1JY2P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords FIBRINOGEN ALPHA CHAIN
total genus 13
structure length 44
sequence length 44
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2P00
1RF0A 1FZFA 2FFDB 1FZEA 3GHGC 2Q9IA 1RF1A 2HLOA 1RF1C 1N73C 1RE3A 2HODB 1RF1B 2XNXA 1RF0C 3E1IA 1RE4C 1LT9B 1JY3N 1T3UA 2FFDC 3HUSC 1M1JC 2A45H 1LTJA 2OYIB 2A45G 1LWUC 2OYHB 1FZGA 2A45I 1JY3O 1FZCA 2OYHA 2HPCB 1LT9A 2OYIC 1JY3P 1FZCC 2OYHC 1M1JB 1N86A 1W2EA 3HUSB 2H43A 1LTJB 1LTJC 1LT9C 3BVHA 2OYIA 2Z4EA 1M1JA 1JY2P 3H32B 1RE4A 1FZBA 1LWUA 2HPCA 1N73B 1FZCB 3H32A 1JY2O 1RE3C 3GHGB 1LWUB 2HODA 3HUSA 1FZAA 1N73A 1JY2N 2FFDA 3GHGA
chains in the Genus database with same CATH superfamily
2LXBA 3EFFK 2P7JA 1PP9G 1L0LD 2I8DA 1NTZG 1IFNA 2K9JB 2PGDA 3FWNA 4GDOA 3NMDA 2YXQB 1M56D 1X0TA 5C39A 3F89A 3H1LD 2W90A 2XDJA 5CJ4A 3KHUA 3V2NA 2Y0CA 4UB8H 1EC5A 1NU1D 3HUSC 1LTBC 1PGPA 3L73G 5AVRB 2M3BA 3BCCG 3AE5C 1KFNA 3CXHE 4PV1D 1FJPA 3TGUG 2E74C 2W6JH 3V2PA 1N86A 1AVYA 3CC2P 5APQA 5KLVE 2YKPA 1IFPA 2E74B 3A2AA 4PD4I 5AVYB 2J58A 1BE3E 2JR8A 1NJIQ 3D70A 1LNQA 5CCGA 1QL2A 1FS0E 1IFIA 1ZOYC 2BEQD 2HODA 2SPZA 3L72J 3HTKB 1QL1A 3L74J 4XFJA 3LW5J 3BASA 3F5HA 4Z1MH 2Q3EA 1GL2D 1PFIA 1QVFO 1R8EA 1RQUA 2E76B 1KILD 3JC22 5APWA 3RGUA 2NPSA 2HLOA 4PD4H 4ZMDA 2WT7A 5KAIH 1RF1B 1FE6A 2E74D 2OGUA 3L71G 1CW5A 2C9NY 2AXTE 2NRGA 3CXHD 1PL5A 2PFXA 3S9OA 3L73E 3AE7C 1AVOA 2A45H 1KB9E 1A02J 4L74A 1GL2A 2J59M 4JPZB 4N78D 4H13D 2JP3A 2N9BA 1FZCC 1BSNA 3IFMA 3TK1A 1JY3P 1RY3A 2G8YA 1GL2C 1L0LJ 2QJPB 2KOGA 1Y9BA 1LP1B 2JO1A 3HE5A 1FDOA 2E5YA 5EFWB 1PGJA 3RL0D 3HE5B 2K9JA 3RK2D 1JUNA 1SQQG 4A7PA 2JEEA 3CI9A 3H32A 1H0TB 1BGYD 5KAFE 3AEDC 2P10A 2M3EA 3P8MC 3H1LG 5AW2B 4KT0J 5AW8B 2KS1A 5CCGD 4LLHA 2J5UA 2LXCB 3Q3DA 1BGYG 2JDIH 1KB9D 3S1KA 2I1KA 1VQ4P 3V4QA 3E1RA 2WPQA 4H44C 1AV1A 3VMZA 2HG5D 2QJYC 3RL0B 1SLQA 2BASA 3H1LE 2A06E 3B71A 3ITKA 2KS1B 3C1LA 3OAKA 3M9BA 5APXA 2JJLA 1IK9A 2Q5UA 4L76A 1BGYE 3RK2C 4ASVA 4YXDC 2WSFH 1LJ2A 1NTKK 2CPBA 1DD3A 3A5TA 3CC4P 1GDTA 2KB7P 3H1ID 2A06G 4QMAA 5APYA 1GK4A 1IFDA 2RN0A 1NH4A 3PJSK 1W2EA 2BCCJ 1M7LA 3Q1MA 1W2BO 4XA4A 2OQQA 1QLED 4DOJA 1BDDA 2OYIA 1HGVA 3M9QA 4R4LA 2A06D 5AW4B 1SQQK 2Y9YA 4MN4C 1G2CA 3AEGC 4EYYQ 5KJ7A 3CCJP 4WY4D 1G2CB 4IFFA 2AXCA 5GTHH 1YJ9P 1SQBJ 4UB6E 2FKWB 1FU1A 3AE6C 1RF1A 1YQ4C 2YNYA 2CPSA 2NPSB 1A02F 1N7SA 3E1IA 1HF9A 1RE4C 1T3UA 3H1IE 4PJ0E 2O1KA 3VN0A 3H1HJ 1JMBA 1M57D 2YKOA 2W6BA 2YMYA 4UB8E 1N8RQ 3H1LJ 1TU3F 2XNDH 1GW3A 3P7KA 1KB9H 3CXHI 3CCEP 4N78E 2HPCB 4WY4C 5AW9B 4D6TJ 1S4XA 4IFDK 3G9RA 3VOPA 3ZDMA 1LTJC 4IL6H 3C9IA 1T8ZA 3A7OA 3BCCE 1MFZA 3TGUD 2C9LY 2KSJA 1N73B 3MUDA 3L70D 5CMZA 1UIXA 3WUUA 3GHGB 2WSEJ 1U7JA 4W80A 1N73A 1OXZA 2B89A 2Q1KA 4D6TE 1G1IA 1S2EA 1J1DC 1T2KC 3U1AA 3AEBC 3L70G 1URQB 1ZRTE 1EDIA 1VDFA 5AW0B 2GUVA 2BEZF 1YJNP 3VTPC 5KKZB 4R4MA 3PLNA 3Q5SA 1VQ7P 1SQBE 1S5LH 2WPSA 1NTKE 2QM8A 4WBAA 1SQVE 5AVSB 1HUCA 1KILA 1KN7A 4GIFA 3L72G 3O8ZA 5KTBA 3L4FA 1HWTC 1DEBA 3GLMA 3TGUE 2A45I 3TSIA 3V4WA 4C7RA 3G4SP 1SQBG 1NTZK 2N9YB 1FZCA 3LIEA 1M1JB 3H1JE 2O01N 3AEEC 2KLUA 1LT9C 2OTKE 2H43A 2Z4EA 3SWKA 1ZLLA 1L0LG 1NTMK 1KD1Q 1SQBD 1OVVA 2YIUC 2M5AA 3T97B 1S9KE 2ZAEB 3BCCJ 1CI6B 1K05A 2DW3A 3L73J 3CPWO 3OW2O 4NPDA 5AVWB 4GT1A 3H1JJ 4L75A 3L75J 3GHGC 1D7MA 1RHZB 2IX7C 3L71J 1N73C 2N1TD 1BCCG 1SQPE 1URQC 2ZXEB 1EZVD 2IBZE 3L72E 3MIWA 4JF7A 1YITP 1N7SD 2KSEA 1HTLC 2JWDA 4HYTB 3H1HG 2GUSA 2V7QJ 1YTZT 2O1JA 1HH0A 2WPRA 2IBZI 3CCLP 3A0BH 4HKZH 2D2CC 2B87A 2ZVOB 3EFGA 1NAFA 3SSUA 1HVVA 1S9KD 2QJKC 2ZT9C 2FXPA 3BATA 3MGNA 4WY4A 3KZIE 3VMXA 4PD4D 4ZNCA 1SQQE 5CBOA 3HD7C 5CCHD 3L75D 2E42A 1GK6A 2ZYGA 2KP8A 3CX5I 1NO4A 2QVAA 3GG2A 3B5NC 3MZWB 2ITAA 4IL6X 4U3FE 1H8AA 4I7ZB 2KLVA 1BE3J 2FFDA 1JTHB 1N7SC 3L75G 5TJHA 3GF7A 1KYOI 2H89C 2QE7H 3M06A 2Z5HA 2BCCG 2R3CA 3BVHA 3KQGA 4H44B 2WSEH 1L4AB 1SFCB 2XKMA 4N3YB 5B66H 3RL0g 