3H1HJ

Cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 20
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1hJ00
2IBZI 3L71J 1BGYJ 1SQBJ 1BE3J 1SQQJ 1NU1J 1EZVI 1KYOI 1NTKJ 3CWBJ 1KB9I 3L70J 5KLVJ 2FYUJ 3H1LJ 2BCCJ 3L73J 3L74J 1PP9J 3BCCJ 3CX5I 3TGUJ 3H1HJ 1NTMJ 3H1KJ 4U3FJ 1P84I 3H1JJ 3H1IJ 1NTZJ 1L0NJ 3L72J 1SQPJ 1SQXJ 1BCCJ 1SQVJ 3CXHI 4PD4I 3L75J 4D6TJ 1L0LJ
chains in the Genus database with same CATH superfamily
1CZQA 2KS1A 3M06A 2KK7A 1BGYE 1IZNB 4H44B 3GF3A 3I56P 2JDIH 1GL2B 1AVYA 3TGUE 3NFQA 4R4LA 3KPEA 1EZVG 3EFFK 1T6AA 3CWBJ 3L71E 1IK9A 3CX5E 2XKMA 2QJKB 3HE4A 1HF9A 2K3RA 2HODA 2W90A 4D6TJ 5CJ0A 1RE4A 1U7JA 2BASA 1FJKA 3H1ID 1J1EB 4ZKPA 3OA7A 2YKPA 1OXZA 2OARA 2R44A 2GUVA 2QM7A 5AVQB 2OYHA 3HE5B 1GW4A 4IFDK 2KI7B 3H32B 1PGPA 2RH0A 2UWJE 4L73A 1OW8A 1KTMA 1H8AA 3CD6P 3SFEC 1IK7A 1SFCC 3LIDA 1W2EA 1OVUA 3L72E 2WPQA 1GU5A 2WSEJ 5KLVJ 3RL0g 3AEBC 3B5NC 1FU1A 1EXJA 2WSEH 1VQKP 1JMBA 1RF1B 5H2FE 2XDJA 2Q1KA 3I5CA 3D6YA 3V4QA 2RKLA 2BCCD 4U3FG 4RJTA 1L0NE 1EC5A 3M0DA 1GZLA 1SLQA 1OX3A 1TU3F 4ASWA 4IFMA 2LKMA 1VQ7P 2YMYA 3P8MC 3CCMP 1L4AC 1RY3A 3CXHE 3CLQA 1PP9G 1GW3A 4H13C 1NTME 2QVAA 1NH4A 1SQBJ 3U59A 3JC22 4A7PA 2N1TA 3V2QA 3CX5I 2Z4EA 4ZMDA 3QWOC 3H1LG 1S4XA 1P84D 5KKZB 5BU8B 4RO0A 4EI2A 1LTAC 2E74B 1X79B 5KAIH 1H89A 2Q3IA 3PRJA 1MKMA 2BCCJ 3CMEP 4NPFX 1LGHB 1T2KC 1SFCD 1LT9B 3HRNA 1FE6A 3RK3C 3GG2A 2HLOA 4LLHA 3B5ND 2O3JA 4YTPC 2ZYDA 3FWLA 1ZXGA 3O8ZA 1YBKA 3U1AA 2E42A 3H1LE 1AQTA 3L70G 1M1JC 1P84I 1H0TA 4GOEA 1YJ9P 4WWIA 3VTPC 3AE4C 2J5UA 5TISE 1SQPG 1SQXG 1L4AD 1K8AQ 1P84H 4H44C 4H13D 1VQPP 1JB0J 1PPJG 2FYUG 1XTGB 4I7ZB 5AW6B 2XZRA 3MUDA 2KB7P 2NPSD 1NAFA 1JNMA 5AVTB 2ZAEB 1T3JA 3NTNA 3GMAA 2YMKA 2QJKC 3TSIA 4C7NA 2WTYA 3L37A 1KILA 1YI2P 1VL2A 1ZP0C 3G3ZA 3L73G 3FWNA 1SFCA 1ZN5A 5M1BA 1T8ZA 1Q82Q 1OW6A 1T2KD 2XV5A 1AQ5A 1GD2E 3KZIE 5AW8B 4GIFA 1KC8Q 1NAYA 4L76A 3RK3D 1PZQA 3WMM0 1J1EC 3AEGC 4C7RA 1CI6A 3TNUA 2C0XA 1M7LA 4U3FJ 4IOIH 1KYOE 1IFPA 5CCHA 1DEEG 3L36A 1VQNP 1R5SA 1EDLA 4N3YB 1EXIA 1RH5B 3MP7B 5AW7B 4CPGA 1WMKA 3UIAA 3CC7P 3I55P 3S9OA 2ZVOB 1HTLC 4GT1A 1HUCA 4H44D 2QM8A 2W27A 1T3UA 3BATA 2YO2A 1NVOA 1RF1C 1NU1G 1Y47A 3JCUH 1ZRTD 3CC4P 3A2AA 3KXDA 4H0LD 2IBZG 4JF7A 2JR8A 5AW2B 4N6JA 4TLFA 1S72P 5CCGA 4OWFA 2R5BA 5KAFH 4EOTA 1BCCD 1SQVD 1N8RQ 5AW4B 2JWAA 5GTHE 2L91A 3G9RA 3AE7C 2HPCA 1NTZE 1JO5A 4PV1B 5AW0B 1KV4A 5AVXB 3H25A 1DIPA 1FDIA 3AE2C 3CCRP 1AVOA 2O01H 2ZYAA 5AVRB 1NTKE 3O6QB 5B66E 3S4RA 2C9NY 1M1JA 2W6AA 1MFTA 5KKZC 1PGQA 5AW3B 2OQQA 3N7NA 2E74C 3II6A 4UB8H 1VQMP 1L0LG 4M3LA 1FC2C 2WSCJ 3KDPB 1FZGA 1LT9C 3CL3D 2WSCH 1GL2A 2ZJSE 2KYVA 1BCCJ 1SQVJ 3CCJP 2B89A 2QE7H 3L74D 2IDBA 3L73J 1JY3O 4IFFA 1YITP 3CWBE 1FBMA 2HR3A 3A0HE 1HGZA 5APTA 2WZ7A 3AE3C 4H13B 3H1KG 2IZ0A 2JEEA 1FAVA 4D6TE 1WRGA 1PL5A 