1JY2P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords FIBRINOGEN ALPHA CHAIN
total genus 13
structure length 44
sequence length 44
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2P00
1RF1C 1FZCC 3HUSC 2OYHC 1T3UA 1RF1A 1M1JC 1LT9B 2OYIA 1FZAA 3H32A 1FZCA 2FFDB 1JY2P 1M1JA 1N86A 1LTJC 1JY2O 1FZBA 1LWUB 3E1IA 1LWUC 2OYIC 1RE4C 2Q9IA 1FZFA 1RF0A 2OYIB 3H32B 1RE4A 2Z4EA 1RF0C 1LT9C 2HODA 3HUSB 2OYHB 1RF1B 1FZCB 2A45G 2FFDA 2H43A 1LTJA 2A45H 1N73B 2HODB 1JY3N 1FZEA 1JY3P 3GHGC 2XNXA 1LT9A 1LTJB 3HUSA 2OYHA 1JY3O 3BVHA 3GHGB 2HLOA 2FFDC 2HPCB 1M1JB 1FZGA 1RE3A 1JY2N 1W2EA 1N73C 1LWUA 1RE3C 2HPCA 2A45I 1N73A 3GHGA
chains in the Genus database with same CATH superfamily
3RL0D 2Y9YA 1RF1C 1PPJD 1PGQA 1OMIA 2G8YA 1NU1D 4JQ0D 1VQ4P 1DIPA 2FFDB 5B5EE 1HUCA 3M06A 3D71A 1ZN5A 3CXHI 1NU1K 2D2CD 2OGUA 3LW5J 4XA4A 1EDIA 1PV3A 5CBNA 1N8RQ 3CC7P 3KDPB 3N7NA 4M3LA 3G6EP 1ZR2A 5H2FH 1BE3J 2KSJA 5AVYB 2YKPA 2GM4A 1SQVJ 2HODA 4NPDA 3RK3D 2HR3A 3MTUE 2Q6QA 2D2CC 3OAKA 1T2KD 3RBXA 1X79B 2K37A 3AE9C 4H44D 5TJHA 1SQVK 4WVZA 3L72E 2E75B 1YHQP 3VYIA 3RL0C 1AV1A 3L73D 1SQVD 4RO0A 2YXRB 3FWLA 4PD4D 3CCQP 1AFOA 2OYOA 2FYUD 2R3SA 2WSFJ 2O01N 3K5BA 3L70J 4C7RA 3JC22 2FYUK 2E76C 2R5BA 1VQ7P 2R32A 3AE5C 3L73G 1JB0J 1D7MA 1FJKA 1VL2A 3U59A 1L0LJ 2OYHC 1M1JC 3FX0A 3H1HD 4D6TG 1L0LE 3HTKA 1M1JA 4H44C 4U3FD 2C0WA 1NAYA 3RK2B 3H25A 3AE3C 3L70G 1R8EA 1RQUA 4AUWA 1S5LX 4AYCA 1N7SB 1DX7A 1W2BO 2O1JA 3B4SA 1IK9A 4WY4D 5KTBA 1KD1Q 1VQLP 1WT6A 3PH0A 2E74C 1AA0A 2WSCH 3A0BH 3GF3A 5AW0B 1SQBJ 1KFMA 1PL5A 1USDA 1KV4A 1LJ2A 1DD4A 2BEZF 1P84I 2QJYB 5AW4B 5KLVD 1NO4A 3V2QA 1H8AA 2PAJA 3MP7B 4JPZB 2H88C 5B66H 4IL6X 5CHXA 4MN4C 1YJWP 2H8PD 1OW7A 1KYOI 3L71G 1LTSC 1JCCA 1N73A 1AVYA 3T97B 1NOHA 3WMM0 3TGUE 2E74B 1S72P 1QVFO 2WMMA 3BCCE 3CL3D 5CCGA 1SQXG 1Q2NA 1NJIQ 3H1JG 5APWA 1T8ZA 2AEJA 5AVTB 4YXDC 3WU2H 1NTKK 1KC8Q 2Q9IA 2WPVB 1X8YA 1BGYG 2YO3A 3H1HE 4LGDE 1H88A 2XNDH 1PGOA 4PV1B 1NTZG 3S9OA 2OYHB 1SQXD 4PD4E 1KILD 4ASVA 3C9IA 4DOJA 1G2CB 1VF5B 1H0TA 1PP9E 4Y99C 4EYYQ 1M7LA 2AXTE 1FDMA 2QA4P 2PRRA 2WWWA 1GW3A 2ITAA 2A06E 1OX3A 2YXQB 3C8VA 1Q81Q 1GU5A 4YPCA 2OQQA 1IFIA 1GTWA 3H1LJ 1LP1B 1FZGA 3H1ID 2RN0A 4WB4A 1PIXA 2WSFH 4KHXA 3M91A 1S3JA 5DJUB 3NFQA 1KORA 4I7ZB 3RGUA 3H1KE 1KILA 2BASA 1R5SA 2GUVA 4W7YA 1K9MQ 2C9NY 2QEXP 4H13C 1YBKA 2ZXEB 3AEGC 4ASWA 2KI7B 4UB8H 1M90Q 1QL2A 5CCHD 1RE4A 4Y99B 1VQ8P 1VF5C 2N9YB 1EXIA 4A7PA 1GK6A 1NTKE 2KZJA 2AXTH 1CW5A 2QJKC 1PGJA 3LW5H 5CBOA 2FFDA 1BSHA 2FXPA 2GA1A 2LKMA 1JM0A 2NPSA 1JEKA 3H1JE 1LNQA 3L73J 3V4WA 1QX8A 2SPZA 3JCUH 4NPFX 1J2JB 4HB1A 3CCRP 3SFEC 1GU4A 1SQPK 3H1HG 1AVOA 2ZT9C 1N2DC 3HD7A 1IFNA 4OWFA 3BCCD 1RH5B 1Q82Q 1W2EA 1BDCA 1MZ9A 1Y47A 3E1RA 1S2EA 2M0BA 4OGQB 1BE3D 2Q7CA 4WWIA 5KAIH 2E43A 1LTTC 3GLMA 3E7KA 3H1IE 1N86A 2QM7A 2WSCJ 1NKZB 1SQPG 2W6JH 1T2KC 1KZUB 1LWUC 1NU1J 2O1KA 3EFFK 2WVRA 3SSUA 2QJYC 2WT7B 1ZR4A 3AEBC 1NTMG 5APVA 3B5NC 1PP9D 2P58A 1SFCD 3AE1C 1VQOP 1IO4A 2UWJE 3A0HH 3BCCJ 2IFMA 4U3FG 5AVQB 1J1EB 2IPPA 2KYVA 3MGNA 5KJ7C 2R44A 2KZIA 1L0LG 1YJNP 4N6JA 3R2PA 1JMBA 1MUUA 1N7SC 2ZXXA 2Y9ZA 1X0TA 3ITKA 3L74G 3HUSA 3VMAA 1JY3O 3BASA 1ZRTD 2JWDA 2LR2A 2M5AA 3AEFC 2KNCA 3N4XA 4LC1A 3TNUA 5KLIB 1HBWA 3H1JD 5APXA 1PPJE 2WSEH 2G3AA 1SFCB 2R5DA 4B86A 2A45I 5KAFH 2E42A 3L35A 4OVNF 2C9LY 4DZOA 1QVGO 2E76B 4PV1C 2QG4A 3LIEA 5KLIC 1LT1A 1JY2P 1KYOE 2FYZA 3L72G 3PHLA 4I2LC 1A02J 2KP8A 3L71D 3AE7C 3P32A 3B8EB 2KXPB 4BRYA 1VQMP 4I1LA 2OYIC 3L75E 1URQC 4GOEA 1VPCA 2M8RA 4TT3H 1SQBE 1IFJA 3CWBD 2P2UA 3HE5A 2V7QH 3MZWB 2D2CB 2MKVA 2A45G 2ZVNB 3EWKA 2KLUA 3P8CD 1CI6B 4DT0A 1L0NK 1YQ3C 3D6YA 1M56D 3V5BA 1URQD 4KT0J 1YJ9P 1FDOA 1SQPE 5EFWB 4ZNCA 3A5TA 1J1DB 3CI9A 1NTKJ 1NTME 2HLOA 5AW1B 4EIJA 3Q5SA 1OWAA 2KLVA 1RE3A 1Y8AA 2JR8A 2O3JA 3ABVC 3QWOC 4XE5B 1RE3C 3RL0g 2HPCA 4OGQC 5CCGD 2MJZA 2K9YA 2ZYDA 3CCEP 3L74J 3H32A 4HKZH 1KQGB 