1ZLLA

Nmr structure of unphosphorylated human phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
b'MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title The structure of phospholamban pentamer reveals a channel-like architecture in membranes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/signaling protein
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zllA00
2HYNA 1ZLLA 2KYVA 1N7LA 2KB7P 1FJKA 1FJPA 2M3BA
chains in the Genus database with same CATH superfamily
4YTPC 1ZLLA 2JWDA 2MJZA 1KILB 2WVRA 3MHVA 1P84E 3JC22 3O6QA 1FAVA 2WZ7A 4H0LB 4ZNCA 1L4AD 1H89A 2OYHC 5C39A 3M06A 4OVNF 3RK2C 2V7QH 1T8ZA 2QJYB 2FYNC 1Q2NA 2LXCB 2WSSH 2RH0A 1GW4A 1XTCC 5H2FE 2E74C 1OWAA 2L91A 3GMAA 1HUCA 1KFMA 2N1TD 2Y0CA 1Y47A 1XTGB 1IFIA 1YHQP 3L72D 4I2LC 1URQB 1NTKD 3GF3A 5KAIE 2WITA 3H1HD 3S4RA 2FXPA 2POHA 2FY8A 3WU2H 4NPEA 3W68A 1L0LE 1J1DB 1JY3N 4NPDA 4WWIA 2PP6A 4IFMA 3MP7B 1KILD 5CCGA 3H1IJ 5DJTB 4H0LD 3I5CA 3MUDA 1SQPJ 1NOHA 2JO1A 1YITP 1L2PA 2Q3EA 1CSBA 1EDKA 4TLFA 4GOFA 4DCKA 1CW5A 1KC8Q 1NTMJ 1L4AA 2OQQA 1SQQK 2GUSA 1SQQJ 2A45G 4JPZB 3BCCE 4O9BA 1S5LX 1M90Q 5APVA 2FBWC 3H1LJ 2FYZA 2QJPC 3GLMA 3B5NB 4L74A 2IZ0A 2KSEA 3GHGB 2LXBA 1P84D 1CI6B 3EQ2A 2YKPA 1RF0A 5KJ7D 1NU1E 3V5BA 4LGDE 1LTJA 4AQRD 1PP9E 4RO0A 2KS1A 2N1TA 3CCVP 5APXA 1RE3A 4AYCA 1SQVD 1VPCA 3A0HE 1GL2D 1LT1A 3SWFA 1K05A 3AE7C 3MTUE 2W6BA 2WSCJ 1OW8A 1E79H 1EZVE 2ZXEB 4K3AA 1KB9E 4C7NB 4IL6E 2K1AA 3H1IG 3HRNA 3FXEA 3E1RA 5APWA 1L0ND 1U7JA 2D2CD 1M1JC 1SQPG 1KILA 3AE3C 4YXWH 1NAFA 1FZCC 3L72J 4PV1B 1NTKK 1NTMG 1L0LD 1BGYE 1NTKJ 4D6TE 3PJSK 3H1HJ 3V2RA 1NHLA 1KV4A 1PGPA 3H1LG 1VF5B 1S5LE 2QJKB 3TDKA 1OW6A 2OYOA 2OGUA 2Z5HA 3VYIA 3SFEC 3H25A 1PGJA 2W8ZA 3L70E 2HLOA 5M1BA 1P84I 1BDCA 1FBMA 1NVOA 3V4QA 5KJ7A 3RK3C 5GTIE 3L74E 3BCCD 3H32B 4I7ZB 1OW7A 3SSUA 1GL2A 2Y9YA 2B89A 1QGKB 4CPGA 2E42A 1NU1D 5TISE 3M91A 2Q6QA 3CXHE 1VQOP 3L72G 3NFQA 3KPEA 3SWYA 2YIUC 2PAJA 2L5GB 5KKZC 1NTKG 1BCCG 2AEMA 1JM0A 3BRTB 1SQVK 3AEBC 3H1HG 1M7LA 1A02J 1VF5D 1EZVD 1DX7A 1KB9D 2KB7P 1KFNA 3HD7B 3CWBE 1LTTC 1WRGA 1GU5A 2W90A 2WQYC 3PP5A 3NMDA 1ZN5A 2E75B 1KYOE 1YJ9P 3RL0C 2Q5UA 3GHGA 1AVOA 1L0NK 3AE4C 1L0NJ 3WUUA 3M0DA 2XU6A 2C9NY 1SQXG 1BGYD 1J1EB 2AXCA 2LR2A 3N4XA 1L0LJ 1PFIA 4Z1MH 1NH4A 1S72P 1X79B 2H43A 4M3LA 4XA4A 5CCGC 1OMIA 5KAFH 2YKOA 1KZUB 4C7NA 4RJTA 3AE6C 3L70D 4YXDC 5AW0B 2IX7C 1IK9A 1HGVA 4W7ZA 5APQA 1HF9A 3MUDC 1JTHB 2M5AB 3VMYA 3L36A 1CZQA 1VQKP 4OWFA 5AW9B 3L74D 2ZYDA 2WSEH 1OVVA 2KI7B 1FZEA 1L4AC 3HD7D 2YXQB 1SFCD 1T3UA 3WUTA 4GKGA 1Y9BA 4BWNA 3A3YB 2P10A 2ZXXA 3BCCJ 1AVYA 1KQFB 4WY4B 5B66H 3TNUA 2P2UA 3D6ZA 1EZVI 2E75D 1KB9I 1PL5A 2JEEA 2J59M 3C8VA 4UB8H 2K3RA 1RE4A 1RF0C 3C9IA 2KYVA 3CXHD 4C46A 1NU1K 3VP8A 1LTJC 1NU1J 5AVUB 2W27A 2ZYGA 5AW8B 1PP9J 2N1TC 1IFMA 2Q9IA 3U59A 2G3AA 4KJMA 1RE3C 4WB4A 1FC2C 1LT9B 2XKMA 2R44A 4N78E 1QL2A 3P7KA 4QMAA 1L0LG 3CWBD 3II6A 1PGQA 5CCHD 2RKLA 2GA1A 1MV8A 3H32A 1WMKA 1K73Q 1MKMA 1KYOD 4U7JA 3Q2YA 2ZVNB 4PJ0E 1BCCE 3AEAC 1BE3E 1KILC 5AW6B 2I1JA 3AEDC 3EWKA 4WVZA 1HVVA 5AW1B 2E76B 1GTWA 1DH3A 2Y0EA 3AECC 2KXPB 1BGYJ 3JCUE 4D6TJ 1K04A 1UIIA 5APTA 1KQGB 3BCCG 