1ZLLA

Nmr structure of unphosphorylated human phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/signaling protein
molecule keywords Cardiac phospholamban
publication title The structure of phospholamban pentamer reveals a channel-like architecture in membranes
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zllA00
2KYVA 1FJPA 2HYNA 2KB7P 1FJKA 1ZLLA 2M3BA 1N7LA
chains in the Genus database with same CATH superfamily
4N78E 5AVTB 4U3FJ 2N1TA 1SQQD 3A2AA 1SQBG 2OTJP 3V2NA 5B66H 1IFPA 3M06A 1HGZA 3TNUB 3TGUE 1L0NG 1FZGA 5AW3B 2C0WA 2R3CA 1R8EA 1AA0A 3LW5J 2ZYAA 4D6TJ 3CCMP 1M1JC 2ZVNB 1LTAC 2RMZA 4Y99C 1P84E 1RF0A 1WRGA 2WSFH 3M0DA 5H2FH 1EDIA 3L37A 3Q5PA 3MD0A 1ZR2A 3LIEA 1N8RQ 2NPSB 1YIJP 2QJKB 3FX0A 3RK2B 3L71G 2D2CD 3GLMA 3O6QB 2YO2A 4LLHA 1X0TA 3GHGC 2P67A 3V6IA 1H8AA 1SQBK 2Y9ZA 1RE4A 3CX5D 2H43A 1L0NK 5E79H 3MTUE 2ZT9C 4RO0A 4BWNA 1PPJE 3SWKA 3L72D 5AW6B 2ZXEB 5KAIE 3CXHE 2Y0DA 3MP7B 1X22A 1YHQP 5KLVG 1T3UA 1CSBA 1ZLLA 3D6YA 1QEXA 2M3EA 1SQBD 1VQ7P 2GA1A 1J1EB 1HGVA 3H1JE 3G71P 1OX3A 4XA4A 2B89A 4KJMA 3F89A 1MKMA 1GW4A 1BSNA 3BCCE 1PGQA 2E76B 1BCCG 1JCDA 1UIIA 2GUVA 1G1IA 1KILA 3JC22 5AVZB 2ZT9D 1BDCA 1NH4A 4Y28J 2JDIH 2QM7A 5AW8B 1CI6A 3M0AA 2M8RA 3RL0B 3I5CA 2WSEH 1OVUA 3H1JJ 1SQQE 1WT6A 1SQXK 1KB9I 1M7LA 1NHLA 3E7KA 2WSFJ 2V7QH 1MV8A 4UB8E 2E75C 1TU3F 3L4FA 3B5NC 2D2CB 5BU5A 2P7JA 2HFED 1PL5A 3V4QA 5APXA 2QJPB 4NPFX 2ZYDA 1S72P 1SQXD 3PRJA 2YIUB 3L70J 1DD3A 3K5BA 4GODA 1QVGO 1HVVA 1JUNA 1EXJA 1LWUB 1M1JB 2JEEA 3ABVC 4Y99B 2YXQB 4HJGH 3CX5E 4I7ZC 2HR3A 1L0LK 1NTMJ 5APTA 3WMM0 4JYCA 3SWYA 2B87A 2E5TA 3B5ND 3L72E 1GD2E 1QL2A 4NPEA 2BCCG 1JM0A 3H1KG 4TT3H 5KAFE 4PJ0H 5AW9B 2E5YA 1XTCC 2UWJE 1L4AC 1KYOE 1AQ5A 2PRRA 3OW2O 3VTPC 3Q3DA 1S5LE 1NTKK 1CZQA 1USEA 2IDBA 1SQBE 1W2EA 5KTBA 3KDPB 1NO4A 1PP9G 2KLUA 2GUSA 2E74D 1L0LD 2KLVA 3B4SA 3A0HH 1JY2P 3SWFA 3CMAP 2WPQA 3H1HJ 1GDTA 4JF7A 3I55P 4JBZA 2AXCA 4L76A 3HE4A 5KKZB 2P58A 2WSEJ 3C9IA 1H0TB 5APYA 4HYTB 1NTKD 3L35A 3CC2P 2OYIC 1JY3N 1EDLA 1L4AD 2QSIA 1QX8A 2Q9IA 2V7QJ 3L71E 3USSA 1L0NJ 1N86A 1NJIQ 1PPJG 2P1JA 1JY3P 2OYOA 1URQB 1AVYA 4EOTA 2I1KA 5APQA 2WQYC 4MN4C 2HPCB 1HF9A 2FXMA 2QEXP 2A06D 3IN6A 3H25A 3AE8C 1DEBA 3R2PA 4WY4C 4KT0J 1OW7A 5B5EH 1N73A 1JEKA 3L71J 3CPWO 1SQXE 2N1TC 2YMKA 1PP9D 2WITA 5AVRB 2I1JA 1J2JB 2W83C 2OYHB 3B5NB 1NWQA 4IL6E 1RY3A 2WTYA 2KSEA 3BCCG 4N6JA 4PD4I 3H1IG 1OWAA 1YTZT 4C7NA 2XV5A 5EFWB 1LTJC 3AE6C 3L36A 2W27A 1RF0C 1M90Q 3M0DC 1MFTA 2E74B 4PV1D 5KLVJ 4DOJA 1N7SA 1LP1B 1SQQG 4W7YA 4EI2A 4WY4D 2KYVA 2IBZI 3KXDA 3AE4C 2FYUK 2FFDB 1GU4A 1RE4C 1L0LE 3AECC 3AEDC 1SQVK 4U7JA 1RE3C 1L4AB 2XNDH 1BCCJ 1HTLC 4K35A 5GTIE 4H0LC 1VQKP 1G2CA 3HUSC 1P84H 1VQ5P 1NTKE 1LJ2A 1LT9A 3O8ZA 3UIAA 2FYUD 3EQ2A 1FOSF 2R5BA 4AYCA 1ZR4A 2M3BA 3CCUP 1SQVD 3AE1C 4N3YB 3H32A 1NKNA 5KJ7A 2KUBA 3P7KA 1OXZA 3AEGC 3L72G 1YJ9P 3RBZA 2IX7C 4H13C 2OYIB 3TNUA 3MUDC 5DJUB 3TDKA 1FZCC 1K9MQ 5KAIH 3VMXA 1ZV8A 3CXHH 1FJPA 4H0LD 1N2DC 3MZWB 1NTZD 2N9YB 3H1LJ 3VP8A 1S9KD 2K9YA 1NKZB 4WVZA 3PH0A 5AVVB 1R5LA 1LGHB 4GKGA 2QJYB 1PP9E 2NPSA 4PV1B 3SSUA 1D7MA 3LIDA 1JTHB 3O6QA 5CCGA 1FDIA 3D6ZA 2Z5HA 2Q3IA 5CCHA 3HE5A 4JYBA 4RESB 2BCCJ 3H1KJ 4H13D 3VMAA 4PD4D 2POHA 2QM8A 1KC8Q 3V5BA 1IJDB 2A45H 3G3ZA 3M91A 2W6AA 3TGUJ 3HE5B 1KORA 2JP3A 2WT7B 3HRNA 1DD4A 2M5AB 1LTJB 3KHUA 1QGKB 4L75A 2OTLP 2C0XA 3ITKA 2O01N 4UB8H 3NMDA 4EDFA 1FZAA 2HYNA 1FDMA 2Q5UA 2AXTE 1S5LX 3W67A 3CWBD 2HLOA 1SQXG 4C46A 1GU5A 1Z56A 3R4YA 3T97B 4W7ZA 4WWIA 1VQPP 1EXIA 1IFNA 2FYUE 1JO5A 4OGQB 2LXCB 3M9HA 1S4XA 1N7LA 4H0LB 1SQVE 2KNCB 3V4WA 2KZJA 3H1IE 4EIJA 1RQUA 3HUSB 5BU8B 2G3AA 3HD7C 2MKVA 3NXSA 3G6EP 1T2KC 3CX5H 1GW3A 3VMYA 3L74D 4DT0A 1YQ4C 1HH0A 2ZFCA 4IFDK 2QA4P 5KAFH 1NTZE 1KYOH 1S9KE 3IFMA 4UB6E 3L75G 3CCRP 3MHVA 