4PJ0H 3L74E 1FBMA 1HH0A 2H7HA 1T6AA 1MV8A 1SQQK 2OYIB 3HE4A 2HYNA 1RE4C 5AW6B 3RK3C 3CC2P 2FXMA 5AVSB 5TISH 4H0LD 2NPSD 3A7OA 1PPJG 1NHLA 2FBWC 3II6A 2FY8A 3L71E 2PFXA 2PP6A 1G1JA 5AVXB 1BDDA 2HFED 2QVAA 1VQ6P 1SQBK 1SFCC 1VDFA 2IBZG 3B5ND 3CX5H 4ZKUA 1XTCC 2M5AB 1EDLA 1EC5A 1JCDA 3P8CE 3HD7C 2JWAA 3BVHA 3EQ2A 4I6MC 1S1CX 4UB8E 1IJDB 1MFTA 3B71A 2IBZD 3IF4A 1HF9A 1X9VA 1J1EC 2XKMA 1SQVG 3GG2A 2E76D 1FJPA 5AVRB 1HTLC 2CPBA 2KS1B 4U3FJ 5DJTB 1HGZA 1LTJC 3TK1A 2W83C 1OVRA 1L0LD 5BU8B 1GDTA 3M9BA 1RF0C 1IC2A 3WUTA 3IFMA 1FS0E 5E79E 2B87B 1G1IA 3VMZA 4IFMA 2XU6A 3WU2E 1SQPD 3L70D 1ZMEC 2QJPC 2FYUJ 1QL1A 2QSIA 4H0LC 4PD4I 4Y28J 3Q5RA 3CWBJ 2IDBA 3FXEA 1KMIZ 3CPWO 1Q7YQ 5BVZA 2Z5HA 1L0NJ 3S4RA 1KB9I 1GL2B 1IK7A 3JCUE 3L71J 2FXOA 3AECC 1UIXA 4H0LB 3SFDC 1EXJA 3F89A 3CD6P 2P10A 1OW6A 3HD7D 1URQA 1R5LA 1M57D 1VQPP 1RF1A 1LT9B 1SQQE 2HG5D 1YI2P 2DW3A 4R4MA 3CCUP 5AVUB 3Q5PA 3VMXA 1OVVA 1M8OB 2KNCB 5AVWB 3WUVA 4H13B 1K04A 3SWKA 1KILB 1BCCE 2Z4EA 3F5HA 4IFDK 1Q90D 4EOTA 1OVUA 2WITA 5M1BA 2LXBA 4RJTA 1M1KQ 3H6PA 2IYPA 1ZW0A 2Q5UA 1EZVI 1EDKA 1JY3N 1URQB 2CK3H 2JO1A 4JYBA 1KILE 1BGYD 1KYOH 4IL6H 1OFCX 1N7SA 1SQXE 1GZLA 1PP9J 1XTGB 3CWBG 3L75G 1CZQA 1IFPA 2GUSA 4H44B 3TGUD 2WSEJ 4QMAA 5E79H 1M1JB 1W5CE 2POHA 5APSA 1N73C 3PRJA 1FAVA 3H1LE 2N1TD 5B66E 5K5GB 5AW5B 3RK2C 2K3RA 3GMAA 4WY4C 3SWYA 1E79H 3AE6C 3UIAA 2L5GB 3FGAD 4GODA 4BWNA 2M3BA 4NPEA 1SFCA 4KJMA 1L0ND 1NYHA 1N7SD 2E75C 1LTIC 4AQRD 3D70A 2JEEA 4WBAA 1U7MA 1WRGA 2ZYAA 5KJ7D 4BXLA 2JJLA 4LLHA 5GTHH 1H89A 1FZCB 3TYYA 3BRTB 1BSNA 1LTJA 3CLQA 3G3ZA 2RKLA 1SQPJ 1U7JA 3VP8A 2FYNC 4BRYB 2ZYGA 2HODB 3NXSA 5CMZA 1KN7A 1JMMA 3M0DA 1NTMJ 3GHGC 4PV1D 2Z5IA 5C39A 4Z1MH 3G71P 3HTKB 1SS1A 3I5CA 3O6QB 1BCCG 3GHGB 4ZMDA 1SQXK 3AEDC 2FFDC 3PTZA 3U1AA 2FYNB 2J5UA 4IFFA 1GL2A 2Y0CA 2WTYA 1K73Q 1DEEG 4U7JA 2J59M 1JUNA 1FZCC 2IBZE 4GT1A 4C7NA 3VOPA 1BCCD 1S4XA 1JOCA 3KXDA 1IZNB 1K05A 3SWFA 2LXCB 4JF7A 1JY2O 1BE3E 1KB9H 3H1LD 2BCCG 2P7JA 5GTHE 1VQNP 3RK3E 1QEXA 1TU3F 3VTPC 2KUBA 3KPEA 2IZ0A 1KQSO 2E5TA 3M0AA 2FYUG 1SQVE 1YTZT 2WQYC 1FOSF 4W80A 2WSSH 3W67A 2B89A 2BCCD 1VQ9P 4CPGA 1P84D 5AW8B 3V2PA 1NTMD 1E5WA 2AEFA 3L70E 5GTIE 4O9BA 2NZ2A 1GW4A 1LTJB 3AEEC 4D6TD 3RL0B 2B9BA 3Q2YA 1MFZA 3TSIA 5KKZC 4IL6E 2ZT9D 1T3JA 1YIJP 1ZRTE 1L0LK 3GHGA 3L74D 4U3FE 1PZQA 3HUSC 2W8ZA 1LGHB 1T3UA 1S9KE 4IOIH 4C46A 3KHUA 1JNMA 1WMKA 2WPRA 3A2AA 1NVOA 3EFGA 1KILC 1GK4A 1RQVA 3G9RA 3CX5D 2OTLP 1HWTC 5CJ0A 1KYOD 3USSA 2N9BA 1S5LH 1ZP0C 4PD4H 1LT9C 3MD0A 3CCMP 1VQ5P 3B5NA 3L75D 4RESB 1OW8A 2E75D 3IAOA 3TGUG 3H1KJ 5GTIH 5KLVJ 2VRSA 5KLVE 5B5EH 1NGMB 5TISE 2H43A 1AQ5A 1SQBD 1IFMA 1SQQG 2ZJSE 4EI2A 1RHZB 1CI6A 2Q3IA 3HRNA 5AW3B 5APQA 3RK3B 3U1CA 5AW9B 1NH4A 2N1TC 4OGQD 1BGYE 1UIIA 3V2NA 2HPCB 1ZLLA 5APTA 1JY2N 1VQKP 4HJGH 1NKNA 1L2PA 2QJPB 1K8AQ 5H2FE 2ZFCA 1L0NG 2KIKA 1USEA 3PJSK 2K1AA 3L36A 1SP4A 1Z56A 1FZAA 5CCHA 1Q86Q 2Q1KA 1HGVA 3NTNA 1NWQA 2XDJA 1JTHB 4JBZA 2E74D 1EQ7A 3E1IA 3H1JJ 4K35A 3QH9A 3TDKA 5KJ7A 3A0BE 3OW2O 3V4QA 5L8RJ 1FZFA 3FWNA 2O01H 1A02F 1FOSE 1P84E 3CC4P 1DD3A 1KFNA 1QGKB 1PGPA 3HUSB 3S1KA 3CMAP 4D6TJ 3OA7A 2P67A 3BATA 1KTMA 3VN0A 3H1KG 1LTGC 3NMDA 1EZVD 2QIWA 4N78E 1FZEA 1N7LA 2QRXA 4YXWH 5APYA 4DCKA 5KLVK 1GMJA 2YO2A 1LT9A 3A0HE 3LIDA 3A3YB 3R4YA 4TLFA 5BU5A 3Q1MA 3BRVB 3M9HA 3VP9A 2IYOA 1AJYA 1HJ0A 3FXDA 1ZOYC 3MUDA 2K9JB 2YKOA 4WY4B 3H1KD 4HH2A 2KK7A 2WT7A 2J58A 3L75J 2R3CA 1OZHA 1S5LE 2YIUC 2KB7P 3CXHD 4RKUJ 1FC2C 2KS1A 4DJGA 1X22A 3AE4C 3CX5E 1KB9E 1PFIA 4UB6H 1VF5D 1QLED 3CCLP 5KAFE 3V6IA 2KSEA 3CCSP 2BEQD 2AXCA 2B88A 2Q3EA 2M3EA 4OH8B 4R4LA 1KQFB 1RY3A 2L91A 1GD2E 3KZIE 4H13D 2IFNA 2WZ7A 4L73A 1Y9BA 2NRGA 3H1LG 3BCCG 2A45H 3L37A 1FU1A 3L73E 4YTPC 1YITP 2IX7C 3RK2D 1LP1A 1BE3G 3I55P 2XNXA 2BCCE 5CCGC 4C7NB 5AVVB 1J1DC 2WPQA 2PGDA 2XZRA 3MUDC 2BCCJ 2I1KA 4W7ZA 3ZDMA 1FDIA 1LTBC 1EZVE 1GL2D 4N78D 2I8DA 3VMYA 1NTZE 