2W6BA 4B86A 1VDFA 1NGMB 5GTIH 2OYIB 2YNYA 2NPSB 1ZMEC 1OMIA 2I1JA 3PH0A 2WT7B 2A06D 3RGUA 4WVZA 3E1IA 3LW5J 4L74A 3H1IG 3H32A 5L8RJ 3LW5H 3L74J 3C9IA 5AVYB 2M3EA 1SQQE 2OTJP 1JMMA 3HTKB 1BE3D 4DCKA 1R8EA 2KIKA 4IL6E 4AQRD 2C9LY 2M5AB 1S5LH 2FKWB 3BCCD 2O01N 1NU1J 3A0BH 3H1HD 4WBAA 4L75A 1RF1A 3WUUA 5KLVE 1HJBA 3AEFC 1RQVA 2AEFA 1URQB 1LTIC 1USDA 3MTUE 1S9KE 1Q7YQ 2FBWC 4OGQB 1PFIA 1EDIA 4PD4E 4AYCA 4GODA 2BCCG 1IFNA 2JWDA 4YPCA 1FZCB 5CHXA 3OJAB 1J2JB 1PGOA 1AJYA 4LGDE 1GTWA 4H0LB 3H1KD 3PLNA 1SQBE 3BCCJ 2H88C 3P7KA 1G2CB 3PJSK 1L0LJ 2OTKE 1MV8A 4QMAA 2ZT9C 3RL0D 3H1JD 3FX0A 3VP9A 1LTTC 1GU4A 2E43A 3CPWO 2PAJA 3RBZA 1KMIZ 2AEJA 4PV1C 1R5LA 1EZVE 3VOPA 1HGVA 1S5LX 1VQLP 5APWA 2I8DA 2WITA 4PJ0H 2FXMA 3L75D 3MHVA 1QLED 4K3AA 4YXWH 3H1KJ 2H43A 1KFNA 1FOSE 5EFWB 3QH9A 2WPRA 3GHGC 2WMMA 2P2UA 1HVVA 2JP3A 3TGUD 4W7ZA 5E79H 2B87B 4WY4D 3HD7B 2QSIA 2IZ1A 3GF7A 3G6EP 3CX5D 3H1IJ 1KILE 2PGDA 3N4XA 3VP8A 3G71P 2CPBA 3RBXA 2P67A 2M3BA 3D71A 2KOGA 2H89C 3R2PA 1LWUB 3T97B 3M91A 2QRXA 2QIWA 3SWYA 1ZLLA 2ZT9D 2G8YA 4PD4I 1IC2A 3L75J 2CK3H 1S1CX 1Q81Q 1FDMA 2QJPB 1FDOA 2KS1B 2Y0CA 3D6ZA 2OYIC 1YTZI 3PHLA 1AA0A 2NPSC 4PV1D 1SP4A 1RE3C 3R4YA 4Y99C 1NO4A 5APYA 1LJ2A 4U3FE 2QEXP 2PRRA 2V7QH 3CX5H 3L72D 1ZR2A 1CW5A 2L5GB 1Q90D 1JTHB 3GLMA 2OGUA 4JBZA 3IFMA 1YJNP 3OAKA 1PP9E 4TT3H 2LXBA 2YXRB 1KB9E 1VQ4P 3VMAA 1EZVI 1PV3A 3F5HA 1N73B 1KORA 3LIEA 1L0ND 2RN0A 1QVGO 3CI9A 3JCUE 4JQ0D 4BRYB 4DOJA 1L0NK 2BEQD 1JCCA 2IX7C 3RK3E 2XNXA 4BXLA 1URQC 1OWAA 4IL6X 3CXHD 3V2RA 1NTMD 2R3SA 4OGQC 4U7JA 1QX8A 3B8EB 1NTMK 5AVVB 1VQ6P 5B5EE 1FZCC 3L72J 4EYYQ 2YKOA 5C39A 2BEZF 2XU6A 2K37A 1YJWP 1QVFO 1BCCG 1SQVG 4H0LC 5TJHA 4AUWA 2VRSA 1E5WA 3O6QA 1H88A 2P10A 3L70E 5H2FH 2V4HA 2H8PD 4RESB 1MZ9A 1L0NJ 2R5DA 3RL0B 3CXHI 1M57D 4UB8E 1SQPE 1SQXE 4ZNCA 3CC2P 4K35A 1ZRTE 4HB1A 3B5NA 1YQ3C 3WU2E 2AXTH 3B71A 1PPJE 4Z1MH 2FYUE 2KNCB 3CXHH 3SWFA 1SQVE 3L35A 3VMXA 4BWNA 1JCDA 3KYQA 5AVZB 3V2NA 5CBOA 1HWTC 1URQD 3L73E 5CBNA 1L4AA 4HJGH 3L74G 5APQA 4OGQD 3USSA 4WY4B 3TDKA 5DJUB 1K04A 2XNDH 5KJ7D 1KQGB 1VQ5P 1JY2P 1LTJC 4HH2A 1S3JA 2OYIA 2POHA 3HD7C 2NPSA 3BRVB 2P58A 2WT7A 2AXCA 1E79H 1Q2NA 2YO3A 2ZT9B 1KQFB 2YIUB 1LWUC 2A06G 3HTKA 1OVVA 1K73Q 3OW2O 2ZXXA 5AVSB 5AVUB 2M5AA 2J58A 1JY2N 5TISH 2QJPC 4YXDC 2O01J 3MD0A 2KXPB 1BE3G 5KLIB 1NU1E 2DW3A 2N9BA 3A3YB 2HG5D 4OVNF 2IBZE 4UB6H 2GM4A 3BCCG 1IFJA 2IFNA 2KSEA 3H1HG 2IYOA 3GHGB 3F89A 3AEDC 2E76D 1VF5B 2YXQB 1N86A 1HJ0A 4DZOA 2LR2A 2OTLP 3FXDA 2K88A 3VYIA 1FZCA 1LT1A 1ZR4A 2FFDB 1HBWA 3HD7D 3KZIH 2Q9IA 1N7LA 2AEMA 1KYOI 1N73C 5APUA 1N7SD 3Q5RA 1J1DB 3MGNA 4NPEA 1G2CA 2Z5HA 1LP1B 2OYHC 3H6PA 1ZV8A 1DD3A 4W7YA 1GK4A 1BSHA 1DX7A 2O1JA 1L0LE 1JY2O 1LNQA 1ZW0A 1NTZD 3AE8C 2E5YA 2QJYC 2K9YA 1NTZK 3P8CD 4Y99B 3HE5A 3A5TA 4XA4A 3H1JG 3CCUP 