2IZ1A 3CCSP 1KV4A 1S5LH 2PAJA 1L0LG 4H13B 5CBOA 1NAYA 1RF1B 3BCCJ 4YXDC 2K9JA 1NU1K 1KZUB 1NAFA 3H1IJ 2ITAA 4AQRD 4H44C 3P8MC 1LWUA 2CPSA 3B8EB 1Q86Q 1M1JA 4DCKA 1MFZA 3II6A 1AQTA 3HD7D 1VQ4P 4C7RA 1EZVI 1IK7A 1NTKG 2K9JB 4PD4E 1ZP0C 2Z5IA 1SQQJ 1JOCA 1FE6A 5CJ0A 1EC5A 2H89C 3AE5C 1EDKA 3MIWA 2KOGA 1NU1D 2K88A 3RK3C 3W68A 4GT1A 3GMAA 3U1CA 1H88A 3H6PA 3PP5A 1JCCA 1KQLA 2KB7P 2KIKA 3SFDC 2E75D 2H88C 2R5DA 1RHZB 2PGDA 3CC7P 3L73D 4H44D 3GHGB 4O9BA 2IPPA 4W80A 1Q82Q 3AEFC 3KZIE 4BRYB 2A06G 3CC4P 2BASA 1DEEG 2CK3H 1VF5C 5AVXB 1ZRTD 3CWBE 2ZT9B 3L75D 1N7SC 1H0TA 3PHLA 3CXHI 1BGYD 1SQPD 4IL6H 3EWKA 2FYNC 3Q5RA 3L72J 2SPZA 1GL2C 3OAKA 1SFCC 1VPCA 1JY2O 3IF4A 1Y9BA 1PGPA 5CMZA 3Q5SA 3BATA 1URQA 2H7HA 2KS1B 2O01H 5APWA 1YJNP 1EQ7A 1IC2A 1BE3D 1GTWA 3OJAB 3C8VA 1SQBJ 3NFQA 2HPCA 2KXPB 1LTGC 2DW3A 4U3FD 3AE2C 1VF5D 1ZW0A 1LT9C 2YKOA 1OIPA 1N7SD 1VQ8P 3HD7B 1EDJA 1GK4A 2B88A 1KFMA 2J58A 2A45I 2ZVOB 2ZAEB 4XE5B 1KB9D 1OFCX 3ZDMA 2OQQA 4D6TD 2OYHA 3B5NA 4L74A 3G9RA 4ZMDA 1GL2D 1SFCD 1FU1A 2W6JH 3WU2E 5GTIH 2FBWC 1ZXGA 1U57A 2E75B 2L91A 2WPSA 2KI7B 1X8YA 3NTNA 3HTKB 1YI2P 2FYUG 1A02J 2K3RA 2FKWB 2O1JA 2K1AA 2YXRB 1EZVD 4H44B 3FWNA 3EFGA 1SQVG 2Z4EA 1NU1E 3JSVC 2WVRA 1LP1A 5CJ4A 1U7JA 3AE9C 5CBNA 2NPSC 3RK2C 1OW8A 5CCGC 2FYZA 3A5TA 2YNYA 3FXDA 1QL1A 2FFDA 3L73E 1E5WA 5AW5B 3F5HA 4DJGA 1NTZG 1JNMA 1L4AA 2LKMA 1M1KQ 3BRVB 5AW7B 1SQXJ 3VN0A 4I7ZB 1KN7A 2G8YA 2FY8A 3CX5I 1PV3A 1LTTC 2JJLA 3L75E 2N1TD 2JO1A 3B71A 1Y47A 3WUUA 4RJTA 4Z1MH 3Q1MA 5AVQB 1BGYE 3A3YB 1KYOI 1IFJA 2O01J 1J1EC 2NPSD 1VF5B 3RK2D 3SFEC 5CCGD 1X9VA 3PJSK 1USDA 1NGMB 2IFNA 2IZ0A 3TK1A 2QG4A 2HODA 3FXEA 4HH2A 1A02F 1NTZK 2OYIA 2E76C 2OTKE 1BE3E 2JR8A 3C1LA 3S9OA 1NYHA 4U3FE 3H1JD 3PLNA 1SVFA 2YO3A 1L0LJ 1SFCB 2LXBA 1OZHA 2HODB 3JCUE 3A0BE 3RGUA 1ZMEC 5APSA 3RL0C 1KILC 2IBZG 3E1IA 3FWLA 1KB9E 3KPEA 4D6TE 1IFMA 1KD1Q 1SP4A 2J59M 1NTMK 3N4XA 1NTKJ 3CWBG 2A06E 1OVRA 1JTHA 4GIFA 1KFNA 3BRTB 4TLFA 2WZ7A 3GG2A 5GTHE 1PGOA 2AXTH 2BEZF 2D2CC 4WY4A 2JWAA 1FZBA 1YJWP 3IR9A 3L70D 4JQ0D 3TSIA 1VQMP 2ZXXA 2E76D 2IYOA 3IAOA 3CCQP 3AEEC 5TISE 1EZVE 4QMAA 2QJPC 3KQGA 1VDFA 1KQGB 2YIUC 3I56P 1K73Q 4WY4B 4LC1A 1DX7A 1NTMD 2WPVB 3RL0D 1LWUC 2WT7A 2M5AA 2N1TB 1KILD 3L74G 2HG5D 1LTJA 2QRXA 2J5UA 3CLQA 1XTGB 1K8AQ 2Y9YA 1E79H 1PP9J 1M56D 1X79B 5KLIC 3GF3A 3VMZA 4UB6H 2V4HA 1HWTC 3N7NA 2OARA 2W8ZA 3T97A 3VOPA 2IBZD 4WBAA 3H1HD 2R44A 1RE3A 1FBMA 4BXLA 1OW6A 2O1KA 3M9BA 2KNCA 2I8DA 5C39A 2WSSH 2ZJSE 3HUSA 1G1JA 1KYOD 1LTIC 4ASVA 3P32A 5B66E 2Q7CA 5AVSB 1FJKA 4PD4H 2VRSA 1T3JA 1NU1G 1YITP 5KKZC 2WSCH 5TJHA 2L5GB 1MUUA 1L0ND 2W90A 4HB1A 2R3SA 2B9BA 2YKPA 5CHXA 5H2FE 1AVOA 1NVOA 3L73G 4R4LA 4GOEA 1RH5B 3MUDA 4YPCA 1Q7YQ 1FZCA 1MZ9A 1RF1A 1LT1A 4YTPC 2K37A 5APUA 2YMYA 1FS0E 1URQC 1YTZI 4ASWA 2PFXA 3KZIH 1AV1A 2Y0CA 2WWWA 3EFFK 1J1DC 2FYUJ 5KLVK 1T6AA 3L71D 1SLQA 1IZNB 4B86A 1KILB 1FZCB 3L70E 3RBXA 1SQVJ 5E79E 1BGYG 1SQPG 1AJYA 5AW1B 1UIXA 2Q1KA 1BSHA 1OVVA 1R5SA 3GF7A 3KYQA 1CI6B 1IK9A 1K04A 2KP8A 4IOIH 5AW2B 1T2KD 1HJ0A 1HBWA 2OYHC 4OWFA 3CCVP 2YKQA 1NTME 3D70A 1KILE 4ZNCA 1DIPA 4YXWH 1NTZJ 4IL6X 1KQFB 5KLVD 1BE3G 1M8OB 3OA7A 1T8ZA 4IFMA 1N73C 1URQD 4U3FG 3H1LG 3GHGA 2AEJA 3CCEP 4LGDE 1FC2C 3AEBC 1P84I 4BRYA 2E74C 3G4SP 2IFMA 3TYYA 1SQPK 1M57D 5BVZA 5L8RJ 1FZFA 4D6TG 4NPDA 2IBZE 1BCCD 3H1HE 1LNQA 1KMIZ 2AEMA 2FFDC 5KLIB 3V2RA 1PGJA 2IYPA 2WSCJ 4M3LA 4XFJA 2XKMA 3P8CD 4OH8B 5AW4B 3WU2H 2NZ2A 1QVFO 2O3JA 1EZVG 1JY2N 2KS1A 2QIWA 3QWOC 3TGUG 3CCJP 3RK3D 2B87B 2KSJA 1HJBA 2XU6A 1KQSO 1L0NE 4ZKPA 3AE7C 4AUWA 1RQVA 2BEQD 3HD7A 1HUCA 2NRGA 3L74E 2MJZA 3VYIA 2P10A 2P2UA 3CWBJ 2N9BA 1AFOA 1PFIA 3H1LD 1VL2A 2RKLA 2JWDA 2WPRA 4L73A 3MGNA 5KJ7C 3S1KA 4OVNF 3U59A 3V2QA 3HE4B 2LR2A 1FOSE 3HTKA 4JPZB 1FAVA 3CCLP 2JKVA 1JY3O 2OGUA 