1VQNP 1RF0C 1Y8AA 2IBZG 2ZT9D 3HD7A 3PP5A 5KLIC 1X8YA 2QJPC 5AVVB 2G3AA 2YKQA 3USSA 1XTCC 4XE5B 3B5NA 3TNUA 1SQPJ 2KNCB 3HD7D 2N1TA 1VQ5P 2OYIB 4KHXA 1SQQD 1K04A 1LGHB 1S1CX 3A0BE 3C8VA 4DCKA 2V7QH 3H1KE 3H6PA 2OYIC 3CWBG 4D6TG 1YHQP 3NFQA 4ZKUA 1PIXA 2FYUJ 5APVA 3A3YB 1YIJP 3PRJA 4D6TD 5CHXA 1PZQA 4OGQC 4BXLA 1OIPA 1SQQJ 4U7JA 5B5EH 1FOSF 1GD2E 5CCHA 3I56P 1NTKG 3M9HA 4JBZA 1SQVG 1EZVG 2BCCE 4BWNA 1DD4A 3G71P 3HE4B 2B88A 2YIUB 1NTMJ 3KDPB 1NTKD 1CI6A 2IZ1A 2XNXA 3V5BA 4C7NB 4HB1A 4YPCA 1P84I 1EDLA 1LT9B 1QGKB 4CPGA 2Y0EA 1M1JC 1N7SB 1HGZA 3AEFC 1LP1A 3UIAA 4PV1B 2A45G 2YO2A 3LIDA 1VF5C 3IF4A 3CCQP 1UIIA 2XZRA 1FZGA 2Q6QA 2FYZA 2R3SA 4OGQD 1P84D 4NPEA 1OW7A 3QH9A 1AFOA 2L5GB 4BRYB 1HBWA 1M90Q 3TDKA 3I55P 1RH5B 1YBKA 3O6QB 1GL2B 1KILC 2FXMA 3BRTB 3FXDA 2L91A 5H2FH 5K5GB 2D2CB 1NVOA 2BCCD 3L74G 2P1JA 5KLVK 1EDKA 2QG4A 1Z56A 1BCCE 1SQVJ 5B5EE 1Q82Q 2OARA 3EWKA 3L36A 3M0DC 1M8OB 1VQPP 1NYHA 1USDA 2NZ2A 1J1EB 2ZXXA 3CL3D 4GODA 2FFDB 1E79H 1R5SA 1VF5D 2W27A 1GU5A 1FBMA 1U7MA 2N1TB 1L4AD 1SFCD 1P84H 4H13C 2FYUG 1PGQA 4H13B 1ZRTD 4HJGH 3B8EB 2MJZA 3AEAC 2E76C 1PPJG 1J1EC 1S3JA 3CWBD 5DJTB 2QA4P 1LT1A 5AVQB 3S4RA 4DJGA 3JSVC 1PGOA 2WITA 1KYOD 4IFMA 1FOSE 2FYNB 1SQBK 1NHLA 1FDMA 1IZNB 1MZ9A 1JEKA 2KK7A 3AE3C 5GTHE 1PV3A 1LTIC 4H0LD 4M3LA 2P67A 2WZ7A 1RQVA 2V4HA 3L75E 3TF5A 1SQVD 5H2FE 1R5LA 2CK3H 2WSCJ 5KJ7D 2ZYAA 2AEJA 3T97A 1Y47A 5APUA 1IJDB 2RKLA 3D6ZA 1RE3C 2E76D 3CCSP 5E79E 3E7KA 1IFMA 1J1DB 3FGAD 2H7HA 1RF0A 2QRXA 3G3ZA 2QM7A 5TISH 1YTZI 1QX8A 2ZVNB 2PRRA 2RH0A 2XU6A 1FZEA 1FZFA 1JO5A 2AEFA 3KZIH 4C7NA 3CLQA 3MD0A 2IPPA 4GKGA 1EXIA 4RKUJ 3L35A 2JKVA 5APTA 1GU4A 2LKMA 2P2UA 2FFDC 1NKNA 3P8CD 2IFMA 4DZOA 2IZ0A 4LC1A 2WWWA 1OZHA 2OYHB 1NTKJ 1NTMD 2O3JA 1FC2C 1MKMA 2K1AA 1Q86Q 1NGMB 2K9YA 3L70J 3CX5H 3II6A 3WUVA 2YMKA 5DJUB 1IK7A 1FDIA 3TGUJ 2AEMA 3VP9A 3U1CA 3H1KD 1KZUB 1Q7YQ 3GMAA 5AW5B 1KQFB 2QJYB 1SQXD 3U59A 1KC8Q 4IL6E 2WPVB 4WY4B 1LTSC 2H88C 2M0BA 3Q5PA 1ZN5A 3R2PA 5APSA 1OW6A 1YI2P 2FYUD 1LWUB 3H1KG 3FXEA 1BCCD 1EZVI 3B4SA 3N4XA 4PV1C 1PP9E 3RK2B 5GTIH 1NTZE 1NTME 3IR9A 1GTWA 1EDJA 2MKVA 4RO0A 1KORA 3JCUH 1JM0A 1JTHA 3A0HH 4AYCA 2R32A 3H1HD 2Q9IA 3G6EP 3QWOC 2E75C 3IAOA 1N7LA 2KIKA 1OWAA 2Q3IA 4NPFX 1L4AA 1SFCA 1JY3N 2B9BA 2C0WA 2KUBA 3L71E 3VYIA 1KTMA 1T3JA 3TYYA 1MUUA 1SQVK 5AVZB 4OGQB 2Y9ZA 1BE3G 3K5BA 5KAFH 1DIPA 1SQXE 2OYHC 5AW6B 4TLFA 1SP4A 2IFNA 2QJKB 1ZP0C 2ZT9B 1VQKP 1H88A 1BCCJ 1AJYA 1L0LE 2WSFJ 4KJMA 3WUTA 2E75D 1OW8A 3RK3C 1KV4A 2W6AA 2YO3A 3H1IJ 2OTLP 1VQOP 1SQXJ 1DEEG 1JY2N 1SVFA 1EZVE 2IBZD 1PPJE 3H1JG 2IYOA 3H1KJ 3RK3E 3V2RA 1EXJA 5KAIE 5BU8B 1L0NG 3LW5H 1IC2A 1FAVA 2P58A 2UWJE 3RL0C 1OFCX 1KQLA 1DH3A 2KXPB 2HODB 4WWIA 1KILE 4GOEA 1S5LX 4I2LC 3Q2YA 2AXTH 4OH8B 3HE4A 5CCGC 2POHA 1LWUC 5AW7B 5GTIE 1SQXG 1ZW0A 4WB4A 1JNMA 1PPJD 1OX3A 3RK3D 3SFDC 1LTAC 2OYHA 3CC7P 1BGYJ 2JWAA 4H44D 3D71A 3V2QA 4L73A 3CCVP 5BVZA 1NU1G 1S5LE 1AQTA 3KPEA 5BU5A 1U57A 2KI7B 3L73D 2GM4A 3H1HE 3BCCD 4BRYA 3H32B 3L74E 1WMKA 1KYOH 2N1TC 1DX7A 1URQD 4K3AA 3V6IA 1NU1E 1YJWP 1YYCA 1MFTA 2FBWC 3VMAA 3L37A 4I1LA 2QIWA 1SQXK 5CJ0A 3RBXA 1VQ8P 3BRVB 4OVNF 1JMMA 2PP6A 3GF3A 4UB6H 2KNCA 4Y99B 5AVTB 2WTYA 1QVGO 1RF1C 3AE9C 1H0TA 4JYCA 2D2CD 4AUWA 3VMYA 3H25A 1ZV8A 2OTJP 1H89A 1JCCA 5TISE 3KXDA 2FYNC 2W8ZA 2PAJA 3B5ND 1VF5B 3CD6P 3L74D 3IN6A 1IO4A 1G1JA 3A0HE 5KLVD 3WMM0 1L0NJ 1NU1K 2HR3A 3CX5E 3HUSB 1KILB 3H1JD 2QSIA 4U3FD 1CZQA 1NTMG 2KYVA 3CWBE 5B66E 5L8RJ 5CBNA 2WQYC 4N6JA 3W68A 1M1KQ 5KKZC 4U3FG 1KYOE 1WT6A 3FWLA 1KQSO 2H8PD 1CSBA 1USEA 1HJ0A 3OJAB 3ABVC 3MTUE 4B86A 4DT0A 1NKZB 1BDCA 4I6MC 1GW4A 1N2DC 1SS1A 3HTKA 4H0LB 4YXWH 1NU1J 3CCMP 3FX0A 2M5AB 3Q5RA 3AECC 3PH0A 1RE3A 1KMIZ 4PJ0H 3NXSA 2K88A 1X9VA 3CCUP 1SQPD 1VQLP 3CMEP 1VQ6P 1AQ5A 3OA7A 1MV8A 4O9BA 4Y99C 1VQMP 2ZJSE 3SFEC 3WU2E 2FY8A 1WRGA 1OVUA 1T2KD 3M0AA 1K9MQ 1Q81Q 1K8AQ 1E5WA 4AQRD 2LR2A 3RK3B 