1ZLLA

Nmr structure of unphosphorylated human phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title The structure of phospholamban pentamer reveals a channel-like architecture in membranes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/signaling protein
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zllA00
1FJKA 2M3BA 2HYNA 1FJPA 2KYVA 2KB7P 1ZLLA 1N7LA
chains in the Genus database with same CATH superfamily
4CPGA 3GG2A 2A45H 4R4MA 4W7ZA 3S1KA 2JDIH 3K5BA 4WY4B 2KLVA 3WUUA 3L75J 1DEEG 3WUTA 1VF5B 2AEJA 3B8EB 3CX5H 2ZYAA 3AE5C 2K88A 3HUSB 2FYUD 4O9BA 3AE6C 2QE7H 1SLQA 1KQLA 5GTHE 3CCJP 3H1IJ 1GDTA 5DJUB 3L71D 4QMAA 3TGUE 1FZAA 2RH0A 2QA4P 2WWWA 1GU4A 3H1LJ 1K04A 1L0NJ 3S9OA 4IFMA 1LTJA 2QJKC 1AFOA 1X9VA 3MTUE 1JOCA 1KC8Q 3CXHH 1N73A 1A02J 1T2KD 4N78E 2FY8A 1JNMA 1SFCA 3R2PA 1JTHB 1KV4A 4BRYB 2WSFH 1LGHB 5AW8B 2M5AB 1PPJG 2ZT9D 2LKMA 2HODB 1SQVJ 5CBOA 3PP5A 4R4LA 4H0LD 4EYYQ 2E74C 3L70G 2QJKB 1SQBE 1SQPJ 2WPQA 3VP8A 2W8ZA 3CXHE 3CCEP 2KNCA 1GTWA 1NU1D 4RESB 1VQ9P 3L74E 4L74A 2KUBA 1IJDB 1YITP 1N7SC 1RF1C 3GHGC 1FJKA 2Y0CA 4TT3H 1KB9H 3N4XA 1DEBA 1QVGO 1R8EA 1RHZB 2WSCH 5DJTB 1NTMG 1BE3E 5AVUB 3TNUA 2BASA 3VMXA 2BCCE 1NTKE 1D7MA 3QWOC 1PIXA 1OX3A 1VQLP 3AEGC 1FOSF 1PFIA 1FZCA 2E75B 2ZFCA 1U7JA 4JQ0D 1RE4C 3B4SA 3BCCD 3Q2YA 3A0BH 2E43A 1N7SB 1RF1B 1RQUA 3CC2P 1JY3N 3CCRP 4OVNF 3L72G 2YKPA 4AYCA 2B88A 5CCHC 4Y99B 3MGNA 3H1HE 4WWIA 1NOHA 1NGMB 1CSBA 1JMMA 1GZLA 1G2CB 4RO0A 1BGYD 3R4YA 3AE9C 2KOGA 2OTKE 3H25A 2B9BA 3M0AA 2O01N 3B5ND 2WPVB 5CCGD 2YNYA 5AVWB 3V2NA 3A0BE 1OVUA 1CZQA 2Q5UA 5CHXA 3CMEP 3Q5SA 3KQGA 1SQQE 5CJ4A 3U1CA 1ZRTD 1FBMA 2NZ2A 1NTKJ 1HJ0A 1P84H 2I1KA 2P67A 3TGUD 1X8YA 2ZXEB 1Q81Q 1S9KE 3CCVP 1HTLC 4PV1C 5APXA 1GK6A 1M57D 1S1CX 2O3JA 2QM7A 2MKVA 2IZ1A 3L73G 1GU5A 1KFNA 2R44A 3M0DC 2OYIC 4U3FG 3L36A 3CC4P 5B66H 2WSCJ 3H1HJ 1VQKP 1WT6A 1DX7A 1YJ9P 4D6TG 1HBWA 5AVRB 2AXTE 2MJZA 3VYIA 1W5CE 2H89C 1RF0A 2ZVNB 3VMAA 1NTMK 4RJTA 2KZIA 1VQ6P 1L0LE 1OVRA 3A0HH 2A06E 1M7LA 3FGAD 3H1KJ 3KHUA 1TU3F 1KYOI 4PV1B 1NH4A 2XU6A 1U57A 3GHGA 1FE6A 3VMZA 1JY2N 2KYVA 1SQBD 2LR2A 5BU8B 3PHLA 3B5NA 5CCGA 3CCQP 3L74D 2HR3A 1S72P 2OYIB 2W6AA 2XDJA 3NMDA 5B66E 1NTZJ 1BCCJ 1PGQA 3AE2C 1M90Q 3LW5H 3CC7P 5KLVE 3CWBJ 3IF4A 1YTZT 5AVXB 1H0TB 1T8ZA 3CCLP 2C0WA 1Y8AA 1RE4A 1BE3D 1PP9G 5E79H 2Q9IA 1FS0E 1QVFO 1HF9A 1OW7A 5CCHA 1QL1A 1FDIA 4H44D 2YIUC 2WQYC 1ZP0C 4HJGH 1JCCA 3H6PA 2Z4EA 2KK7A 2WVRA 1NKNA 4L76A 1FOSE 1UIIA 1LTJC 5E79E 3WU2H 4OGQC 3RBZA 1N73C 1X22A 2QG4A 2AEMA 2K9JA 1JEKA 1SFCC 1MKMA 3AE3C 3EQ2A 1N2DC 1L4AD 2M8RA 4PD4I 3W67A 2H43A 2Q3IA 3D70A 1YHQP 2N1TD 3RL0g 2FYUJ 1Q90D 3P8CE 4KJMA 2Z5IA 1SQQD 3L71J 5KAIH 2YXRB 4GDOA 1VQOP 1WRGA 4JF7A 4MN4C 3WU2E 4OGQB 3L75G 1S9KD 2Q6QA 3CX5I 4LGDE 1N73B 2FFDA 3V4WA 1SQXK 1K9MQ 2IBZG 1URQD 1SFCB 1LJ2A 1DH3A 1IFNA 1FZGA 2FXMA 3U1AA 3NTNA 4JBZA 3H1IG 1KORA 2W83C 1KILD 3LW5J 2FXOA 3SWFA 2IDBA 2G8YA 3L73D 3UIAA 3EFGA 4XFJA 2WSEH 1SP4A 4PJ0E 3D71A 3HE4A 3H1LG 4YTPC 1NJIQ 4U3FD 1L0NG 1ZR4A 5GTIE 3RK2D 1GMJA 5AW9B 2KXPB 3CXHI 3VMYA 2Q3EA 5APWA 1L0LD 2IFNA 1JO5A 2I1JA 1FZCC 3CMAP 4AQRD 1BSNA 1T2KC 2Y9YA 4IFFA 5TISH 1NU1J 3L37A 3O8ZA 1LT1A 1L4AA 3FWNA 3AE1C 2LXBA 2Z5HA 2V7QH 3A2AA 3IR9A 3T97A 1LTAC 1R5LA 1SQVG 4U7JA 2ZT9C 2N1TA 3AE8C 2ZYDA 1VPCA 3TNUB 4B86A 4K3AA 5KLVD 4H0LC 1ZRTE 1PGPA 4BXLA 2HFED 1SQPG 4EIJA 3MHVA 3M9BA 2KS1A 2W90A 1JM0A 1FZCB 1N7LA 1QEXA 1AJYA 5TISE 1KB9I 2W27A 1YQ3C 2BEZF 4NPDA 1URQA 4WY4D 1IFMA 1FZFA 3M9HA 3BASA 2AXCA 3BCCJ 1KILA 2ZT9B 3BRVB 1YJNP 1EZVG 5AVZB 3F89A 4A7PA 3PTZA 3VOPA 3LIDA 1FZBA 1FDOA 2OQQA 2QEXP 2JEEA 2HPCA 2YXQB 1QGKB 1MV8A 1BGYJ 1KFMA 1K05A 3H1JG 4NPFX 1GK4A 1PPJE 1GL2D 2E76D 4W80A 3C8VA 3W68A 4IL6X 2WSEJ 1NKZB 5AVVB 3L70E 2W6JH 4YXWH 3FX0A 1GW3A 2KSJA 