1JY2P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 13
structure length 44
sequence length 44
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2P00
3H32B 1M1JB 3HUSC 1RF1C 2OYHB 1JY3O 1RF0A 1LTJC 1N73B 1N86A 2A45H 1FZFA 1LT9A 2OYIA 1FZCB 1LWUB 1RF0C 1LT9C 1JY2P 2HPCB 2OYIC 2FFDA 2HODA 3GHGB 1JY3P 1M1JA 3H32A 2HLOA 2Z4EA 2OYHA 1RF1B 1T3UA 1N73A 3HUSB 1FZCA 2FFDC 1M1JC 1LWUA 1FZGA 2OYHC 1LTJB 3BVHA 1JY2N 2Q9IA 1RE4A 2H43A 2HPCA 1N73C 1FZEA 1FZCC 1LWUC 1JY3N 1LT9B 3GHGA 1RE4C 2A45I 2A45G 3E1IA 2OYIB 1RE3A 1RF1A 1FZAA 1W2EA 2XNXA 3HUSA 3GHGC 1LTJA 1JY2O 1RE3C 2FFDB 1FZBA 2HODB
chains in the Genus database with same CATH superfamily
2AXTH 2E74B 1Q82Q 3HUSB 2FXOA 1L0LD 2CPBA 4IL6E 1YITP 1HWTC 1SQPD 2UWJE 2LXBA 2K3RA 1S5LE 3M0DA 2ZYDA 3O6QA 2FBWC 3L37A 2WSEJ 3H1HE 4I2LC 4C7NA 1FOSF 5TISE 2NPSC 4MN4C 1X22A 3TDKA 2SPZA 3H1KD 5KAFE 1SQVE 1OZHA 1NWQA 2G3AA 3W68A 1NHLA 4JF7A 1SQVJ 4LLHA 1SQXJ 3CCLP 2WPQA 2KLVA 2R5DA 3VTPC 2HPCB 2L5GB 1T8ZA 5AVYB 1EDKA 4JQ0D 2Q3IA 1FZCC 3WUUA 1XTGB 5CCHC 1JNMA 2KK7A 1PL5A 3AE4C 2O1JA 3CWBG 2Y0DA 3LW5J 1KMIZ 1LTJC 2HFED 1JOCA 2WSFH 2QJYC 3GLMA 2Q7CA 3I55P 1PP9G 1N7SC 1DD3A 4UB8H 3VMZA 3M9BA 3L71E 1RY3A 1FS0E 1G1IA 1NKZB 2Y0EA 5CBNA 3L71J 1FJKA 1RE3C 3RGUA 1XTCC 3A3YB 1JO5A 1N7SA 3II6A 2HYNA 4BWNA 2HG5D 2I1KA 4YPCA 2R5BA 2G8YA 2IFMA 2JJLA 2WVRA 1VQ4P 2XNDH 1HBWA 1BDCA 1M57D 1HH0A 3TSIA 1U7JA 5CCGD 1PFIA 2W83C 1DEEG 1RF1C 3L70G 1KILB 2R44A 3CWBD 3C8VA 4BXLA 2WTYA 5KTBA 1G2CA 1QVFO 2KIKA 1ZLLA 1PP9D 2B9BA 3D6ZA 2XU6A 4XFJA 1Y47A 3KQGA 4L76A 3OAKA 4KT0J 4N3YB 1L4AD 2YMYA 2QJKB 3HD7D 3RK3E 1SQBG 1DD4A 2KXPB 2IX7C 1H0TA 1PV3A 4L74A 5B5EE 1ZOYC 2W27A 1VQNP 4PD4D 3D71A 4OGQD 3RK2B 4D6TG 2Q5UA 1OX3A 3CMAP 3AEDC 2J59M 3L70D 1AFOA 3LIEA 3FX0A 4EI2A 1GW3A 4ZMDA 3Q1MA 1KILD 1LT9B 2FYUG 2WT7A 3M9HA 1RHZB 4R4MA 1OMIA 1NU1K 4HYTB 5B66E 1KYOI 1SQBD 3H25A 1A02J 2O1KA 1HJBA 2WPSA 3D6YA 3CX5E 4D6TD 2FXPA 2QG4A 3W67A 2V7QH 5AW4B 1VPCA 1BCCE 4GOFA 4LGDE 1NTKG 3SSUA 4U3FE 4JYCA 3RK2D 3G4SP 2OYHA 1BCCJ 2KZIA 3B5ND 4I7ZC 4BRYB 3BVHA 3I5CA 1HVVA 2Y9YA 2E42A 3ABVC 2FYUD 3AE5C 1GK4A 1JUNA 1T2KD 1GDTA 3HTKB 2LKMA 3MZWB 3WUVA 1A02F 3GHGA 2JWDA 5AW0B 1EZVG 3IF4A 1SFCB 3Q3DA 1NTZG 2KYVA 2N1TB 2ZJSE 4W7ZA 3KZIH 3TNUB 5APSA 1GD2E 3L35A 1NTKD 2Z5IA 1M90Q 1LTTC 1HGZA 2Q3EA 1YI2P 3I56P 3H1JJ 1M7LA 2QIWA 3HUSA 4GIFA 1URQB 1RH5B 1LWUB 3EWKA 3G6EP 3GW6A 5M1BA 1SQQK 1L2PA 2OTKE 4OWFA 1BE3E 2ITAA 1ZR2A 4LC1A 5BVZA 1KD1Q 1BE3J 1SQPK 1FDIA 3L73G 5L8RJ 2FXMA 3R4YA 1NTZD 4UB6H 1NOHA 5CJ4A 3AE1C 5CCGC 3EFGA 1Q2NA 2N1TD 1OXZA 2K9YA 3OW2O 2ZVOB 1QL1A 3BCCE 1JTHB 1N73B 1FDMA 5KLVK 1NU1E 3BCCJ 5BU5A 2H88C 3A0BE 2HPCA 2Q1KA 5E79E 4ASWA 1L4AC 1NAFA 1X8YA 2Y0CA 1M1JB 3HD7C 3L73D 1YJ9P 3WUTA 1LT1A 1HUCA 1G1JA 2LR2A 2KI7B 1BGYJ 1CI6B 3HE4B 4OGQC 4YXWH 3O8ZA 4YXDC 1P84I 2R3CA 1L4AA 2OYIB 2ZT9D 2E76D 2QE7H 3A7OA 3QWOC 3TGUG 2WSCH 1FAVA 3KPEA 3P32A 3H1ID 5KKZB 2C9NY 3JCUH 5KAIE 4N78D 1R5LA 4GKGA 5APQA 3HE5B 4PJ0H 1S2EA 1H88A 2RH0A 2K1AA 5APXA 4NPDA 1EQ7A 1KILA 5APYA 1J1DB 2XZRA 2N9BA 3RL0B 3U1AA 3E1IA 1NTMG 3GF7A 4OVNF 3VMAA 1MV8A 2ZYGA 3B5NC 1ZRTD 1SQQE 4WVZA 3B71A 4KHXA 1L0NJ 1KYOD 1L0LE 5K5GB 2FYNC 1FZEA 1SQQJ 4Y99C 3H1LJ 1SQPE 1IK9A 2XNXA 2FKWB 4RJTA 4PV1B 2XDJA 1N86A 1T2KC 2IFNA 3V2NA 4H44D 4JBZA 1HGVA 2QVAA 3P8MC 4GT1A 3BASA 2FFDB 2BCCE 1NTMD 3V4WA 2R3SA 3FWLA 3KHUA 1H89A 1GTWA 2AEMA 2YO2A 1J2JB 2BCCJ 5KLVE 3H1KG 1RQUA 1BDDA 3M0DC 5KLVJ 2WSEH 3IAOA 3M06A 1NJIQ 1KB9D 2YKPA 1IJDB 2QA4P 1CW5A 1EC5A 3CCEP 4EIJA 3H1LD 1DIPA 3EQ2A 3SWFA 1IC2A 1QL2A 2AXTE 5H2FH 4BRYA 3AEAC 1USDA 2K9JA 1PPJE 2YIUB 1P84H 3CPWO 3H6PA 1KQFB 3H1HJ 4YTPC 1N2DC 1GU4A 3C9IA 3CX5I 2W6JH 1M56D 2E74D 3HTKA 1QVGO 1J1EB 2E5YA 1KN7A 2KUBA 3M91A 1GMJA 1NO4A 1JY3P 1SQVG 1VF5C 2N1TA 1SQXG 3TNUA 2FY8A 4EDFA 1NKNA 4PD4H 1GZLA 4H13C 3OJAB 2JEEA 3TK1A 1K8AQ 3CWBE 1W5CE 1X79B 1R8EA 2VRSA 3L36A 1K73Q 1PP9E 1IZNB 3IN6A 1AVOA 4I1LA 1LWUA 2ZT9C 2E76C 2Q6QA 3H1HD 3FWNA 1M1KQ 3USSA 4HH2A 3L71G 3IFMA 4AYCA 1SQVD 1SQXD 2MKVA 1IFJA 1P84D 1KC8Q 1IFMA 3M9QA 2M8RA 2J58A 1OVRA 2A45H 2BEQD 3L70E 1KQLA 3CCJP 4UB8E 2JKVA 3CCUP 3L74E 1N73A 1JTHA 3L74J 4U7JA 3VN0A 3BATA 3A0HH 3AE8C 5KLIC 2D2CC 1EDLA 4WY4B 1M1JA 1KZUB 2B89A 2QSIA 1BSNA 3L71D 3RK3B 3WMM0 4DT0A 1S9KE 2A45G 5AW3B 1CI6A 4D6TE 3SFDC 2YNYA 3F5HA 4H44C 3NMDA 2OYIA 1FU1A 1S72P 3CL3D 2IBZE 2OGUA 2C9LY 4H0LB 3VP8A 3VP9A 4DZOA 2PRRA 3RL0g 2E75B 4K35A 2C0WA 3H32B 3HE5A 3MIWA 4ZKPA 2PFXA 4WB4A 1GL2B 5AW5B 3WU2H 1JY2P 2AEFA 1K05A 3RBXA 4KJMA 2OYHC 3VOPA 2IDBA 4WY4D 2P67A 1VQOP 3MUDC 2KLUA 3UIAA 2M0BA 2PGDA 3CXHI 4U3FJ 3PLNA 1JM0A 1AA0A 3PP5A 4WBAA 3MUDA 5AVUB 3PHLA 4NPEA 3GHGC 1U7MA 1BCCG 2QJPC 1AJYA 3AEEC 3GMAA 2O01J 3L72E 4H0LD 3AECC 4IOIH 3L72J 1GK6A 2E75D 2E74C 3G9RA 1GL2D 2OYOA 2NRGA 5CJ0A 1KB9I 1EZVE 1KV4A 3HUSC 1NTZE 2KP8A 3R2PA 2DW3A 1LJ2A 2FFDA 1YBKA 2NPSB 4XE5B 3CX5D 4M3LA 4OH8B 3FXDA 3ZDMA 3B8EB 1BCCD 3L75E 3H1JG 3L75J 1OIPA 1L0LK 3P8CD 3LIDA 3U1CA 3CCMP 2Y9ZA 3KZIE 1UIIA 2OARA 3L73E 1Q86Q 1FZFA 1FZCB 3IR9A 1BE3G 1LTGC 1M8OB 1WMKA 3CC2P 2YXQB 1LTJB 1SFCD 3FGAD 2QJYB 1N7LA 1N7SB 5C39A 1OFCX 3E7KA 4DCKA 1AV1A 1TU3F 3H1IG 2RN0A 1PGQA 2HR3A 2WSSH 3MGNA 1H8AA 3OA7A 2WITA 3H1JD 2WPRA 2C0XA 1URQD 1NU1J 5AVRB 1KYOH 2IZ0A 3D70A 1YJNP 2WMMA 3FXEA 1CSBA 3BCCG 1IO4A 1VQ7P 1YYCA 4UB6E 1OVUA 1NAYA 2R32A 2I1JA 2YO3A 1BE3D 1PIXA 1RF1B 3CXHH 5AW1B 5GTHH 1BGYG 3TGUE 3S9OA 3PRJA 3V5BA 1ZRTE 2JR8A 2IYPA 3VMXA 2W6AA 1FZGA 1KILC 3Q5SA 1MUUA 3V2RA 4QMAA 2B87B 1E79H 2KNCB 1T6AA 2A06G 2JDIH 2L91A 4N6JA 3BCCD 5BU8B 1KB9H 2JWAA 5APUA 2FYZA 1DEBA 5AVXB 1NYHA 1SQXK 4ZNCA 1RE4A 2M5AB 2QJKC 2O01N 3KXDA 3C1LA 2AEJA 1NTME 4NPFX 2O3JA 3JCUE 1BGYD 5APWA 3V6IA 3RK2C 1ZMEC 1VL2A 1FE6A 1PGJA 4PJ0E 2XKMA 2YMKA 4WY4A 1Y9BA 3A5TA 1YQ3C 1L0LJ 2H89C 5GTIH 1IFNA 1L0NG 3K5BA 1RF0A 2W90A 2A06D 1SQPJ 1SQQG 1Q7YQ 1AQ5A 1LT9C 3CLQA 4EOTA 3H1LG 3CXHD 5AVQB 1LTSC 1UIXA 2WQYC 4Y28J 4GODA 1VQLP 2H43A 4C46A 2ZFCA 2GA1A 4I7ZB 4HB1A 1JMBA 4IL6H 1PGOA 4HKZH 3G71P 1LT9A 2Z4EA 3H32A 4R4LA 3V4QA 2CK3H 3RL0D 2WZ7A 1VQ9P 1T3UA 3H1KE 1GL2A 5AW9B 3MD0A 1YIJP 5APVA 1K04A 1S5LH 1FOSE 5KJ7A 3H1KJ 1MKMA 2BCCG 1JCCA 2OTLP 3AEBC 5KLVG 1L0ND 2IBZI 1SQBK 1SQQD 2ZAEB 5TISH 2P7JA 3CCRP 1IFPA 4PV1D 2POHA 5KAFH 1VQPP 1CZQA 2ZXXA 4A7PA 1YJWP 3PJSK 3AE6C 3G3ZA 1S3JA 2IPPA 1DX7A 3MP7B 1SFCC 3KYQA 4Z1MH 3AE9C 2YKOA 3E1RA 4IFMA 2N1TC 1LTAC 1PZQA 1KTMA 3H1HG 1PPJG 4AQRD 1OW6A 2FYUK 3CC7P 3LW5H 2BCCD 5AVWB 2IZ1A 4O9BA 5KLVD 1SFCA 3CD6P 1URQC 1YHQP 3M0AA 4L75A 1SQXE 5H2FE 1LWUC 1ZN5A 4RESB 1P84E 1FBMA 1ZR4A 2HODB 1ZW0A 2H7HA 2NPSA 5APTA 1AQTA 3Q5RA 1Y8AA 1NTKK 3BRTB 1URQA 3CWBJ 2AXCA 3AEFC 1PP9J 3V2PA 1EZVI 2P10A 2N9YB 1PPJD 4XA4A 2QEXP 1WRGA 3S4RA 1L4AB 1VQ8P 1VQKP 1FZCA 4PD4E 1YTZI 3HD7B 1LGHB 1N73C 2Z5HA 5CCHA 3T97B 3TF5A 1LTJA 4OGQB 3L4FA 1NTZK 1ZXGA 2ZXEB 5AW2B 2WSFJ 2MJZA 2KS1B 5EFWB 1SVFA 3L70J 1M1JC 3N4XA 1W2BO 5B5EH 3QH9A 1JY3N 1KILE 1RE3A 4TT3H 2H8PD 2IYOA 1KORA 1FDOA 1LTIC 2KSJA 3L74G 5CHXA 2GUVA 2OYIC 2OTJP 1SQBE 1LP1B 4ASVA 2P2UA 3GF3A 1SQBJ 5KKZC 2E5TA 3SWKA 1RF1A 3HE4A 1D7MA 2KOGA 4I6MC 4IL6X 4D6TJ 1EXIA 2W6BA 5AVTB 1QEXA 1WT6A 1HF9A 5B66H 3CCVP 1QX8A 1X9VA 3A0HE 1S5LX 1Q81Q 3B5NB 3JSVC 1W2EA 3NTNA 2FYUE 2YKQA 1VDFA 3CX5H 1J1DC 2FYNB 1OW8A 2B87A 4RO0A 1SS1A 2KNCA 2FYUJ 4Y99B 3RL0C 2IBZG 5AW6B 3L74D 5CMZA 3P7KA 2M5AA 2O01H 2CPSA 1NVOA 1HJ0A 2I8DA 1EXJA 3RK3D 5AVZB 1MFTA 1PGPA 1NTKE 3MTUE 2JP3A 4PV1C 1JB0J 4TLFA 1S9KD 1NTKJ 1NH4A 1Q90D 1JCDA 3Q5PA 3PTZA 3WU2E 2LXCB 4U3FG 3O6QB 3B4SA 1QGKB 2M3EA 1FJPA 2IBZD 3TYYA 2K9JB 3S1KA 2FFDC 4DOJA 3P8CE 4B86A 3AE3C 4C7NB 3VYIA 3L72G 5KJ7D 1JY3O 2V7QJ 1OW7A 3V2QA 1KQGB 3AE2C 1R5SA 2K88A 1NTZJ 2B88A 1JY2N 4GDOA 5TJHA 1X0TA 2E43A 1QLED 5CBOA 1NTMK 2V4HA 3BRVB 4U3FD 3H1JE 2J5UA 2YIUC 1U57A 2Q9IA 2QRXA 4HJGH 