1NJIQ 4ASWA 1LTAC 2Y9ZA 1HBWA 1YTZI 1N73B 2FFDB 3BATA 3HD7A 1NYHA 4WBAA 1SQXE 1SFCA 2M8RA 3Q3DA 3L37A 2NRGA 2Q3IA 1NU1G 3VN0A 4Y99C 3L70J 1PP9G 1LWUB 4H13B 2RN0A 3CXHI 1R8EA 2PGDA 2R3SA 5AW3B 4N3YB 5KJ7C 1IJDB 3A2AA 5APYA 4PD4H 1K8AQ 4ASVA 3L74J 1JB0J 2JDIH 1BDDA 1LJ2A 1NTZE 1EZVG 2HPCB 4EYYQ 3D70A 1GL2C 1J1DC 2PRRA 1EDLA 2BEQD 5CCHA 3CCQP 3M9HA 1KYOI 1EDJA 1FE6A 2HODB 1U7MA 2E76D 2P7JA 2C9LY 3IR9A 3I55P 3CX5E 3L35A 4N78D 2D2CC 2H7HA 3V2PA 3CMEP 1BGYG 1IFNA 1WT6A 3CC4P 3F5HA 1AQTA 4D6TG 1GZLA 1H8AA 4ZKPA 4C7RA 1HJ0A 3AE8C 5E79E 3L71E 3B71A 1N7SC 2QM7A 4HB1A 1OVUA 3N7NA 3KXDA 3CWBJ 2BCCE 1BCCD 2ZT9B 1BE3D 5AVWB 2K9JA 4OGQB 5CMZA 3GHGC 4JF7A 3L70G 2B88A 4H13D 1GDTA 2I1KA 5B5EH 2O01J 1M56D 2AXTH 1AJYA 1X9VA 2IYPA 1MZ9A 1R5SA 2H89C 3MIWA 1HTLC 2QRXA 3L74G 4DZOA 1LT9A 1Q90D 1SQPK 3WMM0 3OAKA 1SQXD 1JOCA 2OYHB 3CD6P 2WPVB 1X22A 2OARA 4L75A 1NTMK 1YTZT 1S1CX 1JY3P 1FU1A 1H0TB 1JMBA 1IFJA 1TU3F 5KAFE 2YMYA 1FOSF 3TYYA 3CLQA 5AW2B 4ZKUA 1NTZD 1URQD 3Q5RA 1G2CA 4EIJA 2M0BA 2WSCH 3CWBG 1EDIA 2ZT9D 1NWQA 2KP8A 4GIFA 4OGQD 1T3JA 1VF5C 2FFDA 4H44B 1RE4C 5TJHA 4UB6E 5L8RJ 3VMXA 3EFGA 1ZW0A 4JYBA 1FJPA 3CX5D 4XFJA 3ZDMA 2GM4A 1Q7YQ 1KN7A 2WSFJ 2B87A 4UB8E 5AVTB 4L73A 3L71D 1LP1B 5EFWB 2MKVA 2BCCD 4I7ZC 5KLIC 3TSIA 3PLNA 1ZV8A 2IFMA 3H1JG 4DJGA 1BCCJ 3LW5J 1AQ5A 1BE3J 1MFZA 1PZQA 1KORA 2YO3A 2BEZF 3B5ND 2HODA 1OFCX 2A06E 1FJKA 1KTMA 4JBZA 1GU4A 3H6PA 1USDA 2CK3H 4GODA 4YPCA 1QL1A 2HG5D 2IYOA 2JR8A 2KSJA 1EXJA 3E1IA 4KT0J 4H44D 1DEBA 2P67A 3HD7C 1SQXK 1URQA 2E5YA 1SFCC 2KUBA 1SS1A 3G9RA 1SQXJ 2WPSA 4IOIH 2E5TA 4HKZH 3G6EP 4EDFA 1MUUA 2OTKE 1W2EA 1SQBE 3R2PA 2P58A 3AE2C 1R5LA 1P84H 2KNCB 1FZGA 2M3BA 3HTKB 1IFDA 3MD0A 1IZNB 5CBNA 2PFXA 2W83C 3CX5I 4EOTA 1J1EC 2OYIB 2W6AA 3TGUE 2IBZE 3FGAD 3HE5B 1PP9D 5GTHE 4OH8B 1QEXA 3A0BE 1NTZJ 3BASA 4PV1D 3HUSB 2O01N 1QVFO 1HJBA 3RK3E 2E43A 2FXOA 5AW4B 1G1IA 5CCHC 5H2FH 5K5GB 1YQ3C 4ZMDA 1RF1B 1BE3G 1DEEG 2HYNA 2C0XA 4LLHA 2XDJA 3CI9A 1K9MQ 4HYTB 2QEXP 1S9KE 1JUNA 1H0TA 1N2DC 5KAIH 1MFTA 3B5NA 2O3JA 2QIWA 2Z5IA 5CJ0A 3A7OA 1CI6A 3CCJP 2O1KA 3L71J 1S4XA 2LKMA 1W5CE 3E7KA 3RK3B 2BCCJ 2NPSB 4D6TD 1OX3A 1EC5A 4DT0A 1OVRA 2DW3A 1L0LK 3I56P 2A06D 2KLUA 3CCLP 3K5BA 3H1KE 3FXDA 3G71P 3IN6A 2SPZA 1JMMA 3WU2E 3KZIH 4Y28J 3H1JE 3IFMA 4TT3H 3AE1C 3CCRP 1EQ7A 1NTZG 4U3FE 1LP1A 4NPFX 1T6AA 1QVGO 2YIUB 5KKZB 2AEJA 3BVHA 1J2JB 2WT7B 1N7LA 1SQBD 3OW2O 4KHXA 1DD3A 1SQQE 3CC2P 1M8OB 3L75E 4MN4C 3L73E 3TGUD 2IBZD 3RL0B 3CCEP 3A0HH 1W2BO 1VQ9P 1LTSC 1YBKA 3L71G 1FDIA 2NPSD 2BCCG 1RQVA 1ZR4A 5BVZA 3SWKA 1KB9H 3CC7P 4IL6H 2FFDC 3WUVA 3R4YA 2XV5A 3MZWB 3RBZA 1S9KD 2KZJA 1FDOA 2N9BA 1IK7A 1SVFA 3S1KA 2AEFA 3HTKA 3B4SA 1ZOYC 3IAOA 2QVAA 1NKNA 1GK4A 1LTIC 5AVYB 2OYIA 2IDBA 1VL2A 3HE5A 3GG2A 1S5LH 5CHXA 4H0LC 2FKWB 1X0TA 4HH2A 2K88A 3HUSA 2C0WA 2XNXA 1U57A 2HR3A 4WY4D 5AW7B 3H1KD 1RF1A 1VDFA 2QJYC 2FXMA 1SLQA 1OXZA 2GUVA 1VQLP 3H1JD 3G4SP 2FYUE 3M0AA 5GTIH 2IBZI 1EXIA 3T97B 2IZ1A 2O1JA 1H88A 2IPPA 1FOSE 5KTBA 2J58A 2QE7H 3V2QA 1URQC 2K9YA 1GD2E 3FWLA 2NPSA 2ZT9C 4BXLA 4GOEA 1SQBK 1PV3A 4OGQC 3Q5SA 1SQBJ 2IFNA 2JJLA 3L75D 3TF5A 3UIAA 3CL3D 3CXHH 2BASA 2A45H 