3P8CE 2WSCH 1VQ9P 1XTGB 1GZLA 3AE1C 5E79H 2ZFCA 1LT9A 3O6QA 1NTZJ 2ZYDA 4EDFA 3I5CA 1YQ3C 2FYUK 1K73Q 2R5BA 1LTJB 1BE3D 1AA0A 3CXHH 4HH2A 4PD4E 1JY2P 2Z5IA 1L0NE 1L0LK 2E75B 1URQA 1LWUA 1LTTC 1OVRA 2IYPA 1T6AA 2VRSA 5KLVJ 2WSSH 1Q2NA 1NAYA 1W5CE 4Y28J 4TT3H 3GHGA 1EQ7A 3L70E 3PHLA 5AW1B 3CCRP 1LTGC 2XV5A 3M0DA 2NPSC 3AE2C 5AW3B 1JB0J 2QEXP 3GW6A 2IDBA 3CX5D 4WVZA 1L0ND 1ZXGA 1JOCA 1P84E 4U3FJ 1NOHA 4JQ0D 1PP9D 4YTPC 1KB9I 1JCDA 1Q90D 4I7ZC 3RBZA 5M1BA 2O01J 3B5NB 4IOIH 3TNUB 1HJBA 2HFED 2K3RA 2C0XA 2E5TA 3HD7B 3N7NA 2YXRB 3SWFA 2R44A 3M91A 2WVRA 4EOTA 1M1JA 3NTNA 1J2JB 2NPSD 4C46A 1L4AC 1SFCC 3D6YA 1FZCB 3WU2H 1JY2O 1VPCA 3AE8C 4RJTA 3HRNA 3HUSA 4JYBA 1SQPG 1X22A 4EI2A 1S72P 1BSHA 2WT7B 1L0NK 1KQGB 1KFMA 1QEXA 2HYNA 3P32A 3SWYA 4ZKPA 5KLIB 4ASWA 1L2PA 4OWFA 1PP9J 5AVUB 2FYUE 3EQ2A 5CCHC 4LGDE 2E43A 3VP8A 2Y0DA 3MUDC 3CMAP 4H0LC 1OMIA 2FXOA 1VL2A 2M8RA 3H1IG 2KZJA 3KYQA 1LTJA 5KJ7C 1IFJA 2I1JA 1ZMEC 4W7ZA 1GMJA 2WMMA 1NWQA 1SQPK 1JY3O 3CWBJ 3L71D 3MP7B 5AVXB 3JCUE 2O01H 3MHVA 4EIJA 2GA1A 2B87B 2RMZA 2OYOA 3L72D 2KZIA 2W83C 1FJKA 4RESB 3PTZA 5KLVG 1RE4A 3R4YA 1FZBA 3AE4C 4K35A 4W7YA 2HPCA 1NTZD 2Q7CA 4GOFA 2K37A 1ZR2A 3W67A 1ZR4A 1FZAA 1X79B 2R5DA
chains in the Genus database with same CATH topology
2P7JA 1FZFA 1IFNA 3NMDA 5CJ4A 2XDJA 3V2NA 3HUSC 1LTBC 5AVRB 2M3BA 1KFNA 3V2PA 1N86A 5APQA 2YKPA 3A2AA 5AVYB 2J58A 5CCGA 1QL2A 1IFIA 2HODA 3HTKB 1QL1A 3BASA 1GL2D 5APWA 1KILD 2WT7A 2NPSA 2HLOA 1RF1B 2C9NY 1A02J 2A45H 1GL2A 2J59M 4N78D 1FZCC 2N9BA 3TK1A 3IFMA 1JY3P 1RY3A 1GL2C 2KOGA 3HE5A 3RL0D 3HE5B 3RK2D 1JUNA 2JEEA 3CI9A 3H32A 3P8MC 5AW2B 5AW8B 5CCGD 4LLHA 2I1KA 3V4QA 2WPQA 3VMZA 1GDTA 2HG5D 3RL0B 1SLQA 2BASA 3OAKA 3M9BA 5APXA 2JJLA 1IK9A 2Q5UA 3RK2C 2WSFH 1NTKK 2CPBA 3A5TA 2KB7P 5APYA 1GK4A 1IFDA 1NH4A 1W2EA 1M7LA 4XA4A 4DOJA 2OYIA 1HGVA 3M9QA 5AW4B 1SQQK 1G2CA 5KJ7A 4WY4D 1G2CB 4IFFA 1RF1A 2FKWB 1FU1A 1A02F 2YNYA 2CPSA 2NPSB 1N7SA 3E1IA 1RE4C 1T3UA 3VN0A 2O1KA 2YKOA 2W6BA 2YMYA 1GW3A 3P7KA 4N78E 2HPCB 4WY4C 5AW9B 4IFDK 3VOPA 1LTJC 3C9IA 1T8ZA 3A7OA 1MFZA 2C9LY 2KSJA 1N73B 3MUDA 5CMZA 3GHGB 4W80A 1N73A 1OXZA 1G1IA 1J1DC 1T2KC 3U1AA 1URQB 5AW0B 1VDFA 2GUVA 3VTPC 2WPSA 2QM8A 4WBAA 5AVSB 1HUCA 1KILA 4GIFA 3O8ZA 5KTBA 3L4FA 1HWTC 1DEBA 2A45I 3TSIA 3V4WA 4C7RA 1FZCA 1NTZK 3LIEA 1M1JB 2H43A 1LT9C 2Z4EA 1ZLLA 1NTMK 1S9KE 1CI6B 5AVWB 4GT1A 3GHGC 2IX7C 1N73C 2N1TD 1URQC 2ZXEB 1GTWA 3MIWA 4JF7A 1N7SD 1HTLC 4HYTB 2GUSA 1YTZT 2O1JA 1HH0A 2WPRA 3EFGA 1NAFA 1S9KD 1HVVA 3BATA 3MGNA 4WY4A 3VMXA 5CCHD 2E42A 3HD7C 1GK6A 2KP8A 1H8AA 1NO4A 3B5NC 2KLVA 2FFDA 1JTHB 1N7SC 3M06A 2Z5HA 2R3CA 3KQGA 2WSEH 1L4AB 1SFCB 2XKMA 4N3YB 1RF0C 3PP5A 3HD7A 1X8YA 5AVVB 2YKQA 1XTCC 4XE5B 3B5NA 3TNUA 3HD7D 2OYIB 2N1TA 4KHXA 1LGHB 2OYIC 3H6PA 3NFQA 4ZKUA 5APVA 3A3YB 5CHXA 1FOSF 1GD2E 5CCHA 3M9HA 3HE4B 3KDPB 1CI6A 2XNXA 3V5BA 4C7NB 1LT9B 1M1JC 1N7SB 1HGZA 3UIAA 2A45G 2YO2A 3LIDA 2XZRA 1FZGA 2FYZA 1AFOA 2L5GB 1GL2B 1KILC 2FXMA 3BRTB 2P1JA 5KLVK 1Z56A 3L36A 2OARA 3M0DC 1J1EB 3CL3D 2FFDB 1FJPA 2W27A 1FBMA 2N1TB 1GU5A 1L4AD 1SFCD 3B8EB 2MJZA 1J1EC 5AVQB 2WITA 4IFMA 1FOSE 1SQBK 1NHLA 1FDMA 1MZ9A 1LTIC 4M3LA 2P67A 2WZ7A 5KJ7D 3T97A 5APUA 1IJDB 1RE3C 1IFMA 1J1DB 2H7HA 1RF0A 3G3ZA 2QM7A 1YTZI 1JO5A 2XU6A 1FZEA 4C7NA 3CLQA 3MD0A 2IPPA 4GKGA 3L35A 5APTA 1GU4A 2LKMA 2P2UA 2FFDC 1NKNA 3P8CD 2IFMA 4DZOA 4LC1A 2WWWA 2OYHB 3II6A 3VP9A 3U1CA 1KZUB 5AW5B 3U59A 4WY4B 1LTSC 1ZN5A 3R2PA 5APSA 1LWUB 3N4XA 3RK2B 3IR9A 4AYCA 1JTHA 2Q9IA 2R32A 1N7LA 1OWAA 2Q3IA 1L4AA 1SFCA 1JY3N 2C0WA 3VYIA 1T3JA 3TYYA 1MUUA 1SQVK 5AVZB 2OYHC 5AW6B 1SP4A 2IFNA 3RK3C 2W6AA 2YO3A 1JY2N 1SVFA 3V2RA 5BU8B 3LW5H 1IC2A 1FAVA 3RL0C 1DH3A 1KQLA 2HODB 4I2LC 4OH8B 3HE4A 5CCGC 2POHA 1LWUC 5AW7B 4WB4A 1JNMA 3RK3D 1LTAC 2OYHA 3V2QA 5BVZA 3KPEA 5BU5A 2GM4A 3H32B 2N1TC 1DX7A 1URQD 1YYCA 3L37A 4I1LA 5CJ0A 1SQXK 1HBWA 3BRVB 4Y99B 1JMMA 