2FXPA 4CPGA 4PJ0E 2QJYC 2C9NY 3L74J 4R4MA 1J1DB 2AEFA 2BCCD 3H1KD 3RL0g 3D71A 4PV1C 1WMKA 4N78D 5AW0B 1Q81Q 2E42A 5KLVE 1IO4A 3GW6A 4A7PA 1W2BO 1YYCA 1IFDA 3H1JG 2XDJA 3TGUD 1OMIA 1VQ6P 3A0HE 3CD6P 2GM4A 3AE3C 2QJKC 2PP6A 5KJ7D 1ZN5A 5CCHC 1H89A 3JCUH 3A0BH 1L2PA 3S4RA 1P84D 2QVAA 2M0BA 3CI9A 1N73B 4DZOA 3CMEP 1DH3A 4WB4A 1QLED 1BCCE 1KB9H 3LW5H 2A45G 3RK3B 3BVHA 2Q3EA 1ZRTE 1ZOYC 3BASA 2KZIA 2Y0EA 2WMMA 3L70G 3P8CE 5GTHH 3QH9A 1JMMA 1NU1J 4C7NB 1YQ3C 1U7MA 1VQNP 3V2PA 1CW5A 2CPBA 1VQ9P 1SQPE 1Y8AA 1PPJD 2ZYGA 3RK3E 5TISH 4I2LC 1PZQA 3VP9A 5K5GB 3AEAC 1Q2NA 3TF5A 1JMBA 4EYYQ 1NTMG 2W6BA 3CXHD 2H8PD 3L73J 1N7SB 1GL2A 4I1LA 1SFCA 5CCHD 3A7OA 4OGQC 1W5CE 1FZEA 2XZRA 4HKZH 1VQLP 3M9QA 2C9LY 5B5EE 5M1BA 1NOHA 3WUVA 3L75J 5DJTB 2E43A 5AVWB 1S1CX 2FYNB 3H1LE 1GL2B 1GK6A 1SS1A 1SQQK 1BGYJ 2RH0A 1SQPJ 4K3AA 1PIXA 1G2CB 2R32A 3PTZA 4I6MC 2Q6QA 1BDDA 3BCCD 3WUTA 5AVUB 1GZLA 2QE7H 3H1HG 1KTMA 3Q2YA 3H1ID 4GDOA 1S2EA 2FXOA 1GMJA 2KK7A 1S3JA 3FGAD 1Q90D 2XNXA 5AVYB 4ZKUA 1LT9B 3CL3D 4GOFA 4RKUJ 1LTSC 1YBKA 1LTBC 4KHXA 1RF1C 2RN0A 3E1RA 4OGQD 1IFIA 3U1AA 2BCCE 1BE3J 3H1KE 1VQOP 1FDOA 4IFFA 5APVA 1K05A 1JB0J 3H32B
chains in the Genus database with same CATH topology
2YKPA 1OWAA 1YTZT 4N78E 5AVTB 5CHXA 4C7NA 1N7SC 2N1TA 3A2AA 2XV5A 3V2NA 1LTJC 3M06A 3L36A 3MUDA 2W27A 1FZCA 1MZ9A 1HGZA 1RF1A 1RF0C 3TNUB 3M0DC 5APUA 2YMYA 1FZGA 5AW3B 1URQC 4DOJA 1YTZI 2C0WA 2R3CA 1N7SA 2WWWA 3OAKA 1J1DC 1GL2C 1M1JC 4W7YA 1LTAC 5KLVK 1SFCC 1SLQA 4WY4D 1VPCA 4Y99C 1JY2O 2WSFH 1RF0A 1WRGA 2KYVA 3M0DA 4B86A 1KILB 1FZCB 5CMZA 2FYUK 3BATA 1URQA 3L37A 2FFDB 1GU4A 2H7HA 3MD0A 2O01H 5APWA 5AW1B 1EQ7A 1ZR2A 1RE4C 1IC2A 3LIEA 1GTWA 3KYQA 1CI6B 3OJAB 1IK9A 2NPSB 3NFQA 1SQVK 2KP8A 1RE3C 2HPCA 1L4AB 3RK2B 1LTGC 5AW2B 1T2KD 1LT9C 2YO2A 4LLHA 2YKOA 3GHGC 1HBWA 2P67A 2OYHC 1HTLC 1H8AA 2YKQA 1N7SD 1G2CA 1SQBK 3HD7B 3HUSC 1RE4A 1GK4A 2H43A 3OA7A 1L0NK 1KFMA 1T8ZA 3MTUE 2J58A 4IFMA 2A45I 1N73C 4XE5B 1URQD 1LT9A 3GHGA 3O8ZA 3UIAA 5AW6B 3B5NA 2OYHA 2ZXEB 3EQ2A 1FOSF 4LGDE 2R5BA 4AYCA 1ZR4A 1GL2D 2M3BA 1SFCD 1FU1A 2IFMA 3TYYA 4N3YB 3H32A 1T3UA 1NKNA 5KJ7A 1CSBA 1ZLLA 1SQPK 3P7KA 5BVZA 1OXZA 2WPSA 3NTNA 1X8YA 1FZFA 3HTKB 1A02J 2FKWB 2O1JA 2IX7C 1J1EB 2OYIB 3TNUA 1HGVA 1FZCC 3EFGA 2FFDC 3VMXA 2Z4EA 1ZV8A 4XA4A 3V2RA 1FJPA 1N2DC 5CJ4A 2NPSC 3VP8A 4M3LA 2XKMA 3P8CD 4OH8B 5AW4B 1S9KD 3RK2C 1GW4A 1NKZB 5CCGC 1JCDA 2FYZA 2GUVA 5AVZB 1G1IA 1KILA 3A5TA 5AVVB 2YNYA 1NH4A 1LGHB 1JY2N 2QM7A 4GKGA 1QL1A 2FFDA 5AW8B 1E5WA 3RK3D 2KSJA 5AW5B 1CI6A 1HJBA 2NPSA 2XU6A 3M0AA 1JNMA 1L4AA 2LKMA 3BRVB 5AW7B 2M8RA 3LIDA 1JTHB 3VN0A 4ZKPA 5CCGA 2Z5HA 3RL0B 4AUWA 2Q3IA 5CCHA 3I5CA 2WSEH 1LTTC 3HD7A 2JJLA 2N1TD 3HE5A 4JYBA 4RESB 1WT6A 1HUCA 1SQXK 2MJZA 3VYIA 1M7LA 1NHLA 2P2UA 2POHA 2QM8A 2N9BA 1MV8A 1AFOA 5AVQB 3V5BA 1PFIA 3A3YB 3L4FA 1IJDB 2A45H 1IFJA 3B5NC 1J1EC 2WPRA 2NPSD 3G3ZA 3M91A 3MGNA 2W6AA 3HE5B 3RK2D 5BU5A 2P7JA 5CCGD 1X9VA 2WT7B 3HRNA 2HFED 5KJ7C 3U59A 3V2QA 2IFNA 3HE4B 1LTJB 3TK1A 2HODA 3V4QA 4HH2A 1FOSE 3HTKA 5APXA 1FAVA 1A02F 1NTZK 1JY3O 2C0XA 2OYIA 1HVVA 3NMDA 1JUNA 1LWUB 2C9NY 1FZAA 1J1DB 1M1JB 2HYNA 1FDMA 1SVFA 2YO3A 1SFCB 2Q5UA 2JEEA 4Y99B 2HODB 4N78D 5AW0B 2E42A 5APSA 2HLOA 3RL0C 4C46A 1GU5A 1IO4A 1L0LK 1Z56A 1KILC 5APTA 4W7ZA 3WMM0 3E1IA 1YYCA 4JYCA 1IFDA 3SWYA 2XDJA 1IFNA 3B5ND 3KPEA 1GD2E 1QL2A 1IFMA 1JO5A 1SP4A 3M9HA 2GM4A 2J59M 1NTMK 3N4XA 5AW9B 1XTCC 1JTHA 1L4AC 4GIFA 1N7LA 2PP6A 1KFNA 3BRTB 2WZ7A 3V4WA 5KJ7D 1AQ5A 1ZN5A 4EIJA 5CCHC 3HUSB 5BU8B 1H89A 3VTPC 4WY4A 3HD7C 3NXSA 1NTKK 1FZBA 1CZQA 1T2KC 3IR9A 3TSIA 3CI9A 1N73B 1W2EA 4DZOA 5KTBA 1GW3A 3KDPB 3VMYA 1NO4A 1DH3A 4WB4A 1HH0A 2GUSA 3LW5H 2A45G 3RK3B 2KLVA 3BVHA 2ZFCA 4IFDK 3KQGA 1VDFA 1JY2P 3SWFA 2WPQA 3BASA 1GDTA 4WY4B 4JF7A 3P8CE 