1NTKK 2MKVA 3CCLP 2P1JA 3AE9C 2WWWA 4PJ0E 2PFXA 2KLVA 2K9JB 3IR9A 1FS0E 1MUUA 3RL0C 4OH8B 3H1KE 2Q3EA 3C1LA 3AE5C 3M0DC 3PP5A 3BASA 5E79E 3L75G 1WT6A 2B87A 1BDCA 1BGYG 5AW1B 2NZ2A 3FGAD 4EDFA 2B88A 4LC1A 1M56D 3CWBD 3TGUG 2O1KA 3RK2C 3H1IE 2JKVA 1RF0C 2N1TC 2ZXEB 3L71G 1LWUA 1NOHA 4N78D 3T97A 1PGJA 4D6TD 3CCQP 4HYTB 1X22A 4WY4C 2FYNC 1SS1A 4ASVA 4EIJA 1BE3J 3L75E 1U57A 3V5BA 3HUSB 4I1LA 2KZJA 2R3CA 1JM0A 1NKNA 3G4SP 2WVRA 1XTCC 2D2CC 3H1HJ 1FZFA 1Y8AA 1SQQD 2M0BA 2I1KA 1VQ8P 1SQQK 2P7JA 1OW7A 1Z56A 3PTZA 5KAIE 1U7MA 3M9QA 4JYCA 2YIUC 5BVZA 3EQ2A 1JTHA 1LT9A 1LTSC 3ITKA 1EDJA 3A0HH 2BCCE 2WPSA 3GW6A 1LTGC 5KLVD 1JOCA 4KT0J 2G3AA 2IYPA 5KLVK 3L72G 1N73A 3NXSA 5KLIC 1G1JA 1BDDA 3Q2YA 1IFIA 4BRYA 3RK2D 2QA4P 1S9KD 1M1KQ 1OZHA 5CJ4A 1BGYD 2E76B 3MUDC 2N1TD 2Q6QA 4PD4D 3TK1A 1L0NG 1IFDA 1SQQJ 2K1AA 4O9BA 1LTJB 1VF5C 1P84E 2WPVB 1KILC 1L2PA 2C0WA 3TF5A 1SQBD 3H1JJ 3L71D 1HH0A 4R4MA 1N7SB 1X9VA 4IL6H 1NHLA 1IO4A 1SQBK 2FFDC 1NTMG 3D70A 2D2CD 1J1DC 2N9YB 3VN0A 1KN7A 2ZVNB 3SSUA 3A7OA 1K9MQ 1YIJP 3U1CA 3W68A 1BGYJ 2A45I 3NMDA 5CCHC 2KZIA 2E75C 3M9BA 2FXPA 1EZVD 2AXTE 4W80A 2KNCA 3TGUJ 1OVRA 4MN4C 4PD4H 3ABVC 2A45H 3WUVA 1X8YA 1BSNA 3IF4A 2W8ZA 1KQSO 3L71J 2V7QJ 5AW9B 3Q3DA 3JSVC 1RF0A 1AFOA 2JJLA 3P32A 3EWKA 2FYZA 4I6MC 3HE4B 3V4WA 4WY4A 2HODB 1VF5D 1KILD 3AECC 5CCGC 1VQ9P 1PIXA 1YQ4C 3CCSP 2OYHB 4KHXA 1DH3A 3B4SA 4ZKUA 2Y9ZA 3SFDC 5KAFE 2Y0DA 3WUTA 5KJ7C 2QJYB 5CCHD 2E75D 2J59M 1ZOYC 4RKUJ 4DJGA 1KZUB 1QEXA 3CCVP 4JYBA 4U3FD 3HUSC 1Y9BA 1NYHA 1USEA 1VPCA 1GL2C 2WSSH 2NRGA 2ZFCA 4UB6E 3GHGA 1PP9D 3E1RA 3E7KA 2FXOA 4GKGA 1VQOP 1D7MA 3L4FA 2WSFJ 3FXEA 1KB9D 1A02F 3TYYA 1IJDB 1SVFA 1M8OB 2WSFH 1NTMJ 3EFGA 2OYOA 5CCGD 1AV1A 2LXCB 1NJIQ 2ITAA 2FFDA 1KD1Q 3H1LD 1UIXA 3RK2B 3CCEP 1BCCE 2YKQA 2B9BA 2R32A 2KUBA 5AW5B 4NPDA 2N1TB 5AVWB 4C46A 4I2LC 1EDKA 3M0AA 2E76C 2M8RA 1LP1A 3KHUA 2FYNB 3VMYA 2PP6A 1KB9I 1JY3P 1CSBA 5BU5A 1GK6A 1PP9J 5GTIE 3SWKA 1DD4A 4WB4A 1RE3A 2D2CB 5K5GB 1RHZB 1N7SC 1YYCA 1QL2A 3Q5SA 3L70D 3BVHA 4JPZB 1KB9H 2CPSA 1NTZG 1LTBC 1MFZA 1UIIA 1GL2D 2Q7CA 1KQLA 1OFCX 3H1LJ 1SQPD 2KLUA 1SQXD 4XFJA 2K9JA 1NTKG 2MJZA 3L74E 1SQPK 5APXA 1SQXK 3MZWB 1H0TB 1PPJD 2FYUD 1JY3N 1S5LE 1DEBA 5KTBA 1EQ7A 3Q5PA 1YTZT 2FYUK 3A0BE 3CMAP 1KYOD 1X0TA 5B5EH 1SQVK 1FZAA 2IPPA 5APSA 3M9HA 4GDOA 3L73D 2W83C 1URQA 2E5TA 2ZYGA 1KFMA 1FZBA 3V2PA 3AE6C 3L70J 2SPZA 3P8CE 1NKZB 2JO1A 2A06E 5KJ7A 3CWBG 4C7NB 2KSJA 3C8VA 1KILB 1FZEA 4XE5B 1SQPJ 1SQXJ 1SFCB 1GDTA 3BRTB 4DT0A 1W5CE 1RE4C 1YHQP 2GA1A 3KQGA 3MIWA 4D6TG 3HUSA 2FYUJ 3WU2H 1BE3E 1IFMA 3B5NB 2GUSA 1K05A 1CI6B 3TNUB 3BCCE 3H1HE 2QG4A 1KYOH 1RQUA 2HFED 1N2DC 2E75B 2RMZA 1QGKB 2Y9YA 4KJMA 1SQQG 5APVA 3IN6A 1L4AB 4GOFA 4Y28J 2W6JH 1NU1D 3AE1C 1NTKD 3Q1MA 3AEAC 1NU1K 4N78E 2IBZD 3AEEC 2FY8A 1JEKA 2H7HA 3VMZA 5KLVG 1FJPA 4I7ZC 1Q86Q 1M90Q 4HKZH 3S1KA 2WQYC 3W67A 1NWQA 1LTJA 1A02J 2Z5IA 2IFMA 5DJTB 3ZDMA 3HD7A 2E74D 3IAOA 3RK3B 2Q5UA 1NTZJ 1S2EA 1N7SA 5GTHH 2A45G 5CMZA 3H1JE 2IBZI 2HPCB 2HYNA 1W2BO 1NTKJ 1GMJA 1SQBG 3V6IA 1L0LD 2KP8A 1FOSF 1OIPA 5B66H 1QL1A 3K5BA 1M1JB 1JUNA 1L0LK 1G1IA 2Y0EA