2W6AA 2OYIA 1NAFA 1NTZJ 1G2CA 3I56P 3CX5I 2K9JA 3O6QA 1PP9G 2I1JA 2RMZA 1MKMA 2WPSA 3PP5A 4WY4A 1FZCA 5KAIE 3Q3DA 1JO5A 3KYQA 1HJBA 2N1TB 2P1JA 2JKVA 1SQQJ 2RH0A 3CXHE 3H1IJ 1BCCJ 2V7QJ 3KZIH 3L72J 4ZKPA 1RF0A 5AVZB 2QM8A 1ZV8A 1NU1E 1HVVA 2XV5A 3AE8C 4N3YB 2KOGA 2C0XA 2OTKE 5CCHC 1DEBA 1IFDA 1YTZI 2IZ1A 2QJKB 3IN6A 3P8MC 4XFJA 2AEMA 5AW7B 4UB6E 4HYTB 3CCJP 1NTKD 2JDIH 2YIUB 3HE4B 4JYCA 2NPSC 3AEAC 1N73B 3CMEP 2K88A 1SQXJ 1L4AA 1DH3A 5APUA 2YMKA 1FE6A 1L4AC 3G4SP 3O8ZA 3V2RA 2OYHA 1EDJA 2Y0DA 3AE2C 2N1TA 3L72D 1KB9D 1NTKG 1SQQD 1SQBG 5AW2B 1LTAC 1OIPA 1YQ4C 4I7ZC 3TNUB 1LWUA 3M9QA 5CJ4A 5KLVG 3C1LA 1JTHA 1L4AD 2FYUE 3L4FA 1NTZK 2W27A 5KKZB 3JSVC 2OTJP 1NTZD 3B5NB 3GW6A 2YKQA 1ZXGA 2B87A 3WUUA 3T97A 3HD7B 1H0TB 1FZBA 1LWUB 1L4AB 1P84H 2JP3A 1U57A 3CWBE 1AQTA 1EZVG 3PLNA 3H32B 2A06G 3D6ZA 3HE5B 2NPSB 2O01J 4L74A 3GF7A 4GKGA 1L0NE 2YMYA 4GIFA 4L75A 1RF1B 2Y0EA 2W90A 3MIWA 2FKWB 3P7KA 1CSBA 3H1IG 3CXHH 1SLQA 3TGUJ 2E5YA 2OARA 4EDFA 2A06D 1GL2C 2ZAEB 4PJ0E 4D6TE 1NTMK 1BGYJ 1JY3P 2ZT9B 2ZVOB 1KQLA 1OXZA 3M0DC 3IR9A 2V4HA 4K3AA 4L76A 1NU1G 3OJAB 3TF5A 3CCVP 1YYCA 3MHVA 2W6BA 2IBZI 3W68A 2H89C 2CPSA 3RBZA 1SVFA 2QE7H 4GDOA 2YNYA 3KQGA 1S9KD 3H1HJ 4GOFA
chains in the Genus database with same CATH topology
3RL0D 1RF1C 2FFDB 1HUCA 3M06A 1ZN5A 1NU1K 4XA4A 3KDPB 3N7NA 4M3LA 1ZR2A 2KSJA 5AVYB 2YKPA 2GM4A 2HODA 3RK3D 3MTUE 3OAKA 1T2KD 1X79B 1SQVK 3VYIA 3RL0C 1AFOA 4C7RA 2FYUK 2R5BA 2R32A 1FJKA 2OYHC 3U59A 1M1JC 3HTKA 1M1JA 2C0WA 4AUWA 4AYCA 1DX7A 1N7SB 2O1JA 5KTBA 1IK9A 4WY4D 1WT6A 2WSCH 5AW0B 1KFMA 3V2QA 5AW4B 1NO4A 1H8AA 2PAJA 5CHXA 2H8PD 1LTSC 1JCCA 1N73A 1NOHA 3WMM0 3CL3D 5APWA 1T8ZA 5AVTB 2Q9IA 1NTKK 1X8YA 2YO3A 1H88A 2OYHB 1KILD 3C9IA 4DOJA 1G2CB 4Y99C 1M7LA 1FDMA 2WWWA 1GW3A 1GU5A 1IFIA 1GTWA 1FZGA 4WB4A 2WSFH 4KHXA 3M91A 3NFQA 1KILA 2BASA 2GUVA 4W7YA 2C9NY 2ZXEB 1QL2A 5CCHD 1RE4A 4Y99B 1GK6A 1CW5A 3LW5H 2FFDA 2LKMA 2NPSA 3V4WA 1J2JB 1GU4A 1SQPK 3HD7A 1N2DC 1IFNA 1W2EA 1MZ9A 2Q7CA 2E43A 1LTTC 1N86A 2QM7A 1NKZB 1T2KC 1KZUB 1LWUC 2O1KA 2WT7B 1ZR4A 5APVA 3B5NC 1IO4A 1SFCD 2IFMA 5AVQB 1J1EB 2IPPA 2KYVA 3MGNA 5KJ7C 4N6JA 3R2PA 1MUUA 1N7SC 3HUSA 1JY3O 3BASA 4LC1A 4LGDE 3TNUA 3N4XA 1HBWA 5APXA 2WSEH 1SFCB 2R5DA 4B86A 2A45I 2E42A 3L35A 2C9LY 4DZOA 3LIEA 1JY2P 2FYZA 4I2LC 1A02J 2KP8A 3P32A 3B8EB 2OYIC 4I1LA 1URQC 1VPCA 2M8RA 1IFJA 2P2UA 3HE5A 2A45G 3P8CD 1CI6B 1L0NK 3V5BA 1URQD 3A5TA 1J1DB 3CI9A 4EIJA 2HLOA 5AW1B 1OWAA 2KLVA 1RE3A 4XE5B 1RE3C 2HPCA 5CCGD 2MJZA 3H32A 1FBMA 1HH0A 2H7HA 1MV8A 1SQQK 2OYIB 3HE4A 2HYNA 1RE4C 5AW6B 3RK3C 2FXMA 5AVSB 2NPSD 3A7OA 1NHLA 5AVXB 3II6A 1FOSE 2PP6A 1G1JA 2HFED 1SQBK 1SFCC 1VDFA 3B5ND 4ZKUA 1XTCC 1JCDA 3P8CE 3HD7C 3BVHA 3EQ2A 4I6MC 1IJDB 1X9VA 1J1EC 2XKMA 1FJPA 5AVRB 1HTLC 2CPBA 1HGZA 1LTJC 3TK1A 5BU8B 1GDTA 1RF0C 1IC2A 3IFMA 1G1IA 3VMZA 4IFMA 2XU6A 1QL1A 5BVZA 2Z5HA 1GL2B 3HD7D 1URQA 1RF1A 1LT9B 2HG5D 5AVUB 3VMXA 5AVWB 1KILB 2Z4EA 4IFDK 4EOTA 2WITA 3H6PA 2Q5UA 1JY3N 1URQB 4JYBA 1N7SA 3O8ZA 1GZLA 1XTGB 1CZQA 2GUSA 1M1JB 2POHA 5APSA 1N73C 1FAVA 2N1TD 5AW5B 3RK2C 3SWYA 4WY4C 3UIAA 2L5GB 2M3BA 1SFCA 1N7SD 1LTIC 4AQRD 2JEEA 4WBAA 1WRGA 5KJ7D 1H89A 2JJLA 4LLHA 1FZCB 3TYYA 3BRTB 3G3ZA 1LTJA 3CLQA 3VP8A 2HODB 3NXSA 5CMZA 1JMMA 3M0DA 3GHGC 2Z5IA 3HTKB 3I5CA 3GHGB 1SQXK 2FFDC 3U1AA 4IFFA 1GL2A 2WTYA 1JUNA 2J59M 1FZCC 4GT1A 4C7NA 3VOPA 1JOCA 3SWFA 4JF7A 1JY2O 2P7JA 3VTPC 3KPEA 3M0AA 1YTZT 1FOSF 4W80A 5AW8B 3V2PA 1E5WA 4O9BA 1GW4A 1LTJB 3RL0B 1MFZA 3TSIA 1T3JA 3GHGA 1L0LK 3HUSC 1S9KE 1LGHB 1T3UA 1JNMA 4C46A 2WPRA 3A2AA 3EFGA 1KILC 1GK4A 1HWTC 5CJ0A 2N9BA 1LT9C 3MD0A 3B5NA 4RESB 1AQ5A 2VRSA 2H43A 1IFMA 1CI6A 2Q3IA 3HRNA 5AW3B 5APQA 3RK3B 3U1CA 5AW9B 1NH4A 2N1TC 3V2NA 2HPCB 1ZLLA 5APTA 1JY2N 1NKNA 2ZFCA 3L36A 1SP4A 1Z56A 1FZAA 5CCHA 1NWQA 1HGVA 3NTNA 2XDJA 1JTHB 3E1IA 1EQ7A 5KJ7A 1FZFA 3V4QA 2O01H 1A02F 1KFNA 3HUSB 3OA7A 2P67A 