1JY2P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
total genus 13
structure length 44
sequence length 44
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2P00
1T3UA 3H32A 1N73A 2HPCA 2H43A 1RF1A 1RF0C 3HUSA 2OYHC 2Z4EA 1W2EA 2A45G 2FFDB 2HODB 3GHGB 1FZGA 1LT9B 2A45H 2XNXA 2Q9IA 1M1JA 2FFDC 1FZEA 1LT9C 3E1IA 1RF0A 3GHGC 1LTJB 1LWUB 2OYHA 1RE3C 1RE4C 2OYIB 1LTJC 1LWUC 1FZAA 1FZFA 1N73B 1FZCB 2HPCB 1FZBA 1JY3P 3H32B 1RF1B 2OYIC 2HODA 3HUSB 1FZCC 1LT9A 1N73C 2FFDA 1N86A 1RF1C 3GHGA 1JY3O 3HUSC 1RE3A 1JY3N 1RE4A 1JY2P 1LTJA 1LWUA 2HLOA 1FZCA 3BVHA 1M1JB 1JY2N 1JY2O 2OYHB 2OYIA 1M1JC 2A45I
chains in the Genus database with same CATH superfamily
1OW8A 1OWAA 3B71A 3CCEP 2Y9YA 2IYPA 2BCCE 4DJGA 3VP9A 2KZIA 3I55P 3RK3C 2E5YA 3L70J 1UIIA 3H1LJ 1JCDA 1U7JA 4L73A 4DT0A 1KZUB 1ZXGA 2ZXXA 2I8DA 2XDJA 3L71E 2P2UA 3FX0A 4W80A 4ZNCA 2ZVNB 3K5BA 2UWJE 3TK1A 1S5LX 5GTHE 3C1LA 3CPWO 4I6MC 5CCGD 2GM4A 3H1JG 1SQPJ 5E79E 4WY4C 4C46A 2H88C 5B5EE 2B88A 2LR2A 2A06G 1BGYG 1HGZA 2FYUD 2QIWA 2O01H 3RBZA 1L4AC 3M9QA 1N7SD 4BRYB 1FBMA 3BVHA 2WSCH 3FGAD 2POHA 2KYVA 2KNCA 1IFNA 2IZ1A 3WU2E 1KMIZ 2IYOA 1LTSC 2WITA 4WB4A 5K5GB 1NTMK 5AW3B 3L70G 4W7ZA 1JY2N 3H1LG 1M1JC 2W6BA 2H43A 3L74D 2IX7C 2IZ0A 3FWLA 1URQA 2ZFCA 3TGUE 1AVOA 3RL0D 1NHLA 3FXEA 1MZ9A 4Y99B 3VOPA 3OJAB 1ZR4A 1GW3A 3TSIA 3CLQA 2O1JA 5APQA 2XNXA 5CMZA 1MFZA 1SQPG 2O01J 1NOHA 1HH0A 3ZDMA 2Y9ZA 2WSCJ 1N86A 4GKGA 4HYTB 5CCHD 3MUDC 3HE4B 1BE3E 1S9KE 1IFMA 1RY3A 4OVNF 1KB9E 1KILB 4Y28J 1HJ0A 3VYIA 2OARA 1NTKE 5GTHH 1SQQE 4AYCA 3CXHE 2W90A 1FOSF 3H1HJ 1AA0A 1KYOE 4DOJA 1OMIA 1QEXA 3H32A 1DEBA 4OGQB 2N9YB 3HUSA 1A02J 5KLVJ 4R4LA 3GHGB 2E75B 3HD7A 3B5ND 4PV1B 3SWKA 1R5SA 4L74A 1HGVA 5CHXA 1VQPP 3AEBC 3VMXA 1ZV8A 3GG2A 4I7ZC 3I5CA 1SQQD 3CXHD 3RK3B 2ZT9D 1GK6A 2XNDH 1SQXJ 1WT6A 3L71J 1NTZD 1BDDA 4GOEA 1PV3A 1USDA 1G1IA 1KC8Q 1Q86Q 1SLQA 2WWWA 1Y8AA 5KAIH 1BCCJ 1EDIA 4RESB 2RMZA 1QLED 1CSBA 1MFTA 4H0LD 4O9BA 3WUTA 2K9JB 1NKNA 3H1HG 3O6QB 3CI9A 3AE9C 4YXWH 1NAYA 3VMYA 1HF9A 2YXRB 1K73Q 1EDJA 5KLVG 5AVQB 2R5DA 4BWNA 3IN6A 4JQ0D 1L4AB 2JDIH 3SFEC 1UIXA 4NPFX 5KKZC 2JR8A 4EYYQ 1Y47A 5CBOA 2RKLA 4BRYA 1GTWA 1VPCA 1J1EC 1SQVD 1RE3C 3D6YA 1RE4A 1VQOP 1KORA 1SQXG 1M1JB 3M0DA 3L71G 1IFPA 3PP5A 1PP9D 3H1KJ 1FZGA 1LTTC 3IR9A 2D2CC 1ZP0C 1SS1A 2E5TA 1Q81Q 3EQ2A 1BCCG 1GW4A 1KD1Q 1YJ9P 2A06E 1BGYE 1NTMJ 2G8YA 2JP3A 1FZCC 4XA4A 2JEEA 5DJTB 5BU5A 2HYNA 2K1AA 3AE2C 1LT9C 1LT1A 3ITKA 1IC2A 1T6AA 1XTCC 4RKUJ 3GW6A 5KJ7D 2R3CA 1JNMA 2R44A 2AEJA 3AEEC 3H1JD 3L70E 5GTIH 2XKMA 2Q1KA 1SQPK 5AW4B 5B66H 1T2KC 1KILA 3H1IJ 1S1CX 1NAFA 1N7LA 5AVYB 3CCQP 2OYHB 1RF0C 4D6TJ 1MUUA 2KS1B 2JWAA 1SQPE 1KYOI 3H1KG 1S2EA 2IFMA 1PGPA 2W6JH 2YKQA 1NTMG 3L73D 3H1LD 2JWDA 3V4QA 3HD7D 4I7ZB 3F89A 3RK2D 1JM0A 2QA4P 3QWOC 2M0BA 3Q5PA 2Z5IA 2ZYGA 1AFOA 5AW2B 2XV5A 1K05A 2LXBA 1MV8A 2E74D 3VN0A 3N4XA 1AJYA 1SFCB 4DZOA 5AVRB 4PD4H 2O3JA 1VQ5P 1QL1A 4H44C 2FFDC 3H6PA 2P67A 3C9IA 1LTJC 1CI6B 1N73B 3JCUH 1DH3A 2IPPA 3H1IG 4H13D 4ZKUA 1JY2O 2WVRA 3QH9A 2KXPB 3CD6P 1CZQA 5AVXB 2K9JA 3AE7C 3MGNA 4D6TG 3O6QA 4WY4A 3ABVC 1L2PA 1LWUC 1JMMA 5KAFE 3Q1MA 1OW7A 1HUCA 5KKZB 2NPSC 1USEA 1DD3A 2QRXA 1L4AA 2GUSA 5APUA 4GIFA 3CCLP 2E76D 1H0TA 3S1KA 3L72D 5KLVK 3O8ZA 5CBNA 5CCGC 2K9YA 2O1KA 3BATA 3GMAA 3NFQA 1YHQP 4QMAA 2KLVA 3OAKA 1VF5B 3V2RA 2GA1A 3H1HE 4OGQC 1E79H 4U7JA 2D2CB 1M1JA 3CWBD 3GHGC 5AW7B 5KLVE 2OYIB 1PPJE 1OVRA 1EZVD 1ZRTD 3Q5RA 4MN4C 4ZMDA 5AW5B 4PD4I 2ZVOB 1LP1A 3SWYA 1GZLA 1GL2D 1EQ7A 1LT9B 3CX5E 3EFGA 1KILE 2FYUK 5AVZB 3CCMP 4KT0J 2Q7CA 2WPRA 5AW8B 1QVFO 2Y0EA 1SQBK 3TDKA 1YI2P 3V4WA 5BU8B 1SQXE 3LIDA 1DD4A 3MUDA 4IFDK 2CK3H 1DX7A 1NU1D 2IFNA 3U59A 3T97B 3M91A 1BCCE 5AW9B 4N78E 1HJBA 2Y0DA 2RH0A 3II6A 3L75J 1KILD 2BCCD 2KSEA 3RL0g 4C7NB 2N1TB 3L36A 3TYYA 2KS1A 2IDBA 5KAFH 3CCRP 3RK3E 1SQXD 3L71D 2HPCA 2QJPB 1JB0J 3N7NA 1YYCA 1JUNA 1VQ7P 4N78D 