chains in the Genus database with same CATH topology
2IBZI 3L71J 1BGYJ 1SQBJ 1BE3J 1SQQJ 1NU1J 1EZVI 1KYOI 1NTKJ 3CWBJ 1KB9I 3L70J 5KLVJ 2FYUJ 3H1LJ 2BCCJ 3L73J 3L74J 1PP9J 3BCCJ 3CX5I 3TGUJ 3H1HJ 1NTMJ 3H1KJ 4U3FJ 1P84I 3H1JJ 3H1IJ 1NTZJ 1L0NJ 3L72J 1SQPJ 1SQXJ 1BCCJ 1SQVJ 3CXHI 4PD4I 3L75J 4D6TJ 1L0LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ I;  3L71 J;  1BGY J;  1SQB J;  1BE3 J;  1SQQ J;  1NU1 J;  1EZV I;  1KYO I;  1NTK J;  3CWB J;  1KB9 I;  3L70 J;  5KLV J;  2FYU J;  3H1L J;  2BCC J;  3L73 J;  3L74 J;  1PP9 J;  3BCC J;  3CX5 I;  3TGU J;  3H1H J;  1NTM J;  3H1K J;  4U3F J;  1P84 I;  3H1J J;  3H1I J;  1NTZ J;  1L0N J;  3L72 J;  1SQP J;  1SQX J;  1BCC J;  1SQV J;  3CXH I;  4PD4 I;  3L75 J;  4D6T J;  1L0L J; 
#chains in the Genus database with same CATH topology
 1CZQ A;  2KS1 A;  3M06 A;  2KK7 A;  1BGY E;  1IZN B;  4H44 B;  3GF3 A;  3I56 P;  2JDI H;  1GL2 B;  1AVY A;  3TGU E;  3NFQ A;  4R4L A;  3KPE A;  1EZV G;  3EFF K;  1T6A A;  3CWB J;  3L71 E;  1IK9 A;  3CX5 E;  2XKM A;  2QJK B;  3HE4 A;  1HF9 A;  2K3R A;  2HOD A;  2W90 A;  4D6T J;  5CJ0 A;  1RE4 A;  1U7J A;  2BAS A;  1FJK A;  3H1I D;  1J1E B;  4ZKP A;  3OA7 A;  2YKP A;  1OXZ A;  2OAR A;  2R44 A;  2GUV A;  2QM7 A;  5AVQ B;  2OYH A;  3HE5 B;  1GW4 A;  4IFD K;  2KI7 B;  3H32 B;  1PGP A;  2RH0 A;  2UWJ E;  4L73 A;  1OW8 A;  1KTM A;  1H8A A;  3CD6 P;  3SFE C;  1IK7 A;  1SFC C;  3LID A;  1W2E A;  1OVU A;  3L72 E;  2WPQ A;  1GU5 A;  2WSE J;  5KLV J;  3RL0 g;  3AEB C;  3B5N C;  1FU1 A;  1EXJ A;  2WSE H;  1VQK P;  1JMB A;  1RF1 B;  5H2F E;  2XDJ A;  2Q1K A;  3I5C A;  3D6Y A;  3V4Q A;  2RKL A;  2BCC D;  4U3F G;  4RJT A;  1L0N E;  1EC5 A;  3M0D A;  1GZL A;  1SLQ A;  1OX3 A;  1TU3 F;  4ASW A;  4IFM A;  2LKM A;  1VQ7 P;  2YMY A;  3P8M C;  3CCM P;  1L4A C;  1RY3 A;  3CXH E;  3CLQ A;  1PP9 G;  1GW3 A;  4H13 C;  1NTM E;  2QVA A;  1NH4 A;  1SQB J;  3U59 A;  3JC2 2;  4A7P A;  2N1T A;  3V2Q A;  3CX5 I;  2Z4E A;  4ZMD A;  3QWO C;  3H1L G;  1S4X A;  1P84 D;  5KKZ B;  5BU8 B;  4RO0 A;  4EI2 A;  1LTA C;  2E74 B;  1X79 B;  5KAI H;  1H89 A;  2Q3I A;  3PRJ A;  1MKM A;  2BCC J;  3CME P;  4NPF X;  1LGH B;  1T2K C;  1SFC D;  1LT9 B;  3HRN A;  1FE6 A;  3RK3 C;  3GG2 A;  2HLO A;  4LLH A;  3B5N D;  2O3J A;  4YTP C;  2ZYD A;  3FWL A;  1ZXG A;  3O8Z A;  1YBK A;  3U1A A;  2E42 A;  3H1L E;  1AQT A;  3L70 G;  1M1J C;  1P84 I;  1H0T A;  4GOE A;  1YJ9 P;  4WWI A;  3VTP C;  3AE4 C;  2J5U A;  5TIS E;  1SQP G;  1SQX G;  