3OA7A 3P8CE 2M3EA 1S3JA 1OIPA 1RHZB 1X8YA 1T2KD 4AUWA 3TGUJ 1N8RQ 4JYCA 3KHUA 1KQSO 2JP3A 1FZFA 2H8PD 1VQ6P 1KQLA 1JTHA 2M5AA 2ZFCA 2WWWA 4I1LA 2WT7A 1KYOH 1SQVE 5BU5A 4R4LA 3Q5PA 4RESB 2O01H 1VQ5P 2A06G 4WY4A 2V7QJ 3B5NC 4Y99B 4IFDK 2XZRA 4XE5B 1M57D 1L0NE 1HGZA 1FDMA 3M0DC 1GMJA 1UIXA 2KIKA 3F89A 1ZP0C 1SQBG 1JCDA 4H44C 4LC1A 1GL2B 3ITKA 2R3CA 4IL6X 3H1KJ 3RK2B 1JY2O 2HFED 2FYUD 1IO4A 3TK1A 3V2NA 2W6JH 3TGUG 1Z56A 5AVVB 2IBZG 2FYNB 4B86A 5APSA 4L76A 2KOGA 3H1JJ 5KLVE 4U3FJ 2D2CB 1YIJP 1RY3A 2E74B 5CJ4A 3KDPB 4HJGH 2YXRB 5AVRB 4PV1C 3KZIE 2N9YB 3MGNA 1N7SB 2OTLP 3PH0A 1QLED 1FS0E 2Y0DA 3JSVC 3GF7A 3P8CD 1E5WA 2WSFH 1DIPA 3L75J 3L73J 1N73A 1S2EA 2WMMA 2WPQA 3QWOC 5AVZB 2QJKC 1JO5A 3GW6A 3AEGC 1ZRTE 1YYCA 1PPJG 2KZIA 3P32A 5B66E 3AE5C 3T97A 3VTPC 1YJWP 1LWUA 1Q82Q 1JNMA 3QH9A 4PJ0H 3LW5H 1A02F 5APUA 3RK2D 3H1KG 3CCUP 5AVSB 2OTJP 2HPCA 3C1LA 2R5DA 2YKQA 4K35A 3JCUH 4GT1A 3RGUA 4U3FG 2ZAEB 2OYIC 2E74D 3SFDC 2QJPB 2K37A 1VQ8P 3HUSC 3VMZA 1N7SD 2VRSA 2RMZA 3P8MC 3PRJA 1SQQG 3TNUB 1RF1C 1NO4A 3M9BA 2ZVOB 1PGOA 1BSHA 3L75G 3L73G 2QM8A 3D6YA 5KLVD 2FYUK 1HH0A 3S9OA 2QG4A 2FYUJ 2E75C 2I8DA 3U1CA 4W80A 1VQ7P 3AEFC 4I6MC 1M1JB 3CCSP 2NPSC 3B8EB 3IF4A 2YO2A 1FZCB 1NTZK 5KLIB 1VQNP 3RBXA 1LGHB 1NAYA 3CX5H 2OYHA 1ZRTD 4PD4E 1DD4A 1NKZB 5E79H 4BRYB 3AE9C 1IC2A 3D71A 3HE4B 3O8ZA 5DJUB 3USSA 3LIEA 5AVQB 1HWTC 1SQVJ 3NXSA 3KQGA 1N7SA 1PPJE 1SFCB 3EFFK 1D7MA 2R32A 4WY4C 1AA0A 3OJAB 2FYUG 3ABVC 4R4MA 2CPSA 4RKUJ 1RH5B 3VP9A 1QX8A 1JY3O 3W67A 1FZAA 4JQ0D 1PIXA 1IFPA 2WPRA 4IFFA 3H1IE 3LIDA 3O6QB 2QA4P 5AVXB 1LT9C 3V4WA 1Y8AA 1SQPE 5B5EE 1JCCA 2AXTE 3PHLA 2YMKA 1JY2N 1VQ4P 2NZ2A 1G1JA 1NTME 1YJNP 3CCMP 4W7YA 5KLVK 3L4FA 3RL0g 5CBOA 5KLVJ 3CPWO 2KK7A 2R5BA 3H1LE 1T2KC 2Z4EA 2E76C 1SQVG 4UB6H 3M9QA 1YI2P 1OZHA 3RK3D 1Q81Q 2ZJSE 1JY2P 2K9JB 4PD4D 2KLVA 1N73C 1LTGC 2WSEJ 1GW3A 1LTBC 1L0NG 3G3ZA 2UWJE 3NTNA 2XNDH 1USEA 2G8YA 1AFOA 2KNCA 3U1AA 3CMAP 3A5TA 1LWUC 4H13C 2J5UA 3VMAA 2JWAA 2V4HA 2ITAA 2ZYAA 3FX0A 1PPJD 1M1JA 1VQMP 1JEKA 2QSIA 1FZCA 3L72E 2YNYA 1L4AB 1SP4A 1NTKE 1ZXGA 4EI2A 4GDOA 5KLVG 3H1HE 1FZBA 2Q1KA 3V6IA 2B9BA 1LNQA 3H1ID 3RL0D 4BRYA 1M1KQ 1BSNA 2H88C 2P1JA 1G2CB 1KILE 4N6JA 1VQPP 1SQPD 1YQ4C 4U3FD 3HE4A 1LTJB 1GK6A 2JKVA 3AEEC 1ZR2A 1N86A 2Q7CA 2KS1B 2N1TB 1AV1A 1Q86Q 5BU8B 3Q1MA 3KYQA 1NTMD 2CPBA 1ZMEC 4A7PA 1SQQD 5AW5B 4DOJA 5CCGD 1KD1Q 4PD4I 5TISH 1NGMB 3BRVB 3H1LD 5GTHH 2B87B 3A0BH 3FWNA 2WTYA 1RQUA 3VOPA 3L73D 1KMIZ 3PTZA 2A45I
chains in the Genus database with same CATH topology
1SFCD 1T3UA 1ZLLA 4GKGA 3A3YB 4EOTA 2MJZA 1KILB 1J1EC 2OYIB 2W6AA 4WY4B 3P8CD 3TNUA 1E5WA 2WSFH 2P2UA 3HE5B 4OH8B 2JEEA 2J59M 1N73A 1FAVA 2WZ7A 2WPQA 5AVZB 1RE4A 1JO5A 3BASA 3HUSB 1L4AD 1H89A 1RF0C 3C9IA 2KYVA 1HJBA 2E43A 4C46A 2OYHC 1NU1K 3VP8A 1YYCA 3M06A 5AW4B 1G1IA 1LTJC 5CCHC 5AVUB 2W27A 5AW8B 3RK2C 3P32A 2N1TC 1IFMA 2Q9IA 1RF1B 3U59A 2HYNA 1T8ZA 3T97A 1RE3C 3VTPC 4WB4A 1LT9B 2XKMA 1LWUA 2C0XA 4LLHA 2XDJA 3CI9A 4N78E 1JNMA 1QL2A 4HYTB 3P7KA 3LW5H 1S9KE 1GW4A 1JUNA 3II6A 1A02F 1XTCC 1N2DC 5CCHD 1OWAA 5APUA 3RK2D 1HUCA 1KFMA 1MV8A 2N1TD 3H32A 3B5NA 1XTGB 5AVSB 1IFIA 2Z5IA 