2YXQB 3G6EP 2OGUA 2HFED 4JPZB 1KFNA 4H44B 2FFDB 5KAIE 4IOIH 1LTJB 4WWIA 3P8CE 3M0AA 3Q3DA 3BCCE 3H1KE 1FDOA 1QL2A 1KFMA 3HE5A 1AVYA 1CI6A 2KOGA 1NTME 1ZOYC 2M5AB 3PTZA 4U3FE 1PZQA 1SP4A 3CX5H 1LWUB 3L75G 3AE3C 2ZT9C 2M8RA 2NPSB 4XE5B 1JY2P 1PGOA 5BVZA 4WVZA 1NYHA 2YMYA 4I1LA 1NVOA 4WY4D 3TGUD 3CCVP 2LKMA 1S4XA 4RO0A 1NTZK 1X9VA 1EC5A 1L4AD 1RE3A 1R8EA 1NTMD 2Q3EA 3B4SA 3H1IE 1M57D 1LGHB 3TNUA 2FYZA 2OYHC 4UB6H 3IF4A 1FDMA 2QEXP 2YIUB 4D6TE 1N7SB 4L75A 2H7HA 3JC22 1BE3D 3FXDA 1S9KD 1YBKA 4LGDE 1WRGA 2E43A 1FZCA 1KB9D 1M8OB 3CC7P 2B87A 1RHZB 1NTKD 4ZKPA 1KYOD 1LT9A 2YO2A 1IO4A 1VQKP 3R2PA 3CX5I 3RL0B 1SFCC 3GF3A 5GTIE 2FYUJ 4D6TD 1NJIQ 4K35A 5L8RJ 1KN7A 5B66E 4EIJA 4C7RA 1FU1A 1N73C 1SQBJ 2BEQD 2R5BA 2YKPA 2XU6A 1LTAC 5AVUB 2JKVA 2WTYA 2L91A 1K8AQ 1YTZT 1T3UA 1IK9A 2C9LY 2YKOA 1VQMP 1RF0A 2YNYA 1PPJG 3RGUA 3CL3D 2KSJA 2KB7P 2H89C 5KJ7C 4UB8H 4C7NA 1E5WA 3OW2O 3CCUP 5AW6B 4WBAA 2LXCB 3V5BA 4HKZH 2I1KA 2WQYC 4LLHA 1HVVA 1FS0E 4TLFA 2YO3A 1NKZB 3AEAC 2KP8A 4A7PA 5M1BA 4L76A 3VP8A 4R4MA 1VF5C 3B5NB 2J5UA 1M90Q 3BCCJ 4PD4E 3KZIH 2WSSH 3G4SP 3GLMA 2I1JA 1G2CB 3SSUA 2FYUG 3MIWA 2BASA 3JCUE 2OYIC 1L0NK 1JCCA 3AE5C 1LTJA 3HTKB 4U3FJ 1SQBG 1URQD 2QG4A 4AQRD 1HBWA 1NGMB 3A0HH 4W7YA 2SPZA 1Q2NA 4JYCA 2ZT9B 2QM8A 2R32A 1KQSO 3A5TA 2E74C 2M5AA 5H2FH 1J2JB 1LTGC 2W27A 1LWUA 1NWQA 1FE6A 1L0LK 2FBWC 2Y0CA 1W2BO 1RQUA 2L5GB 4PD4D 2NPSA 4K3AA 3HE4A 3AECC 2J59M 2KZJA 2A06D 3A2AA 1BGYD 4EDFA 1YJNP 2PAJA 1YTZI 1YITP 4H13C 2M3EA 5CCGA 2ZJSE 3MTUE 4YPCA 3B8EB 3BCCG 4LC1A 1NTZJ 1IK7A 2IBZI 3R4YA 1T3JA 3L75E 2FKWB 2N1TC 3IAOA 3GHGA 1S5LH 1H89A 3L70D 5TJHA 4U3FG 3V2NA 5CJ0A 1JO5A 4Z1MH 2QJPC 3D6ZA 1P84E 1NH4A 2RN0A 2D2CD 3OA7A 5AVWB 4YTPC 1Q7YQ 3NTNA 3CC2P 1Z56A 2KNCB 1JY3O 3TF5A 3A3YB 1PFIA 1J1DC 5APTA 3I56P 4IL6E 1X79B 1M1KQ 1IJDB 1M7LA 1SQPD 2HR3A 5AW1B 2R3SA 1LJ2A 3RBXA 2IBZG 2QE7H 1VDFA 1AV1A 1JOCA 1GL2C 2G3AA 1FAVA 1T2KD 2XZRA 1FOSE 3SFDC 1NTZG 2ZYAA 1K04A 1PP9J 1BSHA 2N9BA 5APXA 2QSIA 4ASWA 4M3LA 3AEDC 4HB1A 1IFDA 3MD0A 4JBZA 2HLOA 1M56D 5CJ4A 2W6AA 5TISH 2M3BA 4CPGA 3PHLA 2QJYB 3MHVA 2FXMA 1U7MA 2K37A 2WSFH 2YIUC 3V6IA 1N7SC 1X8YA 3NMDA 3C8VA 3HD7B 1G2CA 2HG5D 3E7KA 3GF7A 4PJ0H 2V4HA 2W8ZA 1P84H 1ZLLA 1FZEA 4EOTA 3G3ZA 3SWFA 2E74B 4OWFA 1OVUA 1L0NJ 4GDOA 1RF1C 1ZW0A 1X0TA 3LW5H 1TU3F 3H1HD 3BRTB 4IL6H 4AUWA 1PP9G 1U57A 2FYNC 2BEZF 3A0BH 3RL0C 4TT3H 5KLVD 2PFXA 1PPJD 1NO4A 3USSA 4JYBA 3M9BA 2OTJP 4H13B 3L73J 2FYUE 1L0LJ 2NPSD 2PRRA 4N3YB 1SQBE 4UB6E 2Q6QA 3CX5D 2WSFJ 3V2QA 2OYHA 1EDKA 4KJMA 2KK7A 2J58A 5CCHC 1JY3N 2FXOA 2E76B 1XTGB 3L74E 4OGQD 1JEKA 3AE1C 2AEMA 1QVGO 1D7MA 3VMZA 2K3RA 2E75D 1BCCD 3MP7B 3LW5J 4PV1D 4NPDA 2C0WA 4HH2A 1L0NG 1J1DB 4ASVA 4IFFA 1SQBD 1P84I 3G9RA 4OH8B 1QX8A 2P58A 3M9HA 3B5NC 2WMMA 3Q2YA 1SFCA 1FZBA 1JY3P 3EFFK 2CPBA 1HTLC 1T8ZA 1W5CE 3RK3D 4B86A 2JJLA 3BRVB 3L73G 3AE4C 2WT7B 3V2PA 1JTHB 1GL2B 2P1JA 1OIPA 1L0LG 3L72J 1N73A 2Q5UA 2QVAA 5AVTB 1ZR2A 2AXCA 5APYA 4UB8E 3HRNA 3CWBJ 3BASA 5KJ7A 1OFCX 1NTKK 1SQQK 1KV4A 3A7OA 3EWKA 2OYOA 3P8CD 2KUBA 3BCCD 3NXSA 4BXLA 3H1KD 2QJKC 2FY8A 4H0LC 4I2LC 2IBZE 1BDCA 4U3FD 2QM7A 2HODB 5AW0B 1DEEG 3KZIE 3MZWB 1EZVI 1IZNB 2B89A 5APWA 2PGDA 3U1AA 1PGQA 1NTZE 2OYIA 1NU1J 5AVSB 5E79H 3KYQA 2AXTE 5B5EH 3L72G 2YMKA 3S4RA 3A0HE 1N8RQ 1LTBC 2VRSA 1AQTA 2MJZA 1SVFA 3L37A 5EFWB 1RF1B 1WMKA 4IL6X 5H2FE 3VMAA 2IBZD 3H1ID 2Z5HA 3KQGA 2FXPA 2BCCJ 2FYNB 2WPQA 5DJUB 2KI7B 2DW3A 3CWBG 1IFJA 3WU2H 2KIKA 1SQVK 3CCSP 1FJKA 1OW6A 1A02F 1EZVG 2W83C 3PH0A 1URQC 3T97A 3PRJA 1VQ6P 1QGKB 1RH5B 5APVA 1SQVE 1VQ4P 1ZMEC 2C0XA 3L74J 1LTIC 3P7KA 1S5LE 2N1TA 3Q5SA 4WY4B 3VTPC 3AE6C 2B9BA 1NU1G 1PP9E 2A45H 3F5HA 3M06A 2Q3IA 4EI2A 1KTMA 1VQ8P 4DCKA 1H0TB 4JF7A 1KB9H 1FC2C 1OX3A 5APSA 2BCCG 1LNQA 3E1IA 1OXZA 4N6JA 3CXHH 2QJYC 1FZAA 2OQQA 3U1CA 5KTBA 1KYOH 2E42A 2FFDA 1Y9BA 1KQLA 3HUSC 3TGUJ 3HD7C 3P32A 2AXTH 1G1JA 1YQ3C 3H1JE 