1JY2P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
b'RDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 13
structure length 44
sequence length 44
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2P00
1FZGA 1N73A 3GHGC 2OYHA 1RE4C 1LWUB 1LTJB 2OYHC 1JY2N 1RE3A 1N73C 2A45G 1FZCA 1FZEA 1JY3P 1JY3O 1LT9A 3H32A 1RF1C 3GHGB 1FZCC 1RE3C 2OYIA 1RF1A 1T3UA 3HUSA 2Q9IA 1M1JA 2OYHB 1LT9C 2OYIC 1RF0A 2XNXA 1N73B 3HUSC 3E1IA 2FFDA 1FZBA 1JY2P 1JY2O 1M1JC 2HODA 1FZFA 1RF0C 2H43A 3BVHA 2A45H 2HPCA 1FZCB 2FFDC 3H32B 2A45I 1LT9B 2OYIB 1RF1B 1LWUA 3HUSB 1M1JB 1LTJA 2Z4EA 2FFDB 1W2EA 1LWUC 1FZAA 1LTJC 2HODB 3GHGA 1N86A 1JY3N 2HPCB 1RE4A 2HLOA
chains in the Genus database with same CATH superfamily
4JYBA 1EXJA 1ZR4A 3HE5A 1JMMA 1J1DC 3I5CA 1L0NJ 1S3JA 1BGYJ 3NFQA 1S2EA 1M1KQ 1ZV8A 3HD7A 5B66E 2KS1A 1W5CE 2BASA 1L4AA 1LTAC 4I1LA 3EWKA 1LJ2A 5KLVD 5CCGD 1SQBD 1XTCC 3IFMA 3SWKA 3VP9A 4C7NB 4EIJA 1LTSC 5H2FE 2JWAA 1FE6A 2XV5A 2YNYA 3M0DA 1R5LA 1VPCA 4U3FG 3N7NA 2Q7CA 3H1JD 3WUUA 2WSEJ 5KAFH 1K05A 2E75D 2WMMA 3B5NA 3A0BE 2WITA 2FXMA 1PV3A 4NPDA 1NTME 1VF5C 4RESB 3W68A 1S5LH 1G2CA 5CJ0A 2KYVA 1JY3N 3USSA 3L70E 1DIPA 3A5TA 2XNDH 2K9JB 1LT9A 2Z5IA 1NTMJ 2Q6QA 1UIXA 1BE3D 1JUNA 3FX0A 3Q5SA 3PRJA 2J5UA 1LNQA 4H44D 3L70J 2QJYB 1NTKK 2E42A 1NKNA 1PZQA 2FFDC 2IX7C 4TT3H 4WY4B 3R4YA 2JWDA 2K1AA 3V2NA 1KYOE 2ZT9B 2BCCE 1VQLP 2RKLA 1MFZA 3A0HH 3I56P 1GL2C 1AQTA 4M3LA 1KC8Q 4ZKUA 1SQXD 2P1JA 4HJGH 3RK3B 4PV1C 5AW9B 3KZIH 1URQB 4N3YB 5KJ7A 2BCCJ 3AE3C 1PGOA 1NHLA 1KZUB 3GW6A 3H1LE 2JKVA 5KAIE 4UB6E 3H1LG 2J59M 1NTZK 1GDTA 1QVGO 2OYIB 2WQYC 2E43A 2B9BA 1NAFA 2KI7B 3H1LJ 2L91A 3KQGA 5AVXB 1IFNA 3M0AA 1KILD 3MZWB 4U3FD 4H0LD 2P7JA 3H6PA 5EFWB 3S4RA 1VQ4P 1N73A 4HYTB 3H1KJ 2WSSH 3CI9A 1GMJA 3RGUA 3N4XA 1SQPE 3KYQA 4IOIH 4YPCA 1QEXA 3D6ZA 1IJDB 1EQ7A 3WUTA 3MD0A 2HPCB 2Y0DA 2NPSB 3AEFC 1S5LE 2KSEA 1SQPJ 1PPJG 1M1JC 1N7SA 2KB7P 1LTIC 2WT7A 2ZYAA 1MUUA 2ZFCA 3NMDA 3FWLA 1IFDA 5AW6B 4O9BA 1GK6A 2IYPA 3SWYA 1G1IA 4Y99B 3MGNA 5CCGC 4Z1MH 2YMKA 3RBXA 3GG2A 2YO3A 1S72P 1P84H 1L0NK 3AEEC 3CPWO 2JJLA 2QE7H 4N6JA 1OFCX 2R5BA 2K9YA 5B5EE 1ZRTD 2WSCH 3L75G 3B8EB 1ZXGA 3FXEA 1MFTA 3PLNA 3CCMP 4R4LA 2E75C 3L74E 3T97A 2RN0A 5AVTB 3WMM0 3L74G 5AW5B 5M1BA 3AE4C 3GHGC 2FYUE 1L0LE 1IK9A 3RK2D 3AEAC 3KZIE 1HWTC 3S9OA 1YJWP 2ZYGA 5AW8B 1JNMA 4BRYB 5AVQB 2M0BA 3RL0B 2FYUJ 1L0LJ 1RH5B 2YKPA 1JY2N 3AE6C 5BU5A 2A45G 3VMZA 1AJYA 2QJPB 3E7KA 1KYOI 1G1JA 4H44C 4KHXA 1NVOA 3CX5D 2WSFJ 1NTMK 1Y47A 1LTJA 3A2AA 2W6JH 3B5ND 1N86A 5K5GB 2KZJA 4GKGA 1K04A 1YTZT 2OYHA 3AE5C 1KB9E 1ZMEC 1URQA 1YYCA 3HUSC 3C8VA 1SVFA 2Q5UA 1Y8AA 4B86A 2N9YB 1OW7A 5APVA 1NTKG 2B87B 3ITKA 3U59A 2N1TA 1PPJD 1U7MA 1X9VA 3E1RA 2O01N 1J2JB 1QX8A 1SFCD 1FJKA 2BEZF 5APQA 2FBWC 3A3YB 1YQ3C 2H88C 3H32B 1VF5B 1VQ7P 2IZ0A 1RE4A 1PGQA 1GK4A 5DJUB 2ZVOB 1VQ6P 3P8MC 3MUDC 1FZCC 1SQBE 2V4HA 3IN6A 2K3RA 4IFMA 1KFMA 1LWUC 3L75D 1KILC 4H0LC 2KK7A 3H1JE 3VYIA 1SQBJ 1H88A 4GOFA 1NTZG 1CZQA 3VMXA 1ZOYC 2KLUA 5KJ7D 4GDOA 3JSVC 3Q5RA 1FDOA 1IFJA 3L74D 1TU3F 1USDA 1R8EA 3NXSA 2C0WA 4GIFA 3CXHH 3H1JJ 3SFDC 1KV4A 3AE8C 3VTPC 2Y0CA 2HFED 2JDIH 3AEBC 1GL2B 3E1IA 2KP8A 2KNCB 2Y0EA 1BE3E 3V2PA 4PV1B 3WU2H 2P67A 5GTHH 1LTGC 1SQQK 1BCCG 4DT0A 3CCUP 5CCHA 1FZEA 1RF1A 1YJ9P 1RF0A 1DX7A 2A06G 3RBZA 1BE3J 5TISE 5TJHA 1VQMP 1USEA 1OVUA 1RE3C 4MN4C 3M9QA 2O3JA 1SQXE 1NTKD 4W7YA 1T2KD 1JB0J 2BEQD 4HB1A 4OH8B 3V2QA 2WPSA 3G3ZA 1OZHA 1N7SD 5AW4B 1SQXJ 1PP9G 3RK2C 1BSHA 1K9MQ 1VQOP 5AVUB 1VQ5P 2YKQA 3G9RA 3SSUA 2L5GB 2P2UA 2E5YA 3CX5H 3EFGA 3BASA 2PP6A 1MKMA 4IFFA 4DOJA 3AE7C 2QG4A 2PGDA 1KB9I 2M5AA 1KILE 4U3FE 1M1JB 2QEXP 5APSA 1NU1G 4OGQD 4ZNCA 2K88A 1NTZD 3U1CA 1P84D 1W2BO 4N78D 5E79H 3B5NC 4XFJA 2B87A 2KOGA 1M7LA 3BVHA 1KQLA 4U3FJ 1DH3A 4ZKPA 1AA0A 3V4WA 2N9BA 2MKVA 5CMZA 3AE1C 2JR8A 5AW1B 3CXHE 2IFNA 1FBMA 3AECC 5AVYB 1BCCD 1SFCC 1PIXA 2E75B 1CSBA 1M90Q 