4LC1A 1DX7A 1S9KE 3IFMA 3RL0D 1LWUC 2WT7A 1JMMA 4C7NB 2N1TB 1KILD 3HE4A 2HG5D 1LTJA 3V2PA 2PAJA 3C9IA 1CW5A 2CPBA 5APYA 1RF1B 4HYTB 1NU1K 1KZUB 3L35A 1NAFA 3CLQA 2OYIC 1XTGB 1JY3N 4I2LC 3VP9A 1L4AD 4AQRD 3P8MC 1LWUA 2W6BA 2CPSA 3B8EB 2Q9IA 2H8PD 4I1LA 1N7SB 1GL2A 1M1JA 1X79B 1MFZA 1SFCA 3II6A 5CCHD 3A7OA 1FZEA 2XZRA 3HD7D 3VMZA 4C7RA 1N86A 3M9QA 2C9LY 1HWTC 2P1JA 3N7NA 1JY3P 2OARA 1URQB 1NOHA 3T97A 3VOPA 4WBAA 2Z5IA 2E43A 4EOTA 5AVWB 2I1KA 1JOCA 5APQA 5CJ0A 1GL2B 1RE3A 1FBMA 2HPCB 3MIWA 1GK6A 2KOGA 2O1KA 1SQQK 3RK3C 4GT1A 3M9BA 2FXMA 3U1CA 1H88A 3H6PA 3PP5A 1G2CB 2R32A 3HUSA 1JCCA 4I6MC 1G1JA 1KQLA 1LTIC 2KB7P 5AVUB 3P32A 1DEBA 3R2PA 1GZLA 4WY4C 2Q7CA 2R5DA 1N73A 5AVSB 1FJKA 2VRSA 2N1TC 1T3JA 2WITA 2XNXA 5AVYB 4ZKUA 5AVRB 1LT9B 3CL3D 3GHGB 2I1JA 1J2JB 2OYHB 4O9BA 2WSCH 3B5NB 1NWQA 1LTSC 1RY3A 2IPPA 2L5GB 1LTBC 4W80A 2WTYA 4KHXA 1RF1C 1MUUA 2BASA 1IFIA 3U1AA 4N6JA 4IFFA 5APVA 5AVXB 3H32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYV A;  1FJP A;  2HYN A;  2KB7 P;  1FJK A;  1ZLL A;  2M3B A;  1N7L A; 
#chains in the Genus database with same CATH topology
 4N78 E;  5AVT B;  4U3F J;  2N1T A;  1SQQ D;  3A2A A;  1SQB G;  2OTJ P;  3V2N A;  5B66 H;  1IFP A;  3M06 A;  1HGZ A;  3TNU B;  3TGU E;  1L0N G;  1FZG A;  5AW3 B;  2C0W A;  2R3C A;  1R8E A;  1AA0 A;  3LW5 J;  2ZYA A;  4D6T J;  3CCM P;  1M1J C;  2ZVN B;  1LTA C;  2RMZ A;  4Y99 C;  1P84 E;  1RF0 A;  1WRG A;  2WSF H;  3M0D A;  5H2F H;  1EDI A;  3L37 A;  3Q5P A;  3MD0 A;  1ZR2 A;  3LIE A;  1N8R Q;  2NPS B;  1YIJ P;  2QJK B;  3FX0 A;  3RK2 B;  3L71 G;  2D2C D;  3GLM A;  3O6Q B;  2YO2 A;  4LLH A;  1X0T A;  3GHG C;  2P67 A;  3V6I A;  1H8A A;  1SQB K;  2Y9Z A;  1RE4 A;  3CX5 D;  2H43 A;  1L0N K;  5E79 H;  3MTU E;  2ZT9 C;  4RO0 A;  4BWN A;  1PPJ E;  3SWK A;  3L72 D;  5AW6 B;  2ZXE B;  5KAI E;  3CXH E;  2Y0D A;  3MP7 B;  1X22 A;  1YHQ P;  5KLV G;  1T3U A;  1CSB A;  1ZLL A;  3D6Y A;  1QEX A;  2M3E A;  1SQB D;  1VQ7 P;  2GA1 A;  1J1E B;  1HGV A;  3H1J E;  3G71 P;  1OX3 A;  4XA4 A;  2B89 A;  4KJM A;  3F89 A;  1MKM A;  1GW4 A;  1BSN A;  3BCC E;  1PGQ A;  2E76 B;  1BCC G;  1JCD A;  1UII A;  2GUV A;  1G1I A;  1KIL A;  3JC2 2;  5AVZ B;  2ZT9 D;  1BDC A;  1NH4 A;  4Y28 J;  2JDI H;  2QM7 A;  5AW8 B;  1CI6 A;  3M0A A;  2M8R A;  3RL0 B;  3I5C A;  2WSE H;  1OVU A;  3H1J J;  1SQQ E;  1WT6 A;  1SQX K;  1KB9 I;  1M7L A;  1NHL A;  3E7K A;  2WSF J;  2V7Q H;  1MV8 A;  4UB8 E;  2E75 C;  1TU3 F;  3L4F A;  3B5N C;  2D2C B;  5BU5 A;  2P7J A;  2HFE D;  1PL5 A;  3V4Q A;  5APX A;  2QJP B;  4NPF X;  2ZYD A;  1S72 P;  1SQX D;  3PRJ A;  2YIU B;  3L70 J;  1DD3 A;  3K5B A;  4GOD A;  1QVG O;  1HVV A;  1JUN A;  1EXJ A;  1LWU B;  1M1J B;  2JEE A;  3ABV C;  4Y99 B;  2YXQ B;  4HJG H;  3CX5 E;  4I7Z C;  2HR3 A;  1L0L K;  1NTM J;  5APT A;  3WMM 0;  4JYC A;  3SWY A;  2B87 A;  2E5T A;  3B5N D;  3L72 E;  1GD2 E;  1QL2 A;  4NPE A;  2BCC G;  1JM0 A;  3H1K G;  4TT3 H;  5KAF E;  4PJ0 H;  5AW9 B;  2E5Y A;  1XTC C;  2UWJ E;  1L4A C;  1KYO E;  1AQ5 A;  2PRR A;  3OW2 O;  3VTP C;  3Q3D A;  1S5L E;  1NTK K;  1CZQ A;  1USE A;  2IDB A;  1SQB E;  1W2E A;  5KTB A;  3KDP B;  1NO4 A;  1PP9 G;  2KLU A;  2GUS A;  2E74 D;  1L0L D;  2KLV A;  3B4S A;  3A0H H;  1JY2 P;  3SWF A;  3CMA P;  2WPQ A;  3H1H J;  1GDT A;  4JF7 A;  3I55 P;  4JBZ A;  2AXC A;  4L76 A;  3HE4 A;  5KKZ B;  2P58 A;  2WSE J;  3C9I A;  1H0T B;  5APY A;  4HYT B;  1NTK D;  3L35 A;  3CC2 P;  2OYI C;  1JY3 N;  1EDL A;  1L4A D;  2QSI A;  1QX8 A;  2Q9I A;  2V7Q J;  3L71 E;  3USS A;  1L0N J;  1N86 A;  1NJI Q;  1PPJ G;  2P1J A;  1JY3 P;  2OYO A;  1URQ B;  1AVY A;  4EOT A;  2I1K A;  5APQ A;  2WQY C;  4MN4 C;  2HPC B;  1HF9 A;  2FXM A;  2QEX P;  2A06 D;  3IN6 A;  3H25 A;  3AE8 C;  1DEB A;  3R2P