2OQQA 1VF5B 3L75G 2WWWA 3NXSA 4DJGA 1L0NK 2ZVNB 3L72D 3MHVA 4AUWA 1N8RQ 4H13B 3L73J 3ITKA 1VQMP 1ZV8A 1KQSO 5AW8B 2RKLA 1S4XA 1J1EC 4IFDK 1EDJA 3A0BH 3N7NA 5E79H 3SFEC 1EZVD 1KFMA 3GG2A 2ZT9B 2E76B 3H1IE 2BASA 1OWAA 2NPSD 4JYBA 3H1IJ 4N78E 3EFFK 4CPGA 1KFNA 1SLQA 2KSEA 2P1JA 3RBZA 3CMEP 1FZBA 1G2CB 2KB7P 1YTZT 3L75D 1NU1G 2HODA 2GM4A 5CCGA 3CI9A 1VF5D 3JC22 3Q2YA 1HTLC 5KAIH 5AVVB 1FZAA 1IFDA 1MFZA 4H13D 1H0TB 2YXRB 5CCHD 1BGYE 1Z56A 3HRNA 3TGUJ 1N7SD 5KLIB 5AW7B 2D2CB 1KYOE 4RKUJ 1AVYA 2GUSA 2PAJA 1RE4C 2JO1A 3KDPB 3HD7A 1IK7A 1JY2O 1GU5A 1VQ5P 2A06E 1DH3A 4IFFA 4W80A 1FC2C 1JEKA 1LNQA 3T97A 1YQ4C 1ZP0C 4EYYQ 3CXHE 1NU1D 3VMYA 2WT7B 2HLOA 4W7YA 3U59A 1SQVK 5GTHE 1OVVA 2RMZA 4H44B 2BEZF 4WY4C 3PH0A 3A2AA 2KS1A 2ZYAA 2QM7A 3SWYA 5DJUB 1LTBC 2M3BA 1VQ6P 3RK3C 2WSCJ 1RF0C 2WPVB 1NTMJ 4PD4I 3F89A 5DJTB 4C7RA 3CC4P 1LP1A 2W8ZA 1KB9E 2OYHB 1S1CX 4H0LC 1EDIA 3TGUD 1K9MQ 1L0NE 2D2CD 1SP4A 1L0LG 3H1LE 4GOEA 2E75C 2P58A 4WWIA 1NGMB 1JMMA 1GL2C 3AE7C 2QM8A 1SQPG 1T3JA 5KJ7C 3B5NA 2XV5A 1MZ9A 3CCSP 4L73A 3GHGB 1GW4A 1USEA 2QJPB 3NFQA 1RQVA 4ZKUA 2PP6A 3AEGC 1BSHA 2A45I 4JPZB 5GTIE 2K37A 3CCQP 5AVSB 2NZ2A 2KZJA 1IFIA 4K3AA 1E5WA
chains in the Genus database with same CATH topology
1M1JB 3L4FA 3HD7C 1NTZK 2ZXEB 1HUCA 5AW2B 1G1JA 2MJZA 1CI6B 1SVFA 1GK6A 3HE4B 3HUSB 1M1JC 3N4XA 3O8ZA 1JY3N 2R3CA 2CPBA 1L4AA 1GL2D 2OYIB 1RE3A 2H8PD 1HWTC 3A7OA 5CJ0A 2WSCH 3HUSC 1FAVA 1LTIC 2KSJA 3KPEA 3P32A 2GUVA 5CHXA 2KP8A 3R2PA 2OYIC 2C9NY 2FFDA 3M0DA 4N78D 4GKGA 5APQA 2P2UA 3L37A 3HE5B 2NPSB 4XE5B 1RF1A 4M3LA 4OH8B 3HE4A 4I2LC 1H88A 4C7NA 2KOGA 4I6MC 3B8EB 5APXA 1FOSF 2W6BA 2NPSC 1EQ7A 5AVTB 1WT6A 1KILA 1L0LK 5APYA 1J1DB 1NWQA 2XZRA 3P8CD 1X9VA 1NHLA 2N9BA 3RL0B 3U1AA 3B5NB 3LIDA 3E1IA 3U1CA 4JF7A 1W2EA 3NTNA 4LLHA 2YKQA 2OARA 1MV8A 1VDFA 1J1DC 1FZFA 2WPQA 3IR9A 1FZCB 1LTGC 2KLVA 2R5DA 4Y99B 3RL0C 3VTPC 2HPCB 3B5NC 5AW6B 2L5GB 1T8ZA 4KHXA 5AVYB 1LTJB 5CMZA 1SFCD 1FZEA 2Q3IA 1FZCC 1N7LA 3P7KA 1XTGB 4Y99C 1N7SB 1IK9A 2XNXA 5CCHC 1JNMA 2FKWB 2O1JA 2O01H 2CPSA 2XDJA 1LTJC 2HFED 3MGNA 1H8AA 1N86A 1JOCA 1T2KC 2WSFH 2IFNA 3OA7A 3V2NA 2Q7CA 2WITA 3RK3D 1N7SC 5AVZB 2WPRA 3VMZA 3MTUE 3M9BA 1HGVA 2C0XA 1RY3A 1URQD 3P8MC 1G1IA 1S9KD 1NKZB 5AVRB 1NH4A 4GT1A 3BASA 1FJKA 1CSBA 1JCDA 1IO4A 1RE3C 2FFDB 1XTCC 3V4WA 3A3YB 1JO5A 1YYCA 1N7SA 1H89A 1GTWA 3II6A 2R32A 2I1JA 2HYNA 2YO2A 1J2JB 2YO3A 2HG5D 2I1KA 2R5BA 1FJPA 2IFMA 3TYYA 1RF1B 2JJLA 2FFDC 4DOJA 1HBWA 3P8CE 3M0DC 4B86A 2WSEH 1HH0A 5AW1B 3TSIA 4C7NB 3VYIA 3M06A 5CCGD 1PFIA 1RF1C 5KJ7D 1JY3O 1KILB 3V2QA 3V5BA 2WTYA 2YKPA 1IJDB 5KTBA 1CW5A 1G2CA 4EIJA 1ZLLA 3VMXA 2W6AA 1FZGA 1JY2N 1KILC 1MUUA 3EQ2A 3SWFA 3V2RA 2XU6A 1IC2A 1QL2A 2E43A 3KQGA 3OAKA 1NTMK 4N3YB 1L4AD 2YMYA 4N6JA 5BU8B 3H6PA 3HD7D 3BRVB 2IX7C 5APUA 2FYZA 1N2DC 1DEBA 5AVXB 2W27A 1SQXK 1GU4A 2Q9IA 1RE4A 3C9IA 3RK2B 2Q5UA 3HTKA 2WWWA 3NXSA 1J1EB 1L0NK 2J59M 5APWA 4AUWA 3RK2C 1AFOA 3M91A 3LIEA 1NO4A 1JY3P 1ZV8A 2N1TA 2XKMA 1GW3A 5AW8B 4WY4A 1J1EC 4IFDK 3TNUA 1NKNA 1KILD 1LT9B 2WT7A 1GZLA 3M9HA 3N7NA 3A5TA 3OJAB 2JEEA 1IFNA 1KFMA 3TK1A 1RF0A 1NU1K 1AQ5A 1X79B 4HYTB 1LT9C 3CLQA 2BASA 4EOTA 2VRSA 3L36A 5AVQB 1LTSC 1OWAA 2NPSD 4JYBA 4N78E 1A02J 4I1LA 1LWUA 1KFNA 2O1KA 1HJBA 2H43A 4C46A 2WPSA 1SLQA 2ZFCA 2P1JA 1FZBA 1G2CB 2KB7P 5AW4B 1VPCA 1YTZT 1LT9A 4LGDE 4HH2A 4JYCA 3RK2D 2HODA 3H32A 2Z4EA 2GM4A 2OYHA 3RL0D 3V4QA 2WZ7A 3B5ND 5CCGA 1T3UA 3CI9A 1GL2A 3IFMA 5AW9B 3MD0A 4AYCA 5APVA 3BVHA 3I5CA 1HVVA 1HTLC 1FOSE 5KJ7A 5AVVB 1FZAA 1IFJA 2E42A 1IFDA 1MFZA 1JCCA 1IFMA 3M9QA 2M8RA 2J58A 5CCHD 1Z56A 2A45H 3HRNA 1GK4A 1KQLA 1JUNA 1SQBK 1T2KD 1N73A 1JTHA 1N7SD 1GDTA 5AW7B 3HTKB 2LKMA 2P7JA 2GUSA 2PAJA 1A02F 2POHA 3GHGA 1RE4C 3KDPB 5AW0B 3VN0A 1CZQA 3BATA 3HD7A 1SFCB 1JY2O 1GU5A 2KYVA 1DH3A 4IFFA 2N1TB 3G3ZA 4W7ZA 4W80A 4WY4B 3T97A 3TNUB 5APSA 2IPPA 1GD2E 3VMYA 3L35A 1M1JA 2WT7B 