1RF0C 2KB7P 3P8CD 1L0NK 1EXJA 3O6QA 4OH8B 2IPPA 2FXPA 3TGUJ 1NAFA 2PRRA 3V4QA 1Q2NA 2XKMA 5KAFE 1MZ9A 3B5NC 1N8RQ 2ITAA 3A7OA 5CCGC 2V7QJ 3A5TA 3P32A 2FBWC 1NTME 1ZOYC 1QLED 2E74B 5AVYB 2IBZD 2HG5D 4WY4A 5KJ7D 1NYHA 5AW1B 1P84I 5APSA 1SQVK 4C46A 3HE5A 5APUA 4IL6H 2Q7CA 2GM4A 4JPZB 3CL3D 1CI6A 2M3BA 5AVQB 3GHGB 1FU1A 1SQPK 3MIWA 1T3JA 2KIKA 3L72E 4GODA 1K8AQ 1AA0A 1SQBJ 1UIXA 1GL2A 1S5LE 3HTKA 5KKZC 1JCDA 3IAOA 1MUUA 3CPWO 3H1HG 3A3YB 3L74J 2E75D 4IFDK 3IN6A 2OTJP 4IL6E 2WSFJ 3WMM0 2XNDH 1JTHA 3VTPC 1KZUB 1NO4A 3H1KG 1BSHA 1YQ4C 4YPCA 3B71A 1QL2A 2RN0A 3D6ZA 1N86A 5AVTB 3RK3E 1BE3J 1WMKA 2O1JA 2AXTH 4ZMDA 3RL0D 2BCCJ 4H13C 3TK1A 2KZJA 3NFQA 4GOEA 5KKZB 3Q5PA 1NTZG 1BCCG 5BVZA 3L35A 4I2LC 5APTA 2OYHA 4GIFA 4GOFA 2PGDA 5KJ7A 3CWBG 4N6JA 1LP1A 2ZXXA 4BWNA 1DIPA 1KILE 1USDA 3EFFK 4AUWA 1W2EA 3L73E 1FZEA 4WB4A 2FFDC 1EZVD 1IFPA 2K9JB 4I1LA 1VQPP 3KZIH 3CCMP 2Q1KA 4U3FE 1ZR2A 1A02F 3E1IA 5CMZA 1JUNA 3D6YA 1M8OB 4H13B 1PPJD 1MFTA 4H44C 3H1JD 1RY3A 1IO4A 2GA1A 4TLFA 1OVVA 2OARA 4EDFA 4HB1A 2E5TA 1SQXG 2JP3A 2NPSD 1LTBC 3L70D 2QVAA 1NTKK 3ABVC 5KTBA 4I7ZC 2CPBA 3GLMA 1SQQJ 3V2RA 5CJ0A 2RKLA 2WT7B 2B87A 2D2CD 3KZIE 3AEDC 2JJLA 3Q1MA 4KT0J 2GUVA 1L4AC 4LC1A 2R3SA 1YTZI 2O1KA 2PP6A 4H44B 2FYUG 1K73Q 1AVYA 3MZWB 2N1TC 2GUSA 1NTMD 4C7NA 1PP9E 2M0BA 3HE4B 1Q82Q 1T6AA 3L71G 1PL5A 3HD7D 2ZJSE 1G1IA 1FC2C 4I7ZB 3TYYA 1RQVA 4U3FJ 1ZV8A 1LT9A 5EFWB 3E7KA 1IFDA 2K9YA 3TDKA 1LNQA 1SVFA 1L0LJ 1OFCX 1URQC 3CI9A 3CCSP 1L4AB 2KI7B 3H32A 3GF7A 3L72D 5C39A 4UB6H 1KD1Q 2Y0DA 1KILC 3T97B 3V6IA 1NTZK 1M1KQ 1FJPA 4Y28J 2NPSA 3AEEC 2ZVOB 3RK2C 5AW6B 1EC5A 1AVOA 2YIUB 5KLVJ 2R5DA 2G3AA 2KS1B 2QJYC 2OGUA 4PJ0H 5AW2B 3N7NA 3C1LA 3RK3D 2A45I 1URQB 1NU1G 5GTIH 3AEBC 1LTJB 2K1AA 1OMIA 1OZHA 4IOIH 4UB6E 5B5EE 1RE3A 1L2PA 1KMIZ 1VQNP 1M56D 3L75E 3P8MC 1H8AA 5K5GB 3I5CA 1BCCD 2IBZE 1ZXGA 4GT1A 3HD7A 2K37A 5H2FE 3H1IE 1HUCA 1NHLA 1Z56A 2QJYB 1PZQA 1ZMEC 2RMZA 1EDJA 3IFMA 1MFZA 1DD4A 1L0NE 4WY4C 4NPEA 3V2PA 1LTIC 2BEQD 4D6TD 1M1JA 5AW7B 1VQ4P 3OJAB 3CD6P 1VDFA 2QM8A 3BCCG 4EI2A 2WZ7A 4EOTA 3P7KA 2FYUK 3FXDA 1H89A 3G71P 1T3UA 2KNCB 2VRSA 3C9IA 3O6QB 2NRGA 1HVVA 1S3JA 1SQXD 1NAYA 3BVHA 2ZAEB 4I6MC 1BDCA 1BGYG 1IZNB 2K3RA 2W6BA 1EDLA 1LWUA 1EQ7A 1SQVE 1U7MA 1GL2C 2E76C 1IK9A 2C9LY 1OXZA 1AV1A 3HE5B 1SQPE 3F5HA 1PP9D 1SS1A 1S4XA 1IC2A 1CI6B 1YIJP 3TGUG 2Y0EA 2J58A 1IFJA 1VF5D 4PD4E 3BATA 2KLUA 4JYCA 3S4RA 2SPZA 3Q3DA 2QIWA 3M91A 3KYQA 4DOJA 2FYNC 3WUVA 4UB8H 2I8DA 2A45G 3NXSA 5APQA 1GL2B 3HTKB 1USEA 3SWYA 1NU1K 4RKUJ 2E76B 1EZVE 3EWKA 1VQ7P 4ASWA 4H0LB 2R32A 3KDPB 2LXCB 2OYHC 1R5SA 3MUDA 2P10A 2PAJA 5KJ7C 1S5LX 2YKOA 4Z1MH 2JKVA 1X0TA 2P2UA 3CX5E 1OIPA 5KAFH 3H1JE 3OAKA 1ZN5A 2KP8A 1Y47A 5AW3B 4GKGA 1HGZA 4W7YA 2KSEA 2FYNB 4UB8E 2WPRA 4XA4A 1SQBG 1LTGC 4L75A 1XTCC 2V4HA 4XE5B 2WMMA 2OYHB 3U59A 3L74G 3HRNA 3I56P 1S2EA 2UWJE 5APVA 1LP1B 2XV5A 2E75C 3SFEC 1EDIA 3GF3A 1KYOD 2H8PD 3L75D 1S5LH 2N9YB 4C7RA 1Q86Q 2L91A 4HH2A 2WSSH 4Y99C 2OYOA 1BE3G 1VL2A 1HGVA 1EXIA 2BCCG 1NTKG 3RL0C 3H1ID 1W2BO 1NVOA 2L5GB 5AW0B 2HYNA 4KHXA 3HUSA 2FKWB 1JY3O 1E5WA 2H7HA 2DW3A 3I55P 3H1LD 1L0ND 1OW6A 3H1JJ 3TF5A 4DJGA 2YO3A 3B5NB 2E74D 2P7JA 3M06A 1LT9C 2B89A 2N9BA 1H88A 3L70J 5AVSB 4ASVA 1J2JB 4DT0A 1LTTC 1KB9E 2B87B 3PRJA 2IYOA 1JB0J 3FXEA 1N7SD 3RL0B 3V2QA 1SQVD 4BRYA 3JC22 3VP9A 1HWTC 4C7NB 2M5AA 1NWQA 3H1KE 4DCKA 2R3CA 2HODA 2YMYA 2NPSC 1FDMA 1NTMJ 3GW6A 1SQPD 2FYZA 1SQQG 4DZOA 1LT9B 1YI2P 4ZKUA 1YYCA 3CLQA 5AW4B 2JR8A 1YBKA 2D2CC 2IYPA 3JCUH 2YMKA 1NTZE 4PD4D 1BCCE 3H32B 3CWBE 2POHA 1SQBK 3AEFC 1EDKA 1RE3C 2E5YA 5CCHD 3L72J 2NPSB 1ZLLA 4D6TE 3HD7C 4N78D 3V5BA 2J5UA 3KXDA 3CX5D 2CK3H 3OW2O 1Y9BA 2IZ0A 1JY2O 3TSIA 2H88C 3JCUE 1G1JA 2AEFA 2D2CB 1CW5A 1L0LG 1PGJA 3QH9A 1P84E 2E42A 2A06G 1SQXE 1HH0A 3CCUP 