3BATA 3VN0A 1LTGC 3NMDA 4N78E 1FZEA 1N7LA 5KLVK 5APYA 2YO2A 3LIDA 1LT9A 5BU5A 3A3YB 3BRVB 3M9HA 3VP9A 3MUDA 2YKOA 4WY4B 4HH2A 2WT7A 2J58A 2R3CA 2KB7P 1PFIA 4OH8B 1RY3A 1GD2E 2IFNA 2WZ7A 3L37A 2A45H 1FU1A 2IX7C 3RK2D 2XNXA 5CCGC 4C7NB 5AVVB 1J1DC 2WPQA 4W7ZA 2XZRA 2I1KA 1LTBC 4N78D 1GL2D 3VMYA 2W6AA 2OYIA 1NAFA 1G2CA 3PP5A 4WY4A 2I1JA 1JO5A 1FZCA 2WPSA 3KYQA 1HJBA 2N1TB 2P1JA 4ZKPA 1RF0A 5AVZB 2QM8A 1ZV8A 1HVVA 2XV5A 4N3YB 2KOGA 2C0XA 5CCHC 1DEBA 1IFDA 1YTZI 5AW7B 3RK2B 3P8MC 4HYTB 3HE4B 4JYCA 1N73B 2NPSC 1L4AA 1DH3A 5APUA 1L4AC 3V2RA 2OYHA 2N1TA 5AW2B 3TNUB 1LTAC 5CJ4A 1LWUA 3M9QA 1L4AD 1JTHA 3L4FA 1NTZK 2W27A 3B5NB 2YKQA 3T97A 3HD7B 1FZBA 1LWUB 1L4AB 3H32B 3HE5B 2NPSB 4GKGA 2YMYA 4GIFA 1RF1B 3MIWA 2FKWB 3P7KA 1CSBA 1SLQA 2OARA 5CCGA 1GL2C 1NTMK 1JY3P 1KQLA 1OXZA 3M0DC 3IR9A 3OJAB 1YYCA 2W6BA 2CPSA 1S9KD 1SVFA 2YNYA 3KQGA 3M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF1 C;  1FZC C;  3HUS C;  2OYH C;  1T3U A;  1RF1 A;  1M1J C;  1LT9 B;  2OYI A;  1FZA A;  3H32 A;  1FZC A;  2FFD B;  1JY2 P;  1M1J A;  1N86 A;  1LTJ C;  1JY2 O;  1FZB A;  1LWU B;  3E1I A;  1LWU C;  2OYI C;  1RE4 C;  2Q9I A;  1FZF A;  1RF0 A;  2OYI B;  3H32 B;  1RE4 A;  2Z4E A;  1RF0 C;  1LT9 C;  2HOD A;  3HUS B;  2OYH B;  1RF1 B;  1FZC B;  2A45 G;  2FFD A;  2H43 A;  1LTJ A;  2A45 H;  1N73 B;  2HOD B;  1JY3 N;  1FZE A;  1JY3 P;  3GHG C;  2XNX A;  1LT9 A;  1LTJ B;  3HUS A;  2OYH A;  1JY3 O;  3BVH A;  3GHG B;  2HLO A;  2FFD C;  2HPC B;  1M1J B;  1FZG A;  1RE3 A;  1JY2 N;  1W2E A;  1N73 C;  1LWU A;  1RE3 C;  2HPC A;  2A45 I;  1N73 A;  3GHG A; 
#chains in the Genus database with same CATH topology
 3RL0 D;  2Y9Y A;  1RF1 C;  1PPJ D;  1PGQ A;  1OMI A;  2G8Y A;  1NU1 D;  4JQ0 D;  1VQ4 P;  1DIP A;  2FFD B;  5B5E E;  1HUC A;  3M06 A;  3D71 A;  1ZN5 A;  3CXH I;  1NU1 K;  2D2C D;  2OGU A;  3LW5 J;  4XA4 A;  1EDI A;  1PV3 A;  5CBN A;  1N8R Q;  3CC7 P;  3KDP B;  3N7N A;  4M3L A;  3G6E P;  1ZR2 A;  5H2F H;  1BE3 J;  2KSJ A;  5AVY B;  2YKP A;  2GM4 A;  1SQV J;  2HOD A;  4NPD A;  3RK3 D;  2HR3 A;  3MTU E;  2Q6Q A;  2D2C C;  3OAK A;  1T2K D;  3RBX A;  1X79 B;  2K37 A;  3AE9 C;  4H44 D;  5TJH A;  1SQV K;  4WVZ A;  3L72 E;  2E75 B;  1YHQ P;  3VYI A;  3RL0 C;  1AV1 A;  3L73 D;  1SQV D;  4RO0 A;  2YXR B;  3FWL A;  4PD4 D;  3CCQ P;  1AFO A;  2OYO A;  2FYU D;  2R3S A;  2WSF J;  2O01 N;  3K5B A;  3L70 J;  4C7R A;  3JC2 2;  2FYU K;  2E76 C;  2R5B A;  1VQ7 P;  2R32 A;  3AE5 C;  3L73 G;  1JB0 J;  1D7M A;  1FJK A;  1VL2 A;  3U59 A;  1L0L J;  2OYH C;  1M1J C;  3FX0 A;  3H1H D;  4D6T G;  1L0L E;  3HTK A;  1M1J A;  4H44 C;  4U3F D;  2C0W A;  1NAY A;  3RK2 B;  3H25 A;  3AE3 C;  3L70 G;  1R8E A;  1RQU A;  4AUW A;  1S5L X;  4AYC A;  1N7S B;  1DX7 A;  1W2B O;  2O1J A;  3B4S A;  1IK9 A;  4WY4 D;  5KTB A;  1KD1 Q;  1VQL P;  1WT6 A;  3PH0 A;  2E74 C;  1AA0 A;  2WSC H;  3A0B H;  3GF3 A;  5AW0 B;  1SQB J;  1KFM A;  1PL5 A;  1USD A;  1KV4 A;  1LJ2 A;  1DD4 A;  2BEZ F;  1P84 I;  2QJY B;  5AW4 B;  5KLV D;  1NO4 A;  3V2Q A;  1H8A A;  2PAJ A;  3MP7 B;  4JPZ B;  2H88 C;  5B66 H;  4IL6 X;  5CHX A;  4MN4 C;  1YJW P;  2H8P D;  1OW7 A;  1KYO I;  3L71 G;  1LTS C;  1JCC A;  1N73 A;  1AVY A;  3T97 B;  1NOH A;  3WMM 0;  3TGU E;  2E74 B;  1S72 P;  1QVF O;  2WMM A;  3BCC E;  3CL3 D;  5CCG A;  1SQX G;  1Q2N A;  1NJI Q;  3H1J G;  5APW A;  1T8Z A;  2AEJ A;  5AVT B;  4YXD C;  3WU2 H;  1NTK K;  1KC8 Q;  2Q9I A;  2WPV B;  1X8Y A;  1BGY G;  2YO3 A;  3H1H E;  4LGD E;  1H88 A;  2XND H;  1PGO A;  4PV1 B;  1NTZ G;  3S9O A;  2OYH B;  1SQX D;  4PD4 E;  1KIL D;  4ASV A;  3C9I A;  4DOJ A;  1G2C B;  1VF5 B;  1H0T A;  1PP9 E;  4Y99 C;  4EYY Q;  1M7L A;  2AXT E;  1FDM A;  2QA4 P;  2PRR A;  2WWW A;  1GW3 A;  2ITA A;  2A06 E;  1OX3 A;  2YXQ B;  3C8V A;  1Q81 Q;  1GU5 A;  4YPC A;  2OQQ A;  1IFI A;  1GTW A;  3H1L J;  1LP1 B;  1FZG A;  3H1I D;  2RN0 A;  4WB4 A;  1PIX A;  2WSF H;  4KHX A;  3M91 A;  1S3J A;  5DJU B;  3NFQ A;  1KOR A;  4I7Z B;  3RGU A;  3H1K E;  1KIL A;  2BAS A;  1R5S A;  2GUV A;  4W7Y A;  1K9M Q;  2C9N Y;  2QEX P;  4H13 C;  1YBK A;  2ZXE B;  3AEG C;  4ASW A;  2KI7 B;  4UB8 H;  1M90 Q;  1QL2 A;  5CCH D;  1RE4 A;  4Y99 B;  1VQ8 P;  1VF5 C;  2N9Y B;  1EXI A;  4A7P A;  1GK6 A;  1NTK E;  2KZJ A;  2AXT H;  1CW5 A;  2QJK C;  1PGJ A;  3LW5 H;  5CBO A;  2FFD A;  1BSH A;  2FXP A;  2GA1 A;  2LKM A;  1JM0 A;  2NPS A;  1JEK A;  3H1J E;  1LNQ A;  3L73 J;  3V4W A;  1QX8 A;  2SPZ A;  3JCU H;  4NPF X;  1J2J B;  4HB1 A;  3CCR P;  3SFE C;  1GU4 A;  1SQP K;  3H1H G;  1AVO A;  2ZT9 C;  1N2D C;  3HD7 A;  1IFN A;  4OWF A;  3BCC D;  1RH5 B;  1Q82 Q;  1W2E A;  1BDC A;  1MZ9 A;  1Y47 A;  3E1R A;  1S2E A;  2M0B A;  4OGQ B;  1BE3 D;  2Q7C A;  4WWI A;  5KAI H;  2E43 A;  1LTT C;  3GLM A;  3E7K A;  3H1I E;  1N86 A;  2QM7 A;  2WSC J;  1NKZ B;  1SQP G;  2W6J H;  1T2K C;  1KZU B;  1LWU C;  1NU1 J;  2O1K A;  3EFF K;  2WVR A;  3SSU A;  2QJY C;  2WT7 B;  1ZR4 A;  3AEB C;  1NTM G;  5APV A;  3B5N C;  1PP9 D;  2P58 A;  1SFC D;  3AE1 C;  1VQO P;  1IO4 A;  2UWJ E;  3A0H H;  3BCC J;  2IFM A;  4U3F G;  5AVQ B;  1J1E B;  2IPP A;  2KYV A;  3MGN A;  5KJ7 C;  2R44 A;  2KZI A;  1L0L G;  1YJN P;  4N6J A;  3R2P A;  1JMB A;  1MUU A;  1N7S C;  2ZXX A;  2Y9Z A;  1X0T A;  3ITK A;  3L74 G;  3HUS A;  3VMA A;  1JY3 O;  3BAS A;  1ZRT D;  2JWD A;  2LR2 A;  2M5A A;  3AEF C;  2KNC A;  3N4X A;  4LC1 A;  3TNU A;  5KLI B;  1HBW A;  3H1J D;  5APX A;  1PPJ E;  2WSE H;  2G3A A;  1SFC B;  2R5D A;  4B86 A;  2A45 I;  5KAF H;  2E42 A;  3L35 A;  4OVN F;  2C9L Y;  4DZO A;  1QVG O;  2E76 B;  4PV1 C;  2QG4 A;  3LIE A;  5KLI C;  1LT1 A;  1JY2 P;  1KYO E;  2FYZ A;  3L72 G;  3PHL A;  4I2L C;  1A02 J;  2KP8 A;  3L71 D;  3AE7 C;  3P32 A;  3B8E B;  2KXP B;  4BRY A;  1VQM P;  4I1L A;  2OYI C;  3L75 E;  1URQ C;  4GOE A;  1VPC A;  2M8R A;  4TT3 H;  1SQB E;  1IFJ A;  3CWB D;  2P2U A;  3HE5 A;  2V7Q H;  3MZW B;  2D2C B;  2MKV A;  2A45 G;  2ZVN B;  3EWK A;  2KLU A;  3P8C D;  1CI6 B;  4DT0 A;  1L0N K;  1YQ3 C;  3D6Y A;  1M56 D;  3V5B A;  1URQ D;  4KT0 J;  1YJ9 P;  1FDO A;  1SQP E;  5EFW B;  4ZNC A;  3A5T A;  1J1D B;  3CI9 A;  1NTK J;  1NTM E;  2HLO A;  5AW1 B;  4EIJ A;  3Q5S A;  1OWA A;  2KLV A;  1RE3 A;  1Y8A A;  2JR8 A;  2O3J A;  3ABV C;  3QWO C;  4XE5 B;  1RE3 C;  3RL0 g;  2HPC A;  4OGQ C;  5CCG D;  2MJZ A;  2K9Y A;  2ZYD A;  3CCE P;  3L74 J;  3H32 A;  4HKZ H;  1KQG B;  4PJ0 H;  3L74 E;  1FBM A;  1HH0 A;  2H7H A;  1T6A A;  1MV8 A;  1SQQ K;  2OYI B;  3HE4 A;  2HYN A;  1RE4 C;  5AW6 B;  3RK3 C;  3CC2 P;  2FXM A;  5AVS B;  5TIS H;  4H0L D;  2NPS D;  3A7O A;  1PPJ G;  1NHL A;  2FBW C;  3II6 A;  2FY8 A;  3L71 E;  2PFX A;  2PP6 A;  1G1J A;  5AVX B;  1BDD A;  2HFE D;  2QVA A;  1VQ6 P;  1SQB K;  1SFC C;  1VDF A;  2IBZ G;  3B5N D;  3CX5 H;  4ZKU A;  1XTC C;  2M5A B;  1EDL A;  1EC5 A;  1JCD A;  3P8C E;  3HD7 C;  2JWA A;  3BVH A;  3EQ2 A;  4I6M C;  1S1C X;  4UB8 E;  1IJD B;  1MFT A;  3B71 A;  2IBZ D;  3IF4 A;  1HF9 A;  1X9V A;  1J1E C;  2XKM A;  1SQV G;  3GG2 A;  2E76 D;  1FJP A;  5AVR B;  1HTL C;  2CPB A;  2KS1 B;  4U3F J;  5DJT B;  1HGZ A;  1LTJ C;  3TK1 A;  2W83 C;  1OVR A;  1L0L D;  5BU8 B;  1GDT A;  3M9B A;  1RF0 C;  1IC2 A;  3WUT A;  3IFM A;  1FS0 E;  5E79 E;  2B87 B;  1G1I A;  3VMZ A;  4IFM A;  2XU6 A;  3WU2 E;  1SQP D;  3L70 D;  1ZME C;  2QJP C;  2FYU J;  1QL1 A;  2QSI A;  4H0L C;  4PD4 I;  4Y28 J;  3Q5R A;  3CWB J;  2IDB A;  3FXE A;  1KMI Z;  3CPW O;  1Q7Y Q;  5BVZ A;  2Z5H A;  1L0N J;  3S4R A;  1KB9 I;  1GL2 B;  1IK7 A;  3JCU E;  3L71 J;  2FXO A;  3AEC C;  1UIX A;  4H0L B;  3SFD C;  1EXJ A;  3F89 A;  3CD6 P;  2P10 A;  1OW6 A;  3HD7 D;  1URQ A;  1R5L A;  1M57 D;  1VQP P;  1RF1 A;  1LT9 B;  1SQQ E;  2HG5 D;  1YI2 P;  2DW3 A;  4R4M A;  3CCU