5CJ0A 3A7OA 1CI6A 2HPCA 2O1KA 4I2LC 1URQB 2R5DA 2YKQA 2LKMA 4GT1A 3RK3B 1KILC 2NPSB 5AW6B 2OYIC 2I1JA 2WITA 2POHA 1HVVA 5AW1B 1L0LK 1GTWA 1DH3A 3HUSC 1J1DB 3VMZA 1N7SD 1JY3N 2VRSA 2PP6A 4IFMA 3P8MC 1KILD 5CCGA 3TNUB 5APTA 1RF1C 1NO4A 1JMMA 1LTAC 1HBWA 3M9BA 1YTZI 1N73B 2FFDB 3BATA 2QM8A 3HD7A 3IFMA 3I5CA 4WBAA 1EQ7A 1SFCA 3MUDA 2M8RA 1NOHA 3L37A 2FYUK 1HH0A 2Q3IA 3BVHA 1J2JB 1CSBA 2WT7B 1N7LA 3VN0A 4Y99C 1CW5A 3U1CA 4KHXA 1LWUB 4W80A 1L4AA 1SQQK 5AW3B 4N3YB 5KJ7C 1IJDB 2A45G 2GUSA 4I6MC 1M1JB 4O9BA 2NPSC 3A2AA 5APYA 3B8EB 2YO2A 5APVA 2FYZA 3B5NB 3RL0B 1FZCB 1NTZK 3GHGB 2HPCB 1CI6B 3EQ2A 1GL2C 1J1DC 1LGHB 1LTSC 2YKPA 1RF0A 2OYHA 5KJ7D 3V5BA 4LGDE 1LTJA 4AQRD 2NPSD 5CCHA 1ZR4A 2N1TA 5BVZA 3M9HA 1NKZB 2FFDC 2HODB 5APXA 1RE3A 4AYCA 1VPCA 2P7JA 2C9LY 1GL2D 3IR9A 1IC2A 3SWFA 2XV5A 3L35A 4N78D 2H7HA 3V2PA 3HE4B 3MTUE 1S9KD 2W6BA 2N9BA 1SVFA 1IFNA 1WT6A 3O8ZA 1GZLA 2ZXEB 1H8AA 4ZKPA 4C7NB 3LIEA 5AVQB 4C7RA 1HWTC 3HTKA 3HRNA 3NXSA 3KQGA 1N7SC 2QM7A 1N7SA 1SFCB 3N7NA 1NKNA 5APWA 1GK4A 1LTIC 1M1JC 5AVYB 1KILA 2R32A 2OYIA 4WY4C 5AVWB 3OJAB 3HE5A 5CMZA 1NAFA 1FZCC 2CPSA 3GHGC 5CHXA 4JF7A 2FKWB 4HH2A 1GDTA 3HUSA 2I1KA 3VP9A 1NTKK 1JY3O 2C0WA 1FZAA 2XNXA 1X9VA 2WPRA 1MZ9A 4IFFA 4WY4D 5AW7B 3MIWA 1HTLC 3V2RA 1NHLA 1RF1A 1VDFA 3LIDA 4DZOA 2FXMA 1SLQA 1OXZA 2GUVA 5AVXB 1LT9C 3V4WA 1LT9A 1SQPK 3WMM0 3OAKA 2Z5HA 3VYIA 1JCCA 1JOCA 2OYHB 1JY2N 3M0AA 2OARA 2HLOA 2O1JA 1H88A 1NTMK 1G1JA 2IPPA 1FOSE 5KTBA 2J58A 3V2QA 1URQC 1YTZT 4W7YA 5KLVK 1FBMA 3L4FA 1JY3P 1GD2E 3V4QA 1FU1A 5KJ7A 3RK3C 1IFJA 2NPSA 2R5BA 1T2KC 1SQBK 2YMYA 3H32B 1FOSF 3TYYA 3CLQA 2IFNA 2Z4EA 5AW2B 2JJLA 4ZKUA 3UIAA 1GL2A 3CL3D 3M9QA 2BASA 1URQD 2A45H 1G2CA 3OA7A 4EIJA 2WSCH 3P8CE 3RK3D 2E42A 1JY2P 1X8YA 1T2KD 4AUWA 3M91A 1NWQA 2KP8A 4GIFA 4JYCA 1T3JA 2KLVA 1N73C 2FFDA 1LTGC 1RE4C 1FZFA 2H8PD 1GW3A 3NFQA 3VMXA 3KPEA 1LTBC 1KQLA 3EFGA 3SWYA 1JTHA 2ZFCA 3G3ZA 2PAJA 2L5GB 4JYBA 1FJPA 2WWWA 4I1LA 3NTNA 2GM4A 2WT7A 3BRTB 1SQVK 1AFOA 1M7LA 1A02J 3U1AA 5BU5A 1DX7A 5AVTB 3A5TA 1LWUC 2KB7P 1KFNA 3HD7B 4RESB 2O01H 1LTTC 1WRGA 1GU5A 1M1JA 3PP5A 3NMDA 1ZN5A 4WY4A 3B5NC 4Y99B 4IFDK 3RL0C 2Q5UA 1FZCA 3TSIA 3GHGA 2XZRA 1L0NK 4XE5B 2YNYA 1L4AB 1SP4A 1ZV8A 1HGZA 1FDMA 2IFMA 3M0DC 3M0DA 2XU6A 2C9NY 1J1EB 1FZBA 1AQ5A 1MFZA 2YO3A 3B5ND 3RL0D 2HODA 3N4XA 1JCDA 4LC1A 1FJKA 1GL2B 2P1JA 1G2CB 1GU4A 1PFIA 2R3CA 3H6PA 1NH4A 4N6JA 1X79B 3HE4A 2H43A 1QL1A 1LTJB 4M3LA 2HG5D 1GK6A 4XA4A 5CCGC 3RK2B 2KSJA 1JY2O 1N86A 2Q7CA 2HFED 2N1TB 1ZR2A 3TK1A 1IO4A 2YKOA 3V2NA 1KZUB 4C7NA 5BU8B 3E1IA 1Z56A 5AVVB 4B86A 5AW0B 2IX7C 1DEBA 3HD7C 2P67A 3KYQA 5APSA 1IK9A 1HGVA 1SQXK 4W7ZA 1URQA 2KOGA 5APQA 2CPBA 1SFCC 1JTHB 2WPSA 3VMYA 3L36A 1CZQA 5AW5B 4DOJA 1RY3A 5CJ4A 5CCGD 5AW9B 1MUUA 1W2EA 3KDPB 3R2PA 3BRVB 5AVRB 1FZGA 2M3BA 3HTKB 2WTYA 2WSEH 1IFDA 3VOPA 3MD0A 1FZEA 1L4AC 3HD7D 3MGNA 1N7SB 2A45I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYN A;  1ZLL A;  2KYV A;  1N7L A;  2KB7 P;  1FJK A;  1FJP A;  2M3B A; 
#chains in the Genus database with same CATH topology