1L4A D;  1K8A Q;  1P84 H;  4H44 C;  4H13 D;  1VQP P;  1JB0 J;  1PPJ G;  2FYU G;  1XTG B;  4I7Z B;  5AW6 B;  2XZR A;  3MUD A;  2KB7 P;  2NPS D;  1NAF A;  1JNM A;  5AVT B;  2ZAE B;  1T3J A;  3NTN A;  3GMA A;  2YMK A;  2QJK C;  3TSI A;  4C7N A;  2WTY A;  3L37 A;  1KIL A;  1YI2 P;  1VL2 A;  1ZP0 C;  3G3Z A;  3L73 G;  3FWN A;  1SFC A;  1ZN5 A;  5M1B A;  1T8Z A;  1Q82 Q;  1OW6 A;  1T2K D;  2XV5 A;  1AQ5 A;  1GD2 E;  3KZI E;  5AW8 B;  4GIF A;  1KC8 Q;  1NAY A;  4L76 A;  3RK3 D;  1PZQ A;  3WMM 0;  1J1E C;  3AEG C;  4C7R A;  1CI6 A;  3TNU A;  2C0X A;  1M7L A;  4U3F J;  4IOI H;  1KYO E;  1IFP A;  5CCH A;  1DEE G;  3L36 A;  1VQN P;  1R5S A;  1EDL A;  4N3Y B;  1EXI A;  1RH5 B;  3MP7 B;  5AW7 B;  4CPG A;  1WMK A;  3UIA A;  3CC7 P;  3I55 P;  3S9O A;  2ZVO B;  1HTL C;  4GT1 A;  1HUC A;  4H44 D;  2QM8 A;  2W27 A;  1T3U A;  3BAT A;  2YO2 A;  1NVO A;  1RF1 C;  1NU1 G;  1Y47 A;  3JCU H;  1ZRT D;  3CC4 P;  3A2A A;  3KXD A;  4H0L D;  2IBZ G;  4JF7 A;  2JR8 A;  5AW2 B;  4N6J A;  4TLF A;  1S72 P;  5CCG A;  4OWF A;  2R5B A;  5KAF H;  4EOT A;  1BCC D;  1SQV D;  1N8R Q;  5AW4 B;  2JWA A;  5GTH E;  2L91 A;  3G9R A;  3AE7 C;  2HPC A;  1NTZ E;  1JO5 A;  4PV1 B;  5AW0 B;  1KV4 A;  5AVX B;  3H25 A;  1DIP A;  1FDI A;  3AE2 C;  3CCR P;  1AVO A;  2O01 H;  2ZYA A;  5AVR B;  1NTK E;  3O6Q B;  5B66 E;  3S4R A;  2C9N Y;  1M1J A;  2W6A A;  1MFT A;  5KKZ C;  1PGQ A;  5AW3 B;  2OQQ A;  3N7N A;  2E74 C;  3II6 A;  4UB8 H;  1VQM P;  1L0L G;  4M3L A;  1FC2 C;  2WSC J;  3KDP B;  1FZG A;  1LT9 C;  3CL3 D;  2WSC H;  1GL2 A;  2ZJS E;  2KYV A;  1BCC J;  1SQV J;  3CCJ P;  2B89 A;  2QE7 H;  3L74 D;  2IDB A;  3L73 J;  1JY3 O;  4IFF A;  1YIT P;  3CWB E;  1FBM A;  2HR3 A;  3A0H E;  1HGZ A;  5APT A;  2WZ7 A;  3AE3 C;  4H13 B;  3H1K G;  2IZ0 A;  2JEE A;  1FAV A;  4D6T E;  1WRG A;  1PL5 A;  2W6B A;  4B86 A;  1VDF A;  1NGM B;  5GTI H;  2OYI B;  2YNY A;  2NPS B;  1ZME C;  1OMI A;  2I1J A;  3PH0 A;  2WT7 B;  2A06 D;  3RGU A;  4WVZ A;  3E1I A;  3LW5 J;  4L74 A;  3H1I G;  3H32 A;  5L8R J;  3LW5 H;  3L74 J;  3C9I A;  5AVY B;  2M3E A;  1SQQ E;  2OTJ P;  1JMM A;  3HTK B;  1BE3 D;  4DCK A;  1R8E A;  2KIK A;  4IL6 E;  4AQR D;  2C9L Y;  2M5A B;  1S5L H;  2FKW B;  3BCC D;  2O01 N;  1NU1 J;  3A0B H;  3H1H D;  4WBA A;  4L75 A;  1RF1 A;  3WUU A;  5KLV E;  1HJB A;  3AEF C;  1RQV A;  2AEF A;  1URQ B;  1LTI C;  1USD A;  3MTU E;  1S9K E;  1Q7Y Q;  2FBW C;  4OGQ B;  1PFI A;  1EDI A;  4PD4 E;  4AYC A;  4GOD A;  2BCC G;  1IFN A;  2JWD A;  4YPC A;  1FZC B;  5CHX A;  3OJA B;  1J2J B;  1PGO A;  1AJY A;  4LGD E;  1GTW A;  4H0L B;  3H1K D;  3PLN A;  1SQB E;  3BCC J;  2H88 C;  3P7K A;  1G2C B;  3PJS K;  1L0L J;  2OTK E;  1MV8 A;  4QMA A;  2ZT9 C;  3RL0 D;  3H1J D;  3FX0 A;  3VP9 A;  1LTT C;  1GU4 A;  2E43 A;  