2PP6A 2WTYA 5AVTB 1RF1C 4JYCA 4AUWA 3VMYA 1ZV8A 1H89A 1JCCA 2PAJA 3B5ND 1IO4A 1G1JA 3WMM0 1NU1K 3BVHA 3HUSB 1KILB 1CW5A 1CZQA 2KYVA 4N6JA 1WT6A 2H8PD 1CSBA 3OJAB 3MTUE 4B86A 1NKZB 4I6MC 1GW4A 1N2DC 3HTKA 1H88A 1RE3A 1AQ5A 3NXSA 1X9VA 3OA7A 1MV8A 4O9BA 4Y99C 1WRGA 1T2KD 3M0AA 1E5WA 4AQRD 3RK3B 3P8CE 2WSCH 1XTGB 1GZLA 2ZFCA 1LT9A 3I5CA 2FYUK 2R5BA 1LTJB 4HH2A 1JY2P 2Z5IA 1L0LK 1URQA 1LWUA 1LTTC 2VRSA 3GHGA 1EQ7A 5AW1B 1LTGC 2XV5A 3M0DA 2NPSC 5AW3B 1JOCA 1NOHA 1JCDA 3B5NB 3TNUB 1HJBA 2HFED 2C0XA 3HD7B 3N7NA 3SWFA 3M91A 4EOTA 1M1JA 3NTNA 1J2JB 2NPSD 4C46A 1L4AC 1SFCC 1FZCB 1JY2O 1VPCA 3HRNA 3HUSA 4JYBA 2WT7B 1L0NK 1KFMA 2HYNA 3P32A 4ZKPA 3SWYA 1PFIA 5CCHC 5AVUB 3EQ2A 4LGDE 2E43A 3VP8A 2M8RA 3KYQA 1LTJA 5KJ7C 1IFJA 2I1JA 4W7ZA 1NWQA 1SQPK 1JY3O 5AVXB 2O01H 4EIJA 1FJKA 4RESB 1RE4A 1FZBA 4W7YA 2HPCA 1ZR2A 2Q7CA 1ZR4A 1FZAA 1X79B 2R5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 A;  1FZF A;  2FFD B;  1FZE A;  3GHG C;  2Q9I A;  1RF1 A;  2HLO A;  1RF1 C;  1N73 C;  1RE3 A;  2HOD B;  1RF1 B;  2XNX A;  1RF0 C;  3E1I A;  1RE4 C;  1LT9 B;  1JY3 N;  1T3U A;  2FFD C;  3HUS C;  1M1J C;  2A45 H;  1LTJ A;  2OYI B;  2A45 G;  1LWU C;  2OYH B;  1FZG A;  2A45 I;  1JY3 O;  1FZC A;  2OYH A;  2HPC B;  1LT9 A;  2OYI C;  1JY3 P;  1FZC C;  2OYH C;  1M1J B;  1N86 A;  1W2E A;  3HUS B;  2H43 A;  1LTJ B;  1LTJ C;  1LT9 C;  3BVH A;  2OYI A;  2Z4E A;  1M1J A;  1JY2 P;  3H32 B;  1RE4 A;  1FZB A;  1LWU A;  2HPC A;  1N73 B;  1FZC B;  3H32 A;  1JY2 O;  1RE3 C;  3GHG B;  1LWU B;  2HOD A;  3HUS A;  1FZA A;  1N73 A;  1JY2 N;  2FFD A;  3GHG A; 
#chains in the Genus database with same CATH topology
 2LXB A;  3EFF K;  2P7J A;  1PP9 G;  1L0L D;  2I8D A;  1NTZ G;  1IFN A;  2K9J B;  2PGD A;  3FWN A;  4GDO A;  3NMD A;  2YXQ B;  1M56 D;  1X0T A;  5C39 A;  3F89 A;  3H1L D;  2W90 A;  2XDJ A;  5CJ4 A;  3KHU A;  3V2N A;  2Y0C A;  4UB8 H;  1EC5 A;  1NU1 D;  3HUS C;  1LTB C;  1PGP A;  3L73 G;  5AVR B;  2M3B A;  3BCC G;  3AE5 C;  1KFN A;  3CXH E;  4PV1 D;  1FJP A;  3TGU G;  2E74 C;  2W6J H;  3V2P A;  1N86 A;  1AVY A;  3CC2 P;  5APQ A;  5KLV E;  2YKP A;  1IFP A;  2E74 B;  3A2A A;  4PD4 I;  5AVY B;  2J58 A;  1BE3 E;  2JR8 A;  1NJI Q;  3D70 A;  1LNQ A;  5CCG A;  1QL2 A;  1FS0 E;  1IFI A;  1ZOY C;  2BEQ D;  2HOD A;  2SPZ A;  3L72 J;  3HTK B;  1QL1 A;  3L74 J;  4XFJ A;  3LW5 J;  3BAS A;  3F5H A;  4Z1M H;  2Q3E A;  1GL2 D;  1PFI A;  1QVF O;  1R8E A;  1RQU A;  2E76 B;  1KIL D;  3JC2 2;  5APW A;  3RGU A;  2NPS A;  2HLO A;  4PD4 H;  4ZMD A;  2WT7 A;  5KAI H;  1RF1 B;  1FE6 A;  2E74 D;  2OGU A;  3L71 G;  1CW5 A;  2C9N Y;  2AXT E;  2NRG A;  3CXH D;  1PL5 A;  2PFX A;  3S9O A;  3L73 E;  3AE7 C;  1AVO A;  2A45 H;  1KB9 E;  1A02 J;  4L74 A;  1GL2 A;  2J59 M;  4JPZ B;  4N78 D;  4H13 D;  2JP3 A;  2N9B A;  1FZC C;  1BSN A;  3IFM A;  3TK1 A;  1JY3 P;  1RY3 A;  2G8Y A;  1GL2 C;  1L0L J;  2QJP B;  2KOG A;  1Y9B A;  1LP1 B;  2JO1 A;  3HE5 A;  1FDO A;  2E5Y A;  5EFW B;  1PGJ A;  3RL0 D;  3HE5 B;  2K9J A;  3RK2 D;  1JUN A;  1SQQ G;  4A7P A;  2JEE A;  3CI9 A;  3H32 A;  1H0T B;  1BGY D;  5KAF E;  3AED C;  2P10 A;  2M3E A;  3P8M C;  3H1L G;  5AW2 B;  4KT0 J;  5AW8 B;  2KS1 A;  5CCG D;  4LLH A;  2J5U A;  2LXC B;  3Q3D A;  1BGY G;  2JDI H;  1KB9 D;  3S1K A;  2I1K A;  1VQ4 P;  3V4Q A;  3E1R A;  2WPQ A;  4H44 C;  1AV1 A;  3VMZ A;  2HG5 D;  2QJY C;  3RL0 B;  1SLQ A;  2BAS A;  3H1L E;  2A06 E;  3B71 A;  3ITK A;  2KS1 B;  3C1L A;  3OAK A;  3M9B A;  5APX A;  2JJL A;  1IK9 A;  2Q5U A;  4L76 A;  1BGY E;  3RK2 C;  4ASV A;  4YXD C;  2WSF H;  1LJ2 A;  1NTK K;  2CPB A;  1DD3 A;  3A5T A;  3CC4 P;  1GDT A;  2KB7 P;  3H1I D;  2A06 G;  4QMA A;  5APY A;  1GK4 A;  1IFD A;  2RN0 A;  1NH4 A;  3PJS K;  1W2E A;  2BCC J;  1M7L A;  3Q1M A;  1W2B O;  4XA4 A;  2OQQ A;  1QLE D;  4DOJ A;  1BDD A;  2OYI A;  1HGV A;  3M9Q A;  4R4L A;  2A06 