P;  5AVU B;  3Q5P A;  3VMX A;  1OVV A;  1M8O B;  2KNC B;  5AVW B;  3WUV A;  4H13 B;  1K04 A;  3SWK A;  1KIL B;  1BCC E;  2Z4E A;  3F5H A;  4IFD K;  1Q90 D;  4EOT A;  1OVU A;  2WIT A;  5M1B A;  2LXB A;  4RJT A;  1M1K Q;  3H6P A;  2IYP A;  1ZW0 A;  2Q5U A;  1EZV I;  1EDK A;  1JY3 N;  1URQ B;  2CK3 H;  2JO1 A;  4JYB A;  1KIL E;  1BGY D;  1KYO H;  4IL6 H;  1OFC X;  1N7S A;  1SQX E;  1GZL A;  1PP9 J;  1XTG B;  3CWB G;  3L75 G;  1CZQ A;  1IFP A;  2GUS A;  4H44 B;  3TGU D;  2WSE J;  4QMA A;  5E79 H;  1M1J B;  1W5C E;  2POH A;  5APS A;  1N73 C;  3PRJ A;  1FAV A;  3H1L E;  2N1T D;  5B66 E;  5K5G B;  5AW5 B;  3RK2 C;  2K3R A;  3GMA A;  4WY4 C;  3SWY A;  1E79 H;  3AE6 C;  3UIA A;  2L5G B;  3FGA D;  4GOD A;  4BWN A;  2M3B A;  4NPE A;  1SFC A;  4KJM A;  1L0N D;  1NYH A;  1N7S D;  2E75 C;  1LTI C;  4AQR D;  3D70 A;  2JEE A;  4WBA A;  1U7M A;  1WRG A;  2ZYA A;  5KJ7 D;  4BXL A;  2JJL A;  4LLH A;  5GTH H;  1H89 A;  1FZC B;  3TYY A;  3BRT B;  1BSN A;  1LTJ A;  3CLQ A;  3G3Z A;  2RKL A;  1SQP J;  1U7J A;  3VP8 A;  2FYN C;  4BRY B;  2ZYG A;  2HOD B;  3NXS A;  5CMZ A;  1KN7 A;  1JMM A;  3M0D A;  1NTM J;  3GHG C;  4PV1 D;  2Z5I A;  5C39 A;  4Z1M H;  3G71 P;  3HTK B;  1SS1 A;  3I5C A;  3O6Q B;  1BCC G;  3GHG B;  4ZMD A;  1SQX K;  3AED C;  2FFD C;  3PTZ A;  3U1A A;  2FYN B;  2J5U A;  4IFF A;  1GL2 A;  2Y0C A;  2WTY A;  1K73 Q;  1DEE G;  4U7J A;  2J59 M;  1JUN A;  1FZC C;  2IBZ E;  4GT1 A;  4C7N A;  3VOP A;  1BCC D;  1S4X A;  1JOC A;  3KXD A;  1IZN B;  1K05 A;  3SWF A;  2LXC B;  4JF7 A;  1JY2 O;  1BE3 E;  1KB9 H;  3H1L D;  2BCC G;  2P7J A;  5GTH E;  1VQN P;  3RK3 E;  1QEX A;  1TU3 F;  3VTP C;  2KUB A;  3KPE A;  2IZ0 A;  1KQS O;  2E5T A;  3M0A A;  2FYU G;  1SQV E;  1YTZ T;  2WQY C;  1FOS F;  4W80 A;  2WSS H;  3W67 A;  2B89 A;  2BCC D;  1VQ9 P;  4CPG A;  1P84 D;  5AW8 B;  3V2P A;  1NTM D;  1E5W A;  2AEF A;  3L70 E;  5GTI E;  4O9B A;  2NZ2 A;  1GW4 A;  1LTJ B;  3AEE C;  4D6T D;  3RL0 B;  2B9B A;  3Q2Y A;  1MFZ A;  3TSI A;  5KKZ C;  4IL6 E;  2ZT9 D;  1T3J A;  1YIJ P;  1ZRT E;  1L0L K;  3GHG A;  3L74 D;  4U3F E;  1PZQ A;  3HUS C;  2W8Z A;  1LGH B;  1T3U A;  1S9K E;  4IOI H;  4C46 A;  3KHU A;  1JNM A;  1WMK A;  2WPR A;  3A2A A;  1NVO A;  3EFG A;  1KIL C;  1GK4 A;  1RQV A;  3G9R A;  3CX5 D;  2OTL P;  1HWT C;  5CJ0 A;  1KYO D;  3USS A;  2N9B A;  1S5L H;  1ZP0 C;  4PD4 H;  1LT9 C;  3MD0 A;  3CCM P;  1VQ5 P;  3B5N A;  3L75 D;  4RES B;  1OW8 A;  2E75 D;  3IAO A;  3TGU G;  3H1K J;  5GTI H;  5KLV J;  2VRS A;  5KLV E;  5B5E H;  1NGM B;  5TIS E;  2H43 A;  1AQ5 A;  1SQB D;  1IFM A;  1SQQ G;  2ZJS E;  4EI2 A;  1RHZ B;  1CI6 A;  2Q3I A;  3HRN A;  5AW3 B;  5APQ A;  3RK3 B;  3U1C A;  5AW9 B;  1NH4 A;  2N1T C;  4OGQ D;  1BGY E;  1UII A;  3V2N A;  2HPC B;  1ZLL A;  5APT A;  1JY2 N;  1VQK P;  4HJG H;  1NKN A;  1L2P A;  2QJP B;  1K8A Q;  5H2F E;  2ZFC A;  1L0N G;  2KIK A;  1USE A;  3PJS K;  2K1A A;  3L36 A;  1SP4 A;  1Z56 A;  1FZA A;  5CCH A;  1Q86 Q;  2Q1K A;  1HGV A;  3NTN A;  1NWQ A;  2XDJ A;  1JTH B;  4JBZ A;  2E74 D;  1EQ7 A;  3E1I A;  3H1J J;  4K35 A;  3QH9 A;  3TDK A;  5KJ7 A;  3A0B E;  3OW2 O;  3V4Q A;  5L8R J;  1FZF A;  3FWN A;  2O01 H;  1A02 F;  1FOS E;  1P84 E;  3CC4 P;  1DD3 A;  1KFN A;  1QGK B;  1PGP A;  3HUS B;  3S1K A;  3CMA P;  4D6T J;  3OA7 A;  2P67 A;  3BAT A;  1KTM A;  3VN0 A;  3H1K G;  1LTG C;  3NMD A;  1EZV D;  2QIW A;  4N78 E;  1FZE A;  1N7L A;  2QRX A;  4YXW H;  5APY A;  4DCK A;  5KLV K;  1GMJ A;  2YO2 A;  1LT9 A;  3A0H E;  3LID A;  3A3Y B;  3R4Y A;  4TLF A;  5BU5 A;  3Q1M A;  3BRV B;  3M9H A;  3VP9 A;  2IYO A;  1AJY A;  1HJ0 A;  3FXD A;  1ZOY C;  3MUD A;  2K9J B;  2YKO A;  4WY4 B;  3H1K D;  4HH2 A;  2KK7 A;  2WT7 A;  2J58 A;  3L75 J;  2R3C A;  1OZH A;  1S5L E;  2YIU C;  2KB7 P;  3CXH D;  4RKU J;  1FC2 C;  2KS1 A;  4DJG A;  1X22 A;  3AE4 C;  3CX5 E;  1KB9 