3CPW O;  2PAJ A;  3RBZ A;  1KMI Z;  2AEJ A;  4PV1 C;  1R5L A;  1EZV E;  3VOP A;  1HGV A;  1S5L X;  1VQL P;  5APW A;  2I8D A;  2WIT A;  4PJ0 H;  2FXM A;  3L75 D;  3MHV A;  1QLE D;  4K3A A;  4YXW H;  3H1K J;  2H43 A;  1KFN A;  1FOS E;  5EFW B;  3QH9 A;  2WPR A;  3GHG C;  2WMM A;  2P2U A;  1HVV A;  2JP3 A;  3TGU D;  4W7Z A;  5E79 H;  2B87 B;  4WY4 D;  3HD7 B;  2QSI A;  2IZ1 A;  3GF7 A;  3G6E P;  3CX5 D;  3H1I J;  1KIL E;  2PGD A;  3N4X A;  3VP8 A;  3G71 P;  2CPB A;  3RBX A;  2P67 A;  2M3B A;  3D71 A;  2KOG A;  2H89 C;  3R2P A;  1LWU B;  3T97 B;  3M91 A;  2QRX A;  2QIW A;  3SWY A;  1ZLL A;  2ZT9 D;  2G8Y A;  4PD4 I;  1IC2 A;  3L75 J;  2CK3 H;  1S1C X;  1Q81 Q;  1FDM A;  2QJP B;  1FDO A;  2KS1 B;  2Y0C A;  3D6Z A;  2OYI C;  1YTZ I;  3PHL A;  1AA0 A;  2NPS C;  4PV1 D;  1SP4 A;  1RE3 C;  3R4Y A;  4Y99 C;  1NO4 A;  5APY A;  1LJ2 A;  4U3F E;  2QEX P;  2PRR A;  2V7Q H;  3CX5 H;  3L72 D;  1ZR2 A;  1CW5 A;  2L5G B;  1Q90 D;  1JTH B;  3GLM A;  2OGU A;  4JBZ A;  3IFM A;  1YJN P;  3OAK A;  1PP9 E;  4TT3 H;  2LXB A;  2YXR B;  1KB9 E;  1VQ4 P;  3VMA A;  1EZV I;  1PV3 A;  3F5H A;  1N73 B;  1KOR A;  3LIE A;  1L0N D;  2RN0 A;  1QVG O;  3CI9 A;  3JCU E;  4JQ0 D;  4BRY B;  4DOJ A;  1L0N K;  2BEQ D;  1JCC A;  2IX7 C;  3RK3 E;  2XNX A;  4BXL A;  1URQ C;  1OWA A;  4IL6 X;  3CXH D;  3V2R A;  1NTM D;  2R3S A;  4OGQ C;  4U7J A;  1QX8 A;  3B8E B;  1NTM K;  5AVV B;  1VQ6 P;  5B5E E;  1FZC C;  3L72 J;  4EYY Q;  2YKO A;  5C39 A;  2BEZ F;  2XU6 A;  2K37 A;  1YJW P;  1QVF O;  1BCC G;  1SQV G;  4H0L C;  5TJH A;  4AUW A;  2VRS A;  1E5W A;  3O6Q A;  1H88 A;  2P10 A;  3L70 E;  5H2F H;  2V4H A;  2H8P D;  4RES B;  1MZ9 A;  1L0N J;  2R5D A;  3RL0 B;  3CXH I;  1M57 D;  4UB8 E;  1SQP E;  1SQX E;  4ZNC A;  3CC2 P;  4K35 A;  1ZRT E;  4HB1 A;  3B5N A;  1YQ3 C;  3WU2 E;  2AXT H;  3B71 A;  1PPJ E;  4Z1M H;  2FYU E;  2KNC B;  3CXH H;  3SWF A;  1SQV E;  3L35 A;  3VMX A;  4BWN A;  1JCD A;  3KYQ A;  5AVZ B;  3V2N A;  5CBO A;  1HWT C;  1URQ D;  3L73 E;  5CBN A;  1L4A A;  4HJG H;  3L74 G;  5APQ A;  4OGQ D;  3USS A;  4WY4 B;  3TDK A;  5DJU B;  1K04 A;  2XND H;  5KJ7 D;  1KQG B;  1VQ5 P;  1JY2 P;  1LTJ C;  4HH2 A;  1S3J A;  2OYI A;  2POH A;  3HD7 C;  2NPS A;  3BRV B;  2P58 A;  2WT7 A;  2AXC A;  1E79 H;  1Q2N A;  2YO3 A;  2ZT9 B;  1KQF B;  2YIU B;  1LWU C;  2A06 G;  3HTK A;  1OVV A;  1K73 Q;  3OW2 O;  2ZXX A;  5AVS B;  5AVU B;  2M5A A;  2J58 A;  1JY2 N;  5TIS H;  2QJP C;  4YXD C;  2O01 J;  3MD0 A;  2KXP B;  1BE3 G;  5KLI B;  1NU1 E;  2DW3 A;  2N9B A;  3A3Y B;  2HG5 D;  4OVN F;  2IBZ E;  4UB6 H;  2GM4 A;  3BCC G;  1IFJ A;  2IFN A;  2KSE A;  3H1H G;  2IYO A;  3GHG B;  3F89 A;  3AED C;  2E76 D;  1VF5 B;  2YXQ B;  1N86 A;  1HJ0 A;  4DZO A;  2LR2 A;  2OTL P;  3FXD A;  2K88 A;  3VYI A;  1FZC