2P10A 1IZNB 1FZGA 1U57A 3V6IA 4CPGA 1OWAA 2A06D 3GHGB 1T3UA 3NTNA 4AYCA 1FS0E 2G3AA 3BRVB 1BSNA 3ABVC 1HF9A 2OGUA 1GD2E 1LTTC 1ZRTE 1SQVE 1RQUA 2B89A 1SQVG 2FFDA 3TDKA 4H44B 2N1TD 1QVFO 3L73G 3VMAA 2QVAA 1JOCA 5KJ7C 4EOTA 1Y9BA 3PTZA 2IBZG 1SQVJ 1LTBC 2AEMA 2KNCA 2YMYA 1PP9D 2QM7A 1S5LX 3CL3D 2AXCA 1VQKP 1JTHB 4DJGA 2FY8A 5KLVK 2A45H 3TF5A 1NJIQ 3HUSB 2LXBA 1HJBA 3L36A 1IK7A 3D70A 3A7OA 3OAKA 4LC1A 2AEFA 2YXQB 3JC22 4ASVA 3S1KA 3H1HG 2PAJA 3CX5E 1IO4A 1NU1D 2QJKC 1AV1A 3H1IG 1BDCA 2HLOA 1HJ0A 2B88A 3RL0g 2JEEA 1U7JA 4ASWA 3LW5H 1FU1A 3P8CE 3TNUA 2D2CD 5AVVB 1FZCB 5KAFE 2FKWB 1SQQG 2LXCB 5E79E 3F89A 3CCRP 3QH9A 1LWUB 2E76D 1KILB 4H0LB 1T2KC 2OQQA 1GW3A 1PPJE 3CXHD 2AXTH 3HTKB 3L71G 3CMEP 5APUA 1N7SC 1JCCA 4C7NA 3D6YA 2OTJP 2WPQA 1S9KD 3AEDC 1D7MA 1VQ8P 4RO0A 2XU6A 2M8RA 1ZN5A 1X79B 3VP8A 3R2PA 2HODB 2GUSA 1MZ9A 1GZLA 2E74D 1DEBA 4D6TG 4K35A 2Q3IA 3L75E 1YI2P 1SQVD 4OGQC 2FXOA 5AVZB 3M06A 1KQFB 3L73D 3PH0A 1Q2NA 2W90A 1PFIA 2WVRA 4W7ZA 4A7PA 5APTA 3A0HE 3D71A 2Z4EA 2K9JA 4GT1A 2IBZD 3BCCG 3L75J 3CXHI 3O6QB 2OARA 5CBOA 4GOEA 1GU4A 3HD7D 2H43A 1GU5A 3L74J 3TSIA 1L4AD 2KZIA 3GHGA 5KKZC 1JO5A 2CPBA 2GUVA 1QGKB 2ZVNB 3PJSK 1OMIA 2H8PD 3G71P 3SFEC 3H1HD 4LLHA 4WY4A 3HE5B 1FJPA 1FZFA 2Q1KA 1N2DC 3H1ID 1N8RQ 2P58A 2LR2A 2M3BA 3O8ZA 3RK2B 1LTJC 3CWBE 3CWBG 2ZJSE 2OYHC 2KS1B 3GMAA 1NYHA 3P8CD 2ITAA 3KPEA 3G4SP 1SQQD 3CWBJ 1NTKE 3AEGC 1Q82Q 1NWQA 1FOSE 2FYNC 4Y28J 2N1TC 3TK1A 3MIWA 3CLQA 2OYIA 1HUCA 3L71D 3MTUE 3B5NB 4L76A 2IFMA 1NTKJ 3KDPB 3BRTB 3LW5J 3G6EP 3HRNA 4RJTA 1G2CB 2AXTE 1RE4C 5B66H 4HH2A 1OVRA 3CX5I 3UIAA 3V4QA 2O1KA 2JO1A 2WPRA 2HYNA 4JBZA 2W6AA 2WSEH 2O01H 1YQ4C 3FGAD 4D6TD 4C7RA 4IL6H 5H2FH 2ZAEB 1EDKA 1H0TB 4RKUJ 1SFCB 3TGUE 1NTZE 3TGUG 1P84E 4N78E 1PGJA 2HPCA 3BCCD 2NPSA 1LWUA 3L72G 2I1KA 2D2CC 3TGUJ 1NTZJ 3HTKA 4BWNA 3SWFA 4DCKA 1IFIA 4H13D 3L37A 2UWJE 1VQ9P 3II6A 4WWIA 1FZBA 2NRGA 3Q1MA 3GF3A 2E76C 2WSCJ 2RH0A 4PD4D 2IYOA 1FZAA 1IC2A 2YXRB 1BCCE 5CBNA 1DD4A 4YXDC 2A06E 1E5WA 4KJMA 1RF0C 5KLIB 4JF7A 3CWBD 1SQPK 1GW4A 1BCCJ 3LIEA 3RK3E 1EXIA 4JYCA 1ZP0C 2QM8A 1KYOH 3F5HA 3TYYA 3AE2C 3HE4B 2E74C 2ZYDA 1LP1B 3O6QA 5APXA 1XTGB 1DEEG 1YITP 2HG5D 1OXZA 2QJKB 1BDDA 4YXWH 4BRYA 1RE3A 3ZDMA 2FYZA 1ZLLA 2H89C 1PP9E 1L0NE 1BGYE 3B71A 1GTWA 1L0NG 4AUWA 2SPZA 1BGYG 2A45I 2OTLP 3EQ2A 2NZ2A 2J58A 3HD7C 1N7LA 3AE9C 3JCUH 5CHXA 1L4AC 1JY3O 1PP9J 1H89A 1X22A 1QL1A 1NGMB 1FC2C 3VN0A 5AVSB 5BVZA 1NU1E 3M0DC 3TGUD 1SLQA 1N7SB 1JMBA 1K8AQ 2WT7B 3CCVP 1CI6B 3KHUA 2FYUK 1L0LK 1FDMA 3L72D 2OTKE 3L35A 4IL6E 2KLVA 1NU1J 1JM0A 2HR3A 4I6MC 1CW5A 2CK3H 2O01J 1E79H 2DW3A 3H32A 1LGHB 1H8AA 1NOHA 2Q9IA 1LT9C 2XNXA 1QL2A 1NTMG 4WB4A 1Q7YQ 4AQRD 4OGQB 1EDIA 1Q86Q 3CMAP 2K37A 2JP3A 1VQPP 4WY4D 4K3AA 3T97B 2ZT9D 3L70G 1S9KE 4I7ZC 4DZOA 1J1EC 2GA1A 3IAOA 3WU2E 3CD6P 5GTHE 2W8ZA 1H0TA 1SFCA 3RK3D 1P84I 3OW2O 1URQD 5KKZB 1AQ5A 1HGVA 1MV8A 5AW0B 5B5EH 2W27A 2QRXA 3M9HA 2POHA 1VDFA 3L73E 3C9IA 3MHVA 2YIUC 1GL2A 2BCCG 2IBZE 1YTZI 1LTJB 3PHLA 1M8OB 1EDLA 1L0ND 4PD4H 1BGYD 1KQGB 2OYHB 5KLIC 1Z56A 3L73J 1SQBK 4H13C 3CCJP 2XKMA 2PFXA 1IFPA 1SS1A 2WSFH 2FXPA 3VMYA 1YHQP 1KD1Q 2I8DA 2Z5HA 2YO2A 2FYNB 3V2RA 1KMIZ 2N1TB 3H25A 3H1HE 2R44A 3EFFK 3JCUE 2MJZA 3H1IE 3HE4A 1HVVA 2E5TA 1LP1A 1EZVE 1EZVG 1N73C 3H1KE 1JY3P 3FXDA 3H1HJ 4U7JA 2NPSD 3H1KG 4NPFX 4GODA 4ZMDA 2Y9YA 1KB9H 4QMAA 1KORA 3H1IJ 3C1LA 1SQQE 1S4XA 2GM4A 1NTMD 1M57D 1SQPG 1SQQJ 2M3EA 3L71E 3FWNA 1WRGA 5AVWB 2R3SA 3B4SA 3L70D 5CCHD 3IF4A 4LGDE 1UIIA 1NH4A 2PRRA 2D2CB 1M1JA 1SP4A 3L71J 5KTBA 3M91A 2E76B 1SQXK 1CI6A 4D6TE 5BU8B 3PP5A 1IFMA 2W6BA 3OA7A 3CC4P 3M9BA 5CCGA 3VOPA 1JY2O 3OJAB 5DJTB 1DD3A 1KYOD 3GF7A 1RF1B 3BATA 2IPPA 4W80A 3K5BA 4D6TJ 2IZ1A 2BCCD 3BCCE 1OW6A 2AEJA 3LIDA 4XA4A 1HH0A 1T8ZA 2OYOA 1JEKA 2QSIA 3RL0D 1VL2A 4OWFA 2I1JA 2ZXXA 4NPEA 4IFDK 2QIWA 1WMKA 5AW3B 1RHZB 2O1JA 2XZRA 2E74B 4WVZA 2QJYC 3BCCJ 4PD4E 