1M1JC 1Q7YQ 1N7SA 1RF1A 4WVZA 1AQTA 3MP7B 2FFDB 2WITA 3FWLA 1XTGB 5APYA 2IBZI 4H13D 1DD3A 4N3YB 1VQ8P 3CXHD 2O01H 1IK7A 3HD7B 1G2CA 3ZDMA 4PV1D 1VQMP 5KLVG 1LWUC 1X79B 2FYUE 1ZW0A 2C9NY 4M3LA 3RK3C 3L73J 5AW5B 3L71E 3A0HE 1M1JB 2BCCD 2CPSA 1NTKD 1FAVA 4HKZH 1PGOA 4D6TJ 2C0XA 1JMBA 3L4FA 2IFMA 3JSVC 3G9RA 1JY3P 3M9QA 5TJHA 1OW8A 1IFIA 3SSUA 1LTSC 3E1RA 1SQQK 2XZRA 4LLHA 1RH5B 2P58A 2J59M 5B5EH 3VN0A 1LWUB 3PJSK 1KQFB 2N1TB 1SQXJ 1KB9D 1KYOH 5CBNA 3H1HD 4HYTB 3RK3B 1AQ5A 2P1JA 3MUDC 3USSA 1GD2E 3SFDC 1HJBA 4K35A 1QX8A 2OTLP 1E79H 1OWAA 5H2FH 3AE4C 3AE7C 2PFXA 3PH0A 1VQ5P 3H1KD 1J1EC 3RBXA 3ITKA 2YO2A 4ZNCA 3SWKA 2M3EA 1PP9J 1KQGB 1NU1E 1PV3A 5BU5A 2JO1A 1J1DC 3G6EP 1GW4A 1KILB 2ZYGA 2HLOA 3PLNA 3KPEA 1KYOE 2WTYA 1EZVI 1L0LK 1NTZD 3Q5RA 3RK2B 3M0DA 2OYIA 2WT7A 3CWBD 2XNXA 1BDDA 2HPCB 2IX7C 4OWFA 4ZKPA 4WBAA 1YJWP 5M1BA 3MD0A 2QJPC 2O01J 3II6A 1KN7A 5KLIC 4L73A 3G4SP 1H0TA 3AECC 1J1EB 3H1LE 4OGQD 3G3ZA 1KTMA 1VF5C 1J1DB 5KLVK 2JWAA 3GMAA 2WPSA 2JWDA 1SFCD 3BCCE 2R5BA 5KAIE 3HUSC 1JY2P 4YXDC 1KQSO 3BRTB 1P84D 2Y9ZA 5GTHH 3AEAC 2QRXA 4PD4H 3OA7A 2QSIA 2A06D 3RGUA 5L8RJ 3LIEA 2QJPB 2YKQA 1BGYE 4JYBA 5KLIB
chains in the Genus database with same CATH topology
1FOSE 1LTJC 2H8PD 4AUWA 4C7RA 1W2EA 2A45H 4W7ZA 4HH2A 4WY4B 1FZEA 2KLVA 4WB4A 1N73C 2FFDC 4I1LA 4Y99C 1ZR2A 1A02F 3E1IA 1HGVA 5CMZA 3B8EB 1SFCC 1JUNA 3RL0C 3EQ2A 1N2DC 1L4AD 2L5GB 2M8RA 5AW0B 2HYNA 3HUSB 4KHXA 4O9BA 3HUSA 2FKWB 2H43A 1JY3O 1RY3A 1E5WA 1KQLA 1SLQA 2Q3IA 2H7HA 1GDTA 1IO4A 2N1TD 2OARA 3P8CE 1FZAA 2NPSD 2Z5IA 2WWWA 1LTBC 1NTKK 1GU4A 2YO3A 5KTBA 3B5NB 2P7JA 1WRGA 3M06A 1LT9C 2CPBA 4JF7A 4IFMA 1LTJA 2N9BA 3V2RA 1H88A 5AVSB 5CJ0A 1AFOA 1J2JB 1LTTC 2WT7B 1X9VA 1S9KD 3MTUE 4LGDE 1N73B 1JOCA 2JJLA 1N73A 2FFDA 1A02J 3V4WA 1SQXK 1T2KD 2GUVA 4N78E 1JNMA 1URQD 1SFCB 1N7SD 1SFCA 3R2PA 3RL0B 1JTHB 1L4AC 4LC1A 1DH3A 1IFNA 3V2QA 1YTZI 2O1KA 2PP6A 1FZGA 2FXMA 2WSFH 3U1AA 3NTNA 1LGHB 1KILD 5AW8B 3VP9A 3SWFA 1HWTC 4C7NB 2N1TC 1NWQA 2GUSA 4C7NA 2LKMA 2HODB 3UIAA 3EFGA 2R3CA 1SP4A 2WSEH 2HODA 3HE4B 2YMYA 3HE4A 2NPSC 1FDMA 3HD7D 3PP5A 1ZR4A 1G1IA 3RK2D 2FYZA 5AW9B 4DZOA 3TYYA 1LT9B 3VMYA 1ZV8A 1LT9A 1IFDA 4ZKUA 1YYCA 5APWA 2WPQA 3CLQA 3VP8A 5AW4B 2IFNA 1JO5A 2I1JA 1FZCC 1GTWA 1SVFA 4RESB 4AQRD 1T2KC 1URQC 4IFFA 1IJDB 3CI9A 1N7SC 3H32B 2POHA 3L37A 1L4AB 3O8ZA 1SQBK 3H32A 1L4AA 1RF1C 2Z5HA 3GHGC 1FJKA 1RE3C 1KILC 3A2AA 3IR9A 3N4XA 1NTZK 1LTAC 3T97A 1DEBA 5CCHD 2N1TA 2WSCH 1VPCA 3TNUB 2NPSB 1FJPA 5AVUB 3TNUA 2NPSA 1ZLLA 4B86A 2BASA 3VMXA 3HD7C 4N78D 3V5BA 3RK2C 5AW6B 1JY2O 2HFED 3TSIA 4EIJA 2R5DA 3M9BA 1G1JA 1FOSF 1FZCB 1CW5A 1N7LA 5AW2B 3N7NA 1PFIA 1FZCA 2E42A 2ZFCA 3RK3D 2A45I 1RE4C 1HH0A 1URQB 2W27A 2E43A 1M1JC 1URQA 4WY4D 1IFMA 1N7SB 1FZFA 1LTJB 3M9HA 1N7SA 3BASA 1RF1B 1RF1A 1JY3N 1RE3A 2YKPA 4AYCA 1KILA 2FFDB 2WITA 1XTGB 5APYA 5CCHC 4Y99B 3MGNA 3BRVB 1NOHA 4N3YB 3P8MC 1CSBA 1H8AA 1JMMA 2O01H 1GZLA 3I5CA 1G2CB 3HD7B 5AVZB 1G2CA 3HD7A 4GT1A 3VOPA 3LIDA 1FZBA 2KOGA 2JEEA 2HPCA 1LWUC 1MV8A 1X79B 3M0AA 1KFMA 1HUCA 1NHLA 1Z56A 1GK4A 3B5ND 1GL2D 5CCGD 2YNYA 2C9NY 3IFMA 5AVWB 4W80A 3V2NA 4M3LA 3RK3C 5AW5B 1MFZA 1M1JB 1CZQA 2Q5UA 4WY4C 3V2PA 1LTIC 1M1JA 5AW7B 3OJAB 5CHXA 1VDFA 2QM8A 1NKZB 2WZ7A 2CPSA 4EOTA 1FAVA 3KQGA 3P7KA 5AVVB 2FYUK 1H89A 5CJ4A 3U1CA 1GW3A 1T3UA 2KSJA 2VRSA 1RF0C 2C0XA 1FBMA 3L4FA 2IFMA 2KB7P 1JY3P 2I1KA 3P8CD 2P67A 3C9IA 3M9QA 1L0NK 1X8YA 2ZXEB 1IFIA 1LTSC 1HVVA 1S9KE 4OH8B 2IPPA 1SQQK 2XZRA 4LLHA 1HTLC 5APXA 1GK6A 1NAFA 3BVHA 4I6MC 2J59M 3V4QA 3VN0A 2QM7A 1LWUB 2W6BA 2XKMA 2N1TB 1LWUA 1MZ9A 1EQ7A 3B5NC 3A7OA 1GL2C 5CCGC 1GU5A 1KFNA 1IK9A 3A5TA 4HYTB 3RK3B 3P32A 2C9LY 3M0DC 2OYIC 1AQ5A 2P1JA 1OXZA 3L36A 1GD2E 5AVYB 1HJBA 2HG5D 4WY4A 5KJ7D 5AW1B 1WT6A 5APSA 1DX7A 1OWAA 1HBWA 