3RK2C 1KQGB 1GD2E 1FJPA 1SFCD 2GUVA 3PLNA 3CMAP 2WT7A 1JTHA 1GL2A 1Q82Q 1LP1B 2WPSA 1FZFA 5KLIC 4XFJA 3H25A 3WUUA 3WUVA 1YJWP 1S72P 1L0NE 3D70A 3L74G 1YIJP 2KLUA 2ZXEB 1VQNP 2QJKB 1HWTC 1BE3J 4H0LB 2AEFA 1GU4A 1GK4A 2A45I 2CPSA 3IFMA 3H1LE 3L73E 1RQVA 3E1RA 2WSEH 1NTKJ 5TISE 1SQQJ 1L0LE 1W2EA 4YXDC 1VQLP 3CCJP 2HODA 2ITAA 1KB9I 1L0ND 1GU5A 1VQ9P 3KHUA 1N7SA 2E76C 1VL2A 1OVVA 3TGUG 3CXHI 1VF5D 1PGJA 2WZ7A 2Q9IA 3AEGC 4PJ0E 3UIAA 4KHXA 1YQ4C 2HPCB 1EXIA 1IFIA 1MKMA 3W68A 3D71A 4IFMA 1S3JA 2V7QH 1L0LD 1RF1A 3WMM0 2A45G 1H8AA 2O01N 3L4FA 1X22A 3A0BE 3KDPB 1RE4C 3W67A 3CC4P 3L75D 2C9NY 1N2DC 3M0DC 1AQ5A 2WPVB 1BE3G 1URQB 2WSEJ 2P10A 3AEFC 1SQVJ 1P84D 3HE5B 1NTKG 2P7JA 1SQQG 3L72E 1K9MQ 2OTKE 4GODA 1Q90D 3KPEA 4Y99C 2JO1A 3FWNA 2K88A 2MKVA 1CW5A 3KXDA 1PL5A 5CCHA 1PIXA 2Z4EA 3S9OA 2NRGA 3CWBE 5AVVB 4HJGH 2N1TD 2V7QJ 2H8PD 4GOFA 3L35A 1EZVE 1ZRTE 3JSVC 1GDTA 1GMJA 3G71P 1EDLA 1NU1K 1KILC 1J1EB 2OTLP 1JMBA 3LIEA 4RJTA 3TNUB 1OZHA 3H32B 5C39A 3B5NA 1H88A 1EXJA 3HUSB 3CMEP 1BSNA 2ZYDA 3H1JJ 4GT1A 1FDIA 1ZN5A 3RK2B 3PJSK 3P8MC 1BGYJ 3HTKA 1NU1E 2E75C 1SQVG 4H44D 2PP6A 5KLIB 4PV1C 2NZ2A 1FZCB 3AE8C 1DIPA 4NPEA 1KQFB 1R5LA 2ZAEB 1SQXK 2B87B
chains in the Genus database with same CATH topology
3HRNA 3BASA 3HD7D 5KJ7A 5AW6B 4WBAA 1OWAA 3RK2D 3V5BA 1NTKK 1SQQK 2I1KA 3A7OA 4LLHA 2Z5IA 3P8CD 1AFOA 5AW2B 3NXSA 2XV5A 3VP9A 1HVVA 2YO3A 3RK3C 1MV8A 3VN0A 1JCDA 4I2LC 1KZUB 3N4XA 1NKZB 2KP8A 2XDJA 3VP8A 1SFCB 4DZOA 3B5NB 5AVRB 2P2UA 2QM7A 4W80A 2HODB 5AW0B 1QL1A 2FFDC 3H6PA 2P67A 3C9IA 2I1JA 1G2CB 3TK1A 1LTJC 1CI6B 1N73B 3MIWA 2BASA 1DH3A 2OYIC 5APWA 4I6MC 1L0NK 2IPPA 1JCCA 5CCGD 3U1AA 1LTJA 4ZKUA 3HTKB 1JY2O 2GM4A 1URQD 2OYIA 5AVSB 3KYQA 1CZQA 4AQRD 4WY4C 1HBWA 5AVXB 4C46A 4W7YA 3MGNA 4JYCA 1LTBC 2QM8A 2VRSA 2R32A 4WY4A 1LWUC 1HGZA 2MJZA 1SVFA 1JMMA 3A5TA 2O01H 1J2JB 3L37A 1RF1B 1LTGC 1L4AC 3M9QA 1HUCA 1N7SD 2NPSC 2W27A 1LWUA 1FBMA 3BVHA 1NWQA 2WSCH 2Z5HA 3KQGA 1L0LK 2POHA 1L4AA 2GUSA 2WPQA 5APUA 4GIFA 2KYVA 2L5GB 2NPSA 1IFNA 1IFJA 5KLVK 1SQVK 1FJKA 3HE4A 2J59M 3A2AA 3O8ZA 5CCGC 2PAJA 1LTSC 1YTZI 2O1KA 1A02F 3BATA 2WITA 3NFQA 4WB4A 1NTMK 5AW3B 1URQC 3T97A 4W7ZA 1JY2N 2KLVA 3OAKA 5CCGA 1M1JC 2W6BA 3V2RA 2H43A 2IX7C 1URQA 2ZFCA 1M1JA 3MTUE 3RL0D 1NHLA 3B8EB 3GHGC 5AW7B 5APVA 1MZ9A 4LC1A 2OYIB 4Y99B 3VOPA 3OJAB 1ZR4A 1T3JA 2FKWB 2N1TC 3GHGA 1GW3A 3TSIA 5AW5B 2C0XA 1LTIC 3P7KA 3CLQA 2N1TA 1H89A 4WY4B 3VTPC 3V2NA 1JO5A 5CJ0A 2O1JA 3SWYA 1GZLA 1GL2D 1EQ7A 5APQA 1LT9B 2A45H 2XNXA 1MFZA 5CMZA 3M06A 1NOHA 1NH4A 2Q3IA 1HH0A 3EFGA 2FYUK 3OA7A 5AVZB 5AVWB 2Q7CA 2WPRA 3NTNA 5AW8B 1Z56A 1N86A 4GKGA 1JY3O 4HYTB 5CCHD 1SQBK 4JF7A 3A3YB 3HE4B 1PFIA 1J1DC 5APTA 1S9KE 1IFMA 3V4WA 5BU8B 3LIDA 1RY3A 1KILB 1X79B 3MUDA 5APSA 4IFDK 1DX7A 3VYIA 1IJDB 1M7LA 2IFNA 2OARA 3E1IA 3U59A 1OXZA 4N6JA 5AW1B 1FZAA 4AYCA 3M91A 3U1CA 5KTBA 1FOSF 2E42A 5AW9B 2FFDA 4N78E 1KQLA 3HUSC 1HJBA 4DOJA 1VDFA 3HD7C 3H32A 1JOCA 1DEBA 3P32A 1G1JA 1GL2C 3HUSA 3RK2C 1A02J 1GD2E 3GHGB 3II6A 1KILD 1FJPA 1SFCD 2GUVA 3HD7A 3B5ND 2WT7A 1JTHA 1GL2A 1FAVA 4C7NB 2N1TB 1T2KD 2WPSA 2XZRA 3L36A 1FZFA 1FOSE 3TYYA 1HGVA 5CHXA 3VMXA 1ZV8A 2HPCA 2N9BA 5APXA 3I5CA 3N7NA 2ZXEB 1HWTC 4M3LA 1YYCA 1JUNA 4N78D 3RK3B 1GK6A 1IFDA 1WT6A 3MD0A 2HLOA 2HFED 1GU4A 1G1IA 5CJ4A 1GK4A 2A45I 2CPSA 2W6AA 3IFMA 2WSEH 2M3BA 1KFNA 1SLQA 1W2EA 2WWWA 2FFDB 1LTJB 4RESB 2FXMA 3M0AA 3P8CE 2WSFH 2HODA 1QL2A 1CSBA 1KFMA 1N7SC 4O9BA 1X8YA 3NMDA 3HE5A 1GU5A 3HD7B 1G2CA 1NKNA 1CI6A 2KOGA 2HG5D 1N7SA 3CI9A 3VMYA 2WZ7A 2Q9IA 1SP4A 1FZEA 1ZLLA 3UIAA 4KHXA 4EOTA 5AVQB 1LWUB 3G3ZA 3SWFA 2R5DA 2HPCB 1L4AB 1IFIA 2M8RA 1RF1C 2NPSB 4XE5B 1JY2P 4IFMA 3LW5H 5BVZA 3BRTB 1RF1A 4AUWA 2YMYA 4I1LA 3WMM0 4WY4D 2A45G 1H8AA 1GTWA 3RL0C 1VPCA 3L4FA 1J1EC 1RE3C 3KDPB 1RE4C 2LKMA 1NO4A 4JYBA 3M9BA 2C9NY 1N2DC 3M0DC 1AQ5A 1NTZK 1X9VA 1URQB 1L4AD 1RE3A 1RE4A 1M1JB 2NPSD 3M0DA 