1KZUB 2HLOA 4W7YA 1DX7A 3U59A 1SFCC 1SQVK 2Z5IA 3KYQA 2YKOA 4IFMA 1LTTC 3RK3B 3WMM0 2N1TC 1HGZA 1LTAC 4WY4C 1S9KE 3A2AA 2A45G 5AW3B 1CI6A 2FYUK 1M7LA 2QM7A 4AQRD 3SWYA 3HUSA 4GIFA 1URQB 1LTBC 2M3BA 3LW5H 2YNYA 5AVWB 3RK3C 3NMDA 2OYIA 1LWUB 1RF0C 1SQQK 4O9BA 1FU1A 1SFCA 3CL3D 1ZR2A 1URQC 4LC1A 2C9LY 5BVZA 3M0AA 4C7RA 3VP8A 3VP9A 1LWUC 1SQPK 1ZN5A 4RESB 4DZOA 1FBMA 1ZR4A 2HODB 3H32B 2C0WA 3HE5A 3MIWA 2OYHB 4ZKPA 2H7HA 4WB4A 2NPSA 2FXMA 1GL2B 5AW5B 5APTA 1SP4A 1JY2P 1NTKK 3BRTB 1URQA 1NOHA 2OYHC 5CJ4A 3VOPA 5CCGC 3EFGA 1JMMA 1GL2C 2QM8A 2N1TD 1OXZA 4WY4D 3V2PA 1T3JA 5KJ7C 2P67A 1QL1A 4XA4A 3UIAA 1N73B 1JTHB 3B5NA 1FDMA 2XV5A 1MZ9A 5KLVK 1WRGA 1L4AB 3GHGB 1GW4A 5BU5A 3NFQA 1YTZI 3HD7B 1FZCA 1LGHB 2HPCA 1N73C 2Z5HA 4ZKUA 5CCHA 2PP6A 2A45I 3PP5A 4WBAA 1L4AC 1NAFA 3MUDA 5AVSB 5AVUB 1X8YA 3GHGC 1LTJA 1IFIA 1E5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H32 B;  1M1J B;  3HUS C;  1RF1 C;  2OYH B;  1JY3 O;  1RF0 A;  1LTJ C;  1N73 B;  1N86 A;  2A45 H;  1FZF A;  1LT9 A;  2OYI A;  1FZC B;  1LWU B;  1RF0 C;  1LT9 C;  1JY2 P;  2HPC B;  2OYI C;  2FFD A;  2HOD A;  3GHG B;  1JY3 P;  1M1J A;  3H32 A;  2HLO A;  2Z4E A;  2OYH A;  1RF1 B;  1T3U A;  1N73 A;  3HUS B;  1FZC A;  2FFD C;  1M1J C;  1LWU A;  1FZG A;  2OYH C;  1LTJ B;  3BVH A;  1JY2 N;  2Q9I A;  1RE4 A;  2H43 A;  2HPC A;  1N73 C;  1FZE A;  1FZC C;  1LWU C;  1JY3 N;  1LT9 B;  3GHG A;  1RE4 C;  2A45 I;  2A45 G;  3E1I A;  2OYI B;  1RE3 A;  1RF1 A;  1FZA A;  1W2E A;  2XNX A;  3HUS A;  3GHG C;  1LTJ A;  1JY2 O;  1RE3 C;  2FFD B;  1FZB A;  2HOD B; 
#chains in the Genus database with same CATH topology
 2AXT H;  2E74 B;  1Q82 Q;  3HUS B;  2FXO A;  1L0L D;  2CPB A;  4IL6 E;  1YIT P;  1HWT C;  1SQP D;  2UWJ E;  2LXB A;  2K3R A;  1S5L E;  3M0D A;  2ZYD A;  3O6Q A;  2FBW C;  3L37 A;  2WSE J;  3H1H E;  4I2L C;  4C7N A;  1FOS F;  5TIS E;  2NPS C;  4MN4 C;  1X22 A;  3TDK A;  2SPZ A;  3H1K D;  5KAF E;  1SQV E;  1OZH A;  1NWQ A;  2G3A A;  3W68 A;  1NHL A;  4JF7 A;  1SQV J;  4LLH A;  1SQX J;  3CCL P;  2WPQ A;  2KLV A;  2R5D A;  3VTP C;  2HPC B;  2L5G B;  1T8Z A;  5AVY B;  1EDK A;  4JQ0 D;  2Q3I A;  1FZC C;  3WUU A;  1XTG B;  5CCH C;  1JNM A;  2KK7 A;  1PL5 A;  3AE4 C;  2O1J A;  3CWB G;  2Y0D A;  3LW5 J;  1KMI Z;  1LTJ C;  2HFE D;  1JOC A;  2WSF H;  2QJY C;  3GLM A;  2Q7C A;  3I55 P;  1PP9 G;  1N7S C;  1DD3 A;  4UB8 H;  3VMZ A;  3M9B A;  3L71 E;  1RY3 A;  1FS0 E;  1G1I A;  1NKZ B;  2Y0E A;  5CBN A;  3L71 J;  1FJK A;  1RE3 C;  3RGU A;  1XTC C;  3A3Y B;  1JO5 A;  1N7S A;  3II6 A;  2HYN A;  4BWN A;  2HG5 D;  2I1K A;  4YPC A;  2R5B A;  2G8Y A;  2IFM A;  2JJL A;  2WVR A;  1VQ4 P;  2XND H;  1HBW A;  1BDC A;  1M57 D;  1HH0 A;  3TSI A;  1U7J A;  5CCG D;  1PFI A;  2W83 C;  1DEE G;  1RF1 C;  3L70 G;  1KIL B;  2R44 A;  3CWB D;  3C8V A;  4BXL A;  2WTY A;  5KTB A;  1G2C A;  1QVF O;  2KIK A;  1ZLL A;  1PP9 D;  2B9B A;  3D6Z A;  2XU6 A;  4XFJ A;  1Y47 A;  3KQG A;  4L76 A;  3OAK A;  4KT0 J;  4N3Y B;  1L4A D;  2YMY A;  2QJK B;  3HD7 D;  3RK3 E;  1SQB G;  1DD4 A;  2KXP B;  2IX7 C;  1H0T A;  1PV3 A;  4L74 A;  5B5E E;  1ZOY C;  2W27 A;  1VQN P;  4PD4 D;  3D71 A;  4OGQ D;  3RK2 B;  4D6T G;  2Q5U A;  1OX3 A;  3CMA P;  3AED C;  2J59 M;  3L70 D;  1AFO A;  3LIE A;  3FX0 A;  4EI2 A;  1GW3 A;  4ZMD A;  3Q1M A;  1KIL D;  1LT9 B;  2FYU G;  2WT7 A;  3M9H A;  1RHZ B;  4R4M A;  1OMI A;  1NU1 K;  4HYT B;  5B66 E;  1KYO I;  1SQB D;  3H25 A;  1A02 J;  2O1K A;  1HJB A;  2WPS A;  3D6Y A;  3CX5 E;  4D6T D;  2FXP A;  2QG4 A;  3W67 A;  2V7Q H;  5AW4 B;  1VPC A;  1BCC E;  4GOF A;  4LGD E;  1NTK G;  3SSU A;  4U3F E;  4JYC A;  3RK2 D;  3G4S P;  2OYH A;  1BCC J;  2KZI A;  3B5N D;  4I7Z C;  4BRY B;  3BVH A;  3I5C A;  1HVV A;  2Y9Y A;  2E42 A;  3ABV C;  2FYU D;  3AE5 C;  1GK4 A;  1JUN A;  1T2K D;  1GDT A;  3HTK B;  2LKM A;  3MZW B;  3WUV A;  1A02 