3P32A 3I55P 1A02F 2FYUG 1L0LG 1NU1K 3H1LD 1EDJA 1A02J 4WY4C 3L4FA 2ZT9C 4PJ0H 2V7QH 2W83C 1EZVD 5TISH 4L73A 2WTYA 1OVVA 3H1KD 3HD7B 1Q90D 3RK3C 1WT6A 1L4AB 1URQC 4TLFA 1J1DB 5GTIH 2IBZI 2H7HA 1M56D 2XDJA 1NO4A 2IDBA 1JTHA 1VF5D 2C0XA 2M5AB 3Q2YA 1KQSO 3Q5PA 1JCDA 1QLED 1SQPD 3HUSA 4UB8H 2OYIC 2CPSA 3KXDA 3Q3DA 1FOSF 1T6AA 3CCQP 4I2LC 4L74A 1OX3A 1RY3A 2YKOA 3GLMA 2Q3EA 1NKZB 3U1AA 2R3CA 4JQ0D 4L75A 4XE5B 1EZVI 1ZR2A 1SQVK 3V5BA 1LT9B 2WZ7A 2KIKA 3P7KA 4EDFA 5CJ4A 2G8YA 1R5SA 2KSJA 4EYYQ 5KLVE 3MUDA 1FZCA 2R5DA 4C46A 4R4MA 3WUVA 5KLVG 1SQBG 1PL5A 1OW8A 4I7ZB 3L72E 3A0BH 1GL2D 1J1EB 2NPSC 1L2PA 4HKZH 1HGZA 1KILA 1AFOA 1HTLC 5KLVJ 3IR9A 1X0TA 4PV1D 3CCLP 4OVNF 2C9NY 3H1JG 4YTPC 1KFNA 1Q81Q 1EC5A 1JY2P 3L72J 4BXLA 4JPZB 1FDIA 1YBKA 2ZXEB 1S1CX 2FFDB 1W2EA 2FYUD 1L0LD 5APYA 3W67A 1T3JA 5AW7B 1OIPA 1AVYA 2YIUB 4Y99C 5CCHC 4KT0J 1RF1C 2HODA 1HBWA 5APWA 5L8RJ 1BE3G 4EI2A 2C9LY 1VQNP 1NAYA 2RMZA 3CC2P 1FAVA 4H13B 2R32A 1LT1A 2KXPB 1YJNP 5C39A 2Y9ZA 3CC7P 4PJ0E 2WWWA 3CCEP 4IL6X 1RQVA 2VRSA 1YIJP 1KB9D 5GTIE 1PGPA 5AW2B 2V7QJ 1K73Q 4PD4I 1N73B 3QWOC 3CCSP 1AVOA 2QA4P 4WBAA 3RL0C 1X8YA 1KTMA 1SQXG 3MP7B 2KUBA 2WPVB 2LKMA 5KAIH 3TNUB 1ZW0A 5AVRB 4UB6H 1KN7A 4UB8E 2QJPC
chains in the Genus database with same CATH topology
1GK4A 4JYBA 1GL2A 2Q3IA 1ZR4A 3HE5A 1YTZI 1LTJB 3P8MC 1JMMA 1J1DC 3I5CA 1FZCC 3NFQA 2OYHB 5AVZB 1Z56A 3M06A 4IFMA 1KFMA 1SQBK 1PFIA 4W7ZA 1ZV8A 3HD7A 5APTA 2Z4EA 1LWUC 4GT1A 2BASA 2XKMA 1L4AA 1KILC 1LTAC 2OARA 4I1LA 2WSFH 5CCGD 3VMYA 3VYIA 1H88A 1XTCC 3IFMA 2Z5HA 1GU4A 3VP9A 4C7NB 1CZQA 2YO2A 3VMXA 4EIJA 3V2RA 3HD7D 2N1TB 5KJ7D 2H43A 1LTSC 1GU5A 1IFJA 2XV5A 3TSIA 2MJZA 1L4AD 2YNYA 3M0DA 3NXSA 1VPCA 3HE4A 1HVVA 2C0WA 3GHGA 3N7NA 4GIFA 1JO5A 2Q7CA 2CPBA 2GUVA 1N73C 3VTPC 3B5NA 2H8PD 1JY3P 2HFED 2NPSD 2WITA 4LLHA 2FXMA 4WY4A 1GL2B 3HE5B 3E1IA 1FJPA 2KP8A 1FZFA 4RESB 1N2DC 1G2CA 5CJ0A 2KYVA 3V2PA 2M3BA 3O8ZA 3RK2B 1LTJC 2P67A 1JY3N 1LTGC 1SQQK 3A5TA 2OYHC 2GM4A 5CCHA 1FZEA 1LT9A 2Z5IA 3P8CD 1RF1A 3KPEA 1RF0A 1DX7A 1JUNA 1WRGA 5AVWB 5CCHD 4LGDE 1NWQA 1FOSE 1NTKK 1NH4A 2E42A 1NKNA 2N1TC 3TK1A 3MIWA 3CLQA 1RE3C 2OYIA 3M9QA 1M1JA 1SP4A 1HUCA 5KTBA 3MTUE 3B5NB 2IFMA 2FFDC 3KDPB 2IX7C 3BRTB 4WY4B 4W7YA 3M91A 3V2NA 1T2KD 3HRNA 1SQXK 1CI6A 1G2CB 1RE4C 4OH8B 5BU8B 3V2QA 1MFZA 2WPSA 1GL2C 3PP5A 1IFMA 4HH2A 4M3LA 3UIAA 2W6BA 3OA7A 4ZKUA 3G3ZA 1N7SD 3V4QA 2O1KA 2P1JA 3M9BA 5AW4B 5CCGA 2WPRA 3VOPA 1JY2O 3RK3B 2HYNA 3RK2C 2W6AA 3OJAB 2WSEH 5AW9B 1RF1B 2O01H 2IPPA 3BATA 1URQB 4W80A 4N3YB 5AVUB 5KJ7A 2YKQA 4C7RA 2L5GB 3LIDA 2P2UA 4XA4A 1HH0A 1NHLA 1T8ZA 1SFCB 3EFGA 1KZUB 3BASA 2PP6A 3RL0D 4IFFA 2I1JA 4N78E 4DOJA 4IFDK 2J59M 1NTZK 2HPCA 5AW3B 1GDTA 2O1JA 2XZRA 2OYIB 2NPSA 1LWUA 2I1KA 1M1JB 5APSA 3P32A 1A02F 2E43A 1NAFA 3U1CA 3HTKA 1NU1K 3SWFA 4N78D 1A02J 1IFIA 3B5NC 3KQGA 3L37A 3II6A 2KOGA 1FZBA 4WY4C 5AVXB 1M7LA 3BVHA 1IFNA 3L4FA 3M0AA 1KILD 1KQLA 2P7JA 1DH3A 4ZKPA 3H6PA 1FZAA 1IC2A 3V4WA 2N9BA 2WTYA 1N73A 5CMZA 4HYTB 3HD7B 3CI9A 3RK3C 1WT6A 1L4AB 3N4XA 5AW1B 1URQC 1J1DB 1E5WA 2IFNA 3KYQA 1RF0C 1FBMA 2H7HA 5AVYB 4JF7A 1SQPK 1IJDB 1EQ7A 1GW4A 2XDJA 3MD0A 1SFCC 3LIEA 2HPCB 1CSBA 1NO4A 1FZGA 2NPSB 1JTHA 2C0XA 4JYCA 2QM8A 1OWAA 3TYYA 3HE4B 1JCDA 3GHGB 1T3UA 3HUSA 2OYIC 3NTNA 2CPSA 1M1JC 4AYCA 5APXA 1XTGB 1FOSF 1N7SA 2KB7P 3BRVB 1LTIC 4I2LC 2WT7A 1MUUA 2HG5D 1OXZA 2ZFCA 1RY3A 3NMDA 2YKOA 1RE3A 1IFDA 1NKZB 1GD2E 3U1AA 2FYZA 1LTTC 2R3CA 1ZLLA 5AW6B 4O9BA 1GK6A 3SWYA 1G1IA 2FFDA 4Y99B 4XE5B 1GTWA 3MGNA 1ZR2A 5CCGC 4AUWA 1SQVK 3V5BA 2A45I 2YO3A 1LT9B 2WZ7A 1L0NK 3EQ2A 2N1TD 2JJLA 4N6JA 3P7KA 5CJ4A 2J58A 3HD7C 1JOCA 5KJ7C 1N7LA 4EOTA 2R5BA 2KSJA 5CHXA 2WSCH 1L4AC 1LTBC 2YMYA 3B8EB 3MUDA 1FZCA 2QM7A 1JY3O 2R5DA 3CL3D 4C46A 1H89A 1QL1A 1JTHB 5KLVK 2A45H 1GL2D 1J1EB 3HUSB 3VN0A 3T97A 2NPSC 5AVTB 3WMM0 5AVSB 5BVZA 1HGZA 1KILA 3M0DC 5AW5B 1HJBA 3L36A 1AFOA 1HTLC 