D;  5AW4 B;  1SQQ K;  2Y9Y A;  4MN4 C;  1G2C A;  3AEG C;  4EYY Q;  5KJ7 A;  3CCJ P;  4WY4 D;  1G2C B;  4IFF A;  2AXC A;  5GTH H;  1YJ9 P;  1SQB J;  4UB6 E;  2FKW B;  1FU1 A;  3AE6 C;  1RF1 A;  1YQ4 C;  2YNY A;  2CPS A;  2NPS B;  1A02 F;  1N7S A;  3E1I A;  1HF9 A;  1RE4 C;  1T3U A;  3H1I E;  4PJ0 E;  2O1K A;  3VN0 A;  3H1H J;  1JMB A;  1M57 D;  2YKO A;  2W6B A;  2YMY A;  4UB8 E;  1N8R Q;  3H1L J;  1TU3 F;  2XND H;  1GW3 A;  3P7K A;  1KB9 H;  3CXH I;  3CCE P;  4N78 E;  2HPC B;  4WY4 C;  5AW9 B;  4D6T J;  1S4X A;  4IFD K;  3G9R A;  3VOP A;  3ZDM A;  1LTJ C;  4IL6 H;  3C9I A;  1T8Z A;  3A7O A;  3BCC E;  1MFZ A;  3TGU D;  2C9L Y;  2KSJ A;  1N73 B;  3MUD A;  3L70 D;  5CMZ A;  1UIX A;  3WUU A;  3GHG B;  2WSE J;  1U7J A;  4W80 A;  1N73 A;  1OXZ A;  2B89 A;  2Q1K A;  4D6T E;  1G1I A;  1S2E A;  1J1D C;  1T2K C;  3U1A A;  3AEB C;  3L70 G;  1URQ B;  1ZRT E;  1EDI A;  1VDF A;  5AW0 B;  2GUV A;  2BEZ F;  1YJN P;  3VTP C;  5KKZ B;  4R4M A;  3PLN A;  3Q5S A;  1VQ7 P;  1SQB E;  1S5L H;  2WPS A;  1NTK E;  2QM8 A;  4WBA A;  1SQV E;  5AVS B;  1HUC A;  1KIL A;  1KN7 A;  4GIF A;  3L72 G;  3O8Z A;  5KTB A;  3L4F A;  1HWT C;  1DEB A;  3GLM A;  3TGU E;  2A45 I;  3TSI A;  3V4W A;  4C7R A;  3G4S P;  1SQB G;  1NTZ K;  2N9Y B;  1FZC A;  3LIE A;  1M1J B;  3H1J E;  2O01 N;  3AEE C;  2KLU A;  1LT9 C;  2OTK E;  2H43 A;  2Z4E A;  3SWK A;  1ZLL A;  1L0L G;  1NTM K;  1KD1 Q;  1SQB D;  1OVV A;  2YIU C;  2M5A A;  3T97 B;  1S9K E;  2ZAE B;  3BCC J;  1CI6 B;  1K05 A;  2DW3 A;  3L73 J;  3CPW O;  3OW2 O;  4NPD A;  5AVW B;  4GT1 A;  3H1J J;  4L75 A;  3L75 J;  3GHG C;  1D7M A;  1RHZ B;  2IX7 C;  3L71 J;  1N73 C;  2N1T D;  1BCC G;  1SQP E;  1URQ C;  2ZXE B;  1EZV D;  2IBZ E;  3L72 E;  3MIW A;  4JF7 A;  1YIT P;  1N7S D;  2KSE A;  1HTL C;  2JWD A;  4HYT B;  3H1H G;  2GUS A;  2V7Q J;  1YTZ T;  2O1J A;  1HH0 A;  2WPR A;  2IBZ I;  3CCL P;  3A0B H;  4HKZ H;  2D2C C;  2B87 A;  2ZVO B;  3EFG A;  1NAF A;  3SSU A;  1HVV A;  1S9K D;  2QJK C;  2ZT9 C;  2FXP A;  3BAT A;  3MGN A;  4WY4 A;  3KZI E;  3VMX A;  4PD4 D;  4ZNC A;  1SQQ E;  5CBO A;  3HD7 C;  5CCH D;  3L75 D;  2E42 A;  1GK6 A;  2ZYG A;  2KP8 A;  3CX5 I;  1NO4 A;  2QVA A;  3GG2 A;  3B5N C;  3MZW B;  2ITA A;  4IL6 X;  4U3F E;  1H8A A;  4I7Z B;  2KLV A;  1BE3 J;  2FFD A;  1JTH B;  1N7S C;  3L75 G;  5TJH A;  3GF7 A;  1KYO I;  2H89 C;  2QE7 H;  3M06 A;  2Z5H A;  2BCC G;  2R3C A;  3BVH A;  3KQG A;  4H44 B;  2WSE H;  1L4A B;  1SFC B;  2XKM A;  4N3Y B;  5B66 H;  3RL0 g;  1VQN P;  1RF0 C;  1Y8A A;  2IBZ G;  2ZT9 D;  3HD7 A;  3PP5 A;  5KLI C;  1X8Y A;  2QJP C;  5AVV B;  2G3A A;  2YKQ A;  3USS A;  1XTC C;  4XE5 B;  3B5N A;  3TNU A;  1SQP J;  2KNC B;  3HD7 D;  2N1T A;  1VQ5 P;  2OYI B;  4KHX A;  1SQQ D;  1K04 A;  1LGH B;  1S1C X;  3A0B E;  3C8V A;  4DCK A;  2V7Q H;  3H1K E;  3H6P A;  2OYI C;  3CWB G;  4D6T G;  1YHQ P;  3NFQ A;  4ZKU A;  1PIX A;  2FYU J;  5APV A;  3A3Y B;  1YIJ P;  3PRJ A;  4D6T D;  5CHX A;  1PZQ A;  4OGQ C;  4BXL A;  1OIP A;  1SQQ J;  4U7J A;  5B5E H;  1FOS F;  1GD2 E;  5CCH A;  3I56 P;  1NTK G;  3M9H A;  4JBZ A;  1SQV G;  1EZV G;  2BCC E;  4BWN A;  1DD4 A;  3G71 P;  3HE4 B;  2B88 A;  2YIU B;  1NTM J;  3KDP B;  1NTK D;  1CI6 A;  2IZ1 A;  2XNX A;  3V5B A;  4C7N B;  4HB1 A;  4YPC A;  1P84 I;  1EDL A;  1LT9 B;  1QGK B;  4CPG A;  2Y0E A;  1M1J C;  1N7S B;  1HGZ A;  3AEF C;  1LP1 A;  3UIA A;  4PV1 B;  2A45 G;  2YO2 A;  3LID A;  1VF5 C;  3IF4 A;  3CCQ P;  1UII A;  2XZR A;  1FZG A;  2Q6Q A;  2FYZ A;  2R3S A;  4OGQ D;  1P84 D;  4NPE A;  1OW7 A;  3QH9 A;  1AFO A;  2L5G B;  4BRY B;  1HBW A;  1M90 Q;  3TDK A;  3I55 P;  1RH5 B;  1YBK A;  3O6Q B;  1GL2 B;  1KIL C;  2FXM A;  3BRT B;  3FXD A;  2L91 A;  5H2F H;  5K5G B;  2D2C B;  1NVO A;  2BCC D;  3L74 G;  2P1J A;  5KLV K;  1EDK A;  2QG4 A;  1Z56 A;  1BCC E;  1SQV J;  5B5E E;  1Q82 Q;  2OAR