 4YTP C;  1ZLL A;  2JWD A;  2MJZ A;  1KIL B;  2WVR A;  3MHV A;  1P84 E;  3JC2 2;  3O6Q A;  1FAV A;  2WZ7 A;  4H0L B;  4ZNC A;  1L4A D;  1H89 A;  2OYH C;  5C39 A;  3M06 A;  4OVN F;  3RK2 C;  2V7Q H;  1T8Z A;  2QJY B;  2FYN C;  1Q2N A;  2LXC B;  2WSS H;  2RH0 A;  1GW4 A;  1XTC C;  5H2F E;  2E74 C;  1OWA A;  2L91 A;  3GMA A;  1HUC A;  1KFM A;  2N1T D;  2Y0C A;  1Y47 A;  1XTG B;  1IFI A;  1YHQ P;  3L72 D;  4I2L C;  1URQ B;  1NTK D;  3GF3 A;  5KAI E;  2WIT A;  3H1H D;  3S4R A;  2FXP A;  2POH A;  2FY8 A;  3WU2 H;  4NPE A;  3W68 A;  1L0L E;  1J1D B;  1JY3 N;  4NPD A;  4WWI A;  2PP6 A;  4IFM A;  3MP7 B;  1KIL D;  5CCG A;  3H1I J;  5DJT B;  4H0L D;  3I5C A;  3MUD A;  1SQP J;  1NOH A;  2JO1 A;  1YIT P;  1L2P A;  2Q3E A;  1CSB A;  1EDK A;  4TLF A;  4GOF A;  4DCK A;  1CW5 A;  1KC8 Q;  1NTM J;  1L4A A;  2OQQ A;  1SQQ K;  2GUS A;  1SQQ J;  2A45 G;  4JPZ B;  3BCC E;  4O9B A;  1S5L X;  1M90 Q;  5APV A;  2FBW C;  3H1L J;  2FYZ A;  2QJP C;  3GLM A;  3B5N B;  4L74 A;  2IZ0 A;  2KSE A;  3GHG B;  2LXB A;  1P84 D;  1CI6 B;  3EQ2 A;  2YKP A;  1RF0 A;  5KJ7 D;  1NU1 E;  3V5B A;  4LGD E;  1LTJ A;  4AQR D;  1PP9 E;  4RO0 A;  2KS1 A;  2N1T A;  3CCV P;  5APX A;  1RE3 A;  4AYC A;  1SQV D;  1VPC A;  3A0H E;  1GL2 D;  1LT1 A;  3SWF A;  1K05 A;  3AE7 C;  3MTU E;  2W6B A;  2WSC J;  1OW8 A;  1E79 H;  1EZV E;  2ZXE B;  4K3A A;  1KB9 E;  4C7N B;  4IL6 E;  2K1A A;  3H1I G;  3HRN A;  3FXE A;  3E1R A;  5APW A;  1L0N D;  1U7J A;  2D2C D;  1M1J C;  1SQP G;  1KIL A;  3AE3 C;  4YXW H;  1NAF A;  1FZC C;  3L72 J;  4PV1 B;  1NTK K;  1NTM G;  1L0L D;  1BGY E;  1NTK J;  4D6T E;  3PJS K;  3H1H J;  3V2R A;  1NHL A;  1KV4 A;  1PGP A;  3H1L G;  1VF5 B;  1S5L E;  2QJK B;  3TDK A;  1OW6 A;  2OYO A;  2OGU A;  2Z5H A;  3VYI A;  3SFE C;  3H25 A;  1PGJ A;  2W8Z A;  3L70 E;  2HLO A;  5M1B A;  1P84 I;  1BDC A;  1FBM A;  1NVO A;  3V4Q A;  5KJ7 A;  3RK3 C;  5GTI E;  3L74 E;  3BCC D;  3H32 B;  4I7Z B;  1OW7 A;  3SSU A;  1GL2 A;  2Y9Y A;  2B89 A;  1QGK B;  4CPG A;  2E42 A;  1NU1 D;  5TIS E;  3M91 A;  2Q6Q A;  3CXH E;  1VQO P;  3L72 G;  3NFQ A;  3KPE A;  3SWY A;  2YIU C;  2PAJ A;  2L5G B;  5KKZ C;  1NTK G;  1BCC G;  2AEM A;  1JM0 A;  3BRT B;  1SQV K;  3AEB C;  3H1H G;  1M7L A;  1A02 J;  1VF5 D;  1EZV D;  1DX7 A;  1KB9 D;  2KB7 P;  1KFN A;  3HD7 B;  3CWB E;  1LTT C;  1WRG A;  1GU5 A;  2W90 A;  2WQY C;  3PP5 A;  3NMD A;  1ZN5 A;  2E75 B;  1KYO E;  1YJ9 P;  3RL0 C;  2Q5U A;  3GHG A;  1AVO A;  1L0N K;  3AE4 C;  1L0N J;  3WUU A;  3M0D A;  2XU6 A;  2C9N Y;  1SQX G;  1BGY D;  1J1E B;  2AXC A;  2LR2 A;  3N4X A;  1L0L J;  1PFI A;  4Z1M H;  1NH4 A;  1S72 P;  1X79 B;  2H43 A;  4M3L A;  4XA4 A;  5CCG C;  1OMI A;  5KAF H;  2YKO A;  1KZU B;  4C7N A;  4RJT A;  3AE6 C;  3L70 D;  4YXD C;  5AW0 B;  2IX7 C;  1IK9 A;  1HGV A;  4W7Z A;  5APQ A;  1HF9 A;  3MUD C;  1JTH B;  2M5A B;  3VMY A;  3L36 A;  1CZQ A;  1VQK P;  4OWF A;  5AW9 B;  3L74 D;  2ZYD A;  2WSE H;  1OVV A;  2KI7 B;  1FZE A;  1L4A C;  3HD7 D;  2YXQ B;  1SFC D;  1T3U A;  3WUT A;  4GKG A;  1Y9B A;  4BWN A;  3A3Y B;  2P10 A;  2ZXX A;  3BCC J;  1AVY A;  1KQF B;  4WY4 B;  5B66 H;  3TNU A;  2P2U A;  3D6Z A;  1EZV I;  2E75 D;  1KB9 I;  1PL5 A;  2JEE A;  2J59 M;  