A;  4WY4 C;  4KT0 J;  1OW7 A;  5B5E H;  1N73 A;  1JEK A;  3L71 J;  3CPW O;  1SQX E;  2N1T C;  2YMK A;  1PP9 D;  2WIT A;  5AVR B;  2I1J A;  1J2J B;  2W83 C;  2OYH B;  3B5N B;  1NWQ A;  4IL6 E;  1RY3 A;  2WTY A;  2KSE A;  3BCC G;  4N6J A;  4PD4 I;  3H1I G;  1OWA A;  1YTZ T;  4C7N A;  2XV5 A;  5EFW B;  1LTJ C;  3AE6 C;  3L36 A;  2W27 A;  1RF0 C;  1M90 Q;  3M0D C;  1MFT A;  2E74 B;  4PV1 D;  5KLV J;  4DOJ A;  1N7S A;  1LP1 B;  1SQQ G;  4W7Y A;  4EI2 A;  4WY4 D;  2KYV A;  2IBZ I;  3KXD A;  3AE4 C;  2FYU K;  2FFD B;  1GU4 A;  1RE4 C;  1L0L E;  3AEC C;  3AED C;  1SQV K;  4U7J A;  1RE3 C;  1L4A B;  2XND H;  1BCC J;  1HTL C;  4K35 A;  5GTI E;  4H0L C;  1VQK P;  1G2C A;  3HUS C;  1P84 H;  1VQ5 P;  1NTK E;  1LJ2 A;  1LT9 A;  3O8Z A;  3UIA A;  2FYU D;  3EQ2 A;  1FOS F;  2R5B A;  4AYC A;  1ZR4 A;  2M3B A;  3CCU P;  1SQV D;  3AE1 C;  4N3Y B;  3H32 A;  1NKN A;  5KJ7 A;  2KUB A;  3P7K A;  1OXZ A;  3AEG C;  3L72 G;  1YJ9 P;  3RBZ A;  2IX7 C;  4H13 C;  2OYI B;  3TNU A;  3MUD C;  5DJU B;  3TDK A;  1FZC C;  1K9M Q;  5KAI H;  3VMX A;  1ZV8 A;  3CXH H;  1FJP A;  4H0L D;  1N2D C;  3MZW B;  1NTZ D;  2N9Y B;  3H1L J;  3VP8 A;  1S9K D;  2K9Y A;  1NKZ B;  4WVZ A;  3PH0 A;  5AVV B;  1R5L A;  1LGH B;  4GKG A;  2QJY B;  1PP9 E;  2NPS A;  4PV1 B;  3SSU A;  1D7M A;  3LID A;  1JTH B;  3O6Q A;  5CCG A;  1FDI A;  3D6Z A;  2Z5H A;  2Q3I A;  5CCH A;  3HE5 A;  4JYB A;  4RES B;  2BCC J;  3H1K J;  4H13 D;  3VMA A;  4PD4 D;  2POH A;  2QM8 A;  1KC8 Q;  3V5B A;  1IJD B;  2A45 H;  3G3Z A;  3M91 A;  2W6A A;  3TGU J;  3HE5 B;  1KOR A;  2JP3 A;  2WT7 B;  3HRN A;  1DD4 A;  2M5A B;  1LTJ B;  3KHU A;  1QGK B;  4L75 A;  2OTL P;  2C0X A;  3ITK A;  2O01 N;  4UB8 H;  3NMD A;  4EDF A;  1FZA A;  2HYN A;  1FDM A;  2Q5U A;  2AXT E;  1S5L X;  3W67 A;  3CWB D;  2HLO A;  1SQX G;  4C46 A;  1GU5 A;  1Z56 A;  3R4Y A;  3T97 B;  4W7Z A;  4WWI A;  1VQP P;  1EXI A;  1IFN A;  2FYU E;  1JO5 A;  4OGQ B;  2LXC B;  3M9H A;  1S4X A;  1N7L A;  4H0L B;  1SQV E;  2KNC B;  3V4W A;  2KZJ A;  3H1I E;  4EIJ A;  1RQU A;  3HUS B;  5BU8 B;  2G3A A;  3HD7 C;  2MKV A;  3NXS A;  3G6E P;  1T2K C;  3CX5 H;  1GW3 A;  3VMY A;  3L74 D;  4DT0 A;  1YQ4 C;  1HH0 A;  2ZFC A;  4IFD K;  2QA4 P;  5KAF H;  1NTZ E;  1KYO H;  1S9K E;  3IFM A;  4UB6 E;  3L75 G;  3CCR P;  3MHV A;  2IZ1 A;  3CCS P;  1KV4 A;  1S5L H;  2PAJ A;  1L0L G;  4H13 B;  5CBO A;  1NAY A;  1RF1 B;  3BCC J;  4YXD C;  2K9J A;  1NU1 K;  1KZU B;  1NAF A;  3H1I J;  2ITA A;  4AQR D;  4H44 C;  3P8M C;  1LWU A;  2CPS A;  3B8E B;  1Q86 Q;  1M1J A;  4DCK A;  1MFZ A;  3II6 A;  1AQT A;  3HD7 D;  1VQ4 P;  4C7R A;  1EZV I;  1IK7 A;  1NTK G;  2K9J B;  4PD4 E;  1ZP0 C;  2Z5I A;  1SQQ J;  1JOC A;  1FE6 A;  5CJ0 A;  1EC5 A;  2H89 C;  3AE5 C;  1EDK A;  3MIW A;  2KOG A;  1NU1 D;  2K88 A;  3RK3 C;  3W68 A;  4GT1 A;  3GMA A;  3U1C A;  1H88 A;  3H6P A;  3PP5 A;  1JCC A;  1KQL A;  2KB7 P;  2KIK A;  3SFD C;  2E75 D;  2H88 C;  2R5D A;  1RHZ B;  2PGD A;  3CC7 P;  3L73 D;  4H44 D;  3GHG B;  4O9B A;  2IPP A;  4W80 A;  1Q82 Q;  3AEF C;  3KZI E;  4BRY B;  2A06 G;  3CC4 P;  2BAS A;  1DEE G;  2CK3 H;  1VF5 C;  5AVX B;  1ZRT D;  3CWB E;  2ZT9 B;  3L75 D;  1N7S C;  1H0T A;  3PHL A;  3CXH I;  1BGY D;  1SQP D;  4IL6 H;  3EWK A;  2FYN C;  3Q5R A;  3L72 J;  2SPZ A;  1GL2 C;  3OAK A;  1SFC C;  1VPC A;  1JY2 O;  3IF4 A;  1Y9B A;  1PGP A;  5CMZ A;  3Q5S A;  3BAT A;  1URQ A;  2H7H A;  2KS1 B;  2O01 H;  5APW A;  1YJN P;  1EQ7 A;  1IC2 A;  1BE3 D;  1GTW A;  3OJA B;  3C8V A;  1SQB J;  3NFQ A;  2HPC A;  2KXP B;  1LTG C;  2DW3 A;  4U3F D;  3AE2 C;  1VF5 D;  1ZW0 A;  1LT9 C;  2YKO A;  1OIP A;  1N7S D;  1VQ8 P;  3HD7 B;  1EDJ A;  1GK4 A;  2B88 A;  1KFM A;  2J58 A;  2A45 I;  2ZVO B;  2ZAE B;  4XE5 B;  1KB9 D;  