E;  1PFI A;  4UB6 H;  1VF5 D;  1QLE D;  3CCL P;  5KAF E;  3V6I A;  2KSE A;  3CCS P;  2BEQ D;  2AXC A;  2B88 A;  2Q3E A;  2M3E A;  4OH8 B;  4R4L A;  1KQF B;  1RY3 A;  2L91 A;  1GD2 E;  3KZI E;  4H13 D;  2IFN A;  2WZ7 A;  4L73 A;  1Y9B A;  2NRG A;  3H1L G;  3BCC G;  2A45 H;  3L37 A;  1FU1 A;  3L73 E;  4YTP C;  1YIT P;  2IX7 C;  3RK2 D;  1LP1 A;  1BE3 G;  3I55 P;  2XNX A;  2BCC E;  5CCG C;  4C7N B;  5AVV B;  1J1D C;  2WPQ A;  2PGD A;  2XZR A;  3MUD C;  2BCC J;  2I1K A;  4W7Z A;  3ZDM A;  1FDI A;  1LTB C;  1EZV E;  1GL2 D;  4N78 D;  2I8D A;  3VMY A;  1NTZ E;  2W6A A;  2OYI A;  1NAF A;  1NTZ J;  1G2C A;  3I56 P;  3CX5 I;  2K9J A;  3O6Q A;  1PP9 G;  2I1J A;  2RMZ A;  1MKM A;  2WPS A;  3PP5 A;  4WY4 A;  1FZC A;  5KAI E;  3Q3D A;  1JO5 A;  3KYQ A;  1HJB A;  2N1T B;  2P1J A;  2JKV A;  1SQQ J;  2RH0 A;  3CXH E;  3H1I J;  1BCC J;  2V7Q J;  3KZI H;  3L72 J;  4ZKP A;  1RF0 A;  5AVZ B;  2QM8 A;  1ZV8 A;  1NU1 E;  1HVV A;  2XV5 A;  3AE8 C;  4N3Y B;  2KOG A;  2C0X A;  2OTK E;  5CCH C;  1DEB A;  1IFD A;  1YTZ I;  2IZ1 A;  2QJK B;  3IN6 A;  3P8M C;  4XFJ A;  2AEM A;  5AW7 B;  4UB6 E;  4HYT B;  3CCJ P;  1NTK D;  2JDI H;  2YIU B;  3HE4 B;  4JYC A;  2NPS C;  3AEA C;  1N73 B;  3CME P;  2K88 A;  1SQX J;  1L4A A;  1DH3 A;  5APU A;  2YMK A;  1FE6 A;  1L4A C;  3G4S P;  3O8Z A;  3V2R A;  2OYH A;  1EDJ A;  2Y0D A;  3AE2 C;  2N1T A;  3L72 D;  1KB9 D;  1NTK G;  1SQQ D;  1SQB G;  5AW2 B;  1LTA C;  1OIP A;  1YQ4 C;  4I7Z C;  3TNU B;  1LWU A;  3M9Q A;  5CJ4 A;  5KLV G;  3C1L A;  1JTH A;  1L4A D;  2FYU E;  3L4F A;  1NTZ K;  2W27 A;  5KKZ B;  3JSV C;  2OTJ P;  1NTZ D;  3B5N B;  3GW6 A;  2YKQ A;  1ZXG A;  2B87 A;  3WUU A;  3T97 A;  3HD7 B;  1H0T B;  1FZB A;  1LWU B;  1L4A B;  1P84 H;  2JP3 A;  1U57 A;  3CWB E;  1AQT A;  1EZV G;  3PLN A;  3H32 B;  2A06 G;  3D6Z A;  3HE5 B;  2NPS B;  2O01 J;  4L74 A;  3GF7 A;  4GKG A;  1L0N E;  2YMY A;  4GIF A;  4L75 A;  1RF1 B;  2Y0E A;  2W90 A;  3MIW A;  2FKW B;  3P7K A;  1CSB A;  3H1I G;  3CXH H;  1SLQ A;  3TGU J;  2E5Y A;  2OAR A;  4EDF A;  2A06 D;  1GL2 C;  2ZAE B;  4PJ0 E;  4D6T E;  1NTM K;  1BGY J;  1JY3 P;  2ZT9 B;  2ZVO B;  1KQL A;  1OXZ A;  3M0D C;  3IR9 A;  2V4H A;  4K3A A;  4L76 A;  1NU1 G;  3OJA B;  3TF5 A;  3CCV P;  1YYC A;  3MHV A;  2W6B A;  2IBZ I;  3W68 A;  2H89 C;  2CPS A;  3RBZ A;  1SVF A;  2QE7 H;  4GDO A;  2YNY A;  3KQG A;  1S9K D;  3H1H J;  4GOF A; 
#chains in the Genus database with same CATH homology
 3RL0 D;  1RF1 C;  2FFD B;  1HUC A;  3M06 A;  1ZN5 A;  1NU1 K;  4XA4 A;  3KDP B;  3N7N A;  4M3L A;  1ZR2 A;  2KSJ A;  5AVY B;  2YKP A;  2GM4 A;  2HOD A;  3RK3 D;  3MTU E;  3OAK A;  1T2K D;  1X79 B;  1SQV K;  3VYI A;  3RL0 C;  1AFO A;  4C7R A;  2FYU K;  2R5B A;  2R32 A;  1FJK A;  2OYH C;  3U59 A;  1M1J C;  3HTK A;  1M1J A;  2C0W A;  4AUW A;  4AYC A;  1DX7 A;  1N7S B;  2O1J A;  5KTB A;  1IK9 A;  4WY4 D;  1WT6 A;  2WSC H;  5AW0 B;  1KFM A;  3V2Q A;  5AW4 B;  1NO4 A;  1H8A A;  2PAJ A;  5CHX A;  2H8P D;  1LTS C;  1JCC A;  1N73 A;  1NOH A;  3WMM 0;  3CL3 D;  5APW A;  1T8Z A;  5AVT B;  2Q9I A;  1NTK K;  1X8Y A;  2YO3 A;  1H88 A;  2OYH B;  1KIL D;  3C9I A;  4DOJ A;  1G2C B;  4Y99 C;  1M7L A;  1FDM A;  2WWW A;  1GW3 A;  1GU5 A;  1IFI A;  1GTW A;  1FZG A;  4WB4 A;  2WSF H;  4KHX A;  3M91 A;  3NFQ A;  1KIL A;  2BAS A;  2GUV A;  4W7Y A;  2C9N Y;  2ZXE B;  1QL2 A;  5CCH D;  1RE4 A;  4Y99 B;  1GK6 A;  1CW5 A;  3LW5 H;  2FFD A;  2LKM A;  2NPS A;  3V4W A;  1J2J B;  1GU4 A;  1SQP K;  3HD7 A;  1N2D C;  1IFN A;  1W2E A;  1MZ9 A;  2Q7C A;  2E43 A;  1LTT C;  1N86 A;  2QM7 A;  1NKZ B;  1T2K C;  1KZU B;  1LWU C;  2O1K A;  2WT7 B;  1ZR4 A;  5APV A;  3B5N C;  1IO4 A;  1SFC D;  2IFM A;  5AVQ B;  1J1E B;  2IPP A;  2KYV A;  3MGN A;  5KJ7 C;  4N6J A;  3R2P A;  1MUU A;  1N7S C;  3HUS A;  1JY3 O;  3BAS A;  4LC1 A;  4LGD E;  3TNU A;  3N4X A;  1HBW