1SQVK 4C46A 3HE5B 5AVRB 2MJZA 3VYIA 3HE5A 5APUA 1RF0A 2Q7CA 2GM4A 1NTMK 1J1EC 2YO2A 1IC2A 1CI6B 3CL3D 1M7LA 1CI6A 2M3BA 5AVQB 2J58A 5BU5A 1IFJA 1J1DC 3GHGB 1FU1A 3BATA 1GW4A 1SQPK 1NH4A 2XU6A 3GHGA 4JYCA 1KILB 3VMZA 1JY2N 2HLOA 3MIWA 1T3JA 2KYVA 3M91A 3KYQA 3KPEA 4DOJA 2WTYA 5BU8B 1L0LK 2A45G 3NXSA 3B5NA 5APQA 1GL2B 3HTKB 1GL2A 1NU1K 3SWYA 5CCGA 3HTKA 1JCDA 2OYIB 3RK2B 2R32A 3KDPB 3M0DA 2OYHC 2OYIA 1MUUA 2W6AA 2XDJA 3NMDA 2WT7A 3MUDA 2XNXA 2HPCB 2IX7C 2PAJA 5KJ7C 3A3YB 4ZKPA 4WBAA 2YKOA 3LW5H 3MD0A 4IFDK 3II6A 2P2UA 1YTZT 5AVXB 3OAKA 3WMM0 1T8ZA 1JTHA 2C0WA 3VTPC 1KZUB 1J1EB 1NO4A 1ZN5A 1RE4A 2KP8A 3G3ZA 1QL2A 1N86A 4GKGA 5AW3B 1J1DB 1HGZA 5KLVK 5AVTB 2Q9IA 2O1JA 4W7YA 2WPSA 1SFCD 3RL0D 2R5BA 5CCHA 2WPRA 3TK1A 4XA4A 1QL1A 3HUSC 1JY2P 3NFQA 1LTGC 3BRTB 1XTCC 4XE5B 2OYHB 3U59A 5BVZA 3L35A 4I2LC 5APTA 2OYHA 4GIFA 3HRNA 3OA7A 5APVA 5KJ7A 1JCCA 3H6PA 2Z4EA 2XV5A 3LIEA 4N6JA 2YKQA 4JYBA 1NKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJK A;  2M3B A;  2HYN A;  1FJP A;  2KYV A;  2KB7 P;  1ZLL A;  1N7L A; 
#chains in the Genus database with same CATH topology
 4CPG A;  3GG2 A;  2A45 H;  4R4M A;  4W7Z A;  3S1K A;  2JDI H;  3K5B A;  4WY4 B;  2KLV A;  3WUU A;  3L75 J;  1DEE G;  3WUT A;  1VF5 B;  2AEJ A;  3B8E B;  3CX5 H;  2ZYA A;  3AE5 C;  2K88 A;  3HUS B;  2FYU D;  4O9B A;  3AE6 C;  2QE7 H;  1SLQ A;  1KQL A;  5GTH E;  3CCJ P;  3H1I J;  1GDT A;  5DJU B;  3L71 D;  4QMA A;  3TGU E;  1FZA A;  2RH0 A;  2QA4 P;  2WWW A;  1GU4 A;  3H1L J;  1K04 A;  1L0N J;  3S9O A;  4IFM A;  1LTJ A;  2QJK C;  1AFO A;  1X9V A;  3MTU E;  1JOC A;  1KC8 Q;  3CXH H;  1N73 A;  1A02 J;  1T2K D;  4N78 E;  2FY8 A;  1JNM A;  1SFC A;  3R2P A;  1JTH B;  1KV4 A;  4BRY B;  2WSF H;  1LGH B;  5AW8 B;  2M5A B;  1PPJ G;  2ZT9 D;  2LKM A;  2HOD B;  1SQV J;  5CBO A;  3PP5 A;  4R4L A;  4H0L D;  4EYY Q;  2E74 C;  3L70 G;  2QJK B;  1SQB E;  1SQP J;  2WPQ A;  3VP8 A;  2W8Z A;  3CXH E;  3CCE P;  2KNC A;  1GTW A;  1NU1 D;  4RES B;  1VQ9 P;  3L74 E;  4L74 A;  2KUB A;  1IJD B;  1YIT P;  1N7S C;  1RF1 C;  3GHG C;  1FJK A;  2Y0C A;  4TT3 H;  1KB9 H;  3N4X A;  1DEB A;  1QVG O;  1R8E A;  1RHZ B;  2WSC H;  5DJT B;  1NTM G;  1BE3 E;  5AVU B;  3TNU A;  2BAS A;  3VMX A;  2BCC E;  1NTK E;  1D7M A;  3QWO C;  1PIX A;  1OX3 A;  1VQL P;  3AEG C;  1FOS F;  1PFI A;  1FZC A;  2E75 B;  2ZFC A;  1U7J A;  4JQ0 D;  1RE4 C;  3B4S A;  3BCC D;  3Q2Y A;  3A0B H;  2E43 A;  1N7S B;  1RF1 B;  1RQU A;  3CC2 P;  1JY3 N;  3CCR P;  4OVN F;  3L72 G;  2YKP A;  4AYC A;  2B88 A;  5CCH C;  4Y99 B;  3MGN A;  3H1H E;  4WWI A;  1NOH A;  1NGM B;  1CSB A;  1JMM A;  1GZL A;  1G2C B;  4RO0 A;  1BGY D;  3R4Y A;  3AE9 C;  2KOG A;  2OTK E;  3H25 A;  2B9B A;  3M0A A;  2O01 N;  3B5N D;  2WPV B;  5CCG D;  2YNY A;  5AVW B;  3V2N A;  3A0B E;  1OVU A;  1CZQ A;  2Q5U A;  5CHX A;  3CME P;  3Q5S A;  3KQG A;  1SQQ E;  5CJ4 A;  3U1C A;  1ZRT D;  1FBM A;  2NZ2 A;  1NTK J;  1HJ0 A;  1P84 H;  2I1K A;  2P67 A;  3TGU D;  1X8Y A;  2ZXE B;  1Q81 Q;  1S9K E;  3CCV P;  1HTL C;  4PV1 C;  5APX A;  1GK6 A;  1M57 D;  1S1C X;  2O3J A;  2QM7 A;  2MKV A;  2IZ1 A;  3L73 G;  1GU5 A;  1KFN A;  2R44 A;  3M0D C;  2OYI C;  4U3F G;  3L36 A;  3CC4 P;  5B66 H;  2WSC J;  3H1H J;  1VQK P;  1WT6 A;  1DX7 A;  1YJ9 P;  4D6T G;  1HBW A;  5AVR B;  2AXT E;  2MJZ A;  3VYI A;  1W5C E;  2H89 C;  1RF0 A;  2ZVN B;  3VMA A;  1NTM K;  4RJT A;  2KZI A;  1VQ6 P;  1L0L E;  1OVR A;  3A0H H;  2A06 E;  1M7L A;  3FGA D;  3H1K J;  3KHU A;  1TU3 F;  1KYO I;  4PV1 B;  1NH4 A;  2XU6 A;  1U57 A;  3GHG A;  1FE6 A;  3VMZ A;  1JY2 N;  2KYV A;  1SQB D;  2LR2 A;  5BU8 B;  3PHL A;  3B5N A;  5CCG A;  3CCQ P;  3L74 D;  2HR3 A;  1S72 P;  2OYI B;  2W6A A;  2XDJ A;  3NMD A;  5B66 E;  1NTZ J;  1BCC J;  1PGQ A;  3AE2 C;  1M90 Q;  3LW5 H;  3CC7 P;  5KLV E;  3CWB J;  3IF4 A;  1YTZ T;  5AVX B;  1H0T B;  1T8Z A;  3CCL P;  2C0W A;  1Y8A A;  1RE4 A;  1BE3 D;  1PP9 G;  5E79 H;  2Q9I A;  1FS0 E;  1QVF O;  1HF9 A;  1OW7 A;  5CCH A;  1QL1 A;  1FDI A;  4H44 D;  2YIU C;  2WQY C;  1ZP0 C;  4HJG H;  1JCC A;  3H6P A;  2Z4E A;  2KK7 A;  2WVR A;  1NKN A;  4L76 A;  1FOS E;  1UII A;  1LTJ C;  5E79 E;  3WU2 H;  4OGQ C;  3RBZ A;  1N73 C;  1X22 A;  2QG4 A;  2AEM A;  2K9J A;  1JEK A;  1SFC C;  1MKM A;  3AE3 C;  3EQ2 A;  1N2D C;  1L4A D;  2M8R A;  4PD4 I;  3W67 A;  2H43 A;  2Q3I A;  3D70 A;  1YHQ P;  2N1T D;  3RL0 g;  2FYU J;  1Q90 D;  3P8C E;  4KJM A;  2Z5I A;  1SQQ D;  3L71 J;  5KAI H;  2YXR B;  4GDO A;  1VQO P;  1WRG A;  4JF7 A;  4MN4 C;  3WU2 E;  4OGQ B;  3L75 G;  1S9K D;  2Q6Q A;  3CX5 I;  4LGD E;  1N73 B;  2FFD A;  3V4W A;  1SQX K;  1K9M Q;  2IBZ G;  1URQ D;  1SFC B;  1LJ2 A;  1DH3 A;  1IFN A;  1FZG A;  2FXM A;  3U1A A;  3NTN A;  4JBZ A;  3H1I G;  1KOR A;  2W83 C;  1KIL D;  3LW5 J;  2FXO A;  3SWF A;  2IDB A;  2G8Y A;  3L73 D;  3UIA A;  3EFG A;  4XFJ A;  2WSE H;  1SP4 A;  4PJ0 E;  3D71 A;  3HE4 A;  3H1L G;  4YTP C;  1NJI Q;  4U3F D;  1L0N G;  1ZR4 A;  5GTI E;  3RK2 D;  1GMJ A;  5AW9 B;  2KXP B;  3CXH I;  3VMY A;  2Q3E A;  5APW A;  1L0L D;  2IFN A;  1JO5 A;  2I1J A;  1FZC C;  3CMA P;  4AQR D;  1BSN A;  1T2K C;  2Y9Y A;  4IFF A;  5TIS H;  1NU1 J;  3L37 A;  3O8Z A;  1LT1 A;  1L4A A;  3FWN A;  3AE1 C;  2LXB A;  2Z5H A;  2V7Q H;  3A2A A;  3IR9 A;  3T97 A;  1LTA C;  1R5L A;  1SQV G;  4U7J A;  2ZT9 C;  2N1T A;  3AE8 C;  2ZYD A;  1VPC A;  3TNU B;  4B86 A;  4K3A A;  5KLV D;  4H0L C;  1ZRT E;  1PGP A;  4BXL A;  2HFE D;  1SQP G;  4EIJ A;  3MHV A;  3M9B A;  2KS1 A;  2W90 A;  1JM0 A;  1FZC B;  1N7L A;  1QEX A;  1AJY A;  5TIS E;  1KB9 I;  2W27 A;  1YQ3 C;  2BEZ F;  4NPD A;  1URQ A;  4WY4 D;  1IFM A;  1FZF A;  3M9H A;  3BAS A;  2AXC A;  3BCC J;  1KIL A;  2ZT9 B;  3BRV B;  1YJN P;  1EZV G;  5AVZ B;  3F89 A;  4A7P A;  3PTZ A;  3VOP A;  3LID A;  1FZB A;  1FDO A;  2OQQ A;  2QEX P;  2JEE A;  2HPC A;  2YXQ B;  1QGK B;  1MV8 A;  1BGY J;  1KFM A;  1K05 A;  3H1J G;  4NPF X;  1GK4 A;  1PPJ E;  1GL2 D;  2E76 D;  4W80 A;  3C8V A;  3W68 A;  4IL6 X;  2WSE J;  1NKZ B;  5AVV B;  3L70 E;  2W6J H;  4YXW H;  3FX0 A;  1GW3 A;  2KSJ A;  1RF0 C;  2KB7 P;  3P8C D;  1L0N K;  1EXJ A;  3O6Q A;  4OH8 B;  2IPP A;  2FXP A;  3TGU J;  1NAF A;  2PRR A;  3V4Q A;  1Q2N A;  2XKM A;  5KAF E;  1MZ9 A;  3B5N C;  1N8R Q;  2ITA A;  3A7O A;  5CCG C;  2V7Q J;  3A5T A;  3P32 A;  2FBW C;  1NTM E;  1ZOY C;  1QLE D;  2E74 B;  5AVY B;  2IBZ D;  2HG5 D;  4WY4 A;  5KJ7 D;  1NYH A;  5AW1 B;  1P84 I;  5APS A;  1SQV K;  4C46 A;  3HE5 A;  5APU A;  4IL6 H;  2Q7C A;  2GM4 A;  4JPZ B;  3CL3 D;  1CI6 A;  2M3B A;  5AVQ B;  3GHG B;  1FU1 A;  1SQP K;  3MIW A;  1T3J A;  2KIK A;  3L72 E;  4GOD A;  1K8A Q;  1AA0 A;  1SQB J;  1UIX A;  1GL2 A;  1S5L E;  3HTK A;  5KKZ C;  1JCD A;  3IAO A;  1MUU A;  3CPW O;  3H1H G;  3A3Y B;  3L74 J;  2E75 D;  4IFD K;  3IN6 A;  2OTJ P;  4IL6 E;  2WSF J;  3WMM 0;  2XND H;  1JTH A;  3VTP C;  1KZU B;  1NO4 A;  3H1K G;  1BSH A;  1YQ4 C;  4YPC A;  3B71 A;  1QL2 A;  2RN0 A;  3D6Z A;  1N86 A;  5AVT B;  3RK3 E;  1BE3 J;  1WMK A;  2O1J A;  2AXT H;  4ZMD A;  3RL0 D;  2BCC J;  4H13 C;  3TK1 A;  2KZJ A;  3NFQ A;  4GOE A;  5KKZ B;  3Q5P A;  1NTZ G;  1BCC G;  5BVZ A;  3L35 A;  4I2L C;  5APT A;  2OYH A;  4GIF A;  4GOF A;  2PGD A;  5KJ7 A;  3CWB G;  4N6J A;  1LP1 A;  2ZXX A;  4BWN A;  1DIP A;  1KIL E;  1USD A;  3EFF K;  4AUW A;  1W2E A;  3L73 E;  1FZE A;  4WB4 A;  2FFD C;  1EZV D;  1IFP A;  2K9J B;  4I1L A;  1VQP P;  3KZI H;  3CCM P;  2Q1K A;  4U3F E;  1ZR2 A;  1A02 F;  3E1I A;  5CMZ A;  1JUN A;  3D6Y A;  1M8O B;  