1SLQA 3GHGC 3IR9A 1N7SB 3RK2D 1IK9A 3A7OA 3OAKA 4LC1A 2C9NY 2WT7B 1CI6B 1KFNA 1HWTC 2FYUK 1L0LK 1FDMA 5AW8B 3L35A 1JY2P 1JNMA 5AVQB 2PAJA 2KLVA 1IO4A 2ZXEB 2FFDB 1W2EA 3RL0B 4I6MC 5APYA 1CW5A 2YKPA 2HLOA 1T3JA 5AW7B 1JY2N 5BU5A 2JEEA 2A45G 4Y99C 3VMZA 3H32A 1LGHB 1H8AA 1NOHA 3LW5H 1G1JA 5CCHC 2Q9IA 1FU1A 3P8CE 1LT9C 2XNXA 3TNUA 4KHXA 1QL2A 1RF1C 2HODA 5AVVB 1FZCB 4WB4A 1HBWA 5APWA 4AQRD 1NTMK 2FKWB 1LTJA 3A2AA 3B5ND 2C9LY 1N86A 4GKGA 1YTZT 1FAVA 2OYHA 4WY4D 2R32A 1LWUB 1S9KE 1KILB 1URQA 1T2KC 1GW3A 2WWWA 1YYCA 4DZOA 1J1EC 3HUSC 3HTKB 1SVFA 2Q5UA 2VRSA 4B86A 1SFCA 5APUA 3RK3D 1N7SC 5APVA 1JCCA 4C7NA 1URQD 2WPQA 3U59A 2N1TA 1S9KD 5AW2B 1X9VA 1AQ5A 1HGVA 1MV8A 5AW0B 2XU6A 1J2JB 1SFCD 1FJKA 1N73B 5APQA 2W27A 3A3YB 4WBAA 3H32B 1X8YA 3M9HA 3RL0C 2POHA 2M8RA 1VDFA 1ZN5A 2LKMA 1X79B 3TNUB 3VP8A 5AVRB 3C9IA 3R2PA 2HODB 2GUSA 1MZ9A 1GZLA 1RE4A 1DEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZG A;  1N73 A;  3GHG C;  2OYH A;  1RE4 C;  1LWU B;  1LTJ B;  2OYH C;  1JY2 N;  1RE3 A;  1N73 C;  2A45 G;  1FZC A;  1FZE A;  1JY3 P;  1JY3 O;  1LT9 A;  3H32 A;  1RF1 C;  3GHG B;  1FZC C;  1RE3 C;  2OYI A;  1RF1 A;  1T3U A;  3HUS A;  2Q9I A;  1M1J A;  2OYH B;  1LT9 C;  2OYI C;  1RF0 A;  2XNX A;  1N73 B;  3HUS C;  3E1I A;  2FFD A;  1FZB A;  1JY2 P;  1JY2 O;  1M1J C;  2HOD A;  1FZF A;  1RF0 C;  2H43 A;  3BVH A;  2A45 H;  2HPC A;  1FZC B;  2FFD C;  3H32 B;  2A45 I;  1LT9 B;  2OYI B;  1RF1 B;  1LWU A;  3HUS B;  1M1J B;  1LTJ A;  2Z4E A;  2FFD B;  1W2E A;  1LWU C;  1FZA A;  1LTJ C;  2HOD B;  3GHG A;  1N86 A;  1JY3 N;  2HPC B;  1RE4 A;  2HLO A; 
#chains in the Genus database with same CATH topology
 4JYB A;  1EXJ A;  1ZR4 A;  3HE5 A;  1JMM A;  1J1D C;  3I5C A;  1L0N J;  1S3J A;  1BGY J;  3NFQ A;  1S2E A;  1M1K Q;  1ZV8 A;  3HD7 A;  5B66 E;  2KS1 A;  1W5C E;  2BAS A;  1L4A A;  1LTA C;  4I1L A;  3EWK A;  1LJ2 A;  5KLV D;  5CCG D;  1SQB D;  1XTC C;  3IFM A;  3SWK A;  3VP9 A;  4C7N B;  4EIJ A;  1LTS C;  5H2F E;  2JWA A;  1FE6 A;  2XV5 A;  2YNY A;  3M0D A;  1R5L A;  1VPC A;  4U3F G;  3N7N A;  2Q7C A;  3H1J D;  3WUU A;  2WSE J;  5KAF H;  1K05 A;  2E75 D;  2WMM A;  3B5N A;  3A0B E;  2WIT A;  2FXM A;  1PV3 A;  4NPD A;  1NTM E;  1VF5 C;  4RES B;  3W68 A;  1S5L H;  1G2C A;  5CJ0 A;  2KYV A;  1JY3 N;  3USS A;  3L70 E;  1DIP A;  3A5T A;  2XND H;  2K9J B;  1LT9 A;  2Z5I A;  1NTM J;  2Q6Q A;  1UIX A;  1BE3 D;  1JUN A;  3FX0 A;  3Q5S A;  3PRJ A;  2J5U A;  1LNQ A;  4H44 D;  3L70 J;  2QJY B;  1NTK K;  2E42 A;  1NKN A;  1PZQ A;  2FFD C;  2IX7 C;  4TT3 H;  4WY4 B;  3R4Y A;  2JWD A;  2K1A A;  3V2N A;  1KYO E;  2ZT9 B;  2BCC E;  1VQL P;  2RKL A;  1MFZ A;  3A0H H;  3I56 P;  1GL2 C;  1AQT A;  4M3L A;  1KC8 Q;  4ZKU A;  1SQX D;  2P1J A;  4HJG H;  3RK3 B;  4PV1 C;  5AW9 B;  3KZI H;  1URQ B;  4N3Y B;  5KJ7 A;  2BCC J;  3AE3 C;  1PGO A;  1NHL A;  1KZU B;  3GW6 A;  3H1L E;  2JKV A;  5KAI E;  4UB6 E;  3H1L G;  2J59 M;  1NTZ K;  1GDT A;  1QVG O;  2OYI B;  2WQY C;  2E43 A;  2B9B A;  1NAF A;  2KI7 B;  3H1L J;  2L91 A;  3KQG A;  5AVX B;  1IFN A;  3M0A A;  1KIL D;  3MZW B;  4U3F D;  4H0L D;  2P7J A;  3H6P A;  5EFW B;  3S4R A;  1VQ4 P;  1N73 A;  4HYT B;  3H1K J;  2WSS H;  3CI9 A;  1GMJ A;  3RGU A;  3N4X A;  1SQP E;  3KYQ A;  4IOI H;  4YPC A;  1QEX A;  3D6Z A;  1IJD B;  1EQ7 A;  3WUT A;  3MD0 A;  2HPC B;  2Y0D A;  2NPS B;  3AEF C;  1S5L E;  2KSE A;  1SQP J;  1PPJ G;  1M1J C;  1N7S A;  2KB7 P;  1LTI C;  2WT7 A;  2ZYA A;  1MUU A;  2ZFC A;  3NMD A;  3FWL A;  1IFD A;  5AW6 B;  4O9B A;  1GK6 A;  2IYP A;  3SWY A;  1G1I A;  4Y99 B;  3MGN A;  5CCG C;  4Z1M H;  2YMK A;  3RBX A;  3GG2 A;  2YO3 A;  1S72 P;  1P84 H;  1L0N K;  3AEE C;  3CPW O;  2JJL A;  2QE7 H;  4N6J A;  1OFC X;  2R5B A;  2K9Y A;  5B5E E;  1ZRT D;  2WSC H;  3L75 G;  3B8E B;  1ZXG A;  3FXE A;  1MFT A;  3PLN A;  3CCM P;  4R4L A;  2E75 C;  