F;  3GHG A;  2JWD A;  5AW0 B;  1EZV G;  3IF4 A;  1SFC B;  3Q3D A;  1NTZ G;  2KYV A;  2N1T B;  2ZJS E;  4W7Z A;  3KZI H;  3TNU B;  5APS A;  1GD2 E;  3L35 A;  1NTK D;  2Z5I A;  1M90 Q;  1LTT C;  1HGZ A;  2Q3E A;  1YI2 P;  3I56 P;  3H1J J;  1M7L A;  2QIW A;  3HUS A;  4GIF A;  1URQ B;  1RH5 B;  1LWU B;  3EWK A;  3G6E P;  3GW6 A;  5M1B A;  1SQQ K;  1L2P A;  2OTK E;  4OWF A;  1BE3 E;  2ITA A;  1ZR2 A;  4LC1 A;  5BVZ A;  1KD1 Q;  1BE3 J;  1SQP K;  1FDI A;  3L73 G;  5L8R J;  2FXM A;  3R4Y A;  1NTZ D;  4UB6 H;  1NOH A;  5CJ4 A;  3AE1 C;  5CCG C;  3EFG A;  1Q2N A;  2N1T D;  1OXZ A;  2K9Y A;  3OW2 O;  2ZVO B;  1QL1 A;  3BCC E;  1JTH B;  1N73 B;  1FDM A;  5KLV K;  1NU1 E;  3BCC J;  5BU5 A;  2H88 C;  3A0B E;  2HPC A;  2Q1K A;  5E79 E;  4ASW A;  1L4A C;  1NAF A;  1X8Y A;  2Y0C A;  1M1J B;  3HD7 C;  3L73 D;  1YJ9 P;  3WUT A;  1LT1 A;  1HUC A;  1G1J A;  2LR2 A;  2KI7 B;  1BGY J;  1CI6 B;  3HE4 B;  4OGQ C;  4YXW H;  3O8Z A;  4YXD C;  1P84 I;  2R3C A;  1L4A A;  2OYI B;  2ZT9 D;  2E76 D;  2QE7 H;  3A7O A;  3QWO C;  3TGU G;  2WSC H;  1FAV A;  3KPE A;  3P32 A;  3H1I D;  5KKZ B;  2C9N Y;  3JCU H;  5KAI E;  4N78 D;  1R5L A;  4GKG A;  5APQ A;  3HE5 B;  4PJ0 H;  1S2E A;  1H88 A;  2RH0 A;  2K1A A;  5APX A;  4NPD A;  1EQ7 A;  1KIL A;  5APY A;  1J1D B;  2XZR A;  2N9B A;  3RL0 B;  3U1A A;  3E1I A;  1NTM G;  3GF7 A;  4OVN F;  3VMA A;  1MV8 A;  2ZYG A;  3B5N C;  1ZRT D;  1SQQ E;  4WVZ A;  3B71 A;  4KHX A;  1L0N J;  1KYO D;  1L0L E;  5K5G B;  2FYN C;  1FZE A;  1SQQ J;  4Y99 C;  3H1L J;  1SQP E;  1IK9 A;  2XNX A;  2FKW B;  4RJT A;  4PV1 B;  2XDJ A;  1N86 A;  1T2K C;  2IFN A;  3V2N A;  4H44 D;  4JBZ A;  1HGV A;  2QVA A;  3P8M C;  4GT1 A;  3BAS A;  2FFD B;  2BCC E;  1NTM D;  3V4W A;  2R3S A;  3FWL A;  3KHU A;  1H89 A;  1GTW A;  2AEM A;  2YO2 A;  1J2J B;  2BCC J;  5KLV E;  3H1K G;  1RQU A;  1BDD A;  3M0D C;  5KLV J;  2WSE H;  3IAO A;  3M06 A;  1NJI Q;  1KB9 D;  2YKP A;  1IJD B;  2QA4 P;  1CW5 A;  1EC5 A;  3CCE P;  4EIJ A;  3H1L D;  1DIP A;  3EQ2 A;  3SWF A;  1IC2 A;  1QL2 A;  2AXT E;  5H2F H;  4BRY A;  3AEA C;  1USD A;  2K9J A;  1PPJ E;  2YIU B;  1P84 H;  3CPW O;  3H6P A;  1KQF B;  3H1H J;  4YTP C;  1N2D C;  1GU4 A;  3C9I A;  3CX5 I;  2W6J H;  1M56 D;  2E74 D;  3HTK A;  1QVG O;  1J1E B;  2E5Y A;  1KN7 A;  2KUB A;  3M91 A;  1GMJ A;  1NO4 A;  1JY3 P;  1SQV G;  1VF5 C;  2N1T A;  1SQX G;  3TNU A;  2FY8 A;  4EDF A;  1NKN A;  4PD4 H;  1GZL A;  4H13 C;  3OJA B;  2JEE A;  3TK1 A;  1K8A Q;  3CWB E;  1W5C E;  1X79 B;  1R8E A;  2VRS A;  3L36 A;  1K73 Q;  1PP9 E;  1IZN B;  3IN6 A;  1AVO A;  4I1L A;  1LWU A;  2ZT9 C;  2E76 C;  2Q6Q A;  3H1H D;  3FWN A;  1M1K Q;  3USS A;  4HH2 A;  3L71 G;  3IFM A;  4AYC A;  1SQV D;  1SQX D;  2MKV A;  1IFJ A;  1P84 D;  1KC8 Q;  1IFM A;  3M9Q A;  2M8R A;  2J58 A;  1OVR A;  2A45 H;  2BEQ D;  3L70 E;  1KQL A;  3CCJ P;  4UB8 E;  2JKV A;  3CCU P;  3L74 E;  1N73 A;  1JTH A;  3L74 J;  4U7J A;  3VN0 A;  3BAT A;  3A0H H;  3AE8 C;  5KLI C;  2D2C C;  1EDL A;  4WY4 B;  1M1J A;  1KZU B;  2B89 A;  2QSI A;  1BSN A;  3L71 D;  3RK3 B;  3WMM 0;  4DT0 A;  1S9K E;  2A45 G;  5AW3 B;  1CI6 A;  4D6T E;  3SFD C;  2YNY A;  3F5H A;  4H44 C;  3NMD A;  2OYI A;  1FU1 A;  1S72 P;  3CL3 D;  2IBZ E;  2OGU A;  2C9L Y;  4H0L B;  3VP8 A;  3VP9 A;  4DZO A;  2PRR A;  3RL0 g;  2E75 B;  4K35 A;  2C0W A;  3H32 B;  3HE5 A;  3MIW A;  4ZKP A;  2PFX A;  4WB4 A;  1GL2 B;  5AW5 B;  3WU2 H;  1JY2 P;  2AEF A;  1K05 A;  3RBX A;  4KJM A;  2OYH C;  3VOP A;  2IDB A;  4WY4 D;  2P67 A;  1VQO P;  3MUD C;  2KLU A;  3UIA A;  2M0B A;  2PGD A;  3CXH I;  4U3F J;  3PLN A;  1JM0 A;  1AA0 A;  3PP5 A;  4WBA A;  3MUD A;  5AVU B;  3PHL A;  4NPE A;  3GHG C;  1U7M A;  1BCC G;  2QJP C;  1AJY A;  3AEE C;  3GMA A;  2O01 J;  3L72 E;  4H0L D;  3AEC C;  4IOI H;  3L72 J;  1GK6 A;  2E75 D;  2E74 C;  3G9R A;  1GL2 D;  