3C8V A;  4UB8 H;  2K3R A;  1RE4 A;  1RF0 C;  3C9I A;  2KYV A;  3CXH D;  4C46 A;  1NU1 K;  3VP8 A;  1LTJ C;  1NU1 J;  5AVU B;  2W27 A;  2ZYG A;  5AW8 B;  1PP9 J;  2N1T C;  1IFM A;  2Q9I A;  3U59 A;  2G3A A;  4KJM A;  1RE3 C;  4WB4 A;  1FC2 C;  1LT9 B;  2XKM A;  2R44 A;  4N78 E;  1QL2 A;  3P7K A;  4QMA A;  1L0L G;  3CWB D;  3II6 A;  1PGQ A;  5CCH D;  2RKL A;  2GA1 A;  1MV8 A;  3H32 A;  1WMK A;  1K73 Q;  1MKM A;  1KYO D;  4U7J A;  3Q2Y A;  2ZVN B;  4PJ0 E;  1BCC E;  3AEA C;  1BE3 E;  1KIL C;  5AW6 B;  2I1J A;  3AED C;  3EWK A;  4WVZ A;  1HVV A;  5AW1 B;  2E76 B;  1GTW A;  1DH3 A;  2Y0E A;  3AEC C;  2KXP B;  1BGY J;  3JCU E;  4D6T J;  1K04 A;  1UII A;  5APT A;  1KQG B;  3BCC G;  1NJI Q;  4ASW A;  1LTA C;  2Y9Z A;  1HBW A;  1YTZ I;  1N73 B;  2FFD B;  3BAT A;  3HD7 A;  1NYH A;  4WBA A;  1SQX E;  1SFC A;  2M8R A;  3Q3D A;  3L37 A;  2NRG A;  2Q3I A;  1NU1 G;  3VN0 A;  4Y99 C;  3L70 J;  1PP9 G;  1LWU B;  4H13 B;  2RN0 A;  3CXH I;  1R8E A;  2PGD A;  2R3S A;  5AW3 B;  4N3Y B;  5KJ7 C;  1IJD B;  3A2A A;  5APY A;  4PD4 H;  1K8A Q;  4ASV A;  3L74 J;  1JB0 J;  2JDI H;  1BDD A;  1LJ2 A;  1NTZ E;  1EZV G;  2HPC B;  4EYY Q;  3D70 A;  1GL2 C;  1J1D C;  2PRR A;  1EDL A;  2BEQ D;  5CCH A;  3CCQ P;  3M9H A;  1KYO I;  1EDJ A;  1FE6 A;  2HOD B;  1U7M A;  2E76 D;  2P7J A;  2C9L Y;  3IR9 A;  3I55 P;  3CX5 E;  3L35 A;  4N78 D;  2D2C C;  2H7H A;  3V2P A;  3CME P;  1BGY G;  1IFN A;  1WT6 A;  3CC4 P;  3F5H A;  1AQT A;  4D6T G;  1GZL A;  1H8A A;  4ZKP A;  4C7R A;  1HJ0 A;  3AE8 C;  5E79 E;  3L71 E;  3B71 A;  1N7S C;  2QM7 A;  4HB1 A;  1OVU A;  3N7N A;  3KXD A;  3CWB J;  2BCC E;  1BCC D;  2ZT9 B;  1BE3 D;  5AVW B;  2K9J A;  4OGQ B;  5CMZ A;  3GHG C;  4JF7 A;  3L70 G;  2B88 A;  4H13 D;  1GDT A;  2I1K A;  5B5E H;  2O01 J;  1M56 D;  2AXT H;  1AJY A;  1X9V A;  2IYP A;  1MZ9 A;  1R5S A;  2H89 C;  3MIW A;  1HTL C;  2QRX A;  3L74 G;  4DZO A;  1LT9 A;  1Q90 D;  1SQP K;  3WMM 0;  3OAK A;  1SQX D;  1JOC A;  2OYH B;  3CD6 P;  2WPV B;  1X22 A;  2OAR A;  4L75 A;  1NTM K;  1YTZ T;  1S1C X;  1JY3 P;  1FU1 A;  1H0T B;  1JMB A;  1IFJ A;  1TU3 F;  5KAF E;  2YMY A;  1FOS F;  3TYY A;  3CLQ A;  5AW2 B;  4ZKU A;  1NTZ D;  1URQ D;  3Q5R A;  1G2C A;  4EIJ A;  2M0B A;  2WSC H;  3CWB G;  1EDI A;  2ZT9 D;  1NWQ A;  2KP8 A;  4GIF A;  4OGQ D;  1T3J A;  1VF5 C;  2FFD A;  4H44 B;  1RE4 C;  5TJH A;  4UB6 E;  5L8R J;  3VMX A;  3EFG A;  1ZW0 A;  4JYB A;  1FJP A;  3CX5 D;  4XFJ A;  3ZDM A;  2GM4 A;  1Q7Y Q;  1KN7 A;  2WSF J;  2B87 A;  4UB8 E;  5AVT B;  4L73 A;  3L71 D;  1LP1 B;  5EFW B;  2MKV A;  2BCC D;  4I7Z C;  5KLI C;  3TSI A;  3PLN A;  1ZV8 A;  2IFM A;  3H1J G;  4DJG A;  1BCC J;  3LW5 J;  1AQ5 A;  1BE3 J;  1MFZ A;  1PZQ A;  1KOR A;  2YO3 A;  2BEZ F;  3B5N D;  2HOD A;  1OFC X;  2A06 E;  1FJK A;  1KTM A;  4JBZ A;  1GU4 A;  3H6P A;  1USD A;  2CK3 H;  4GOD A;  4YPC A;  1QL1 A;  2HG5 D;  2IYO A;  2JR8 A;  2KSJ A;  1EXJ A;  3E1I A;  4KT0 J;  4H44 D;  1DEB A;  2P67 A;  3HD7 C;  1SQX K;  1URQ A;  2E5Y A;  1SFC C;  2KUB A;  1SS1 A;  3G9R A;  1SQX J;  2WPS A;  4IOI H;  2E5T A;  4HKZ H;  3G6E P;  4EDF A;  1MUU A;  