A;  1LT1 A;  1ZR4 A;  2FFD B;  1HBW A;  3HD7 D;  3KZI H;  2Q9I A;  1N7L A;  2AEM A;  1KYO I;  1N73 C;  5APU A;  1N7S D;  3Q5R A;  1J1D B;  3MGN A;  4NPE A;  1G2C A;  2Z5H A;  1LP1 B;  2OYH C;  3H6P A;  1ZV8 A;  1DD3 A;  4W7Y A;  1GK4 A;  1BSH A;  1DX7 A;  2O1J A;  1L0L E;  1JY2 O;  1LNQ A;  1ZW0 A;  1NTZ D;  3AE8 C;  2E5Y A;  2QJY C;  2K9Y A;  1NTZ K;  3P8C D;  4Y99 B;  3HE5 A;  3A5T A;  4XA4 A;  3H1J G;  3CCU P;  1NTK K;  2MKV A;  3CCL P;  2P1J A;  3AE9 C;  2WWW A;  4PJ0 E;  2PFX A;  2KLV A;  2K9J B;  3IR9 A;  1FS0 E;  1MUU A;  3RL0 C;  4OH8 B;  3H1K E;  2Q3E A;  3C1L A;  3AE5 C;  3M0D C;  3PP5 A;  3BAS A;  5E79 E;  3L75 G;  1WT6 A;  2B87 A;  1BDC A;  1BGY G;  5AW1 B;  2NZ2 A;  3FGA D;  4EDF A;  2B88 A;  4LC1 A;  1M56 D;  3CWB D;  3TGU G;  2O1K A;  3RK2 C;  3H1I E;  2JKV A;  1RF0 C;  2N1T C;  2ZXE B;  3L71 G;  1LWU A;  1NOH A;  4N78 D;  3T97 A;  1PGJ A;  4D6T D;  3CCQ P;  4HYT B;  1X22 A;  4WY4 C;  2FYN C;  1SS1 A;  4ASV A;  4EIJ A;  1BE3 J;  3L75 E;  1U57 A;  3V5B A;  3HUS B;  4I1L A;  2KZJ A;  2R3C A;  1JM0 A;  1NKN A;  3G4S P;  2WVR A;  1XTC C;  2D2C C;  3H1H J;  1FZF A;  1Y8A A;  1SQQ D;  2M0B A;  2I1K A;  1VQ8 P;  1SQQ K;  2P7J A;  1OW7 A;  1Z56 A;  3PTZ A;  5KAI E;  1U7M A;  3M9Q A;  4JYC A;  2YIU C;  5BVZ A;  3EQ2 A;  1JTH A;  1LT9 A;  1LTS C;  3ITK A;  1EDJ A;  3A0H H;  2BCC E;  2WPS A;  3GW6 A;  1LTG C;  5KLV D;  1JOC A;  4KT0 J;  2G3A A;  2IYP A;  5KLV K;  3L72 G;  1N73 A;  3NXS A;  5KLI C;  1G1J A;  1BDD A;  3Q2Y A;  1IFI A;  4BRY A;  3RK2 D;  2QA4 P;  1S9K D;  1M1K Q;  1OZH A;  5CJ4 A;  1BGY D;  2E76 B;  3MUD C;  2N1T D;  2Q6Q A;  4PD4 D;  3TK1 A;  1L0N G;  1IFD A;  1SQQ J;  2K1A A;  4O9B A;  1LTJ B;  1VF5 C;  1P84 E;  2WPV B;  1KIL C;  1L2P A;  2C0W A;  3TF5 A;  1SQB D;  3H1J J;  3L71 D;  1HH0 A;  4R4M A;  1N7S B;  1X9V A;  4IL6 H;  1NHL A;  1IO4 A;  1SQB K;  2FFD C;  1NTM G;  3D70 A;  2D2C D;  1J1D C;  2N9Y B;  3VN0 A;  1KN7 A;  2ZVN B;  3SSU A;  3A7O A;  1K9M Q;  1YIJ P;  3U1C A;  3W68 A;  1BGY J;  2A45 I;  3NMD A;  5CCH C;  2KZI A;  2E75 C;  3M9B A;  2FXP A;  1EZV D;  2AXT E;  4W80 A;  2KNC A;  3TGU J;  1OVR A;  4MN4 C;  4PD4 H;  3ABV C;  2A45 H;  3WUV A;  1X8Y A;  1BSN A;  3IF4 A;  2W8Z A;  1KQS O;  3L71 J;  2V7Q J;  5AW9 B;  3Q3D A;  3JSV C;  1RF0 A;  1AFO A;  2JJL A;  3P32 A;  3EWK A;  2FYZ A;  4I6M C;  3HE4 B;  3V4W A;  4WY4 A;  2HOD B;  1VF5 D;  1KIL D;  3AEC C;  5CCG C;  1VQ9 P;  1PIX A;  1YQ4 C;  3CCS P;  2OYH B;  4KHX A;  1DH3 A;  3B4S A;  4ZKU A;  2Y9Z A;  3SFD C;  5KAF E;  2Y0D A;  3WUT A;  5KJ7 C;  2QJY B;  5CCH D;  2E75 D;  2J59 M;  1ZOY C;  4RKU J;  4DJG A;  1KZU B;  1QEX A;  3CCV P;  4JYB A;  4U3F D;  3HUS C;  1Y9B A;  1NYH A;  1USE A;  1VPC A;  1GL2 C;  2WSS H;  2NRG A;  2ZFC A;  4UB6 E;  3GHG