4H13 B;  1PPJ D;  1MFT A;  4H44 C;  3H1J D;  1RY3 A;  1IO4 A;  2GA1 A;  4TLF A;  1OVV A;  2OAR A;  4EDF A;  4HB1 A;  2E5T A;  1SQX G;  2JP3 A;  2NPS D;  1LTB C;  3L70 D;  2QVA A;  1NTK K;  3ABV C;  5KTB A;  4I7Z C;  2CPB A;  3GLM A;  1SQQ J;  3V2R A;  5CJ0 A;  2RKL A;  2WT7 B;  2B87 A;  2D2C D;  3KZI E;  3AED C;  2JJL A;  3Q1M A;  4KT0 J;  2GUV A;  1L4A C;  4LC1 A;  2R3S A;  1YTZ I;  2O1K A;  2PP6 A;  4H44 B;  2FYU G;  1K73 Q;  1AVY A;  3MZW B;  2N1T C;  2GUS A;  1NTM D;  4C7N A;  1PP9 E;  2M0B A;  3HE4 B;  1Q82 Q;  1T6A A;  3L71 G;  1PL5 A;  3HD7 D;  2ZJS E;  1G1I A;  1FC2 C;  4I7Z B;  3TYY A;  1RQV A;  4U3F J;  1ZV8 A;  1LT9 A;  5EFW B;  3E7K A;  1IFD A;  2K9Y A;  3TDK A;  1LNQ A;  1SVF A;  1L0L J;  1OFC X;  1URQ C;  3CI9 A;  3CCS P;  1L4A B;  2KI7 B;  3H32 A;  3GF7 A;  3L72 D;  5C39 A;  4UB6 H;  1KD1 Q;  2Y0D A;  1KIL C;  3T97 B;  3V6I A;  1NTZ K;  1M1K Q;  1FJP A;  4Y28 J;  2NPS A;  3AEE C;  2ZVO B;  3RK2 C;  5AW6 B;  1EC5 A;  1AVO A;  2YIU B;  5KLV J;  2R5D A;  2G3A A;  2KS1 B;  2QJY C;  2OGU A;  4PJ0 H;  5AW2 B;  3N7N A;  3C1L A;  3RK3 D;  2A45 I;  1URQ B;  1NU1 G;  5GTI H;  3AEB C;  1LTJ B;  2K1A A;  1OMI A;  1OZH A;  4IOI H;  4UB6 E;  5B5E E;  1RE3 A;  1L2P A;  1KMI Z;  1VQN P;  1M56 D;  3L75 E;  3P8M C;  1H8A A;  5K5G B;  3I5C A;  1BCC D;  2IBZ E;  1ZXG A;  4GT1 A;  3HD7 A;  2K37 A;  5H2F E;  3H1I E;  1HUC A;  1NHL A;  1Z56 A;  2QJY B;  1PZQ A;  1ZME C;  2RMZ A;  1EDJ A;  3IFM A;  1MFZ A;  1DD4 A;  1L0N E;  4WY4 C;  4NPE A;  3V2P A;  1LTI C;  2BEQ D;  4D6T D;  1M1J A;  5AW7 B;  1VQ4 P;  3OJA B;  3CD6 P;  1VDF A;  2QM8 A;  3BCC G;  4EI2 A;  2WZ7 A;  4EOT A;  3P7K A;  2FYU K;  3FXD A;  1H89 A;  3G71 P;  1T3U A;  2KNC B;  2VRS A;  3C9I A;  3O6Q B;  2NRG A;  1HVV A;  1S3J A;  1SQX D;  1NAY A;  3BVH A;  2ZAE B;  4I6M C;  1BDC A;  1BGY G;  1IZN B;  2K3R A;  2W6B A;  1EDL A;  1LWU A;  1EQ7 A;  1SQV E;  1U7M A;  1GL2 C;  2E76 C;  1IK9 A;  2C9L Y;  1OXZ A;  1AV1 A;  3HE5 B;  1SQP E;  3F5H A;  1PP9 D;  1SS1 A;  1S4X A;  1IC2 A;  1CI6 B;  1YIJ P;  3TGU G;  2Y0E A;  2J58 A;  1IFJ A;  1VF5 D;  4PD4 E;  3BAT A;  2KLU A;  4JYC A;  3S4R A;  2SPZ A;  3Q3D A;  2QIW A;  3M91 A;  3KYQ A;  4DOJ A;  2FYN C;  3WUV A;  4UB8 H;  2I8D A;  2A45 G;  3NXS A;  5APQ A;  1GL2 B;  3HTK B;  1USE A;  3SWY A;  1NU1 K;  4RKU J;  2E76 B;  1EZV E;  3EWK A;  1VQ7 P;  4ASW A;  4H0L B;  2R32 A;  3KDP B;  2LXC B;  2OYH C;  1R5S A;  3MUD A;  2P10 A;  2PAJ A;  5KJ7 C;  1S5L X;  2YKO A;  4Z1M H;  2JKV A;  1X0T A;  2P2U A;  3CX5 E;  1OIP A;  5KAF H;  3H1J E;  3OAK A;  1ZN5 A;  2KP8 A;  1Y47 A;  5AW3 B;  4GKG A;  1HGZ A;  4W7Y A;  2KSE A;  2FYN B;  4UB8 E;  2WPR A;  4XA4 A;  1SQB G;  1LTG C;  4L75 A;  1XTC C;  2V4H A;  4XE5 B;  2WMM A;  2OYH B;  3U59 A;  3L74 G;  3HRN A;  3I56 P;  1S2E A;  2UWJ E;  5APV A;  1LP1 B;  2XV5 A;  2E75 C;  3SFE C;  1EDI A;  3GF3 A;  1KYO D;  2H8P D;  3L75 D;  1S5L H;  2N9Y B;  4C7R A;  1Q86 Q;  2L91 A;  4HH2 A;  2WSS H;  4Y99 C;  2OYO A;  1BE3 G;  1VL2 A;  1HGV A;  1EXI A;  2BCC G;  1NTK G;  3RL0 C;  3H1I D;  1W2B O;  1NVO A;  2L5G B;  5AW0 B;  2HYN A;  4KHX A;  3HUS A;  2FKW B;  1JY3 O;  1E5W A;  2H7H A;  2DW3 A;  3I55 P;  3H1L D;  1L0N D;  1OW6 A;  3H1J J;  3TF5 A;  4DJG A;  2YO3 A;  3B5N B;  2E74 D;  2P7J A;  3M06 A;  1LT9 C;  2B89 A;  2N9B A;  1H88 A;  3L70 J;  5AVS B;  4ASV A;  1J2J B;  4DT0 A;  1LTT C;  1KB9 E;  2B87 B;  3PRJ A;  2IYO A;  1JB0 J;  3FXE A;  1N7S D;  3RL0 B;  3V2Q A;  1SQV D;  4BRY A;  3JC2 2;  3VP9 A;  1HWT C;  4C7N B;  2M5A A;  1NWQ A;  3H1K E;  4DCK A;  2R3C A;  2HOD A;  2YMY A;  2NPS C;  1FDM A;  1NTM J;  3GW6 A;  1SQP D;  2FYZ A;  1SQQ G;  4DZO A;  1LT9 B;  1YI2 P;  4ZKU A;  1YYC A;  3CLQ A;  5AW4 B;  2JR8 A;  1YBK