2OTK E;  1W2E A;  1SQB E;  3R2P A;  2P58 A;  3AE2 C;  1R5L A;  1P84 H;  2KNC B;  1FZG A;  2M3B A;  3HTK B;  1IFD A;  3MD0 A;  1IZN B;  5CBN A;  2PFX A;  2W83 C;  3CX5 I;  4EOT A;  1J1E C;  2OYI B;  2W6A A;  3TGU E;  2IBZ E;  3FGA D;  3HE5 B;  1PP9 D;  5GTH E;  4OH8 B;  1QEX A;  3A0B E;  1NTZ J;  3BAS A;  4PV1 D;  3HUS B;  2O01 N;  1QVF O;  1HJB A;  3RK3 E;  2E43 A;  2FXO A;  5AW4 B;  1G1I A;  5CCH C;  5H2F H;  5K5G B;  1YQ3 C;  4ZMD A;  1RF1 B;  1BE3 G;  1DEE G;  2HYN A;  2C0X A;  4LLH A;  2XDJ A;  3CI9 A;  1K9M Q;  4HYT B;  2QEX P;  1S9K E;  1JUN A;  1H0T A;  1N2D C;  5KAI H;  1MFT A;  3B5N A;  2O3J A;  2QIW A;  2Z5I A;  5CJ0 A;  3A7O A;  1CI6 A;  3CCJ P;  2O1K A;  3L71 J;  1S4X A;  2LKM A;  1W5C E;  3E7K A;  3RK3 B;  2BCC J;  2NPS B;  4D6T D;  1OX3 A;  1EC5 A;  4DT0 A;  1OVR A;  2DW3 A;  1L0L K;  3I56 P;  2A06 D;  2KLU A;  3CCL P;  3K5B A;  3H1K E;  3FXD A;  3G71 P;  3IN6 A;  2SPZ A;  1JMM A;  3WU2 E;  3KZI H;  4Y28 J;  3H1J E;  3IFM A;  4TT3 H;  3AE1 C;  3CCR P;  1EQ7 A;  1NTZ G;  4U3F E;  1LP1 A;  4NPF X;  1T6A A;  1QVG O;  2YIU B;  5KKZ B;  2AEJ A;  3BVH A;  1J2J B;  2WT7 B;  1N7L A;  1SQB D;  3OW2 O;  4KHX A;  1DD3 A;  1SQQ E;  3CC2 P;  1M8O B;  3L75 E;  4MN4 C;  3L73 E;  3TGU D;  2IBZ D;  3RL0 B;  3CCE P;  3A0H H;  1W2B O;  1VQ9 P;  1LTS C;  1YBK A;  3L71 G;  1FDI A;  2NPS D;  2BCC G;  1RQV A;  1ZR4 A;  5BVZ A;  3SWK A;  1KB9 H;  3CC7 P;  4IL6 H;  2FFD C;  3WUV A;  3R4Y A;  2XV5 A;  3MZW B;  3RBZ A;  1S9K D;  2KZJ A;  1FDO A;  2N9B A;  1IK7 A;  1SVF A;  3S1K A;  2AEF A;  3HTK A;  3B4S A;  1ZOY C;  3IAO A;  2QVA A;  1NKN A;  1GK4 A;  1LTI C;  5AVY B;  2OYI A;  2IDB A;  1VL2 A;  3HE5 A;  3GG2 A;  1S5L H;  5CHX A;  4H0L C;  2FKW B;  1X0T A;  4HH2 A;  2K88 A;  3HUS A;  2C0W A;  2XNX A;  1U57 A;  2HR3 A;  4WY4 D;  5AW7 B;  3H1K D;  1RF1 A;  1VDF A;  2QJY C;  2FXM A;  1SLQ A;  1OXZ A;  2GUV A;  1VQL P;  3H1J D;  3G4S P;  2FYU E;  3M0A A;  5GTI H;  2IBZ I;  1EXI A;  3T97 B;  2IZ1 A;  2O1J A;  1H88 A;  2IPP A;  1FOS E;  5KTB A;  2J58 A;  2QE7 H;  3V2Q A;  1URQ C;  2K9Y A;  1GD2 E;  3FWL A;  2NPS A;  2ZT9 C;  4BXL A;  4GOE A;  1SQB K;  1PV3 A;  4OGQ C;  3Q5S A;  1SQB J;  2IFN A;  2JJL A;  3L75 D;  3TF5 A;  3UIA A;  3CL3 D;  3CXH H;  2BAS A;  2A45 H;  3OA7 A;  3P8C E;  2M3E A;  1S3J A;  1OIP A;  1RHZ B;  1X8Y A;  1T2K D;  4AUW A;  3TGU J;  1N8R Q;  4JYC A;  3KHU A;  1KQS O;  2JP3 A;  1FZF A;  2H8P D;  1VQ6 P;  1KQL A;  1JTH A;  2M5A A;  2ZFC A;  2WWW A;  4I1L A;  2WT7 A;  1KYO H;  1SQV E;  5BU5 A;  4R4L A;  3Q5P A;  4RES B;  2O01 H;  1VQ5 P;  2A06 G;  4WY4 A;  2V7Q J;  3B5N C;  4Y99 B;  4IFD K;  2XZR A;  4XE5 B;  1M57 D;  1L0N E;  1HGZ A;  1FDM A;  3M0D C;  1GMJ A;  1UIX A;  2KIK A;  3F89 A;  1ZP0 C;  1SQB G;  1JCD A;  4H44 C;  4LC1 A;  1GL2 B;  3ITK A;  2R3C A;  4IL6 X;  3H1K J;  3RK2 B;  1JY2 O;  2HFE D;  2FYU D;  1IO4 A;  3TK1 A;  3V2N A;  2W6J H;  3TGU G;  1Z56 A;  5AVV B;  2IBZ G;  2FYN B;  4B86 A;  5APS A;  4L76 A;  2KOG A;  3H1J J;  5KLV E;  4U3F J;  2D2C B;  1YIJ P;  1RY3 A;  2E74 B;  5CJ4 A;  3KDP B;  4HJG H;  2YXR B;  5AVR B;  4PV1 C;  3KZI