2OYO A;  2NRG A;  5CJ0 A;  1KB9 I;  1EZV E;  1KV4 A;  3HUS C;  1NTZ E;  2KP8 A;  3R2P A;  2DW3 A;  1LJ2 A;  2FFD A;  1YBK A;  2NPS B;  4XE5 B;  3CX5 D;  4M3L A;  4OH8 B;  3FXD A;  3ZDM A;  3B8E B;  1BCC D;  3L75 E;  3H1J G;  3L75 J;  1OIP A;  1L0L K;  3P8C D;  3LID A;  3U1C A;  3CCM P;  2Y9Z A;  3KZI E;  1UII A;  2OAR A;  3L73 E;  1Q86 Q;  1FZF A;  1FZC B;  3IR9 A;  1BE3 G;  1LTG C;  1M8O B;  1WMK A;  3CC2 P;  2YXQ B;  1LTJ B;  1SFC D;  3FGA D;  2QJY B;  1N7L A;  1N7S B;  5C39 A;  1OFC X;  3E7K A;  4DCK A;  1AV1 A;  1TU3 F;  3H1I G;  2RN0 A;  1PGQ A;  2HR3 A;  2WSS H;  3MGN A;  1H8A A;  3OA7 A;  2WIT A;  3H1J D;  2WPR A;  2C0X A;  1URQ D;  1NU1 J;  5AVR B;  1KYO H;  2IZ0 A;  3D70 A;  1YJN P;  2WMM A;  3FXE A;  1CSB A;  3BCC G;  1IO4 A;  1VQ7 P;  1YYC A;  4UB6 E;  1OVU A;  1NAY A;  2R32 A;  2I1J A;  2YO3 A;  1BE3 D;  1PIX A;  1RF1 B;  3CXH H;  5AW1 B;  5GTH H;  1BGY G;  3TGU E;  3S9O A;  3PRJ A;  3V5B A;  1ZRT E;  2JR8 A;  2IYP A;  3VMX A;  2W6A A;  1FZG A;  1KIL C;  3Q5S A;  1MUU A;  3V2R A;  4QMA A;  2B87 B;  1E79 H;  2KNC B;  1T6A A;  2A06 G;  2JDI H;  2L91 A;  4N6J A;  3BCC D;  5BU8 B;  1KB9 H;  2JWA A;  5APU A;  2FYZ A;  1DEB A;  5AVX B;  1NYH A;  1SQX K;  4ZNC A;  1RE4 A;  2M5A B;  2QJK C;  2O01 N;  3KXD A;  3C1L A;  2AEJ A;  1NTM E;  4NPF X;  2O3J A;  3JCU E;  1BGY D;  5APW A;  3V6I A;  3RK2 C;  1ZME C;  1VL2 A;  1FE6 A;  1PGJ A;  4PJ0 E;  2XKM A;  2YMK A;  4WY4 A;  1Y9B A;  3A5T A;  1YQ3 C;  1L0L J;  2H89 C;  5GTI H;  1IFN A;  1L0N G;  3K5B A;  1RF0 A;  2W90 A;  2A06 D;  1SQP J;  1SQQ G;  1Q7Y Q;  1AQ5 A;  1LT9 C;  3CLQ A;  4EOT A;  3H1L G;  3CXH D;  5AVQ B;  1LTS C;  1UIX A;  2WQY C;  4Y28 J;  4GOD A;  1VQL P;  2H43 A;  4C46 A;  2ZFC A;  2GA1 A;  4I7Z B;  4HB1 A;  1JMB A;  4IL6 H;  1PGO A;  4HKZ H;  3G71 P;  1LT9 A;  2Z4E A;  3H32 A;  4R4L A;  3V4Q A;  2CK3 H;  3RL0 D;  2WZ7 A;  1VQ9 P;  1T3U A;  3H1K E;  1GL2 A;  5AW9 B;  3MD0 A;  1YIJ P;  5APV A;  1K04 A;  1S5L H;  1FOS E;  5KJ7 A;  3H1K J;  1MKM A;  2BCC G;  1JCC A;  2OTL P;  3AEB C;  5KLV G;  1L0N D;  2IBZ I;  1SQB K;  1SQQ D;  2ZAE B;  5TIS H;  2P7J A;  3CCR P;  1IFP A;  4PV1 D;  2POH A;  5KAF H;  1VQP P;  1CZQ A;  2ZXX A;  4A7P A;  1YJW P;  3PJS K;  3AE6 C;  3G3Z A;  1S3J A;  2IPP A;  1DX7 A;  3MP7 B;  1SFC C;  3KYQ A;  4Z1M H;  3AE9 C;  2YKO A;  3E1R A;  4IFM A;  2N1T C;  1LTA C;  1PZQ A;  1KTM A;  3H1H G;  1PPJ G;  4AQR D;  1OW6 A;  2FYU K;  3CC7 P;  3LW5 H;  2BCC D;  5AVW B;  2IZ1 A;  4O9B A;  5KLV D;  1SFC A;  3CD6 P;  1URQ C;  1YHQ P;  3M0A A;  4L75 A;  1SQX E;  5H2F E;  1LWU C;  1ZN5 A;  4RES B;  1P84 E;  1FBM A;  1ZR4 A;  2HOD B;  1ZW0 A;  2H7H A;  2NPS A;  5APT A;  1AQT A;  3Q5R A;  1Y8A A;  1NTK K;  3BRT B;  1URQ A;  3CWB J;  2AXC A;  3AEF C;  1PP9 J;  3V2P A;  1EZV I;  2P10 A;  2N9Y B;  1PPJ D;  4XA4 A;  2QEX P;  1WRG A;  3S4R A;  1L4A B;  1VQ8 P;  1VQK P;  1FZC A;  4PD4 E;  1YTZ I;  3HD7 B;  1LGH B;  1N73 C;  2Z5H A;  5CCH A;  3T97 B;  3TF5 A;  1LTJ A;  4OGQ B;  3L4F A;  1NTZ K;  1ZXG A;  2ZXE B;  5AW2 B;  2WSF J;  2MJZ A;  2KS1 B;  5EFW B;  1SVF A;  3L70 J;  1M1J C;  3N4X A;  1W2B O;  5B5E H;  3QH9 A;  1JY3 N;  1KIL E;  1RE3 A;  4TT3 H;  2H8P D;  2IYO A;  1KOR A;  1FDO A;  1LTI C;  2KSJ A;  3L74 G;  5CHX A;  2GUV A;  2OYI C;  2OTJ P;  1SQB E;  1LP1 B;  4ASV A;  2P2U A;  3GF3 A;  1SQB J;  5KKZ C;  2E5T A;  3SWK A;  1RF1 A;  3HE4 A;  1D7M A;  2KOG A;  4I6M C;  4IL6 X;  4D6T J;  1EXI A;  2W6B A;  5AVT B;  1QEX A;  1WT6 A;  1HF9 A;  5B66 H;  3CCV P;  1QX8 A;  1X9V A;  3A0H E;  1S5L X;  1Q81 Q;  3B5N B;  3JSV C;  1W2E A;  3NTN A;  2FYU E;  2YKQ A;  1VDF A;  3CX5 H;  1J1D C;  2FYN B;  1OW8 A;  2B87 A;  4RO0 A;  1SS1 A;  2KNC A;  2FYU J;  4Y99 B;  3RL0 C;  2IBZ G;  5AW6 B;  3L74 D;  5CMZ A;  3P7K A;  2M5A A;  2O01 H;  2CPS A;  1NVO A;  1HJ0 A;  2I8D A;  1EXJ A;  3RK3 D;  5AVZ B;  1MFT A;  1PGP A;  1NTK E;  3MTU E;  2JP3 A;  4PV1 C;  1JB0 J;  4TLF A;  1S9K D;  1NTK J;  1NH4 A;  1Q90 D;  1JCD A;  3Q5P A;  3PTZ A;  3WU2 E;  2LXC B;  4U3F G;  3O6Q B;  3B4S A;  1QGK B;  2M3E A;  1FJP A;  2IBZ D;  3TYY A;  2K9J B;  3S1K A;  2FFD C;  4DOJ A;  3P8C E;  4B86 A;  3AE3 C;  4C7N B;  3VYI A;  3L72 G;  5KJ7 D;  1JY3 O;  2V7Q J;  1OW7 A;  3V2Q A;  1KQG B;  3AE2 C;  1R5S A;  2K88 A;  1NTZ J;  2B88 A;  1JY2 N;  4GDO A;  5TJH A;  1X0T A;  2E43 A;  1QLE D;  5CBO A;  1NTM K;  2V4H A;  3BRV B;  4U3F D;  3H1J E;  2J5U A;  2YIU C;  1U57 A;  2Q9I A;  2QRX A;  4HJG H;  2OQQ A;  1VF5 B;  3L75 G;  2WWW A;  3NXS A;  4DJG A;  1L0N K;  2ZVN B;  3L72 D;  3MHV A;  4AUW A;  1N8R Q;  4H13 B;  3L73 J;  3ITK A;  1VQM P;  1ZV8 A;  1KQS O;  5AW8 B;  2RKL A;  1S4X A;  1J1E C;  4IFD K;  1EDJ A;  3A0B H;  3N7N A;  5E79 H;  3SFE C;  1EZV D;  1KFM A;  3GG2 A;  2ZT9 B;  2E76 B;  3H1I E;  2BAS A;  1OWA A;  2NPS D;  4JYB A;  3H1I J;  4N78 E;  3EFF K;  4CPG A;  1KFN A;  1SLQ A;  2KSE A;  2P1J A;  3RBZ A;  3CME P;  1FZB A;  1G2C B;  2KB7 P;  1YTZ T;  3L75 D;  1NU1 G;  2HOD A;  2GM4 A;  5CCG A;  3CI9 A;  1VF5 D;  3JC2 2;  3Q2Y A;  1HTL C;  5KAI H;  5AVV B;  1FZA A;  1IFD A;  1MFZ A;  4H13 D;  1H0T B;  2YXR B;  5CCH D;  1BGY E;  1Z56 A;  3HRN A;  3TGU J;  1N7S D;  5KLI B;  5AW7 B;  2D2C B;  1KYO E;  4RKU J;  1AVY A;  2GUS A;  2PAJ A;  1RE4 C;  2JO1 A;  3KDP B;  3HD7 A;  1IK7 A;  1JY2 O;  1GU5 A;  1VQ5 P;  2A06 E;  1DH3 A;  4IFF A;  4W80 A;  1FC2 C;  1JEK A;  1LNQ A;  3T97 A;  1YQ4 C;  1ZP0 C;  4EYY Q;  3CXH E;  1NU1 D;  3VMY A;  2WT7 B;  2HLO A;  4W7Y A;  3U59 A;  1SQV K;  5GTH E;  1OVV A;  2RMZ A;  4H44 B;  2BEZ F;  4WY4 C;  3PH0 A;  3A2A A;  2KS1 A;  2ZYA A;  2QM7 A;  3SWY A;  5DJU B;  1LTB C;  2M3B A;  1VQ6 P;  3RK3 C;  2WSC J;  1RF0 C;  2WPV B;  1NTM J;  4PD4 I;  3F89 A;  5DJT B;  4C7R A;  3CC4 P;  1LP1 A;  2W8Z A;  1KB9 E;  2OYH B;  1S1C X;  4H0L C;  1EDI A;  3TGU D;  1K9M Q;  1L0N E;  2D2C D;  1SP4 A;  1L0L G;  3H1L E;  4GOE A;  2E75 C;  2P58 A;  4WWI A;  1NGM B;  1JMM A;  1GL2 C;  3AE7 C;  2QM8 A;  1SQP G;  1T3J A;  5KJ7 C;  3B5N A;  2XV5 A;  1MZ9 A;  3CCS P;  4L73 A;  3GHG B;  1GW4 A;  1USE A;  2QJP B;  3NFQ A;  1RQV A;  4ZKU A;  2PP6 A;  3AEG C;  1BSH A;  2A45 I;  4JPZ B;  5GTI E;  2K37 A;  3CCQ P;  5AVS B;  2NZ2 A;  2KZJ A;  1IFI A;  4K3A A;  1E5W A; 
#chains in the Genus database with same CATH homology
 1M1J B;  3L4F A;  3HD7 C;  1NTZ K;  2ZXE B;  1HUC A;  5AW2 B;  1G1J A;  2MJZ A;  1CI6 B;  1SVF A;  1GK6 A;  3HE4 B;  3HUS B;  1M1J C;  3N4X A;  3O8Z A;  1JY3 N;  2R3C A;  2CPB A;  1L4A A;  1GL2 D;  2OYI B;  1RE3 A;  2H8P D;  1HWT C;  3A7O A;  5CJ0 A;  2WSC H;  3HUS C;  1FAV A;  1LTI C;  2KSJ A;  3KPE A;  3P32 A;  2GUV A;  5CHX A;  2KP8 A;  3R2P A;  2OYI C;  2C9N Y;  2FFD A;  3M0D A;  4N78 D;  4GKG A;  5APQ A;  2P2U A;  3L37 A;  3HE5 B;  2NPS B;  4XE5 B;  1RF1 A;  4M3L A;  4OH8 B;  3HE4 A;  4I2L C;  1H88 A;  4C7N A;  2KOG A;  4I6M C;  3B8E B;  5APX A;  1FOS F;  2W6B A;  2NPS C;  1EQ7 A;  5AVT B;  1WT6 A;  1KIL A;  1L0L K;  5APY A;  1J1D B;  1NWQ A;  2XZR A;  3P8C D;  1X9V A;  1NHL A;  2N9B A;  3RL0 B;  3U1A A;  3B5N B;  3LID A;  3E1I A;  3U1C A;  4JF7 A;  1W2E A;  3NTN A;  4LLH A;  2YKQ A;  2OAR A;  1MV8 A;  1VDF A;  1J1D C;  1FZF A;  2WPQ A;  3IR9 A;  1FZC B;  1LTG C;  2KLV A;  2R5D A;  4Y99 B;  3RL0 C;  3VTP C;  2HPC B;  3B5N C;  5AW6 B;  2L5G B;  1T8Z A;  4KHX A;  5AVY B;  1LTJ B;  5CMZ A;  1SFC D;  1FZE A;  2Q3I A;  1FZC C;  1N7L A;  3P7K A;  1XTG B;  4Y99 C;  1N7S B;  1IK9 A;  2XNX A;  5CCH C;  1JNM A;  2FKW B;  2O1J A;  2O01 H;  2CPS A;  2XDJ A;  1LTJ C;  2HFE D;  3MGN A;  1H8A A;  1N86 A;  1JOC A;  1T2K C;  2WSF H;  2IFN A;  3OA7 A;  3V2N A;  2Q7C A;  2WIT A;  3RK3 D;  1N7S C;  5AVZ B;  2WPR A;  3VMZ A;  3MTU E;  