3L74 E;  3T97 A;  2RN0 A;  5AVT B;  3WMM 0;  3L74 G;  5AW5 B;  5M1B A;  3AE4 C;  3GHG C;  2FYU E;  1L0L E;  1IK9 A;  3RK2 D;  3AEA C;  3KZI E;  1HWT C;  3S9O A;  1YJW P;  2ZYG A;  5AW8 B;  1JNM A;  4BRY B;  5AVQ B;  2M0B A;  3RL0 B;  2FYU J;  1L0L J;  1RH5 B;  2YKP A;  1JY2 N;  3AE6 C;  5BU5 A;  2A45 G;  3VMZ A;  1AJY A;  2QJP B;  3E7K A;  1KYO I;  1G1J A;  4H44 C;  4KHX A;  1NVO A;  3CX5 D;  2WSF J;  1NTM K;  1Y47 A;  1LTJ A;  3A2A A;  2W6J H;  3B5N D;  1N86 A;  5K5G B;  2KZJ A;  4GKG A;  1K04 A;  1YTZ T;  2OYH A;  3AE5 C;  1KB9 E;  1ZME C;  1URQ A;  1YYC A;  3HUS C;  3C8V A;  1SVF A;  2Q5U A;  1Y8A A;  4B86 A;  2N9Y B;  1OW7 A;  5APV A;  1NTK G;  2B87 B;  3ITK A;  3U59 A;  2N1T A;  1PPJ D;  1U7M A;  1X9V A;  3E1R A;  2O01 N;  1J2J B;  1QX8 A;  1SFC D;  1FJK A;  2BEZ F;  5APQ A;  2FBW C;  3A3Y B;  1YQ3 C;  2H88 C;  3H32 B;  1VF5 B;  1VQ7 P;  2IZ0 A;  1RE4 A;  1PGQ A;  1GK4 A;  5DJU B;  2ZVO B;  1VQ6 P;  3P8M C;  3MUD C;  1FZC C;  1SQB E;  2V4H A;  3IN6 A;  2K3R A;  4IFM A;  1KFM A;  1LWU C;  3L75 D;  1KIL C;  4H0L C;  2KK7 A;  3H1J E;  3VYI A;  1SQB J;  1H88 A;  4GOF A;  1NTZ G;  1CZQ A;  3VMX A;  1ZOY C;  2KLU A;  5KJ7 D;  4GDO A;  3JSV C;  3Q5R A;  1FDO A;  1IFJ A;  3L74 D;  1TU3 F;  1USD A;  1R8E A;  3NXS A;  2C0W A;  4GIF A;  3CXH H;  3H1J J;  3SFD C;  1KV4 A;  3AE8 C;  3VTP C;  2Y0C A;  2HFE D;  2JDI H;  3AEB C;  1GL2 B;  3E1I A;  2KP8 A;  2KNC B;  2Y0E A;  1BE3 E;  3V2P A;  4PV1 B;  3WU2 H;  2P67 A;  5GTH H;  1LTG C;  1SQQ K;  1BCC G;  4DT0 A;  3CCU P;  5CCH A;  1FZE A;  1RF1 A;  1YJ9 P;  1RF0 A;  1DX7 A;  2A06 G;  3RBZ A;  1BE3 J;  5TIS E;  5TJH A;  1VQM P;  1USE A;  1OVU A;  1RE3 C;  4MN4 C;  3M9Q A;  2O3J A;  1SQX E;  1NTK D;  4W7Y A;  1T2K D;  1JB0 J;  2BEQ D;  4HB1 A;  4OH8 B;  3V2Q A;  2WPS A;  3G3Z A;  1OZH A;  1N7S D;  5AW4 B;  1SQX J;  1PP9 G;  3RK2 C;  1BSH A;  1K9M Q;  1VQO P;  5AVU B;  1VQ5 P;  2YKQ A;  3G9R A;  3SSU A;  2L5G B;  2P2U A;  2E5Y A;  3CX5 H;  3EFG A;  3BAS A;  2PP6 A;  1MKM A;  4IFF A;  4DOJ A;  3AE7 C;  2QG4 A;  2PGD A;  1KB9 I;  2M5A A;  1KIL E;  4U3F E;  1M1J B;  2QEX P;  5APS A;  1NU1 G;  4OGQ D;  4ZNC A;  2K88 A;  1NTZ D;  3U1C A;  1P84 D;  1W2B O;  4N78 D;  5E79 H;  3B5N C;  4XFJ A;  2B87 A;  2KOG A;  1M7L A;  3BVH A;  1KQL A;  4U3F J;  1DH3 A;  4ZKP A;  1AA0 A;  3V4W A;  2N9B A;  2MKV A;  5CMZ A;  3AE1 C;  2JR8 A;  5AW1 B;  3CXH E;  2IFN A;  1FBM A;  3AEC C;  5AVY B;  1BCC D;  1SFC C;  1PIX A;  2E75 B;  1CSB A;  1M90 Q;  2P10 A;  1IZN B;  1FZG A;  1U57 A;  3V6I A;  4CPG A;  1OWA A;  2A06 D;  3GHG B;  1T3U A;  3NTN A;  4AYC A;  1FS0 E;  2G3A A;  3BRV B;  1BSN A;  3ABV C;  1HF9 A;  2OGU A;  1GD2 E;  1LTT C;  1ZRT E;  1SQV E;  1RQU A;  2B89 A;  1SQV G;  2FFD A;  3TDK A;  4H44 B;  2N1T D;  1QVF O;  3L73 G;  3VMA A;  2QVA A;  1JOC A;  5KJ7 C;  4EOT A;  1Y9B A;  3PTZ A;  2IBZ G;  1SQV J;  1LTB C;  2AEM A;  2KNC A;  2YMY A;  1PP9 D;  2QM7 A;  1S5L X;  3CL3 D;  2AXC A;  1VQK P;  1JTH B;  4DJG A;  2FY8 A;  5KLV K;  2A45 H;  3TF5 A;  1NJI Q;  3HUS B;  2LXB A;  1HJB A;  3L36 A;  1IK7 A;  3D70 A;  3A7O A;  3OAK A;  4LC1 A;  2AEF A;  2YXQ B;  3JC2 2;  4ASV A;  3S1K A;  3H1H G;  2PAJ A;  3CX5 E;  1IO4 A;  1NU1 D;  2QJK C;  1AV1 A;  3H1I G;  1BDC A;  2HLO A;  1HJ0 A;  2B88 A;  3RL0 g;  2JEE A;  1U7J A;  4ASW A;  3LW5 H;  1FU1 A;  3P8C E;  3TNU A;  2D2C D;  5AVV B;  1FZC B;  5KAF E;  2FKW B;  1SQQ G;  2LXC B;  5E79 E;  3F89 A;  3CCR P;  3QH9 A;  1LWU B;  2E76 D;  1KIL B;  4H0L B;  1T2K C;  2OQQ A;  1GW3 A;  1PPJ E;  3CXH D;  2AXT H;  3HTK B;  3L71 G;  3CME P;  5APU A;  1N7S C;  1JCC A;  4C7N A;  3D6Y A;  2OTJ P;  2WPQ A;  1S9K D;  3AED C;  1D7M A;  1VQ8 P;  4RO0 A;  2XU6 A;  2M8R A;  1ZN5 A;  1X79 B;  3VP8 A;  3R2P A;  2HOD B;  2GUS A;  1MZ9 A;  1GZL A;  2E74 D;  1DEB A;  4D6T G;  4K35 A;  2Q3I A;  3L75 E;  1YI2 