1OFC X;  3ZDM A;  2OQQ A;  4D6T D;  2OYH A;  3B5N A;  4L74 A;  3G9R A;  4ZMD A;  1GL2 D;  1SFC D;  1FU1 A;  2W6J H;  3WU2 E;  5GTI H;  2FBW C;  1ZXG A;  1U57 A;  2E75 B;  2L91 A;  2WPS A;  2KI7 B;  1X8Y A;  3NTN A;  3HTK B;  1YI2 P;  2FYU G;  1A02 J;  2K3R A;  2FKW B;  2O1J A;  2K1A A;  2YXR B;  1EZV D;  4H44 B;  3FWN A;  3EFG A;  1SQV G;  2Z4E A;  1NU1 E;  3JSV C;  2WVR A;  1LP1 A;  5CJ4 A;  1U7J A;  3AE9 C;  5CBN A;  2NPS C;  3RK2 C;  1OW8 A;  5CCG C;  2FYZ A;  3A5T A;  2YNY A;  3FXD A;  1QL1 A;  2FFD A;  3L73 E;  1E5W A;  5AW5 B;  3F5H A;  4DJG A;  1NTZ G;  1JNM A;  1L4A A;  2LKM A;  1M1K Q;  3BRV B;  5AW7 B;  1SQX J;  3VN0 A;  4I7Z B;  1KN7 A;  2G8Y A;  2FY8 A;  3CX5 I;  1PV3 A;  1LTT C;  2JJL A;  3L75 E;  2N1T D;  2JO1 A;  3B71 A;  1Y47 A;  3WUU A;  4RJT A;  4Z1M H;  3Q1M A;  5AVQ B;  1BGY E;  3A3Y B;  1KYO I;  1IFJ A;  2O01 J;  1J1E C;  2NPS D;  1VF5 B;  3RK2 D;  3SFE C;  5CCG D;  1X9V A;  3PJS K;  1USD A;  1NGM B;  2IFN A;  2IZ0 A;  3TK1 A;  2QG4 A;  2HOD A;  3FXE A;  4HH2 A;  1A02 F;  1NTZ K;  2OYI A;  2E76 C;  2OTK E;  1BE3 E;  2JR8 A;  3C1L A;  3S9O A;  1NYH A;  4U3F E;  3H1J D;  3PLN A;  1SVF A;  2YO3 A;  1L0L J;  1SFC B;  2LXB A;  1OZH A;  2HOD B;  3JCU E;  3A0B E;  3RGU A;  1ZME C;  5APS A;  3RL0 C;  1KIL C;  2IBZ G;  3E1I A;  3FWL A;  1KB9 E;  3KPE A;  4D6T E;  1IFM A;  1KD1 Q;  1SP4 A;  2J59 M;  1NTM K;  3N4X A;  1NTK J;  3CWB G;  2A06 E;  1OVR A;  1JTH A;  4GIF A;  1KFN A;  3BRT B;  4TLF A;  2WZ7 A;  3GG2 A;  5GTH E;  1PGO A;  2AXT H;  2BEZ F;  2D2C C;  4WY4 A;  2JWA A;  1FZB A;  1YJW P;  3IR9 A;  3L70 D;  4JQ0 D;  3TSI A;  1VQM P;  2ZXX A;  2E76 D;  2IYO A;  3IAO A;  3CCQ P;  3AEE C;  5TIS E;  1EZV E;  4QMA A;  2QJP C;  3KQG A;  1VDF A;  1KQG B;  2YIU C;  3I56 P;  1K73 Q;  4WY4 B;  4LC1 A;  1DX7 A;  1NTM D;  2WPV B;  3RL0 D;  1LWU C;  2WT7 A;  2M5A A;  2N1T B;  1KIL D;  3L74 G;  2HG5 D;  1LTJ A;  2QRX A;  2J5U A;  3CLQ A;  1XTG B;  1K8A Q;  2Y9Y A;  1E79 H;  1PP9 J;  1M56 D;  1X79 B;  5KLI C;  3GF3 A;  3VMZ A;  4UB6 H;  2V4H A;  1HWT C;  3N7N A;  2OAR A;  2W8Z A;  3T97 A;  3VOP A;  2IBZ D;  4WBA A;  3H1H D;  2R44 A;  1RE3 A;  1FBM A;  4BXL A;  1OW6 A;  2O1K A;  3M9B A;  2KNC A;  2I8D A;  5C39 A;  2WSS H;  2ZJS E;  3HUS A;  1G1J A;  1KYO D;  1LTI C;  4ASV A;  3P32 A;  5B66 E;  2Q7C A;  5AVS B;  1FJK A;  4PD4 H;  2VRS A;  1T3J A;  1NU1 G;  1YIT P;  5KKZ C;  2WSC H;  5TJH A;  2L5G B;  1MUU A;  1L0N D;  2W90 A;  4HB1 A;  2R3S A;  2B9B A;  2YKP A;  5CHX A;  5H2F E;  1AVO A;  1NVO A;  3L73 G;  4R4L A;  4GOE A;  1RH5 B;  3MUD A;  4YPC A;  1Q7Y Q;  1FZC A;  1MZ9 A;  1RF1 A;  1LT1 A;  4YTP C;  2K37 A;  5APU A;  2YMY A;  1FS0 E;  1URQ C;  1YTZ I;  4ASW A;  2PFX A;  3KZI H;  1AV1 A;  2Y0C A;  2WWW A;  3EFF K;  1J1D C;  2FYU J;  5KLV K;  1T6A A;  3L71 D;  1SLQ A;  1IZN B;  4B86 A;  1KIL B;  1FZC B;  3L70 E;  3RBX A;  1SQV J;  5E79 E;  1BGY G;  1SQP G;  1AJY A;  5AW1 B;  1UIX A;  2Q1K A;  1BSH A;  1OVV A;  1R5S A;  3GF7 A;  3KYQ A;  1CI6 B;  1IK9 A;  1K04 A;  2KP8 A;  4IOI H;  5AW2 B;  1T2K D;  1HJ0 A;  1HBW A;  2OYH C;  4OWF A;  3CCV P;  2YKQ A;  1NTM E;  3D70 A;  1KIL E;  4ZNC A;  1DIP A;  4YXW H;  1NTZ J;  4IL6 X;  1KQF B;  5KLV D;  1BE3 G;  1M8O B;  3OA7 A;  1T8Z A;  4IFM A;  1N73 C;  1URQ D;  4U3F G;  3H1L G;  3GHG A;  2AEJ A;  3CCE P;  4LGD E;  1FC2 C;  3AEB C;  1P84 I;  4BRY A;  2E74 C;  3G4S P;  2IFM A;  3TYY A;  1SQP K;  1M57 D;  5BVZ A;  5L8R J;  1FZF A;  4D6T G;  4NPD A;  2IBZ E;  1BCC D;  3H1H E;  1LNQ A;  1KMI Z;  2AEM A;  2FFD C;  5KLI B;  3V2R A;  1PGJ A;  2IYP A;  2WSC J;  4M3L A;  4XFJ A;  2XKM A;  3P8C D;  4OH8 B;  5AW4 B;  3WU2 H;  2NZ2 A;  1QVF O;  2O3J A;  1EZV G;  1JY2 N;  2KS1 A;  2QIW A;  3QWO C;  3TGU