A;  1PP9 D;  3E1R A;  3E7K A;  2FXO A;  4GKG A;  1VQO P;  1D7M A;  3L4F A;  2WSF J;  3FXE A;  1KB9 D;  1A02 F;  3TYY A;  1IJD B;  1SVF A;  1M8O B;  2WSF H;  1NTM J;  3EFG A;  2OYO A;  5CCG D;  1AV1 A;  2LXC B;  1NJI Q;  2ITA A;  2FFD A;  1KD1 Q;  3H1L D;  1UIX A;  3RK2 B;  3CCE P;  1BCC E;  2YKQ A;  2B9B A;  2R32 A;  2KUB A;  5AW5 B;  4NPD A;  2N1T B;  5AVW B;  4C46 A;  4I2L C;  1EDK A;  3M0A A;  2E76 C;  2M8R A;  1LP1 A;  3KHU A;  2FYN B;  3VMY A;  2PP6 A;  1KB9 I;  1JY3 P;  1CSB A;  5BU5 A;  1GK6 A;  1PP9 J;  5GTI E;  3SWK A;  1DD4 A;  4WB4 A;  1RE3 A;  2D2C B;  5K5G B;  1RHZ B;  1N7S C;  1YYC A;  1QL2 A;  3Q5S A;  3L70 D;  3BVH A;  4JPZ B;  1KB9 H;  2CPS A;  1NTZ G;  1LTB C;  1MFZ A;  1UII A;  1GL2 D;  2Q7C A;  1KQL A;  1OFC X;  3H1L J;  1SQP D;  2KLU A;  1SQX D;  4XFJ A;  2K9J A;  1NTK G;  2MJZ A;  3L74 E;  1SQP K;  5APX A;  1SQX K;  3MZW B;  1H0T B;  1PPJ D;  2FYU D;  1JY3 N;  1S5L E;  1DEB A;  5KTB A;  1EQ7 A;  3Q5P A;  1YTZ T;  2FYU K;  3A0B E;  3CMA P;  1KYO D;  1X0T A;  5B5E H;  1SQV K;  1FZA A;  2IPP A;  5APS A;  3M9H A;  4GDO A;  3L73 D;  2W83 C;  1URQ A;  2E5T A;  2ZYG A;  1KFM A;  1FZB A;  3V2P A;  3AE6 C;  3L70 J;  2SPZ A;  3P8C E;  1NKZ B;  2JO1 A;  2A06 E;  5KJ7 A;  3CWB G;  4C7N B;  2KSJ A;  3C8V A;  1KIL B;  1FZE A;  4XE5 B;  1SQP J;  1SQX J;  1SFC B;  1GDT A;  3BRT B;  4DT0 A;  1W5C E;  1RE4 C;  1YHQ P;  2GA1 A;  3KQG A;  3MIW A;  4D6T G;  3HUS A;  2FYU J;  3WU2 H;  1BE3 E;  1IFM A;  3B5N B;  2GUS A;  1K05 A;  1CI6 B;  3TNU B;  3BCC E;  3H1H E;  2QG4 A;  1KYO H;  1RQU A;  2HFE D;  1N2D C;  2E75 B;  2RMZ A;  1QGK B;  2Y9Y A;  4KJM A;  1SQQ G;  5APV A;  3IN6 A;  1L4A B;  4GOF A;  4Y28 J;  2W6J H;  1NU1 D;  3AE1 C;  1NTK D;  3Q1M A;  3AEA C;  1NU1 K;  4N78 E;  2IBZ D;  3AEE C;  2FY8 A;  1JEK A;  2H7H A;  3VMZ A;  5KLV G;  1FJP A;  4I7Z C;  1Q86 Q;  1M90 Q;  4HKZ H;  3S1K A;  2WQY C;  3W67 A;  1NWQ A;  1LTJ A;  1A02 J;  2Z5I A;  2IFM A;  5DJT B;  3ZDM A;  3HD7 A;  2E74 D;  3IAO A;  3RK3 B;  2Q5U A;  1NTZ J;  1S2E A;  1N7S A;  5GTH H;  2A45 G;  5CMZ A;  3H1J E;  2IBZ I;  2HPC B;  2HYN A;  1W2B O;  1NTK J;  1GMJ A;  1SQB G;  3V6I A;  1L0L D;  2KP8 A;  1FOS F;  1OIP A;  5B66 H;  1QL1 A;  3K5B A;  1M1J B;  1JUN A;  1L0L K;  1G1I A;  2Y0E A; 
#chains in the Genus database with same CATH homology
 2IBZ I;  3L71 J;  1BGY J;  1SQB J;  1BE3 J;  1SQQ J;  1NU1 J;  1EZV I;  1KYO I;  1NTK J;  3CWB J;  1KB9 I;  3L70 J;  5KLV J;  2FYU J;  3H1L J;  2BCC J;  3L73 J;  3L74 J;  1PP9 J;  3BCC J;  3CX5 I;  3TGU J;  3H1H J;  1NTM J;  3H1K J;  4U3F J;  1P84 I;  3H1J J;  3H1I J;  1NTZ J;  1L0N J;  3L72 J;  1SQP J;  1SQX J;  1BCC J;  1SQV J;  3CXH I;  4PD4 I;  3L75 J;  4D6T J;  1L0L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...