4N3YB 1LGHB 3TNUA 2FYZA 2OYHC 3PP5A 1FDMA 1FZGA 1LTTC 3HE5B 3IR9A 2P7JA 3V2QA 2OYHA 3EQ2A 1GW4A 3KPEA 1N7SB 4Y99C 2H7HA 1FZCC 2J58A 5CCHC 1JY3N 4XA4A 2JEEA 1S9KD 1CW5A 4LGDE 1WRGA 2E43A 1FZCA 1XTGB 5BU5A 5CCHA 2HYNA 2Z4EA 1LT9C 4ZKPA 3VMZA 5AVVB 1IC2A 2C0WA 1LT9A 2N1TD 2H8PD 1XTCC 4HH2A 2YO2A 3L35A 1J1DB 1GDTA 5KJ7D 1IO4A 2R3CA 4IFFA 1JNMA 3R2PA 4OH8B 3RL0B 1NU1K 1KILC 2XKMA 1SFCC 1J1EB 3M9HA 1SQPK 3B5NC 5AW4B 1T2KC 3LIEA 1KILA 4EIJA 1SFCA 3TNUB 4C7RA 1FU1A 3H32B 1FZBA 1JY3P 3B5NA 2CPBA 1H88A 1NAFA 3HUSB 1N7LA 1HTLC 1T8ZA 1N73C 5AVYB 2R5BA 2YKPA 4GT1A 3RK3D 4B86A 2JJLA 2XU6A 3BRVB 1LTAC 5AVUB 2WTYA 1ZN5A 2OYHB 3V2PA 1JTHB 1GL2B 3RK2B 2P1JA 1YTZT 1T3UA 2WT7B 1N73A 1RF0C 2Q5UA 1MUUA 1IK9A 2C9LY 3P8MC 2YKOA 3HTKA 1RF0A 2YNYA 5AVTB 2PP6A 1ZR2A 1FZCB 5APYA 3CL3D 2KSJA 2IFMA 2KB7P 2YKQA 5KJ7C 1SQXK 4C7NA 1E5WA 3V4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3U A;  3H32 A;  1N73 A;  2HPC A;  2H43 A;  1RF1 A;  1RF0 C;  3HUS A;  2OYH C;  2Z4E A;  1W2E A;  2A45 G;  2FFD B;  2HOD B;  3GHG B;  1FZG A;  1LT9 B;  2A45 H;  2XNX A;  2Q9I A;  1M1J A;  2FFD C;  1FZE A;  1LT9 C;  3E1I A;  1RF0 A;  3GHG C;  1LTJ B;  1LWU B;  2OYH A;  1RE3 C;  1RE4 C;  2OYI B;  1LTJ C;  1LWU C;  1FZA A;  1FZF A;  1N73 B;  1FZC B;  2HPC B;  1FZB A;  1JY3 P;  3H32 B;  1RF1 B;  2OYI C;  2HOD A;  3HUS B;  1FZC C;  1LT9 A;  1N73 C;  2FFD A;  1N86 A;  1RF1 C;  3GHG A;  1JY3 O;  3HUS C;  1RE3 A;  1JY3 N;  1RE4 A;  1JY2 P;  1LTJ A;  1LWU A;  2HLO A;  1FZC A;  3BVH A;  1M1J B;  1JY2 N;  1JY2 O;  2OYH B;  2OYI A;  1M1J C;  2A45 I; 
#chains in the Genus database with same CATH topology
 1OW8 A;  1OWA A;  3B71 A;  3CCE P;  2Y9Y A;  2IYP A;  2BCC E;  4DJG A;  3VP9 A;  2KZI A;  3I55 P;  3RK3 C;  2E5Y A;  3L70 J;  1UII A;  3H1L J;  1JCD A;  1U7J A;  4L73 A;  4DT0 A;  1KZU B;  1ZXG A;  2ZXX A;  2I8D A;  2XDJ A;  3L71 E;  2P2U A;  3FX0 A;  4W80 A;  4ZNC A;  2ZVN B;  3K5B A;  2UWJ E;  3TK1 A;  1S5L X;  5GTH E;  3C1L A;  3CPW O;  4I6M C;  5CCG D;  2GM4 A;  3H1J G;  1SQP J;  5E79 E;  4WY4 C;  4C46 A;  2H88 C;  5B5E E;  2B88 A;  2LR2 A;  2A06 G;  1BGY G;  1HGZ A;  2FYU D;  2QIW A;  2O01 H;  3RBZ A;  1L4A C;  3M9Q A;  1N7S D;  4BRY B;  1FBM A;  3BVH A;  2WSC H;  3FGA D;  2POH A;  2KYV A;  2KNC A;  1IFN A;  2IZ1 A;  3WU2 E;  1KMI Z;  2IYO A;  1LTS C;  2WIT A;  4WB4 A;  5K5G B;  1NTM K;  5AW3 B;  3L70 G;  4W7Z A;  1JY2 N;  3H1L G;  1M1J C;  2W6B A;  2H43 A;  3L74 D;  2IX7 C;  2IZ0 A;  3FWL A;  1URQ A;  2ZFC A;  3TGU E;  1AVO A;  3RL0 D;  1NHL A;  3FXE A;  1MZ9 A;  4Y99 B;  3VOP A;  3OJA B;  1ZR4 A;  1GW3 A;  3TSI A;  3CLQ A;  2O1J A;  5APQ A;  2XNX A;  5CMZ A;  1MFZ A;  1SQP G;  2O01 J;  1NOH A;  1HH0 A;  3ZDM A;  2Y9Z A;  2WSC J;  1N86 A;  4GKG A;  4HYT B;  5CCH D;  3MUD C;  3HE4 B;  1BE3 E;  1S9K E;  1IFM A;  1RY3 A;  4OVN F;  1KB9 E;  1KIL B;  4Y28 J;  1HJ0 A;  3VYI A;  2OAR A;  1NTK E;  5GTH H;  1SQQ E;  4AYC A;  3CXH E;  2W90 A;  1FOS F;  3H1H J;  1AA0 A;  1KYO E;  4DOJ A;  1OMI A;  1QEX A;  3H32 A;  1DEB A;  4OGQ B;  2N9Y B;  3HUS A;  1A02 J;  5KLV J;  4R4L A;  3GHG B;  2E75 B;  3HD7 A;  3B5N D;  4PV1 B;  3SWK A;  1R5S A;  4L74 A;  1HGV A;  5CHX A;  1VQP P;  3AEB C;  3VMX A;  1ZV8 A;  3GG2 A;  4I7Z C;  3I5C A;  1SQQ D;  3CXH D;  3RK3 B;  2ZT9 D;  1GK6 A;  2XND H;  1SQX J;  1WT6 A;  3L71 J;  1NTZ D;  1BDD A;  4GOE A;  1PV3 A;  1USD A;  1G1I A;  1KC8 Q;  1Q86 Q;  1SLQ A;  2WWW A;  1Y8A A;  5KAI H;  1BCC J;  1EDI A;  4RES B;  2RMZ A;  1QLE D;  1CSB A;  1MFT A;  4H0L D;  4O9B A;  3WUT A;  2K9J B;  1NKN A;  3H1H G;  3O6Q B;  3CI9 A;  3AE9 C;  4YXW H;  1NAY A;  3VMY A;  1HF9 A;  2YXR B;  1K73 Q;  1EDJ A;  5KLV G;  5AVQ B;  2R5D A;  4BWN A;  3IN6 A;  4JQ0 D;  1L4A B;  2JDI H;  3SFE C;  1UIX A;  4NPF X;  5KKZ C;  2JR8 A;  4EYY Q;  1Y47 A;  5CBO A;  2RKL A;  4BRY A;  1GTW A;  1VPC