G;  3CCJ P;  3RK3 D;  2B87 B;  2KSJ A;  1HJB A;  2XU6 A;  1KQS O;  1L0N E;  4ZKP A;  3AE7 C;  4AUW A;  1RQV A;  2BEQ D;  3HD7 A;  1HUC A;  2NRG A;  3L74 E;  2MJZ A;  3VYI A;  2P10 A;  2P2U A;  3CWB J;  2N9B A;  1AFO A;  1PFI A;  3H1L D;  1VL2 A;  2RKL A;  2JWD A;  2WPR A;  4L73 A;  3MGN A;  5KJ7 C;  3S1K A;  4OVN F;  3U59 A;  3V2Q A;  3HE4 B;  2LR2 A;  1FOS E;  3HTK A;  4JPZ B;  1FAV A;  3CCL P;  2JKV A;  1JY3 O;  2OGU A;  2FXP A;  4CPG A;  4PJ0 E;  2QJY C;  2C9N Y;  3L74 J;  4R4M A;  1J1D B;  2AEF A;  2BCC D;  3H1K D;  3RL0 g;  3D71 A;  4PV1 C;  1WMK A;  4N78 D;  5AW0 B;  1Q81 Q;  2E42 A;  5KLV E;  1IO4 A;  3GW6 A;  4A7P A;  1W2B O;  1YYC A;  1IFD A;  3H1J G;  2XDJ A;  3TGU D;  1OMI A;  1VQ6 P;  3A0H E;  3CD6 P;  2GM4 A;  3AE3 C;  2QJK C;  2PP6 A;  5KJ7 D;  1ZN5 A;  5CCH C;  1H89 A;  3JCU H;  3A0B H;  1L2P A;  3S4R A;  1P84 D;  2QVA A;  2M0B A;  3CI9 A;  1N73 B;  4DZO A;  3CME P;  1DH3 A;  4WB4 A;  1QLE D;  1BCC E;  1KB9 H;  3LW5 H;  2A45 G;  3RK3 B;  3BVH A;  2Q3E A;  1ZRT E;  1ZOY C;  3BAS A;  2KZI A;  2Y0E A;  2WMM A;  3L70 G;  3P8C E;  5GTH H;  3QH9 A;  1JMM A;  1NU1 J;  4C7N B;  1YQ3 C;  1U7M A;  1VQN P;  3V2P A;  1CW5 A;  2CPB A;  1VQ9 P;  1SQP E;  1Y8A A;  1PPJ D;  2ZYG A;  3RK3 E;  5TIS H;  4I2L C;  1PZQ A;  3VP9 A;  5K5G B;  3AEA C;  1Q2N A;  3TF5 A;  1JMB A;  4EYY Q;  1NTM G;  2W6B A;  3CXH D;  2H8P D;  3L73 J;  1N7S B;  1GL2 A;  4I1L A;  1SFC A;  5CCH D;  3A7O A;  4OGQ C;  1W5C E;  1FZE A;  2XZR A;  4HKZ H;  1VQL P;  3M9Q A;  2C9L Y;  5B5E E;  5M1B A;  1NOH A;  3WUV A;  3L75 J;  5DJT B;  2E43 A;  5AVW B;  1S1C X;  2FYN B;  3H1L E;  1GL2 B;  1GK6 A;  1SS1 A;  1SQQ K;  1BGY J;  2RH0 A;  1SQP J;  4K3A A;  1PIX A;  1G2C B;  2R32 A;  3PTZ A;  4I6M C;  2Q6Q A;  1BDD A;  3BCC D;  3WUT A;  5AVU B;  1GZL A;  2QE7 H;  3H1H G;  1KTM A;  3Q2Y A;  3H1I D;  4GDO A;  1S2E A;  2FXO A;  1GMJ A;  2KK7 A;  1S3J A;  3FGA D;  1Q90 D;  2XNX A;  5AVY B;  4ZKU A;  1LT9 B;  3CL3 D;  4GOF A;  4RKU J;  1LTS C;  1YBK A;  1LTB C;  4KHX A;  1RF1 C;  2RN0 A;  3E1R A;  4OGQ D;  1IFI A;  3U1A A;  2BCC E;  1BE3 J;  3H1K E;  1VQO P;  1FDO A;  4IFF A;  5APV A;  1K05 A;  1JB0 J;  3H32 B; 
#chains in the Genus database with same CATH homology
 2YKP A;  1OWA A;  1YTZ T;  4N78 E;  5AVT B;  5CHX A;  4C7N A;  1N7S C;  2N1T A;  3A2A A;  2XV5 A;  3V2N A;  1LTJ C;  3M06 A;  3L36 A;  3MUD A;  2W27 A;  1FZC A;  1MZ9 A;  1HGZ A;  1RF1 A;  1RF0 C;  3TNU B;  3M0D C;  5APU A;  2YMY A;  1FZG A;  5AW3 B;  1URQ C;  4DOJ A;  1YTZ I;  2C0W A;  2R3C A;  1N7S A;  2WWW A;  3OAK A;  1J1D C;  1GL2 C;  1M1J C;  4W7Y A;  1LTA C;  5KLV K;  1SFC C;  1SLQ A;  4WY4 D;  1VPC A;  4Y99 C;  1JY2 O;  2WSF H;  1RF0 A;  1WRG A;  2KYV A;  3M0D A;  4B86 A;  1KIL B;  1FZC B;  5CMZ A;  2FYU K;  3BAT A;  1URQ A;  3L37 A;  2FFD B;  1GU4 A;  2H7H A;  3MD0 A;  2O01 H;  5APW A;  5AW1 B;  1EQ7 A;  1ZR2 A;  1RE4 C;  1IC2 A;  3LIE A;  1GTW A;  3KYQ A;  1CI6 B;  3OJA B;  1IK9 A;  2NPS B;  3NFQ A;  1SQV K;  2KP8 A;  1RE3 C;  2HPC A;  1L4A B;  3RK2 B;  1LTG C;  5AW2 B;  1T2K D;  1LT9 C;  2YO2 A;  4LLH A;  2YKO A;  3GHG C;  1HBW A;  2P67 A;  2OYH C;  1HTL C;  1H8A A;  2YKQ A;  1N7S D;  1G2C A;  1SQB K;  3HD7 B;  3HUS C;  1RE4 A;  1GK4 A;  2H43 A;  3OA7 A;  1L0N K;  1KFM A;  1T8Z A;  3MTU E;  2J58 A;  4IFM A;  2A45 I;  1N73 C;  4XE5 B;  1URQ D;  1LT9 A;  3GHG A;  3O8Z A;  3UIA A;  5AW6 B;  3B5N A;  2OYH A;  2ZXE B;  3EQ2 A;  1FOS F;  4LGD E;  2R5B A;  4AYC A;  1ZR4 A;  1GL2 D;  2M3B A;  1SFC D;  1FU1 A;  2IFM A;  3TYY A;  4N3Y B;  3H32 A;  1T3U A;  1NKN A;  5KJ7 A;  1CSB A;  1ZLL A;  1SQP K;  3P7K A;  5BVZ A;  1OXZ A;  2WPS A;  3NTN A;  1X8Y A;  1FZF A;  3HTK B;  1A02 J;  2FKW B;  2O1J A;  2IX7 C;  1J1E B;  