A;  5APX A;  2WSE H;  1SFC B;  2R5D A;  4B86 A;  2A45 I;  2E42 A;  3L35 A;  2C9L Y;  4DZO A;  3LIE A;  1JY2 P;  2FYZ A;  4I2L C;  1A02 J;  2KP8 A;  3P32 A;  3B8E B;  2OYI C;  4I1L A;  1URQ C;  1VPC A;  2M8R A;  1IFJ A;  2P2U A;  3HE5 A;  2A45 G;  3P8C D;  1CI6 B;  1L0N K;  3V5B A;  1URQ D;  3A5T A;  1J1D B;  3CI9 A;  4EIJ A;  2HLO A;  5AW1 B;  1OWA A;  2KLV A;  1RE3 A;  4XE5 B;  1RE3 C;  2HPC A;  5CCG D;  2MJZ A;  3H32 A;  1FBM A;  1HH0 A;  2H7H A;  1MV8 A;  1SQQ K;  2OYI B;  3HE4 A;  2HYN A;  1RE4 C;  5AW6 B;  3RK3 C;  2FXM A;  5AVS B;  2NPS D;  3A7O A;  1NHL A;  5AVX B;  3II6 A;  1FOS E;  2PP6 A;  1G1J A;  2HFE D;  1SQB K;  1SFC C;  1VDF A;  3B5N D;  4ZKU A;  1XTC C;  1JCD A;  3P8C E;  3HD7 C;  3BVH A;  3EQ2 A;  4I6M C;  1IJD B;  1X9V A;  1J1E C;  2XKM A;  1FJP A;  5AVR B;  1HTL C;  2CPB A;  1HGZ A;  1LTJ C;  3TK1 A;  5BU8 B;  1GDT A;  1RF0 C;  1IC2 A;  3IFM A;  1G1I A;  3VMZ A;  4IFM A;  2XU6 A;  1QL1 A;  5BVZ A;  2Z5H A;  1GL2 B;  3HD7 D;  1URQ A;  1RF1 A;  1LT9 B;  2HG5 D;  5AVU B;  3VMX A;  5AVW B;  1KIL B;  2Z4E A;  4IFD K;  4EOT A;  2WIT A;  3H6P A;  2Q5U A;  1JY3 N;  1URQ B;  4JYB A;  1N7S A;  3O8Z A;  1GZL A;  1XTG B;  1CZQ A;  2GUS A;  1M1J B;  2POH A;  5APS A;  1N73 C;  1FAV A;  2N1T D;  5AW5 B;  3RK2 C;  3SWY A;  4WY4 C;  3UIA A;  2L5G B;  2M3B A;  1SFC A;  1N7S D;  1LTI C;  4AQR D;  2JEE A;  4WBA A;  1WRG A;  5KJ7 D;  1H89 A;  2JJL A;  4LLH A;  1FZC B;  3TYY A;  3BRT B;  3G3Z A;  1LTJ A;  3CLQ A;  3VP8 A;  2HOD B;  3NXS A;  5CMZ A;  1JMM A;  3M0D A;  3GHG C;  2Z5I A;  3HTK B;  3I5C A;  3GHG B;  1SQX K;  2FFD C;  3U1A A;  4IFF A;  1GL2 A;  2WTY A;  1JUN A;  2J59 M;  1FZC C;  4GT1 A;  4C7N A;  3VOP A;  1JOC A;  3SWF A;  4JF7 A;  1JY2 O;  2P7J A;  3VTP C;  3KPE A;  3M0A A;  1YTZ T;  1FOS F;  4W80 A;  5AW8 B;  3V2P A;  1E5W A;  4O9B A;  1GW4 A;  1LTJ B;  3RL0 B;  1MFZ A;  3TSI A;  1T3J A;  3GHG A;  1L0L K;  3HUS C;  1S9K E;  1LGH B;  1T3U A;  1JNM A;  4C46 A;  2WPR A;  3A2A A;  3EFG A;  1KIL C;  1GK4 A;  1HWT C;  5CJ0 A;  2N9B A;  1LT9 C;  3MD0 A;  3B5N A;  4RES B;  1AQ5 A;  2VRS A;  2H43 A;  1IFM A;  1CI6 A;  2Q3I A;  3HRN A;  5AW3 B;  5APQ A;  3RK3 B;  3U1C A;  5AW9 B;  1NH4 A;  2N1T C;  3V2N A;  2HPC B;  1ZLL A;  5APT A;  1JY2 N;  1NKN A;  2ZFC A;  3L36 A;  1SP4 A;  1Z56 A;  1FZA A;  5CCH A;  1NWQ A;  1HGV A;  3NTN A;  2XDJ A;  1JTH B;  3E1I A;  1EQ7 A;  5KJ7 A;  1FZF A;  3V4Q A;  2O01 H;  1A02 F;  1KFN A;  3HUS B;  3OA7 A;  2P67 A;  3BAT A;  3VN0 A;  1LTG C;  3NMD A;  4N78 E;  1FZE A;  1N7L A;  5KLV K;  5APY A;  2YO2 A;  3LID A;  1LT9 A;  5BU5 A;  3A3Y B;  3BRV B;  3M9H A;  3VP9 A;  3MUD A;  2YKO A;  4WY4 B;  4HH2 A;  2WT7 A;  2J58 A;  2R3C A;  2KB7 P;  1PFI A;  4OH8 B;  1RY3 A;  1GD2 E;  2IFN A;  2WZ7 A;  3L37 A;  2A45 H;  1FU1 A;  2IX7 C;  3RK2 D;  2XNX A;  5CCG C;  4C7N B;  5AVV B;  1J1D C;  2WPQ A;  4W7Z A;  2XZR A;  2I1K A;  1LTB C;  4N78 D;  1GL2 D;  3VMY A;  2W6A A;  2OYI A;  1NAF A;  1G2C A;  3PP5 A;  4WY4 A;  2I1J A;  1JO5 A;  1FZC A;  2WPS A;  3KYQ A;  1HJB A;  2N1T B;  2P1J A;  4ZKP A;  1RF0 A;  5AVZ B;  2QM8 A;  1ZV8 A;  1HVV A;  2XV5 A;  4N3Y B;  2KOG A;  2C0X A;  5CCH C;  1DEB A;  1IFD A;  1YTZ I;  5AW7 B;  3RK2 B;  3P8M C;  4HYT B;  3HE4 B;  4JYC A;  1N73 B;  2NPS C;  1L4A A;  1DH3 A;  5APU A;  1L4A C;  3V2R A;  2OYH A;  2N1T A;  5AW2 B;  3TNU B;  1LTA C;  5CJ4 A;  1LWU A;  3M9Q A;  1L4A D;  1JTH A;  3L4F A;  1NTZ K;  2W27 A;  3B5N B;  2YKQ A;  3T97 A;  3HD7 B;  1FZB A;  1LWU B;  1L4A B;  3H32 B;  3HE5 B;  2NPS B;  4GKG A;  2YMY A;  4GIF A;  1RF1 B;  3MIW A;  2FKW B;  3P7K A;  1CSB A;  1SLQ A;  2OAR A;  5CCG A;  1GL2 C;  1NTM K;  1JY3 P;  1KQL A;  1OXZ A;  3M0D C;  3IR9 A;  3OJA B;  1YYC A;  2W6B A;  2CPS A;  1S9K D;  1SVF A;  2YNY A;  3KQG A;  3M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...