  1LWU B;  1LTT C;  3V2P A;  1L4A B;  3HUS C;  1KIL D;  2Z5H A;  1QL1 A;  3U1C A;  3N4X A;  1NO4 A;  2I1K A;  1S9K E;  3L35 A;  1CI6 A;  1RF1 B;  5AVT B;  3M06 A;  1T3J A;  2FKW B;  3VMY A;  1FZC B;  5AVW B;  2N9B A;  3U1A A;  3HUS A;  5AW7 B;  3IFM A;  5CCG D;  2N1T D;  4AYC A;  2OYH B;  2HYN A;  3BAT A;  4LC1 A;  1JY2 O;  1KFN A;  2H7H A;  2W6A A;  1MFZ A;  3HD7 C;  4N78 D;  2WT7 A;  1X9V A;  2A45 H;  1KIL B;  1ZR2 A;  5AW1 B;  1HUC A;  1JNM A;  1NWQ A;  1IFJ A;  3H32 A;  4B86 A;  3RK3 C;  4N6J A;  3HD7 A;  2A45 G;  1J1E B;  4EIJ A;  5CCH C;  1JTH B;  4N78 E;  3L37 A;  2N1T B;  2OYI B;  1N7S C;  3A7O A;  1CSB A;  2I1J A;  1GU4 A;  3HE4 A;  5CJ0 A;  2W6B A;  5CCH A;  4ZKP A;  3RL0 C;  1G2C A;  2R3C A;  2C9L Y;  5AW6 B;  1J1D C;  3V5B A;  4C7N A;  2WPR A;  4LGD E;  1LTS C;  1FOS E;  3RK3 D;  2CPB A;  1LWU C;  2HFE D;  1IO4 A;  1A02 F;  1L4A C;  2JEE A;  1URQ C;  3BRV B;  5AVZ B;  1NU1 K;  1X79 B;  2O1J A;  5CCH D;  4IFD K;  1GL2 A;  2KOG A;  1M1J C;  1XTG B;  1HH0 A;  1N7S D;  1LWU A;  1SQV K;  2POH A;  1L4A A;  1IFD A;  4XE5 B;  3H32 B;  1PFI A;  3A2A A;  3RL0 D;  1ZN5 A;  2HG5 D;  2YKO A;  1DX7 A;  1HJB A;  1RY3 A;  4I1L A;  1GW4 A;  1IK9 A;  1SQX K;  4EOT A;  1RF1 A;  3LW5 H;  5CJ4 A;  1EQ7 A;  2KSJ A;  1URQ D;  3MTU E;  2WPQ A;  3KPE A;  1FZC A;  1SVF A;  3V4Q A;  1FBM A;  4OH8 B;  3E1I A;  2OYH A;  2WTY A;  1LT9 B;  2WSF H;  4W80 A;  2O01 H;  4ZKU A;  1FJK A;  2IX7 C;  4N3Y B;  2C0X A;  1N7S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...