2OYI B;  3TNU A;  1HGV A;  1FZC C;  3EFG A;  2FFD C;  3VMX A;  2Z4E A;  1ZV8 A;  4XA4 A;  3V2R A;  1FJP A;  1N2D C;  5CJ4 A;  2NPS C;  3VP8 A;  4M3L A;  2XKM A;  3P8C D;  4OH8 B;  5AW4 B;  1S9K D;  3RK2 C;  1GW4 A;  1NKZ B;  5CCG C;  1JCD A;  2FYZ A;  2GUV A;  5AVZ B;  1G1I A;  1KIL A;  3A5T A;  5AVV B;  2YNY A;  1NH4 A;  1LGH B;  1JY2 N;  2QM7 A;  4GKG A;  1QL1 A;  2FFD A;  5AW8 B;  1E5W A;  3RK3 D;  2KSJ A;  5AW5 B;  1CI6 A;  1HJB A;  2NPS A;  2XU6 A;  3M0A A;  1JNM A;  1L4A A;  2LKM A;  3BRV B;  5AW7 B;  2M8R A;  3LID A;  1JTH B;  3VN0 A;  4ZKP A;  5CCG A;  2Z5H A;  3RL0 B;  4AUW A;  2Q3I A;  5CCH A;  3I5C A;  2WSE H;  1LTT C;  3HD7 A;  2JJL A;  2N1T D;  3HE5 A;  4JYB A;  4RES B;  1WT6 A;  1HUC A;  1SQX K;  2MJZ A;  3VYI A;  1M7L A;  1NHL A;  2P2U A;  2POH A;  2QM8 A;  2N9B A;  1MV8 A;  1AFO A;  5AVQ B;  3V5B A;  1PFI A;  3A3Y B;  3L4F A;  1IJD B;  2A45 H;  1IFJ A;  3B5N C;  1J1E C;  2WPR A;  2NPS D;  3G3Z A;  3M91 A;  3MGN A;  2W6A A;  3HE5 B;  3RK2 D;  5BU5 A;  2P7J A;  5CCG D;  1X9V A;  2WT7 B;  3HRN A;  2HFE D;  5KJ7 C;  3U59 A;  3V2Q A;  2IFN A;  3HE4 B;  1LTJ B;  3TK1 A;  2HOD A;  3V4Q A;  4HH2 A;  1FOS E;  3HTK A;  5APX A;  1FAV A;  1A02 F;  1NTZ K;  1JY3 O;  2C0X A;  2OYI A;  1HVV A;  3NMD A;  1JUN A;  1LWU B;  2C9N Y;  1FZA A;  1J1D B;  1M1J B;  2HYN A;  1FDM A;  1SVF A;  2YO3 A;  1SFC B;  2Q5U A;  2JEE A;  4Y99 B;  2HOD B;  4N78 D;  5AW0 B;  2E42 A;  5APS A;  2HLO A;  3RL0 C;  4C46 A;  1GU5 A;  1IO4 A;  1L0L K;  1Z56 A;  1KIL C;  5APT A;  4W7Z A;  3WMM 0;  3E1I A;  1YYC A;  4JYC A;  1IFD A;  3SWY A;  2XDJ A;  1IFN A;  3B5N D;  3KPE A;  1GD2 E;  1QL2 A;  1IFM A;  1JO5 A;  1SP4 A;  3M9H A;  2GM4 A;  2J59 M;  1NTM K;  3N4X A;  5AW9 B;  1XTC C;  1JTH A;  1L4A C;  4GIF A;  1N7L A;  2PP6 A;  1KFN A;  3BRT B;  2WZ7 A;  3V4W A;  5KJ7 D;  1AQ5 A;  1ZN5 A;  4EIJ A;  5CCH C;  3HUS B;  5BU8 B;  1H89 A;  3VTP C;  4WY4 A;  3HD7 C;  3NXS A;  1NTK K;  1FZB A;  1CZQ A;  1T2K C;  3IR9 A;  3TSI A;  3CI9 A;  1N73 B;  1W2E A;  4DZO A;  5KTB A;  1GW3 A;  3KDP B;  3VMY A;  1NO4 A;  1DH3 A;  4WB4 A;  1HH0 A;  2GUS A;  3LW5 H;  2A45 G;  3RK3 B;  2KLV A;  3BVH A;  2ZFC A;  4IFD K;  3KQG A;  1VDF A;  1JY2 P;  3SWF A;  2WPQ A;  3BAS A;  1GDT A;  4WY4 B;  4JF7 A;  3P8C E;  4LC1 A;  1DX7 A;  1S9K E;  3IFM A;  3RL0 D;  1LWU C;  2WT7 A;  1JMM A;  4C7N B;  2N1T B;  1KIL D;  3HE4 A;  2HG5 D;  1LTJ A;  3V2P A;  2PAJ A;  3C9I A;  1CW5 A;  2CPB A;  5APY A;  1RF1 B;  4HYT B;  1NU1 K;  1KZU B;  3L35 A;  1NAF A;  3CLQ A;  2OYI C;  1XTG B;  1JY3 N;  4I2L C;  3VP9 A;  1L4A D;  4AQR D;  3P8M C;  1LWU A;  2W6B A;  2CPS A;  3B8E B;  2Q9I A;  2H8P D;  4I1L A;  1N7S B;  1GL2 A;  1M1J A;  1X79 B;  1MFZ A;  1SFC A;  3II6 A;  5CCH D;  3A7O A;  1FZE A;  2XZR A;  3HD7 D;  3VMZ A;  4C7R A;  1N86 A;  3M9Q A;  2C9L Y;  1HWT C;  2P1J A;  3N7N A;  1JY3 P;  2OAR A;  1URQ B;  1NOH A;  3T97 A;  3VOP A;  4WBA A;  2Z5I A;  2E43 A;  4EOT A;  5AVW B;  2I1K A;  1JOC A;  5APQ A;  5CJ0 A;  1GL2 B;  1RE3 A;  1FBM A;  2HPC B;  3MIW A;  1GK6 A;  2KOG A;  2O1K A;  1SQQ K;  3RK3 C;  4GT1 A;  3M9B A;  2FXM A;  3U1C A;  1H88 A;  3H6P A;  3PP5 A;  1G2C B;  2R32 A;  3HUS A;  1JCC A;  4I6M C;  1G1J A;  1KQL A;  1LTI C;  2KB7 P;  5AVU B;  3P32 A;  1DEB A;  3R2P A;  1GZL A;  4WY4 C;  2Q7C A;  2R5D A;  1N73 A;  5AVS B;  1FJK A;  2VRS A;  2N1T C;  1T3J A;  2WIT A;  2XNX A;  5AVY B;  4ZKU A;  5AVR B;  1LT9 B;  3CL3 D;  3GHG B;  2I1J A;  1J2J B;  2OYH B;  4O9B A;  2WSC H;  3B5N B;  1NWQ A;  1LTS C;  1RY3 A;  2IPP A;  2L5G B;  1LTB C;  4W80 A;  2WTY A;  4KHX A;  1RF1 C;  1MUU A;  2BAS A;  1IFI A;  3U1A A;  4N6J A;  4IFF A;  5APV A;  5AVX B;  3H32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...