A;  3EWK A;  3L36 A;  3M0D C;  1M8O B;  1VQP P;  1NYH A;  1USD A;  2NZ2 A;  1J1E B;  2ZXX A;  3CL3 D;  4GOD A;  2FFD B;  1E79 H;  1R5S A;  1VF5 D;  2W27 A;  1GU5 A;  1FBM A;  1U7M A;  2N1T B;  1L4A D;  1SFC D;  1P84 H;  4H13 C;  2FYU G;  1PGQ A;  4H13 B;  1ZRT D;  4HJG H;  3B8E B;  2MJZ A;  3AEA C;  2E76 C;  1PPJ G;  1J1E C;  1S3J A;  3CWB D;  5DJT B;  2QA4 P;  1LT1 A;  5AVQ B;  3S4R A;  4DJG A;  3JSV C;  1PGO A;  2WIT A;  1KYO D;  4IFM A;  1FOS E;  2FYN B;  1SQB K;  1NHL A;  1FDM A;  1IZN B;  1MZ9 A;  1JEK A;  2KK7 A;  3AE3 C;  5GTH E;  1PV3 A;  1LTI C;  4H0L D;  4M3L A;  2P67 A;  2WZ7 A;  1RQV A;  2V4H A;  3L75 E;  3TF5 A;  1SQV D;  5H2F E;  1R5L A;  2CK3 H;  2WSC J;  5KJ7 D;  2ZYA A;  2AEJ A;  3T97 A;  1Y47 A;  5APU A;  1IJD B;  2RKL A;  3D6Z A;  1RE3 C;  2E76 D;  3CCS P;  5E79 E;  3E7K A;  1IFM A;  1J1D B;  3FGA D;  2H7H A;  1RF0 A;  2QRX A;  3G3Z A;  2QM7 A;  5TIS H;  1YTZ I;  1QX8 A;  2ZVN B;  2PRR A;  2RH0 A;  2XU6 A;  1FZE A;  1FZF A;  1JO5 A;  2AEF A;  3KZI H;  4C7N A;  3CLQ A;  3MD0 A;  2IPP A;  4GKG A;  1EXI A;  4RKU J;  3L35 A;  2JKV A;  5APT A;  1GU4 A;  2LKM A;  2P2U A;  2FFD C;  1NKN A;  3P8C D;  2IFM A;  4DZO A;  2IZ0 A;  4LC1 A;  2WWW A;  1OZH A;  2OYH B;  1NTK J;  1NTM D;  2O3J A;  1FC2 C;  1MKM A;  2K1A A;  1Q86 Q;  1NGM B;  2K9Y A;  3L70 J;  3CX5 H;  3II6 A;  3WUV A;  2YMK A;  5DJU B;  1IK7 A;  1FDI A;  3TGU J;  2AEM A;  3VP9 A;  3U1C A;  3H1K D;  1KZU B;  1Q7Y Q;  3GMA A;  5AW5 B;  1KQF B;  2QJY B;  1SQX D;  3U59 A;  1KC8 Q;  4IL6 E;  2WPV B;  4WY4 B;  1LTS C;  2H88 C;  2M0B A;  3Q5P A;  1ZN5 A;  3R2P A;  5APS A;  1OW6 A;  1YI2 P;  2FYU D;  1LWU B;  3H1K G;  3FXE A;  1BCC D;  1EZV I;  3B4S A;  3N4X A;  4PV1 C;  1PP9 E;  3RK2 B;  5GTI H;  1NTZ E;  1NTM E;  3IR9 A;  1GTW A;  1EDJ A;  2MKV A;  4RO0 A;  1KOR A;  3JCU H;  1JM0 A;  1JTH A;  3A0H H;  4AYC A;  2R32 A;  3H1H D;  2Q9I A;  3G6E P;  3QWO C;  2E75 C;  3IAO A;  1N7L A;  2KIK A;  1OWA A;  2Q3I A;  4NPF X;  1L4A A;  1SFC A;  1JY3 N;  2B9B A;  2C0W A;  2KUB A;  3L71 E;  3VYI A;  1KTM A;  1T3J A;  3TYY A;  1MUU A;  1SQV K;  5AVZ B;  4OGQ B;  2Y9Z A;  1BE3 G;  3K5B A;  5KAF H;  1DIP A;  1SQX E;  2OYH C;  5AW6 B;  4TLF A;  1SP4 A;  2IFN A;  2QJK B;  1ZP0 C;  2ZT9 B;  1VQK P;  1H88 A;  1BCC J;  1AJY A;  1L0L E;  2WSF J;  4KJM A;  3WUT A;  2E75 D;  1OW8 A;  3RK3 C;  1KV4 A;  2W6A A;  2YO3 A;  3H1I J;  2OTL P;  1VQO P;  1SQX J;  1DEE G;  1JY2 N;  1SVF A;  1EZV E;  2IBZ D;  1PPJ E;  3H1J G;  2IYO A;  3H1K J;  3RK3 E;  3V2R A;  1EXJ A;  5KAI E;  5BU8 B;  1L0N G;  3LW5 H;  1IC2 A;  1FAV A;  2P58 A;  2UWJ E;  3RL0 C;  1OFC X;  1KQL A;  1DH3 A;  2KXP B;  2HOD B;  4WWI A;  1KIL E;  4GOE A;  1S5L X;  4I2L C;  3Q2Y A;  2AXT H;  4OH8 B;  3HE4 A;  5CCG C;  2POH A;  1LWU C;  5AW7 B;  5GTI E;  1SQX G;  1ZW0 A;  4WB4 A;  1JNM A;  1PPJ D;  1OX3 A;  3RK3 D;  3SFD C;  1LTA C;  2OYH A;  3CC7 P;  1BGY J;  2JWA A;  4H44 D;  3D71 A;  3V2Q A;  4L73 A;  3CCV P;  5BVZ A;  1NU1 G;  1S5L E;  1AQT A;  3KPE A;  5BU5 A;  1U57 A;  2KI7 B;  3L73 D;  2GM4 A;  3H1H E;  3BCC D;  4BRY A;  3H32 B;  3L74 E;  1WMK A;  1KYO H;  2N1T C;  1DX7 A;  1URQ D;  4K3A A;  3V6I A;  1NU1 E;  1YJW P;  1YYC A;  1MFT A;  2FBW C;  3VMA A;  3L37 A;  4I1L A;  2QIW A;  1SQX K;  5CJ0 A;  3RBX A;  1VQ8 P;  3BRV B;  4OVN F;  1JMM A;  2PP6 A;  3GF3 A;  4UB6 H;  2KNC A;  4Y99 B;  5AVT B;  2WTY A;  1QVG O;  1RF1 C;  3AE9 C;  1H0T A;  4JYC A;  2D2C D;  4AUW A;  3VMY A;  3H25 A;  1ZV8 A;  2OTJ P;  1H89 A;  1JCC A;  5TIS E;  3KXD A;  2FYN C;  2W8Z A;  2PAJ A;  3B5N D;  1VF5 B;  3CD6 P;  3L74 D;  3IN6 A;  1IO4 A;  1G1J A;  3A0H E;  5KLV D;  3WMM 0;  1L0N J;  1NU1 K;  2HR3 A;  3CX5 E;  3HUS B;  1KIL B;  3H1J D;  2QSI A;  4U3F D;  1CZQ A;  1NTM G;  2KYV A;  3CWB E;  5B66 E;  5L8R J;  5CBN A;  2WQY C;  4N6J A;  3W68 A;  1M1K Q;  5KKZ C;  4U3F G;  1KYO E;  1WT6 A;  3FWL A;  1KQS O;  2H8P D;  1CSB A;  1USE A;  1HJ0 A;  3OJA B;  3ABV C;  3MTU E;  4B86 A;  4DT0 A;  1NKZ B;  1BDC A;  4I6M C;  1GW4 A;  1N2D C;  1SS1 A;  3HTK A;  4H0L B;  4YXW H;  1NU1 J;  3CCM P;  3FX0 A;  2M5A B;  3Q5R A;  3AEC C;  3PH0 A;  1RE3 A;  1KMI Z;  4PJ0 H;  3NXS A;  2K88 A;  1X9V A;  3CCU P;  1SQP D;  1VQL P;  3CME P;  1VQ6 P;  1AQ5 A;  3OA7 A;  1MV8 A;  4O9B A;  4Y99 C;  1VQM P;  2ZJS E;  3SFE C;  3WU2 E;  2FY8 A;  1WRG A;  1OVU A;  1T2K D;  3M0A A;  1K9M Q;  1Q81 Q;  1K8A Q;  1E5W A;  4AQR D;  2LR2 A;  3RK3 B;  3P8C E;  2WSC H;  1VQ9 P;  1XTG B;  1GZL A;  3AE1 C;  5E79 H;  2ZFC A;  1LT9 A;  3O6Q A;  1NTZ J;  2ZYD A;  4EDF A;  3I5C A;  1YQ3 C;  2FYU K;  1K73 Q;  2R5B A;  1LTJ B;  1BE3 D;  1AA0 A;  3CXH H;  4HH2 A;  4PD4 E;  1JY2 P;  2Z5I A;  1L0N E;  1L0L K;  2E75 B;  1URQ A;  1LWU A;  1LTT C;  1OVR A;  2IYP A;  1T6A A;  2VRS A;  5KLV J;  2WSS H;  1Q2N A;  1NAY A;  1W5C E;  4Y28 J;  4TT3 H;  3GHG A;  1EQ7 A;  3L70 E;  3PHL A;  5AW1 B;  3CCR P;  1LTG C;  2XV5 A;  3M0D A;  2NPS C;  3AE2 C;  5AW3 B;  1JB0 J;  2QEX P;  3GW6 A;  2IDB A;  3CX5 D;  4WVZ A;  1L0N D;  1ZXG A;  1JOC A;  1P84 E;  4U3F J;  1NOH A;  4JQ0 D;  1PP9 D;  4YTP C;  1KB9 I;  1JCD A;  1Q90 D;  4I7Z C;  3RBZ A;  5M1B A;  2O01 J;  3B5N B;  4IOI H;  3TNU B;  1HJB A;  2HFE D;  2K3R A;  2C0X A;  2E5T A;  3HD7 B;  3N7N A;  2YXR B;  3SWF A;  2R44 A;  3M91 A;  2WVR A;  4EOT A;  1M1J A;  3NTN A;  1J2J B;  2NPS D;  4C46 A;  1L4A C;  1SFC C;  3D6Y A;  1FZC B;  3WU2 H;  1JY2 O;  1VPC A;  3AE8 C;  4RJT A;  3HRN A;  3HUS A;  4JYB A;  1SQP G;  1X22 A;  4EI2 A;  1S72 P;  1BSH A;  2WT7 B;  1L0N K;  1KQG B;  1KFM A;  1QEX A;  2HYN A;  3P32 A;  3SWY A;  4ZKP A;  5KLI B;  4ASW A;  1L2P A;  4OWF A;  1PP9 J;  5AVU B;  2FYU E;  3EQ2 A;  5CCH C;  4LGD E;  2E43 A;  3VP8 A;  2Y0D A;  3MUD C;  3CMA P;  4H0L C;  1OMI A;  2FXO A;  1VL2 A;  2M8R A;  3H1I G;  2KZJ A;  3KYQ A;  1LTJ A;  5KJ7 C;  1IFJ A;  2I1J A;  1ZME C;  4W7Z A;  1GMJ A;  2WMM A;  1NWQ A;  1SQP K;  1JY3 O;  3CWB J;  3L71 D;  3MP7 B;  5AVX B;  3JCU E;  2O01 H;  3MHV A;  4EIJ A;  2GA1 A;  2B87 B;  2RMZ A;  2OYO A;  3L72 D;  2KZI A;  2W83 C;  1FJK A;  4RES B;  3PTZ A;  5KLV G;  1RE4 A;  3R4Y A;  1FZB A;  3AE4 C;  4K35 A;  4W7Y A;  2HPC A;  1NTZ D;  2Q7C A;  4GOF A;  2K37 A;  1ZR2 A;  3W67 A;  1ZR4 A;  1FZA A;  1X79 B;  2R5D A; 
#chains in the Genus database with same CATH homology
 2P7J A;  1FZF A;  1IFN A;  3NMD A;  5CJ4 A;  2XDJ A;  3V2N A;  3HUS C;  1LTB C;  5AVR B;  2M3B A;  1KFN A;  3V2P A;  1N86 A;  5APQ A;  2YKP A;  3A2A A;  5AVY B;  2J58 A;  5CCG A;  1QL2 A;  1IFI A;  2HOD A;  3HTK B;  1QL1 A;  3BAS A;  1GL2 D;  5APW A;  1KIL D;  2WT7 A;  2NPS A;  2HLO A;  1RF1 B;  2C9N Y;  1A02 J;  2A45 H;  1GL2 A;  2J59 M;  4N78 D;  1FZC C;  2N9B A;  3TK1 A;  3IFM A;  1JY3 P;  1RY3 A;  1GL2 C;  2KOG A;  3HE5 A;  3RL0 D;  3HE5 B;  3RK2 D;  1JUN A;  2JEE A;  3CI9 A;  3H32 A;  3P8M C;  5AW2 B;  5AW8 B;  5CCG D;  4LLH A;  2I1K A;  3V4Q A;  2WPQ A;  3VMZ A;  1GDT A;  2HG5 D;  3RL0 B;  1SLQ A;  2BAS A;  3OAK A;  3M9B A;  5APX A;  2JJL A;  1IK9 A;  2Q5U A;  3RK2 C;  2WSF H;  1NTK K;  2CPB A;  3A5T A;  2KB7 P;  5APY A;  1GK4 A;  1IFD A;  1NH4 A;  1W2E A;  1M7L A;  4XA4 A;  4DOJ A;  2OYI A;  1HGV A;  3M9Q A;  5AW4 B;  1SQQ K;  1G2C A;  5KJ7 A;  4WY4 D;  1G2C B;  4IFF A;  1RF1 A;  2FKW B;  1FU1 A;  1A02 F;  2YNY A;  2CPS A;  2NPS B;  1N7S A;  3E1I A;  1RE4 C;  1T3U A;  3VN0 A;  2O1K A;  2YKO A;  2W6B A;  2YMY A;  1GW3 A;  3P7K A;  4N78 E;  2HPC B;  4WY4 C;  5AW9 B;  4IFD K;  3VOP A;  1LTJ C;  3C9I A;  1T8Z A;  3A7O A;  1MFZ A;  2C9L Y;  2KSJ A;  1N73 B;  3MUD A;  5CMZ A;  3GHG B;  4W80 A;  1N73 A;  1OXZ A;  1G1I A;  1J1D C;  1T2K C;  3U1A A;  1URQ B;  5AW0 B;  1VDF A;  2GUV A;  3VTP C;  2WPS A;  2QM8 A;  4WBA