P;  1SQV D;  4OGQ C;  2FXO A;  5AVZ B;  3M06 A;  1KQF B;  3L73 D;  3PH0 A;  1Q2N A;  2W90 A;  1PFI A;  2WVR A;  4W7Z A;  4A7P A;  5APT A;  3A0H E;  3D71 A;  2Z4E A;  2K9J A;  4GT1 A;  2IBZ D;  3BCC G;  3L75 J;  3CXH I;  3O6Q B;  2OAR A;  5CBO A;  4GOE A;  1GU4 A;  3HD7 D;  2H43 A;  1GU5 A;  3L74 J;  3TSI A;  1L4A D;  2KZI A;  3GHG A;  5KKZ C;  1JO5 A;  2CPB A;  2GUV A;  1QGK B;  2ZVN B;  3PJS K;  1OMI A;  2H8P D;  3G71 P;  3SFE C;  3H1H D;  4LLH A;  4WY4 A;  3HE5 B;  1FJP A;  1FZF A;  2Q1K A;  1N2D C;  3H1I D;  1N8R Q;  2P58 A;  2LR2 A;  2M3B A;  3O8Z A;  3RK2 B;  1LTJ C;  3CWB E;  3CWB G;  2ZJS E;  2OYH C;  2KS1 B;  3GMA A;  1NYH A;  3P8C D;  2ITA A;  3KPE A;  3G4S P;  1SQQ D;  3CWB J;  1NTK E;  3AEG C;  1Q82 Q;  1NWQ A;  1FOS E;  2FYN C;  4Y28 J;  2N1T C;  3TK1 A;  3MIW A;  3CLQ A;  2OYI A;  1HUC A;  3L71 D;  3MTU E;  3B5N B;  4L76 A;  2IFM A;  1NTK J;  3KDP B;  3BRT B;  3LW5 J;  3G6E P;  3HRN A;  4RJT A;  1G2C B;  2AXT E;  1RE4 C;  5B66 H;  4HH2 A;  1OVR A;  3CX5 I;  3UIA A;  3V4Q A;  2O1K A;  2JO1 A;  2WPR A;  2HYN A;  4JBZ A;  2W6A A;  2WSE H;  2O01 H;  1YQ4 C;  3FGA D;  4D6T D;  4C7R A;  4IL6 H;  5H2F H;  2ZAE B;  1EDK A;  1H0T B;  4RKU J;  1SFC B;  3TGU E;  1NTZ E;  3TGU G;  1P84 E;  4N78 E;  1PGJ A;  2HPC A;  3BCC D;  2NPS A;  1LWU A;  3L72 G;  2I1K A;  2D2C C;  3TGU J;  1NTZ J;  3HTK A;  4BWN A;  3SWF A;  4DCK A;  1IFI A;  4H13 D;  3L37 A;  2UWJ E;  1VQ9 P;  3II6 A;  4WWI A;  1FZB A;  2NRG A;  3Q1M A;  3GF3 A;  2E76 C;  2WSC J;  2RH0 A;  4PD4 D;  2IYO A;  1FZA A;  1IC2 A;  2YXR B;  1BCC E;  5CBN A;  1DD4 A;  4YXD C;  2A06 E;  1E5W A;  4KJM A;  1RF0 C;  5KLI B;  4JF7 A;  3CWB D;  1SQP K;  1GW4 A;  1BCC J;  3LIE A;  3RK3 E;  1EXI A;  4JYC A;  1ZP0 C;  2QM8 A;  1KYO H;  3F5H A;  3TYY A;  3AE2 C;  3HE4 B;  2E74 C;  2ZYD A;  1LP1 B;  3O6Q A;  5APX A;  1XTG B;  1DEE G;  1YIT P;  2HG5 D;  1OXZ A;  2QJK B;  1BDD A;  4YXW H;  4BRY A;  1RE3 A;  3ZDM A;  2FYZ A;  1ZLL A;  2H89 C;  1PP9 E;  1L0N E;  1BGY E;  3B71 A;  1GTW A;  1L0N G;  4AUW A;  2SPZ A;  1BGY G;  2A45 I;  2OTL P;  3EQ2 A;  2NZ2 A;  2J58 A;  3HD7 C;  1N7L A;  3AE9 C;  3JCU H;  5CHX A;  1L4A C;  1JY3 O;  1PP9 J;  1H89 A;  1X22 A;  1QL1 A;  1NGM B;  1FC2 C;  3VN0 A;  5AVS B;  5BVZ A;  1NU1 E;  3M0D C;  3TGU D;  1SLQ A;  1N7S B;  1JMB A;  1K8A Q;  2WT7 B;  3CCV P;  1CI6 B;  3KHU A;  2FYU K;  1L0L K;  1FDM A;  3L72 D;  2OTK E;  3L35 A;  4IL6 E;  2KLV A;  1NU1 J;  1JM0 A;  2HR3 A;  4I6M C;  1CW5 A;  2CK3 H;  2O01 J;  1E79 H;  2DW3 A;  3H32 A;  1LGH B;  1H8A A;  1NOH A;  2Q9I A;  1LT9 C;  2XNX A;  1QL2 A;  1NTM G;  4WB4 A;  1Q7Y Q;  4AQR D;  4OGQ B;  1EDI A;  1Q86 Q;  3CMA P;  2K37 A;  2JP3 A;  1VQP P;  4WY4 D;  4K3A A;  3T97 B;  2ZT9 D;  3L70 G;  1S9K E;  4I7Z C;  4DZO A;  1J1E C;  2GA1 A;  3IAO A;  3WU2 E;  3CD6 P;  5GTH E;  2W8Z A;  1H0T A;  1SFC A;  3RK3 D;  1P84 I;  3OW2 O;  1URQ D;  5KKZ B;  1AQ5 A;  1HGV A;  1MV8 A;  5AW0 B;  5B5E H;  2W27 A;  2QRX A;  3M9H A;  2POH A;  1VDF A;  3L73 E;  3C9I A;  3MHV A;  2YIU C;  1GL2 A;  2BCC G;  2IBZ E;  1YTZ I;  1LTJ B;  3PHL A;  1M8O B;  1EDL A;  1L0N D;  4PD4 H;  1BGY D;  1KQG B;  2OYH B;  5KLI C;  1Z56 A;  3L73 J;  1SQB K;  4H13 C;  3CCJ P;  2XKM A;  2PFX A;  1IFP A;  1SS1 A;  2WSF H;  2FXP A;  3VMY A;  1YHQ P;  1KD1 Q;  2I8D A;  2Z5H A;  2YO2 A;  2FYN B;  3V2R A;  1KMI Z;  2N1T B;  3H25 A;  3H1H E;  2R44 A;  3EFF K;  3JCU E;  2MJZ A;  3H1I E;  3HE4 A;  1HVV A;  2E5T A;  1LP1 A;  1EZV E;  1EZV G;  1N73 C;  3H1K E;  1JY3 P;  3FXD A;  3H1H J;  4U7J A;  2NPS D;  3H1K G;  4NPF X;  4GOD A;  4ZMD A;  2Y9Y A;  1KB9 H;  4QMA A;  1KOR A;  3H1I J;  3C1L A;  1SQQ E;  1S4X A;  2GM4 A;  1NTM D;  1M57 D;  1SQP G;  1SQQ J;  2M3E A;  3L71 E;  3FWN A;  1WRG A;  5AVW B;  2R3S A;  3B4S A;  3L70 D;  5CCH D;  3IF4 A;  4LGD E;  1UII A;  1NH4 A;  2PRR A;  