3M9B A;  1HGV A;  2C0X A;  1RY3 A;  1URQ D;  3P8M C;  1G1I A;  1S9K D;  1NKZ B;  5AVR B;  1NH4 A;  4GT1 A;  3BAS A;  1FJK A;  1CSB A;  1JCD A;  1IO4 A;  1RE3 C;  2FFD B;  1XTC C;  3V4W A;  3A3Y B;  1JO5 A;  1YYC A;  1N7S A;  1H89 A;  1GTW A;  3II6 A;  2R32 A;  2I1J A;  2HYN A;  2YO2 A;  1J2J B;  2YO3 A;  2HG5 D;  2I1K A;  2R5B A;  1FJP A;  2IFM A;  3TYY A;  1RF1 B;  2JJL A;  2FFD C;  4DOJ A;  1HBW A;  3P8C E;  3M0D C;  4B86 A;  2WSE H;  1HH0 A;  5AW1 B;  3TSI A;  4C7N B;  3VYI A;  3M06 A;  5CCG D;  1PFI A;  1RF1 C;  5KJ7 D;  1JY3 O;  1KIL B;  3V2Q A;  3V5B A;  2WTY A;  2YKP A;  1IJD B;  5KTB A;  1CW5 A;  1G2C A;  4EIJ A;  1ZLL A;  3VMX A;  2W6A A;  1FZG A;  1JY2 N;  1KIL C;  1MUU A;  3EQ2 A;  3SWF A;  3V2R A;  2XU6 A;  1IC2 A;  1QL2 A;  2E43 A;  3KQG A;  3OAK A;  1NTM K;  4N3Y B;  1L4A D;  2YMY A;  4N6J A;  5BU8 B;  3H6P A;  3HD7 D;  3BRV B;  2IX7 C;  5APU A;  2FYZ A;  1N2D C;  1DEB A;  5AVX B;  2W27 A;  1SQX K;  1GU4 A;  2Q9I A;  1RE4 A;  3C9I A;  3RK2 B;  2Q5U A;  3HTK A;  2WWW A;  3NXS A;  1J1E B;  1L0N K;  2J59 M;  5APW A;  4AUW A;  3RK2 C;  1AFO A;  3M91 A;  3LIE A;  1NO4 A;  1JY3 P;  1ZV8 A;  2N1T A;  2XKM A;  1GW3 A;  5AW8 B;  4WY4 A;  1J1E C;  4IFD K;  3TNU A;  1NKN A;  1KIL D;  1LT9 B;  2WT7 A;  1GZL A;  3M9H A;  3N7N A;  3A5T A;  3OJA B;  2JEE A;  1IFN A;  1KFM A;  3TK1 A;  1RF0 A;  1NU1 K;  1AQ5 A;  1X79 B;  4HYT B;  1LT9 C;  3CLQ A;  2BAS A;  4EOT A;  2VRS A;  3L36 A;  5AVQ B;  1LTS C;  1OWA A;  2NPS D;  4JYB A;  4N78 E;  1A02 J;  4I1L A;  1LWU A;  1KFN A;  2O1K A;  1HJB A;  2H43 A;  4C46 A;  2WPS A;  1SLQ A;  2ZFC A;  2P1J A;  1FZB A;  1G2C B;  2KB7 P;  5AW4 B;  1VPC A;  1YTZ T;  1LT9 A;  4LGD E;  4HH2 A;  4JYC A;  3RK2 D;  2HOD A;  3H32 A;  2Z4E A;  2GM4 A;  2OYH A;  3RL0 D;  3V4Q A;  2WZ7 A;  3B5N D;  5CCG A;  1T3U A;  3CI9 A;  1GL2 A;  3IFM A;  5AW9 B;  3MD0 A;  4AYC A;  5APV A;  3BVH A;  3I5C A;  1HVV A;  1HTL C;  1FOS E;  5KJ7 A;  5AVV B;  1FZA A;  1IFJ A;  2E42 A;  1IFD A;  1MFZ A;  1JCC A;  1IFM A;  3M9Q A;  2M8R A;  2J58 A;  5CCH D;  1Z56 A;  2A45 H;  3HRN A;  1GK4 A;  1KQL A;  1JUN A;  1SQB K;  1T2K D;  1N73 A;  1JTH A;  1N7S D;  1GDT A;  5AW7 B;  3HTK B;  2LKM A;  2P7J A;  2GUS A;  2PAJ A;  1A02 F;  2POH A;  3GHG A;  1RE4 C;  3KDP B;  5AW0 B;  3VN0 A;  1CZQ A;  3BAT A;  3HD7 A;  1SFC B;  1JY2 O;  1GU5 A;  2KYV A;  1DH3 A;  4IFF A;  2N1T B;  3G3Z A;  4W7Z A;  4W80 A;  4WY4 B;  3T97 A;  3TNU B;  5APS A;  2IPP A;  1GD2 E;  3VMY A;  3L35 A;  1M1J A;  2WT7 B;  1KZU B;  2HLO A;  4W7Y A;  1DX7 A;  3U59 A;  1SFC C;  1SQV K;  2Z5I A;  3KYQ A;  2YKO A;  4IFM A;  1LTT C;  3RK3 B;  3WMM 0;  2N1T C;  1HGZ A;  1LTA C;  4WY4 C;  1S9K E;  3A2A A;  2A45 G;  5AW3 B;  1CI6 A;  2FYU K;  1M7L A;  2QM7 A;  4AQR D;  3SWY A;  3HUS A;  4GIF A;  1URQ B;  1LTB C;  2M3B A;  3LW5 H;  2YNY A;  5AVW B;  3RK3 C;  3NMD A;  2OYI A;  1LWU B;  1RF0 C;  1SQQ K;  4O9B A;  1FU1 A;  1SFC A;  3CL3 D;  1ZR2 A;  1URQ C;  4LC1 A;  2C9L Y;  5BVZ A;  3M0A A;  4C7R A;  3VP8 A;  3VP9 A;  1LWU C;  1SQP K;  1ZN5 A;  4RES B;  4DZO A;  1FBM A;  1ZR4 A;  2HOD B;  3H32 B;  2C0W A;  3HE5 A;  3MIW A;  2OYH B;  4ZKP A;  2H7H A;  4WB4 A;  2NPS A;  2FXM A;  1GL2 B;  5AW5 B;  5APT A;  1SP4 A;  1JY2 P;  1NTK K;  3BRT B;  1URQ A;  1NOH A;  2OYH C;  5CJ4 A;  3VOP A;  5CCG C;  3EFG A;  1JMM A;  1GL2 C;  2QM8 A;  2N1T D;  1OXZ A;  4WY4 D;  3V2P A;  1T3J A;  5KJ7 C;  2P67 A;  1QL1 A;  4XA4 A;  3UIA A;  1N73 B;  1JTH B;  3B5N A;  1FDM A;  2XV5 A;  1MZ9 A;  5KLV K;  1WRG A;  1L4A B;  3GHG B;  1GW4 A;  5BU5 A;  3NFQ A;  1YTZ I;  3HD7 B;  1FZC A;  1LGH B;  2HPC A;  1N73 C;  2Z5H A;  4ZKU A;  5CCH A;  2PP6 A;  2A45 I;  3PP5 A;  4WBA A;  1L4A C;  1NAF A;  3MUD A;  5AVS B;  5AVU B;  1X8Y A;  3GHG C;  1LTJ A;  1IFI A;  1E5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...