A;  5AVS B;  1HUC A;  1KIL A;  4GIF A;  3O8Z A;  5KTB A;  3L4F A;  1HWT C;  1DEB A;  2A45 I;  3TSI A;  3V4W A;  4C7R A;  1FZC A;  1NTZ K;  3LIE A;  1M1J B;  2H43 A;  1LT9 C;  2Z4E A;  1ZLL A;  1NTM K;  1S9K E;  1CI6 B;  5AVW B;  4GT1 A;  3GHG C;  2IX7 C;  1N73 C;  2N1T D;  1URQ C;  2ZXE B;  1GTW A;  3MIW A;  4JF7 A;  1N7S D;  1HTL C;  4HYT B;  2GUS A;  1YTZ T;  2O1J A;  1HH0 A;  2WPR A;  3EFG A;  1NAF A;  1S9K D;  1HVV A;  3BAT A;  3MGN A;  4WY4 A;  3VMX A;  5CCH D;  2E42 A;  3HD7 C;  1GK6 A;  2KP8 A;  1H8A A;  1NO4 A;  3B5N C;  2KLV A;  2FFD A;  1JTH B;  1N7S C;  3M06 A;  2Z5H A;  2R3C A;  3KQG A;  2WSE H;  1L4A B;  1SFC B;  2XKM A;  4N3Y B;  1RF0 C;  3PP5 A;  3HD7 A;  1X8Y A;  5AVV B;  2YKQ A;  1XTC C;  4XE5 B;  3B5N A;  3TNU A;  3HD7 D;  2OYI B;  2N1T A;  4KHX A;  1LGH B;  2OYI C;  3H6P A;  3NFQ A;  4ZKU A;  5APV A;  3A3Y B;  5CHX A;  1FOS F;  1GD2 E;  5CCH A;  3M9H A;  3HE4 B;  3KDP B;  1CI6 A;  2XNX A;  3V5B A;  4C7N B;  1LT9 B;  1M1J C;  1N7S B;  1HGZ A;  3UIA A;  2A45 G;  2YO2 A;  3LID A;  2XZR A;  1FZG A;  2FYZ A;  1AFO A;  2L5G B;  1GL2 B;  1KIL C;  2FXM A;  3BRT B;  2P1J A;  5KLV K;  1Z56 A;  3L36 A;  2OAR A;  3M0D C;  1J1E B;  3CL3 D;  2FFD B;  1FJP A;  2W27 A;  1FBM A;  2N1T B;  1GU5 A;  1L4A D;  1SFC D;  3B8E B;  2MJZ A;  1J1E C;  5AVQ B;  2WIT A;  4IFM A;  1FOS E;  1SQB K;  1NHL A;  1FDM A;  1MZ9 A;  1LTI C;  4M3L A;  2P67 A;  2WZ7 A;  5KJ7 D;  3T97 A;  5APU A;  1IJD B;  1RE3 C;  1IFM A;  1J1D B;  2H7H A;  1RF0 A;  3G3Z A;  2QM7 A;  1YTZ I;  1JO5 A;  2XU6 A;  1FZE A;  4C7N A;  3CLQ A;  3MD0 A;  2IPP A;  4GKG A;  3L35 A;  5APT A;  1GU4 A;  2LKM A;  2P2U A;  2FFD C;  1NKN A;  3P8C D;  2IFM A;  4DZO A;  4LC1 A;  2WWW A;  2OYH B;  3II6 A;  3VP9 A;  3U1C A;  1KZU B;  5AW5 B;  3U59 A;  4WY4 B;  1LTS C;  1ZN5 A;  3R2P A;  5APS A;  1LWU B;  3N4X A;  3RK2 B;  3IR9 A;  4AYC A;  1JTH A;  2Q9I A;  2R32 A;  1N7L A;  1OWA A;  2Q3I A;  1L4A A;  1SFC A;  1JY3 N;  2C0W A;  3VYI A;  1T3J A;  3TYY A;  1MUU A;  1SQV K;  5AVZ B;  2OYH C;  5AW6 B;  1SP4 A;  2IFN A;  3RK3 C;  2W6A A;  2YO3 A;  1JY2 N;  1SVF A;  3V2R A;  5BU8 B;  3LW5 H;  1IC2 A;  1FAV A;  3RL0 C;  1DH3 A;  1KQL A;  2HOD B;  4I2L C;  4OH8 B;  3HE4 A;  5CCG C;  2POH A;  1LWU C;  5AW7 B;  4WB4 A;  1JNM A;  3RK3 D;  1LTA C;  2OYH A;  3V2Q A;  5BVZ A;  3KPE A;  5BU5 A;  2GM4 A;  3H32 B;  2N1T C;  1DX7 A;  1URQ D;  1YYC A;  3L37 A;  4I1L A;  5CJ0 A;  1SQX K;  1HBW A;  3BRV B;  4Y99 B;  1JMM A;  2PP6 A;  2WTY A;  5AVT B;  1RF1 C;  4JYC A;  4AUW A;  3VMY A;  1ZV8 A;  1H89 A;  1JCC A;  2PAJ A;  3B5N D;  1IO4 A;  1G1J A;  3WMM 0;  1NU1 K;  3BVH A;  3HUS B;  1KIL B;  1CW5 A;  1CZQ A;  2KYV A;  4N6J A;  1WT6 A;  2H8P D;  1CSB A;  3OJA B;  3MTU E;  4B86 A;  1NKZ B;  4I6M C;  1GW4 A;  1N2D C;  3HTK A;  1H88 A;  1RE3 A;  1AQ5 A;  3NXS A;  1X9V A;  3OA7 A;  1MV8 A;  4O9B A;  4Y99 C;  1WRG A;  1T2K D;  3M0A A;  1E5W A;  4AQR D;  3RK3 B;  3P8C E;  2WSC H;  1XTG B;  1GZL A;  2ZFC A;  1LT9 A;  3I5C A;  2FYU K;  2R5B A;  1LTJ B;  4HH2 A;  1JY2 P;  2Z5I A;  1L0L K;  1URQ A;  1LWU A;  1LTT C;  2VRS A;  3GHG A;  1EQ7 A;  5AW1 B;  1LTG C;  2XV5 A;  3M0D A;  2NPS C;  5AW3 B;  1JOC A;  1NOH A;  1JCD A;  3B5N B;  3TNU B;  1HJB A;  2HFE D;  2C0X A;  3HD7 B;  3N7N A;  3SWF A;  3M91 A;  4EOT A;  1M1J A;  3NTN A;  1J2J B;  2NPS D;  4C46 A;  1L4A C;  1SFC C;  1FZC B;  1JY2 O;  1VPC A;  3HRN A;  3HUS A;  4JYB A;  2WT7 B;  1L0N K;  1KFM A;  2HYN A;  3P32 A;  4ZKP A;  3SWY A;  1PFI A;  5CCH C;  5AVU B;  3EQ2 A;  4LGD E;  2E43 A;  3VP8 A;  2M8R A;  3KYQ A;  1LTJ A;  5KJ7 C;  1IFJ A;  2I1J A;  4W7Z A;  1NWQ A;  1SQP K;  1JY3 O;  5AVX B;  2O01 H;  4EIJ A;  1FJK A;  4RES B;  1RE4 A;  1FZB A;  4W7Y A;  2HPC A;  1ZR2 A;  2Q7C A;  1ZR4 A;  1FZA A;  1X79 B;  2R5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...