A;  1J1E C;  1SQV D;  1RE3 C;  3D6Y A;  1RE4 A;  1VQO P;  1KOR A;  1SQX G;  1M1J B;  3M0D A;  3L71 G;  1IFP A;  3PP5 A;  1PP9 D;  3H1K J;  1FZG A;  1LTT C;  3IR9 A;  2D2C C;  1ZP0 C;  1SS1 A;  2E5T A;  1Q81 Q;  3EQ2 A;  1BCC G;  1GW4 A;  1KD1 Q;  1YJ9 P;  2A06 E;  1BGY E;  1NTM J;  2G8Y A;  2JP3 A;  1FZC C;  4XA4 A;  2JEE A;  5DJT B;  5BU5 A;  2HYN A;  2K1A A;  3AE2 C;  1LT9 C;  1LT1 A;  3ITK A;  1IC2 A;  1T6A A;  1XTC C;  4RKU J;  3GW6 A;  5KJ7 D;  2R3C A;  1JNM A;  2R44 A;  2AEJ A;  3AEE C;  3H1J D;  3L70 E;  5GTI H;  2XKM A;  2Q1K A;  1SQP K;  5AW4 B;  5B66 H;  1T2K C;  1KIL A;  3H1I J;  1S1C X;  1NAF A;  1N7L A;  5AVY B;  3CCQ P;  2OYH B;  1RF0 C;  4D6T J;  1MUU A;  2KS1 B;  2JWA A;  1SQP E;  1KYO I;  3H1K G;  1S2E A;  2IFM A;  1PGP A;  2W6J H;  2YKQ A;  1NTM G;  3L73 D;  3H1L D;  2JWD A;  3V4Q A;  3HD7 D;  4I7Z B;  3F89 A;  3RK2 D;  1JM0 A;  2QA4 P;  3QWO C;  2M0B A;  3Q5P A;  2Z5I A;  2ZYG A;  1AFO A;  5AW2 B;  2XV5 A;  1K05 A;  2LXB A;  1MV8 A;  2E74 D;  3VN0 A;  3N4X A;  1AJY A;  1SFC B;  4DZO A;  5AVR B;  4PD4 H;  2O3J A;  1VQ5 P;  1QL1 A;  4H44 C;  2FFD C;  3H6P A;  2P67 A;  3C9I A;  1LTJ C;  1CI6 B;  1N73 B;  3JCU H;  1DH3 A;  2IPP A;  3H1I G;  4H13 D;  4ZKU A;  1JY2 O;  2WVR A;  3QH9 A;  2KXP B;  3CD6 P;  1CZQ A;  5AVX B;  2K9J A;  3AE7 C;  3MGN A;  4D6T G;  3O6Q A;  4WY4 A;  3ABV C;  1L2P A;  1LWU C;  1JMM A;  5KAF E;  3Q1M A;  1OW7 A;  1HUC A;  5KKZ B;  2NPS C;  1USE A;  1DD3 A;  2QRX A;  1L4A A;  2GUS A;  5APU A;  4GIF A;  3CCL P;  2E76 D;  1H0T A;  3S1K A;  3L72 D;  5KLV K;  3O8Z A;  5CBN A;  5CCG C;  2K9Y A;  2O1K A;  3BAT A;  3GMA A;  3NFQ A;  1YHQ P;  4QMA A;  2KLV A;  3OAK A;  1VF5 B;  3V2R A;  2GA1 A;  3H1H E;  4OGQ C;  1E79 H;  4U7J A;  2D2C B;  1M1J A;  3CWB D;  3GHG C;  5AW7 B;  5KLV E;  2OYI B;  1PPJ E;  1OVR A;  1EZV D;  1ZRT D;  3Q5R A;  4MN4 C;  4ZMD A;  5AW5 B;  4PD4 I;  2ZVO B;  1LP1 A;  3SWY A;  1GZL A;  1GL2 D;  1EQ7 A;  1LT9 B;  3CX5 E;  3EFG A;  1KIL E;  2FYU K;  5AVZ B;  3CCM P;  4KT0 J;  2Q7C A;  2WPR A;  5AW8 B;  1QVF O;  2Y0E A;  1SQB K;  3TDK A;  1YI2 P;  3V4W A;  5BU8 B;  1SQX E;  3LID A;  1DD4 A;  3MUD A;  4IFD K;  2CK3 H;  1DX7 A;  1NU1 D;  2IFN A;  3U59 A;  3T97 B;  3M91 A;  1BCC E;  5AW9 B;  4N78 E;  1HJB A;  2Y0D A;  2RH0 A;  3II6 A;  3L75 J;  1KIL D;  2BCC D;  2KSE A;  3RL0 g;  4C7N B;  2N1T B;  3L36 A;  3TYY A;  2KS1 A;  2IDB A;  5KAF H;  3CCR P;  3RK3 E;  1SQX D;  3L71 D;  2HPC A;  2QJP B;  1JB0 J;  3N7N A;  1YYC A;  1JUN A;  1VQ7 P;  4N78 D;  2YXQ B;  3G6E P;  2OGU A;  2HFE D;  4JPZ B;  1KFN A;  4H44 B;  2FFD B;  5KAI E;  4IOI H;  1LTJ B;  4WWI A;  3P8C E;  3M0A A;  3Q3D A;  3BCC E;  3H1K E;  1FDO A;  1QL2 A;  1KFM A;  3HE5 A;  1AVY A;  1CI6 A;  2KOG A;  1NTM E;  1ZOY C;  2M5A B;  3PTZ A;  4U3F E;  1PZQ A;  1SP4 A;  3CX5 H;  1LWU B;  3L75 G;  3AE3 C;  2ZT9 C;  2M8R A;  2NPS B;  4XE5 B;  1JY2 P;  1PGO A;  5BVZ A;  4WVZ A;  1NYH A;  2YMY A;  4I1L A;  1NVO A;  4WY4 D;  3TGU D;  3CCV P;  2LKM A;  1S4X A;  4RO0 A;  1NTZ K;  1X9V A;  1EC5 A;  1L4A D;  1RE3 A;  1R8E A;  1NTM D;  2Q3E A;  3B4S A;  3H1I E;  1M57 D;  1LGH B;  3TNU A;  2FYZ A;  2OYH C;  4UB6 H;  3IF4 A;  1FDM A;  2QEX P;  2YIU B;  4D6T E;  1N7S B;  4L75 A;  2H7H A;  3JC2 2;  1BE3 D;  3FXD A;  1S9K D;  1YBK A;  4LGD E;  1WRG A;  2E43 A;  1FZC A;  1KB9 D;  1M8O B;  3CC7 P;  2B87 A;  1RHZ B;  1NTK D;  4ZKP A;  1KYO D;  1LT9 A;  2YO2 A;  1IO4 A;  1VQK P;  3R2P A;  3CX5 I;  3RL0 B;  1SFC C;  3GF3 A;  5GTI E;  2FYU J;  4D6T D;  1NJI Q;  4K35 A;  5L8R J;  1KN7 A;  5B66 E;  4EIJ A;  4C7R A;  1FU1 A;  1N73 C;  1SQB J;  2BEQ D;  2R5B A;  2YKP A;  2XU6 A;  1LTA C;  5AVU B;  2JKV A;  2WTY A;  2L91 A;  1K8A Q;  1YTZ T;  1T3U A;  1IK9 A;  2C9L Y;  2YKO A;  1VQM P;  1RF0 A;  2YNY A;  1PPJ G;  3RGU A;  3CL3 D;  2KSJ A;  2KB7 P;  2H89 C;  5KJ7 