A;  2D2C C;  2IYP A;  3JCU H;  2YMK A;  1NTZ E;  4PD4 D;  1BCC E;  3H32 B;  3CWB E;  2POH A;  1SQB K;  3AEF C;  1EDK A;  1RE3 C;  2E5Y A;  5CCH D;  3L72 J;  2NPS B;  1ZLL A;  4D6T E;  3HD7 C;  4N78 D;  3V5B A;  2J5U A;  3KXD A;  3CX5 D;  2CK3 H;  3OW2 O;  1Y9B A;  2IZ0 A;  1JY2 O;  3TSI A;  2H88 C;  3JCU E;  1G1J A;  2AEF A;  2D2C B;  1CW5 A;  1L0L G;  1PGJ A;  3QH9 A;  1P84 E;  2E42 A;  2A06 G;  1SQX E;  1HH0 A;  3CCU P;  1M1J C;  1Q7Y Q;  1N7S A;  1RF1 A;  4WVZ A;  1AQT A;  3MP7 B;  2FFD B;  2WIT A;  3FWL A;  1XTG B;  5APY A;  2IBZ I;  4H13 D;  1DD3 A;  4N3Y B;  1VQ8 P;  3CXH D;  2O01 H;  1IK7 A;  3HD7 B;  1G2C A;  3ZDM A;  4PV1 D;  1VQM P;  5KLV G;  1LWU C;  1X79 B;  2FYU E;  1ZW0 A;  2C9N Y;  4M3L A;  3RK3 C;  3L73 J;  5AW5 B;  3L71 E;  3A0H E;  1M1J B;  2BCC D;  2CPS A;  1NTK D;  1FAV A;  4HKZ H;  1PGO A;  4D6T J;  2C0X A;  1JMB A;  3L4F A;  2IFM A;  3JSV C;  3G9R A;  1JY3 P;  3M9Q A;  5TJH A;  1OW8 A;  1IFI A;  3SSU A;  1LTS C;  3E1R A;  1SQQ K;  2XZR A;  4LLH A;  1RH5 B;  2P58 A;  2J59 M;  5B5E H;  3VN0 A;  1LWU B;  3PJS K;  1KQF B;  2N1T B;  1SQX J;  1KB9 D;  1KYO H;  5CBN A;  3H1H D;  4HYT B;  3RK3 B;  1AQ5 A;  2P1J A;  3MUD C;  3USS A;  1GD2 E;  3SFD C;  1HJB A;  4K35 A;  1QX8 A;  2OTL P;  1E79 H;  1OWA A;  5H2F H;  3AE4 C;  3AE7 C;  2PFX A;  3PH0 A;  1VQ5 P;  3H1K D;  1J1E C;  3RBX A;  3ITK A;  2YO2 A;  4ZNC A;  3SWK A;  2M3E A;  1PP9 J;  1KQG B;  1NU1 E;  1PV3 A;  5BU5 A;  2JO1 A;  1J1D C;  3G6E P;  1GW4 A;  1KIL B;  2ZYG A;  2HLO A;  3PLN A;  3KPE A;  1KYO E;  2WTY A;  1EZV I;  1L0L K;  1NTZ D;  3Q5R A;  3RK2 B;  3M0D A;  2OYI A;  2WT7 A;  3CWB D;  2XNX A;  1BDD A;  2HPC B;  2IX7 C;  4OWF A;  4ZKP A;  4WBA A;  1YJW P;  5M1B A;  3MD0 A;  2QJP C;  2O01 J;  3II6 A;  1KN7 A;  5KLI C;  4L73 A;  3G4S P;  1H0T A;  3AEC C;  1J1E B;  3H1L E;  4OGQ D;  3G3Z A;  1KTM A;  1VF5 C;  1J1D B;  5KLV K;  2JWA A;  3GMA A;  2WPS A;  2JWD A;  1SFC D;  3BCC E;  2R5B A;  5KAI E;  3HUS C;  1JY2 P;  4YXD C;  1KQS O;  3BRT B;  1P84 D;  2Y9Z A;  5GTH H;  3AEA C;  2QRX A;  4PD4 H;  3OA7 A;  2QSI A;  2A06 D;  3RGU A;  5L8R J;  3LIE A;  2QJP B;  2YKQ A;  1BGY E;  4JYB A;  5KLI B; 
#chains in the Genus database with same CATH homology
 1FOS E;  1LTJ C;  2H8P D;  4AUW A;  4C7R A;  1W2E A;  2A45 H;  4W7Z A;  4HH2 A;  4WY4 B;  1FZE A;  2KLV A;  4WB4 A;  1N73 C;  2FFD C;  4I1L A;  4Y99 C;  1ZR2 A;  1A02 F;  3E1I A;  1HGV A;  5CMZ A;  3B8E B;  1SFC C;  1JUN A;  3RL0 C;  3EQ2 A;  1N2D C;  1L4A D;  2L5G B;  2M8R A;  5AW0 B;  2HYN A;  3HUS B;  4KHX A;  4O9B A;  3HUS A;  2FKW B;  2H43 A;  1JY3 O;  1RY3 A;  1E5W A;  1KQL A;  1SLQ A;  2Q3I A;  2H7H A;  1GDT A;  1IO4 A;  2N1T D;  2OAR A;  3P8C E;  1FZA A;  2NPS D;  2Z5I A;  2WWW A;  1LTB C;  1NTK K;  1GU4 A;  2YO3 A;  5KTB A;  3B5N B;  2P7J A;  1WRG A;  3M06 A;  1LT9 C;  2CPB A;  4JF7 A;  4IFM A;  1LTJ A;  2N9B A;  3V2R A;  1H88 A;  5AVS B;  5CJ0 A;  1AFO A;  1J2J B;  1LTT C;  2WT7 B;  1X9V A;  1S9K D;  3MTU E;  4LGD E;  1N73 B;  1JOC A;  2JJL A;  1N73 A;  2FFD A;  1A02 J;  3V4W A;  1SQX K;  1T2K D;  2GUV A;  4N78 E;  1JNM A;  1URQ D;  1SFC B;  1N7S D;  1SFC A;  3R2P A;  3RL0 B;  1JTH B;  1L4A C;  4LC1 A;  1DH3 A;  1IFN A;  3V2Q A;  1YTZ I;  2O1K A;  2PP6 A;  1FZG A;  2FXM A;  2WSF H;  3U1A A;  3NTN A;  1LGH B;  1KIL D;  5AW8 B;  3VP9 A;  3SWF A;  1HWT C;  4C7N B;  2N1T C;  1NWQ A;  2GUS A;  4C7N A;  2LKM A;  2HOD B;  3UIA A;  3EFG A;  2R3C A;  1SP4 A;  2WSE H;  2HOD A;  3HE4 B;  2YMY A;  3HE4 A;  2NPS C;  1FDM A;  3HD7 D;  3PP5 A;  1ZR4 A;  1G1I A;  3RK2 D;  2FYZ A;  5AW9 B;  4DZO A;  3TYY A;  1LT9 B;  3VMY A;  1ZV8 A;  1LT9 A;  1IFD A;  4ZKU A;  1YYC A;  5APW A;  2WPQ A;  3CLQ A;  3VP8 A;  5AW4 B;  2IFN A;  