2D2C B;  1M1J A;  1SP4 A;  3L71 J;  5KTB A;  3M91 A;  2E76 B;  1SQX K;  1CI6 A;  4D6T E;  5BU8 B;  3PP5 A;  1IFM A;  2W6B A;  3OA7 A;  3CC4 P;  3M9B A;  5CCG A;  3VOP A;  1JY2 O;  3OJA B;  5DJT B;  1DD3 A;  1KYO D;  3GF7 A;  1RF1 B;  3BAT A;  2IPP A;  4W80 A;  3K5B A;  4D6T J;  2IZ1 A;  2BCC D;  3BCC E;  1OW6 A;  2AEJ A;  3LID A;  4XA4 A;  1HH0 A;  1T8Z A;  2OYO A;  1JEK A;  2QSI A;  3RL0 D;  1VL2 A;  4OWF A;  2I1J A;  2ZXX A;  4NPE A;  4IFD K;  2QIW A;  1WMK A;  5AW3 B;  1RHZ B;  2O1J A;  2XZR A;  2E74 B;  4WVZ A;  2QJY C;  3BCC J;  4PD4 E;  3P32 A;  3I55 P;  1A02 F;  2FYU G;  1L0L G;  1NU1 K;  3H1L D;  1EDJ A;  1A02 J;  4WY4 C;  3L4F A;  2ZT9 C;  4PJ0 H;  2V7Q H;  2W83 C;  1EZV D;  5TIS H;  4L73 A;  2WTY A;  1OVV A;  3H1K D;  3HD7 B;  1Q90 D;  3RK3 C;  1WT6 A;  1L4A B;  1URQ C;  4TLF A;  1J1D B;  5GTI H;  2IBZ I;  2H7H A;  1M56 D;  2XDJ A;  1NO4 A;  2IDB A;  1JTH A;  1VF5 D;  2C0X A;  2M5A B;  3Q2Y A;  1KQS O;  3Q5P A;  1JCD A;  1QLE D;  1SQP D;  3HUS A;  4UB8 H;  2OYI C;  2CPS A;  3KXD A;  3Q3D A;  1FOS F;  1T6A A;  3CCQ P;  4I2L C;  4L74 A;  1OX3 A;  1RY3 A;  2YKO A;  3GLM A;  2Q3E A;  1NKZ B;  3U1A A;  2R3C A;  4JQ0 D;  4L75 A;  4XE5 B;  1EZV I;  1ZR2 A;  1SQV K;  3V5B A;  1LT9 B;  2WZ7 A;  2KIK A;  3P7K A;  4EDF A;  5CJ4 A;  2G8Y A;  1R5S A;  2KSJ A;  4EYY Q;  5KLV E;  3MUD A;  1FZC A;  2R5D A;  4C46 A;  4R4M A;  3WUV A;  5KLV G;  1SQB G;  1PL5 A;  1OW8 A;  4I7Z B;  3L72 E;  3A0B H;  1GL2 D;  1J1E B;  2NPS C;  1L2P A;  4HKZ H;  1HGZ A;  1KIL A;  1AFO A;  1HTL C;  5KLV J;  3IR9 A;  1X0T A;  4PV1 D;  3CCL P;  4OVN F;  2C9N Y;  3H1J G;  4YTP C;  1KFN A;  1Q81 Q;  1EC5 A;  1JY2 P;  3L72 J;  4BXL A;  4JPZ B;  1FDI A;  1YBK A;  2ZXE B;  1S1C X;  2FFD B;  1W2E A;  2FYU D;  1L0L D;  5APY A;  3W67 A;  1T3J A;  5AW7 B;  1OIP A;  1AVY A;  2YIU B;  4Y99 C;  5CCH C;  4KT0 J;  1RF1 C;  2HOD A;  1HBW A;  5APW A;  5L8R J;  1BE3 G;  4EI2 A;  2C9L Y;  1VQN P;  1NAY A;  2RMZ A;  3CC2 P;  1FAV A;  4H13 B;  2R32 A;  1LT1 A;  2KXP B;  1YJN P;  5C39 A;  2Y9Z A;  3CC7 P;  4PJ0 E;  2WWW A;  3CCE P;  4IL6 X;  1RQV A;  2VRS A;  1YIJ P;  1KB9 D;  5GTI E;  1PGP A;  5AW2 B;  2V7Q J;  1K73 Q;  4PD4 I;  1N73 B;  3QWO C;  3CCS P;  1AVO A;  2QA4 P;  4WBA A;  3RL0 C;  1X8Y A;  1KTM A;  1SQX G;  3MP7 B;  2KUB A;  2WPV B;  2LKM A;  5KAI H;  3TNU B;  1ZW0 A;  5AVR B;  4UB6 H;  1KN7 A;  4UB8 E;  2QJP C; 
#chains in the Genus database with same CATH homology
 1GK4 A;  4JYB A;  1GL2 A;  2Q3I A;  1ZR4 A;  3HE5 A;  1YTZ I;  1LTJ B;  3P8M C;  1JMM A;  1J1D C;  3I5C A;  1FZC C;  3NFQ A;  2OYH B;  5AVZ B;  1Z56 A;  3M06 A;  4IFM A;  1KFM A;  1SQB K;  1PFI A;  4W7Z A;  1ZV8 A;  3HD7 A;  5APT A;  2Z4E A;  1LWU C;  4GT1 A;  2BAS A;  2XKM A;  1L4A A;  1KIL C;  1LTA C;  2OAR A;  4I1L A;  2WSF H;  5CCG D;  3VMY A;  3VYI A;  1H88 A;  1XTC C;  3IFM A;  2Z5H A;  1GU4 A;  3VP9 A;  4C7N B;  1CZQ A;  2YO2 A;  3VMX A;  4EIJ A;  3V2R A;  3HD7 D;  2N1T B;  5KJ7 D;  2H43 A;  1LTS C;  1GU5 A;  1IFJ A;  2XV5 A;  3TSI A;  2MJZ A;  1L4A D;  2YNY A;  3M0D A;  3NXS A;  1VPC A;  3HE4 A;  1HVV A;  2C0W A;  3GHG A;  3N7N A;  4GIF A;  1JO5 A;  2Q7C A;  2CPB A;  2GUV A;  1N73 C;  3VTP C;  3B5N A;  2H8P D;  1JY3 P;  2HFE D;  2NPS D;  2WIT A;  4LLH A;  2FXM A;  4WY4 A;  1GL2 B;  3HE5 B;  3E1I A;  1FJP A;  2KP8 A;  1FZF A;  4RES B;  1N2D C;  1G2C A;  5CJ0 A;  2KYV A;  3V2P A;  2M3B A;  3O8Z A;  3RK2 B;  1LTJ C;  2P67 A;  1JY3 N;  1LTG C;  1SQQ K;  3A5T A;  2OYH C;  2GM4 A;  5CCH A;  1FZE A;  1LT9 A;  2Z5I A;  3P8C D;  1RF1 A;  3KPE A;  1RF0 A;  1DX7 A;  1JUN A;  1WRG A;  5AVW B;  5CCH D;  4LGD E;  1NWQ A;  1FOS E;  1NTK K;  1NH4 A;  2E42 A;  1NKN A;  2N1T C;  3TK1 A;  3MIW A;  3CLQ A;  1RE3 C;  2OYI A;  3M9Q A;  1M1J A;  1SP4 A;  1HUC A;  5KTB A;  3MTU E;  3B5N B;  2IFM A;  2FFD C;  3KDP B;  2IX7 C;  