C;  4UB8 H;  4C7N A;  1E5W A;  3OW2 O;  3CCU P;  5AW6 B;  4WBA A;  2LXC B;  3V5B A;  4HKZ H;  2I1K A;  2WQY C;  4LLH A;  1HVV A;  1FS0 E;  4TLF A;  2YO3 A;  1NKZ B;  3AEA C;  2KP8 A;  4A7P A;  5M1B A;  4L76 A;  3VP8 A;  4R4M A;  1VF5 C;  3B5N B;  2J5U A;  1M90 Q;  3BCC J;  4PD4 E;  3KZI H;  2WSS H;  3G4S P;  3GLM A;  2I1J A;  1G2C B;  3SSU A;  2FYU G;  3MIW A;  2BAS A;  3JCU E;  2OYI C;  1L0N K;  1JCC A;  3AE5 C;  1LTJ A;  3HTK B;  4U3F J;  1SQB G;  1URQ D;  2QG4 A;  4AQR D;  1HBW A;  1NGM B;  3A0H H;  4W7Y A;  2SPZ A;  1Q2N A;  4JYC A;  2ZT9 B;  2QM8 A;  2R32 A;  1KQS O;  3A5T A;  2E74 C;  2M5A A;  5H2F H;  1J2J B;  1LTG C;  2W27 A;  1LWU A;  1NWQ A;  1FE6 A;  1L0L K;  2FBW C;  2Y0C A;  1W2B O;  1RQU A;  2L5G B;  4PD4 D;  2NPS A;  4K3A A;  3HE4 A;  3AEC C;  2J59 M;  2KZJ A;  2A06 D;  3A2A A;  1BGY D;  4EDF A;  1YJN P;  2PAJ A;  1YTZ I;  1YIT P;  4H13 C;  2M3E A;  5CCG A;  2ZJS E;  3MTU E;  4YPC A;  3B8E B;  3BCC G;  4LC1 A;  1NTZ J;  1IK7 A;  2IBZ I;  3R4Y A;  1T3J A;  3L75 E;  2FKW B;  2N1T C;  3IAO A;  3GHG A;  1S5L H;  1H89 A;  3L70 D;  5TJH A;  4U3F G;  3V2N A;  5CJ0 A;  1JO5 A;  4Z1M H;  2QJP C;  3D6Z A;  1P84 E;  1NH4 A;  2RN0 A;  2D2C D;  3OA7 A;  5AVW B;  4YTP C;  1Q7Y Q;  3NTN A;  3CC2 P;  1Z56 A;  2KNC B;  1JY3 O;  3TF5 A;  3A3Y B;  1PFI A;  1J1D C;  5APT A;  3I56 P;  4IL6 E;  1X79 B;  1M1K Q;  1IJD B;  1M7L A;  1SQP D;  2HR3 A;  5AW1 B;  2R3S A;  1LJ2 A;  3RBX A;  2IBZ G;  2QE7 H;  1VDF A;  1AV1 A;  1JOC A;  1GL2 C;  2G3A A;  1FAV A;  1T2K D;  2XZR A;  1FOS E;  3SFD C;  1NTZ G;  2ZYA A;  1K04 A;  1PP9 J;  1BSH A;  2N9B A;  5APX A;  2QSI A;  4ASW A;  4M3L A;  3AED C;  4HB1 A;  1IFD A;  3MD0 A;  4JBZ A;  2HLO A;  1M56 D;  5CJ4 A;  2W6A A;  5TIS H;  2M3B A;  4CPG A;  3PHL A;  2QJY B;  3MHV A;  2FXM A;  1U7M A;  2K37 A;  2WSF H;  2YIU C;  3V6I A;  1N7S C;  1X8Y A;  3NMD A;  3C8V A;  3HD7 B;  1G2C A;  2HG5 D;  3E7K A;  3GF7 A;  4PJ0 H;  2V4H A;  2W8Z A;  1P84 H;  1ZLL A;  1FZE A;  4EOT A;  3G3Z A;  3SWF A;  2E74 B;  4OWF A;  1OVU A;  1L0N J;  4GDO A;  1RF1 C;  1ZW0 A;  1X0T A;  3LW5 H;  1TU3 F;  3H1H D;  3BRT B;  4IL6 H;  4AUW A;  1PP9 G;  1U57 A;  2FYN C;  2BEZ F;  3A0B H;  3RL0 C;  4TT3 H;  5KLV D;  2PFX A;  1PPJ D;  1NO4 A;  3USS A;  4JYB A;  3M9B A;  2OTJ P;  4H13 B;  3L73 J;  2FYU E;  1L0L J;  2NPS D;  2PRR A;  4N3Y B;  1SQB E;  4UB6 E;  2Q6Q A;  3CX5 D;  2WSF J;  3V2Q A;  2OYH A;  1EDK A;  4KJM A;  2KK7 A;  2J58 A;  5CCH C;  1JY3 N;  2FXO A;  2E76 B;  1XTG B;  3L74 E;  4OGQ D;  1JEK A;  3AE1 C;  2AEM A;  1QVG O;  1D7M A;  3VMZ A;  2K3R A;  2E75 D;  1BCC D;  3MP7 B;  3LW5 J;  4PV1 D;  4NPD A;  2C0W A;  4HH2 A;  1L0N G;  1J1D B;  4ASV A;  4IFF A;  1SQB D;  1P84 I;  3G9R A;  4OH8 B;  1QX8 A;  2P58 A;  3M9H A;  3B5N C;  2WMM A;  3Q2Y A;  1SFC A;  1FZB A;  1JY3 P;  3EFF K;  2CPB A;  1HTL C;  1T8Z A;  1W5C E;  3RK3 D;  4B86 A;  2JJL A;  3BRV B;  3L73 G;  3AE4 C;  2WT7 B;  3V2P A;  1JTH B;  1GL2 B;  2P1J A;  1OIP A;  1L0L G;  3L72 J;  1N73 A;  2Q5U A;  2QVA A;  5AVT B;  1ZR2 A;  2AXC A;  5APY A;  4UB8 E;  3HRN A;  3CWB J;  3BAS A;  5KJ7 A;  1OFC X;  1NTK K;  1SQQ K;  1KV4 A;  3A7O A;  3EWK A;  2OYO A;  3P8C D;  2KUB A;  3BCC D;  3NXS A;  4BXL A;  3H1K D;  2QJK C;  2FY8 A;  4H0L C;  4I2L C;  2IBZ E;  1BDC A;  4U3F D;  2QM7 A;  2HOD B;  5AW0 B;  1DEE G;  3KZI E;  3MZW B;  1EZV I;  1IZN B;  2B89 A;  5APW A;  2PGD A;  3U1A A;  1PGQ A;  1NTZ E;  2OYI A;  1NU1 J;  5AVS B;  5E79 H;  3KYQ A;  2AXT E;  5B5E H;  3L72 G;  2YMK A;  3S4R A;  3A0H E;  1N8R Q;  1LTB C;  2VRS A;  1AQT A;  2MJZ A;  1SVF A;  3L37 A;  5EFW B;  1RF1 B;  1WMK A;  4IL6 X;  5H2F E;  3VMA A;  2IBZ D;  3H1I D;  2Z5H A;  3KQG A;  2FXP A;  2BCC J;  2FYN B;  2WPQ A;  5DJU B;  2KI7 B;  2DW3 A;  3CWB G;  1IFJ A;  3WU2 H;  2KIK A;  1SQV K;  3CCS P;  1FJK A;  1OW6 A;  1A02 F;  1EZV G;  2W83 C;  3PH0 A;  1URQ C;  3T97 A;  3PRJ A;  1VQ6 P;  1QGK B;  1RH5 B;  5APV A;  1SQV E;  1VQ4 P;  1ZME C;  2C0X A;  3L74 J;  1LTI C;  3P7K A;  1S5L E;  2N1T A;  3Q5S A;  4WY4 B;  3VTP C;  3AE6 C;  2B9B A;  1NU1 G;  1PP9 E;  2A45 H;  3F5H A;  3M06 A;  2Q3I A;  4EI2 A;  1KTM A;  1VQ8 P;  4DCK A;  1H0T B;  4JF7 A;  1KB9 H;  1FC2 C;  1OX3 A;  5APS A;  2BCC G;  1LNQ A;  3E1I A;  1OXZ A;  4N6J A;  3CXH H;  2QJY C;  1FZA A;  2OQQ A;  3U1C A;  5KTB A;  1KYO H;  2E42 A;  2FFD A;  1Y9B A;  1KQL A;  3HUS C;  3TGU J;  3HD7 C;  3P32 A;  2AXT H;  1G1J A;  1YQ3 C;  3H1J E;  3RK2 C;  1KQG B;  1GD2 E;  1FJP A;  1SFC D;  2GUV A;  3PLN A;  3CMA P;  2WT7 A;  1JTH A;  1GL2 A;  1Q82 Q;  1LP1 B;  2WPS A;  1FZF A;  5KLI C;  4XFJ A;  3H25 A;  3WUU A;  3WUV A;  1YJW P;  1S72 P;  1L0N E;  3D70 A;  3L74 G;  1YIJ P;  2KLU A;  2ZXE B;  1VQN P;  2QJK B;  1HWT C;  1BE3 J;  4H0L B;  2AEF A;  1GU4 A;  1GK4 A;  2A45 I;  2CPS A;  3IFM A;  3H1L E;  3L73 E;  1RQV A;  3E1R A;  2WSE H;  1NTK J;  5TIS E;  1SQQ J;  1L0L E;  1W2E A;  4YXD C;  1VQL P;  3CCJ P;  2HOD A;  2ITA A;  1KB9 I;  1L0N D;  1GU5 A;  1VQ9 P;  3KHU A;  1N7S A;  2E76 C;  1VL2 A;  1OVV A;  3TGU G;  3CXH I;  1VF5 D;  1PGJ A;  2WZ7 A;  2Q9I A;  3AEG C;  4PJ0 E;  3UIA A;  4KHX A;  1YQ4 C;  2HPC B;  1EXI A;  1IFI A;  1MKM A;  3W68 A;  3D71 A;  4IFM A;  1S3J A;  2V7Q H;  1L0L D;  1RF1 A;  3WMM 0;  2A45 G;  1H8A A;  2O01 N;  3L4F A;  1X22 A;  3A0B E;  3KDP B;  1RE4 C;  3W67 A;  3CC4 P;  3L75 D;  2C9N Y;  1N2D C;  3M0D C;  1AQ5 A;  2WPV B;  1BE3 G;  1URQ B;  2WSE J;  2P10 A;  3AEF C;  1SQV J;  1P84 D;  3HE5 B;  1NTK G;  2P7J A;  1SQQ G;  3L72 E;  1K9M Q;  2OTK E;  4GOD A;  1Q90 D;  3KPE A;  4Y99 C;  2JO1 A;  3FWN A;  2K88 A;  2MKV A;  1CW5 A;  3KXD A;  1PL5 A;  5CCH A;  1PIX A;  2Z4E A;  3S9O A;  2NRG A;  3CWB E;  5AVV B;  4HJG H;  2N1T D;  2V7Q J;  2H8P D;  4GOF A;  3L35 A;  1EZV E;  1ZRT E;  3JSV C;  1GDT A;  1GMJ A;  3G71 P;  1EDL A;  1NU1 K;  1KIL C;  1J1E B;  2OTL P;  1JMB A;  3LIE A;  4RJT A;  3TNU B;  1OZH A;  3H32 B;  5C39 A;  3B5N A;  1H88 A;  1EXJ A;  3HUS B;  3CME P;  1BSN A;  2ZYD A;  3H1J J;  4GT1 A;  1FDI A;  1ZN5 A;  3RK2 B;  3PJS K;  3P8M C;  1BGY J;  3HTK A;  1NU1 E;  2E75 C;  1SQV G;  4H44 D;  2PP6 A;  5KLI B;  4PV1 C;  2NZ2 A;  1FZC B;  3AE8 C;  1DIP A;  4NPE A;  1KQF B;  1R5L A;  2ZAE B;  1SQX K;  2B87 B; 
#chains in the Genus database with same CATH homology
 3HRN A;  3BAS A;  3HD7 D;  5KJ7 A;  5AW6 B;  4WBA A;  1OWA A;  3RK2 D;  3V5B A;  1NTK K;  1SQQ K;  2I1K A;  3A7O A;  4LLH A;  2Z5I A;  3P8C D;  1AFO A;  5AW2 B;  3NXS A;  2XV5 A;  3VP9 A;  1HVV A;  2YO3 A;  3RK3 C;  1MV8 A;  3VN0 A;  1JCD A;  4I2L C;  1KZU B;  3N4X A;  1NKZ B;  2KP8 A;  2XDJ A;  3VP8 A;  1SFC B;  4DZO A;  3B5N B;  5AVR B;  2P2U A;  2QM7 A;  4W80 A;  2HOD B;  5AW0 B;  1QL1 A;  2FFD C;  3H6P A;  2P67 A;  3C9I A;  2I1J A;  1G2C B;  3TK1 A;  1LTJ C;  1CI6 B;  1N73 B;  3MIW A;  2BAS A;  1DH3 A;  2OYI C;  5APW A;  4I6M C;  1L0N K;  2IPP A;  1JCC A;  5CCG D;  3U1A A;  1LTJ A;  4ZKU A;  3HTK B;  1JY2 O;  2GM4 A;  1URQ D;  2OYI A;  5AVS B;  3KYQ A;  1CZQ A;  4AQR D;  4WY4 C;  1HBW A;  5AVX B;  4C46 A;  4W7Y A;  3MGN A;  4JYC A;  1LTB C;  2QM8 A;  2VRS A;  2R32 A;  4WY4 A;  1LWU C;  1HGZ A;  2MJZ A;  1SVF A;  1JMM A;  3A5T A;  2O01 H;  1J2J B;  3L37 A;  1RF1 B;  1LTG C;  1L4A C;  3M9Q A;  1HUC A;  1N7S D;  2NPS C;  2W27 A;  1LWU A;  1FBM A;  3BVH A;  1NWQ A;  2WSC H;  2Z5H A;  3KQG A;  1L0L K;  2POH A;  1L4A A;  2GUS A;  2WPQ A;  5APU A;  4GIF A;  2KYV A;  2L5G B;  2NPS A;  1IFN A;  1IFJ A;  5KLV K;  1SQV K;  1FJK A;  3HE4 A;  2J59 M;  3A2A A;  3O8Z A;  5CCG C;  2PAJ A;  1LTS C;  1YTZ I;  2O1K A;  1A02 F;  3BAT A;  2WIT A;  3NFQ A;  4WB4 A;  1NTM K;  5AW3 B;  1URQ C;  3T97 A;  4W7Z A;  1JY2 N;  2KLV A;  3OAK A;  