1JO5 A;  2I1J A;  1FZC C;  1GTW A;  1SVF A;  4RES B;  4AQR D;  1T2K C;  1URQ C;  4IFF A;  1IJD B;  3CI9 A;  1N7S C;  3H32 B;  2POH A;  3L37 A;  1L4A B;  3O8Z A;  1SQB K;  3H32 A;  1L4A A;  1RF1 C;  2Z5H A;  3GHG C;  1FJK A;  1RE3 C;  1KIL C;  3A2A A;  3IR9 A;  3N4X A;  1NTZ K;  1LTA C;  3T97 A;  1DEB A;  5CCH D;  2N1T A;  2WSC H;  1VPC A;  3TNU B;  2NPS B;  1FJP A;  5AVU B;  3TNU A;  2NPS A;  1ZLL A;  4B86 A;  2BAS A;  3VMX A;  3HD7 C;  4N78 D;  3V5B A;  3RK2 C;  5AW6 B;  1JY2 O;  2HFE D;  3TSI A;  4EIJ A;  2R5D A;  3M9B A;  1G1J A;  1FOS F;  1FZC B;  1CW5 A;  1N7L A;  5AW2 B;  3N7N A;  1PFI A;  1FZC A;  2E42 A;  2ZFC A;  3RK3 D;  2A45 I;  1RE4 C;  1HH0 A;  1URQ B;  2W27 A;  2E43 A;  1M1J C;  1URQ A;  4WY4 D;  1IFM A;  1N7S B;  1FZF A;  1LTJ B;  3M9H A;  1N7S A;  3BAS A;  1RF1 B;  1RF1 A;  1JY3 N;  1RE3 A;  2YKP A;  4AYC A;  1KIL A;  2FFD B;  2WIT A;  1XTG B;  5APY A;  5CCH C;  4Y99 B;  3MGN A;  3BRV B;  1NOH A;  4N3Y B;  3P8M C;  1CSB A;  1H8A A;  1JMM A;  2O01 H;  1GZL A;  3I5C A;  1G2C B;  3HD7 B;  5AVZ B;  1G2C A;  3HD7 A;  4GT1 A;  3VOP A;  3LID A;  1FZB A;  2KOG A;  2JEE A;  2HPC A;  1LWU C;  1MV8 A;  1X79 B;  3M0A A;  1KFM A;  1HUC A;  1NHL A;  1Z56 A;  1GK4 A;  3B5N D;  1GL2 D;  5CCG D;  2YNY A;  2C9N Y;  3IFM A;  5AVW B;  4W80 A;  3V2N A;  4M3L A;  3RK3 C;  5AW5 B;  1MFZ A;  1M1J B;  1CZQ A;  2Q5U A;  4WY4 C;  3V2P A;  1LTI C;  1M1J A;  5AW7 B;  3OJA B;  5CHX A;  1VDF A;  2QM8 A;  1NKZ B;  2WZ7 A;  2CPS A;  4EOT A;  1FAV A;  3KQG A;  3P7K A;  5AVV B;  2FYU K;  1H89 A;  5CJ4 A;  3U1C A;  1GW3 A;  1T3U A;  2KSJ A;  2VRS A;  1RF0 C;  2C0X A;  1FBM A;  3L4F A;  2IFM A;  2KB7 P;  1JY3 P;  2I1K A;  3P8C D;  2P67 A;  3C9I A;  3M9Q A;  1L0N K;  1X8Y A;  2ZXE B;  1IFI A;  1LTS C;  1HVV A;  1S9K E;  4OH8 B;  2IPP A;  1SQQ K;  2XZR A;  4LLH A;  1HTL C;  5APX A;  1GK6 A;  1NAF A;  3BVH A;  4I6M C;  2J59 M;  3V4Q A;  3VN0 A;  2QM7 A;  1LWU B;  2W6B A;  2XKM A;  2N1T B;  1LWU A;  1MZ9 A;  1EQ7 A;  3B5N C;  3A7O A;  1GL2 C;  5CCG C;  1GU5 A;  1KFN A;  1IK9 A;  3A5T A;  4HYT B;  3RK3 B;  3P32 A;  2C9L Y;  3M0D C;  2OYI C;  1AQ5 A;  2P1J A;  1OXZ A;  3L36 A;  1GD2 E;  5AVY B;  1HJB A;  2HG5 D;  4WY4 A;  5KJ7 D;  5AW1 B;  1WT6 A;  5APS A;  1DX7 A;  1OWA A;  1HBW A;  1SQV K;  4C46 A;  3HE5 B;  5AVR B;  2MJZ A;  3VYI A;  3HE5 A;  5APU A;  1RF0 A;  2Q7C A;  2GM4 A;  1NTM K;  1J1E C;  2YO2 A;  1IC2 A;  1CI6 B;  3CL3 D;  1M7L A;  1CI6 A;  2M3B A;  5AVQ B;  2J58 A;  5BU5 A;  1IFJ A;  1J1D C;  3GHG B;  1FU1 A;  3BAT A;  1GW4 A;  1SQP K;  1NH4 A;  2XU6 A;  3GHG A;  4JYC A;  1KIL B;  3VMZ A;  1JY2 N;  2HLO A;  3MIW A;  1T3J A;  2KYV A;  3M91 A;  3KYQ A;  3KPE A;  4DOJ A;  2WTY A;  5BU8 B;  1L0L K;  2A45 G;  3NXS A;  3B5N A;  5APQ A;  1GL2 B;  3HTK B;  1GL2 A;  1NU1 K;  3SWY A;  5CCG A;  3HTK A;  1JCD A;  2OYI B;  3RK2 B;  2R32 A;  3KDP B;  3M0D A;  2OYH C;  2OYI A;  1MUU A;  2W6A A;  2XDJ A;  3NMD A;  2WT7 A;  3MUD A;  2XNX A;  2HPC B;  2IX7 C;  2PAJ A;  5KJ7 C;  3A3Y B;  4ZKP A;  4WBA A;  2YKO A;  3LW5 H;  3MD0 A;  4IFD K;  3II6 A;  2P2U A;  1YTZ T;  5AVX B;  3OAK A;  3WMM 0;  1T8Z A;  1JTH A;  2C0W A;  3VTP C;  1KZU B;  1J1E B;  1NO4 A;  1ZN5 A;  1RE4 A;  2KP8 A;  3G3Z A;  1QL2 A;  1N86 A;  4GKG A;  5AW3 B;  1J1D B;  1HGZ A;  5KLV K;  5AVT B;  2Q9I A;  2O1J A;  4W7Y A;  2WPS A;  1SFC D;  3RL0 D;  2R5B A;  5CCH A;  2WPR A;  3TK1 A;  4XA4 A;  1QL1 A;  3HUS C;  1JY2 P;  3NFQ A;  1LTG C;  3BRT B;  1XTC C;  4XE5 B;  2OYH B;  3U59 A;  5BVZ A;  3L35 A;  4I2L C;  5APT A;  2OYH A;  4GIF A;  3HRN A;  3OA7 A;  5APV A;  5KJ7 A;  1JCC A;  3H6P A;  2Z4E A;  2XV5 A;  3LIE A;  4N6J A;  2YKQ A;  4JYB A;  1NKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...