3BRT B;  4WY4 B;  4W7Y A;  3M91 A;  3V2N A;  1T2K D;  3HRN A;  1SQX K;  1CI6 A;  1G2C B;  1RE4 C;  4OH8 B;  5BU8 B;  3V2Q A;  1MFZ A;  2WPS A;  1GL2 C;  3PP5 A;  1IFM A;  4HH2 A;  4M3L A;  3UIA A;  2W6B A;  3OA7 A;  4ZKU A;  3G3Z A;  1N7S D;  3V4Q A;  2O1K A;  2P1J A;  3M9B A;  5AW4 B;  5CCG A;  2WPR A;  3VOP A;  1JY2 O;  3RK3 B;  2HYN A;  3RK2 C;  2W6A A;  3OJA B;  2WSE H;  5AW9 B;  1RF1 B;  2O01 H;  2IPP A;  3BAT A;  1URQ B;  4W80 A;  4N3Y B;  5AVU B;  5KJ7 A;  2YKQ A;  4C7R A;  2L5G B;  3LID A;  2P2U A;  4XA4 A;  1HH0 A;  1NHL A;  1T8Z A;  1SFC B;  3EFG A;  1KZU B;  3BAS A;  2PP6 A;  3RL0 D;  4IFF A;  2I1J A;  4N78 E;  4DOJ A;  4IFD K;  2J59 M;  1NTZ K;  2HPC A;  5AW3 B;  1GDT A;  2O1J A;  2XZR A;  2OYI B;  2NPS A;  1LWU A;  2I1K A;  1M1J B;  5APS A;  3P32 A;  1A02 F;  2E43 A;  1NAF A;  3U1C A;  3HTK A;  1NU1 K;  3SWF A;  4N78 D;  1A02 J;  1IFI A;  3B5N C;  3KQG A;  3L37 A;  3II6 A;  2KOG A;  1FZB A;  4WY4 C;  5AVX B;  1M7L A;  3BVH A;  1IFN A;  3L4F A;  3M0A A;  1KIL D;  1KQL A;  2P7J A;  1DH3 A;  4ZKP A;  3H6P A;  1FZA A;  1IC2 A;  3V4W A;  2N9B A;  2WTY A;  1N73 A;  5CMZ A;  4HYT B;  3HD7 B;  3CI9 A;  3RK3 C;  1WT6 A;  1L4A B;  3N4X A;  5AW1 B;  1URQ C;  1J1D B;  1E5W A;  2IFN A;  3KYQ A;  1RF0 C;  1FBM A;  2H7H A;  5AVY B;  4JF7 A;  1SQP K;  1IJD B;  1EQ7 A;  1GW4 A;  2XDJ A;  3MD0 A;  1SFC C;  3LIE A;  2HPC B;  1CSB A;  1NO4 A;  1FZG A;  2NPS B;  1JTH A;  2C0X A;  4JYC A;  2QM8 A;  1OWA A;  3TYY A;  3HE4 B;  1JCD A;  3GHG B;  1T3U A;  3HUS A;  2OYI C;  3NTN A;  2CPS A;  1M1J C;  4AYC A;  5APX A;  1XTG B;  1FOS F;  1N7S A;  2KB7 P;  3BRV B;  1LTI C;  4I2L C;  2WT7 A;  1MUU A;  2HG5 D;  1OXZ A;  2ZFC A;  1RY3 A;  3NMD A;  2YKO A;  1RE3 A;  1IFD A;  1NKZ B;  1GD2 E;  3U1A A;  2FYZ A;  1LTT C;  2R3C A;  1ZLL A;  5AW6 B;  4O9B A;  1GK6 A;  3SWY A;  1G1I A;  2FFD A;  4Y99 B;  4XE5 B;  1GTW A;  3MGN A;  1ZR2 A;  5CCG C;  4AUW A;  1SQV K;  3V5B A;  2A45 I;  2YO3 A;  1LT9 B;  2WZ7 A;  1L0N K;  3EQ2 A;  2N1T D;  2JJL A;  4N6J A;  3P7K A;  5CJ4 A;  2J58 A;  3HD7 C;  1JOC A;  5KJ7 C;  1N7L A;  4EOT A;  2R5B A;  2KSJ A;  5CHX A;  2WSC H;  1L4A C;  1LTB C;  2YMY A;  3B8E B;  3MUD A;  1FZC A;  2QM7 A;  1JY3 O;  2R5D A;  3CL3 D;  4C46 A;  1H89 A;  1QL1 A;  1JTH B;  5KLV K;  2A45 H;  1GL2 D;  1J1E B;  3HUS B;  3VN0 A;  3T97 A;  2NPS C;  5AVT B;  3WMM 0;  5AVS B;  5BVZ A;  1HGZ A;  1KIL A;  3M0D C;  5AW5 B;  1HJB A;  3L36 A;  1AFO A;  1HTL C;  1SLQ A;  3GHG C;  3IR9 A;  1N7S B;  3RK2 D;  1IK9 A;  3A7O A;  3OAK A;  4LC1 A;  2C9N Y;  2WT7 B;  1CI6 B;  1KFN A;  1HWT C;  2FYU K;  1L0L K;  1FDM A;  5AW8 B;  3L35 A;  1JY2 P;  1JNM A;  5AVQ B;  2PAJ A;  2KLV A;  1IO4 A;  2ZXE B;  2FFD B;  1W2E A;  3RL0 B;  4I6M C;  5APY A;  1CW5 A;  2YKP A;  2HLO A;  1T3J A;  5AW7 B;  1JY2 N;  5BU5 A;  2JEE A;  2A45 G;  4Y99 C;  3VMZ A;  3H32 A;  1LGH B;  1H8A A;  1NOH A;  3LW5 H;  1G1J A;  5CCH C;  2Q9I A;  1FU1 A;  3P8C E;  1LT9 C;  2XNX A;  3TNU A;  4KHX A;  1QL2 A;  1RF1 C;  2HOD A;  5AVV B;  1FZC B;  4WB4 A;  1HBW A;  5APW A;  4AQR D;  1NTM K;  2FKW B;  1LTJ A;  3A2A A;  3B5N D;  2C9L Y;  1N86 A;  4GKG A;  1YTZ T;  1FAV A;  2OYH A;  4WY4 D;  2R32 A;  1LWU B;  1S9K E;  1KIL B;  1URQ A;  1T2K C;  1GW3 A;  2WWW A;  1YYC A;  4DZO A;  1J1E C;  3HUS C;  3HTK B;  1SVF A;  2Q5U A;  2VRS A;  4B86 A;  1SFC A;  5APU A;  3RK3 D;  1N7S C;  5APV A;  1JCC A;  4C7N A;  1URQ D;  2WPQ A;  3U59 A;  2N1T A;  1S9K D;  5AW2 B;  1X9V A;  1AQ5 A;  1HGV A;  1MV8 A;  5AW0 B;  2XU6 A;  1J2J B;  1SFC D;  1FJK A;  1N73 B;  5APQ A;  2W27 A;  3A3Y B;  4WBA A;  3H32 B;  1X8Y A;  3M9H A;  3RL0 C;  2POH A;  2M8R A;  1VDF A;  1ZN5 A;  2LKM A;  1X79 B;  3TNU B;  3VP8 A;  5AVR B;  3C9I A;  3R2P A;  2HOD B;  2GUS A;  1MZ9 A;  1GZL A;  1RE4 A;  1DEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...