5CCG A;  1M1J C;  2W6B A;  3V2R A;  2H43 A;  2IX7 C;  1URQ A;  2ZFC A;  1M1J A;  3MTU E;  3RL0 D;  1NHL A;  3B8E B;  3GHG C;  5AW7 B;  5APV A;  1MZ9 A;  4LC1 A;  2OYI B;  4Y99 B;  3VOP A;  3OJA B;  1ZR4 A;  1T3J A;  2FKW B;  2N1T C;  3GHG A;  1GW3 A;  3TSI A;  5AW5 B;  2C0X A;  1LTI C;  3P7K A;  3CLQ A;  2N1T A;  1H89 A;  4WY4 B;  3VTP C;  3V2N A;  1JO5 A;  5CJ0 A;  2O1J A;  3SWY A;  1GZL A;  1GL2 D;  1EQ7 A;  5APQ A;  1LT9 B;  2A45 H;  2XNX A;  1MFZ A;  5CMZ A;  3M06 A;  1NOH A;  1NH4 A;  2Q3I A;  1HH0 A;  3EFG A;  2FYU K;  3OA7 A;  5AVZ B;  5AVW B;  2Q7C A;  2WPR A;  3NTN A;  5AW8 B;  1Z56 A;  1N86 A;  4GKG A;  1JY3 O;  4HYT B;  5CCH D;  1SQB K;  4JF7 A;  3A3Y B;  3HE4 B;  1PFI A;  1J1D C;  5APT A;  1S9K E;  1IFM A;  3V4W A;  5BU8 B;  3LID A;  1RY3 A;  1KIL B;  1X79 B;  3MUD A;  5APS A;  4IFD K;  1DX7 A;  3VYI A;  1IJD B;  1M7L A;  2IFN A;  2OAR A;  3E1I A;  3U59 A;  1OXZ A;  4N6J A;  5AW1 B;  1FZA A;  4AYC A;  3M91 A;  3U1C A;  5KTB A;  1FOS F;  2E42 A;  5AW9 B;  2FFD A;  4N78 E;  1KQL A;  3HUS C;  1HJB A;  4DOJ A;  1VDF A;  3HD7 C;  3H32 A;  1JOC A;  1DEB A;  3P32 A;  1G1J A;  1GL2 C;  3HUS A;  3RK2 C;  1A02 J;  1GD2 E;  3GHG B;  3II6 A;  1KIL D;  1FJP A;  1SFC D;  2GUV A;  3HD7 A;  3B5N D;  2WT7 A;  1JTH A;  1GL2 A;  1FAV A;  4C7N B;  2N1T B;  1T2K D;  2WPS A;  2XZR A;  3L36 A;  1FZF A;  1FOS E;  3TYY A;  1HGV A;  5CHX A;  3VMX A;  1ZV8 A;  2HPC A;  2N9B A;  5APX A;  3I5C A;  3N7N A;  2ZXE B;  1HWT C;  4M3L A;  1YYC A;  1JUN A;  4N78 D;  3RK3 B;  1GK6 A;  1IFD A;  1WT6 A;  3MD0 A;  2HLO A;  2HFE D;  1GU4 A;  1G1I A;  5CJ4 A;  1GK4 A;  2A45 I;  2CPS A;  2W6A A;  3IFM A;  2WSE H;  2M3B A;  1KFN A;  1SLQ A;  1W2E A;  2WWW A;  2FFD B;  1LTJ B;  4RES B;  2FXM A;  3M0A A;  3P8C E;  2WSF H;  2HOD A;  1QL2 A;  1CSB A;  1KFM A;  1N7S C;  4O9B A;  1X8Y A;  3NMD A;  3HE5 A;  1GU5 A;  3HD7 B;  1G2C A;  1NKN A;  1CI6 A;  2KOG A;  2HG5 D;  1N7S A;  3CI9 A;  3VMY A;  2WZ7 A;  2Q9I A;  1SP4 A;  1FZE A;  1ZLL A;  3UIA A;  4KHX A;  4EOT A;  5AVQ B;  1LWU B;  3G3Z A;  3SWF A;  2R5D A;  2HPC B;  1L4A B;  1IFI A;  2M8R A;  1RF1 C;  2NPS B;  4XE5 B;  1JY2 P;  4IFM A;  3LW5 H;  5BVZ A;  3BRT B;  1RF1 A;  4AUW A;  2YMY A;  4I1L A;  3WMM 0;  4WY4 D;  2A45 G;  1H8A A;  1GTW A;  3RL0 C;  1VPC A;  3L4F A;  1J1E C;  1RE3 C;  3KDP B;  1RE4 C;  2LKM A;  1NO4 A;  4JYB A;  3M9B A;  2C9N Y;  1N2D C;  3M0D C;  1AQ5 A;  1NTZ K;  1X9V A;  1URQ B;  1L4A D;  1RE3 A;  1RE4 A;  1M1J B;  2NPS D;  3M0D A;  4N3Y B;  1LGH B;  3TNU A;  2FYZ A;  2OYH C;  3PP5 A;  1FDM A;  1FZG A;  1LTT C;  3HE5 B;  3IR9 A;  2P7J A;  3V2Q A;  2OYH A;  3EQ2 A;  1GW4 A;  3KPE A;  1N7S B;  4Y99 C;  2H7H A;  1FZC C;  2J58 A;  5CCH C;  1JY3 N;  4XA4 A;  2JEE A;  1S9K D;  1CW5 A;  4LGD E;  1WRG A;  2E43 A;  1FZC A;  1XTG B;  5BU5 A;  5CCH A;  2HYN A;  2Z4E A;  1LT9 C;  4ZKP A;  3VMZ A;  5AVV B;  1IC2 A;  2C0W A;  1LT9 A;  2N1T D;  2H8P D;  1XTC C;  4HH2 A;  2YO2 A;  3L35 A;  1J1D B;  1GDT A;  5KJ7 D;  1IO4 A;  2R3C A;  4IFF A;  1JNM A;  3R2P A;  4OH8 B;  3RL0 B;  1NU1 K;  1KIL C;  2XKM A;  1SFC C;  1J1E B;  3M9H A;  1SQP K;  3B5N C;  5AW4 B;  1T2K C;  3LIE A;  1KIL A;  4EIJ A;  1SFC A;  3TNU B;  4C7R A;  1FU1 A;  3H32 B;  1FZB A;  1JY3 P;  3B5N A;  2CPB A;  1H88 A;  1NAF A;  3HUS B;  1N7L A;  1HTL C;  1T8Z A;  1N73 C;  5AVY B;  2R5B A;  2YKP A;  4GT1 A;  3RK3 D;  4B86 A;  2JJL A;  2XU6 A;  3BRV B;  1LTA C;  5AVU B;  2WTY A;  1ZN5 A;  2OYH B;  3V2P A;  1JTH B;  1GL2 B;  3RK2 B;  2P1J A;  1YTZ T;  1T3U A;  2WT7 B;  1N73 A;  1RF0 C;  2Q5U A;  1MUU A;  1IK9 A;  2C9L Y;  3P8M C;  2YKO A;  3HTK A;  1RF0 A;  2YNY A;  5AVT B;  2PP6 A;  1ZR2 A;  1FZC B;  5APY A;  3CL3 D;  2KSJ A;  2IFM A;  2KB7 P;  2YKQ A;  5KJ7 C;  1SQX K;  4C7N A;  1E5W A;  3V4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...