E;  2N9Y B;  3MGN A;  1N7S B;  2OTL P;  3PH0 A;  1QLE D;  1FS0 E;  2Y0D A;  3JSV C;  3GF7 A;  3P8C D;  1E5W A;  2WSF H;  1DIP A;  3L75 J;  3L73 J;  1N73 A;  1S2E A;  2WMM A;  2WPQ A;  3QWO C;  5AVZ B;  2QJK C;  1JO5 A;  3GW6 A;  3AEG C;  1ZRT E;  1YYC A;  1PPJ G;  2KZI A;  3P32 A;  5B66 E;  3AE5 C;  3T97 A;  3VTP C;  1YJW P;  1LWU A;  1Q82 Q;  1JNM A;  3QH9 A;  4PJ0 H;  3LW5 H;  1A02 F;  5APU A;  3RK2 D;  3H1K G;  3CCU P;  5AVS B;  2OTJ P;  2HPC A;  3C1L A;  2R5D A;  2YKQ A;  4K35 A;  3JCU H;  4GT1 A;  3RGU A;  4U3F G;  2ZAE B;  2OYI C;  2E74 D;  3SFD C;  2QJP B;  2K37 A;  1VQ8 P;  3HUS C;  3VMZ A;  1N7S D;  2VRS A;  2RMZ A;  3P8M C;  3PRJ A;  1SQQ G;  3TNU B;  1RF1 C;  1NO4 A;  3M9B A;  2ZVO B;  1PGO A;  1BSH A;  3L75 G;  3L73 G;  2QM8 A;  3D6Y A;  5KLV D;  2FYU K;  1HH0 A;  3S9O A;  2QG4 A;  2FYU J;  2E75 C;  2I8D A;  3U1C A;  4W80 A;  1VQ7 P;  3AEF C;  4I6M C;  1M1J B;  3CCS P;  2NPS C;  3B8E B;  3IF4 A;  2YO2 A;  1FZC B;  1NTZ K;  5KLI B;  1VQN P;  3RBX A;  1LGH B;  1NAY A;  3CX5 H;  2OYH A;  1ZRT D;  4PD4 E;  1DD4 A;  1NKZ B;  5E79 H;  4BRY B;  3AE9 C;  1IC2 A;  3D71 A;  3HE4 B;  3O8Z A;  5DJU B;  3USS A;  3LIE A;  5AVQ B;  1HWT C;  1SQV J;  3NXS A;  3KQG A;  1N7S A;  1PPJ E;  1SFC B;  3EFF K;  1D7M A;  2R32 A;  4WY4 C;  1AA0 A;  3OJA B;  2FYU G;  3ABV C;  4R4M A;  2CPS A;  4RKU J;  1RH5 B;  3VP9 A;  1QX8 A;  1JY3 O;  3W67 A;  1FZA A;  4JQ0 D;  1PIX A;  1IFP A;  2WPR A;  4IFF A;  3H1I E;  3LID A;  3O6Q B;  2QA4 P;  5AVX B;  1LT9 C;  3V4W A;  1Y8A A;  1SQP E;  5B5E E;  1JCC A;  2AXT E;  3PHL A;  2YMK A;  1JY2 N;  1VQ4 P;  2NZ2 A;  1G1J A;  1NTM E;  1YJN P;  3CCM P;  4W7Y A;  5KLV K;  3L4F A;  3RL0 g;  5CBO A;  5KLV J;  3CPW O;  2KK7 A;  2R5B A;  3H1L E;  1T2K C;  2Z4E A;  2E76 C;  1SQV G;  4UB6 H;  3M9Q A;  1YI2 P;  1OZH A;  3RK3 D;  1Q81 Q;  2ZJS E;  1JY2 P;  2K9J B;  4PD4 D;  2KLV A;  1N73 C;  1LTG C;  2WSE J;  1GW3 A;  1LTB C;  1L0N G;  3G3Z A;  2UWJ E;  3NTN A;  2XND H;  1USE A;  2G8Y A;  1AFO A;  2KNC A;  3U1A A;  3CMA P;  3A5T A;  1LWU C;  4H13 C;  2J5U A;  3VMA A;  2JWA A;  2V4H A;  2ITA A;  2ZYA A;  3FX0 A;  1PPJ D;  1M1J A;  1VQM P;  1JEK A;  2QSI A;  1FZC A;  3L72 E;  2YNY A;  1L4A B;  1SP4 A;  1NTK E;  1ZXG A;  4EI2 A;  4GDO A;  5KLV G;  3H1H E;  1FZB A;  2Q1K A;  3V6I A;  2B9B A;  1LNQ A;  3H1I D;  3RL0 D;  4BRY A;  1M1K Q;  1BSN A;  2H88 C;  2P1J A;  1G2C B;  1KIL E;  4N6J A;  1VQP P;  1SQP D;  1YQ4 C;  4U3F D;  3HE4 A;  1LTJ B;  1GK6 A;  2JKV A;  3AEE C;  1ZR2 A;  1N86 A;  2Q7C A;  2KS1 B;  2N1T B;  1AV1 A;  1Q86 Q;  5BU8 B;  3Q1M A;  3KYQ A;  1NTM D;  2CPB A;  1ZME C;  4A7P A;  1SQQ D;  5AW5 B;  4DOJ A;  5CCG D;  1KD1 Q;  4PD4 I;  5TIS H;  1NGM B;  3BRV B;  3H1L D;  5GTH H;  2B87 B;  3A0B H;  3FWN A;  2WTY A;  1RQU A;  3VOP A;  3L73 D;  1KMI Z;  3PTZ A;  2A45 I; 
#chains in the Genus database with same CATH homology
 1SFC D;  1T3U A;  1ZLL A;  4GKG A;  3A3Y B;  4EOT A;  2MJZ A;  1KIL B;  1J1E C;  2OYI B;  2W6A A;  4WY4 B;  3P8C D;  3TNU A;  1E5W A;  2WSF H;  2P2U A;  3HE5 B;  4OH8 B;  2JEE A;  2J59 M;  1N73 A;  1FAV A;  2WZ7 A;  2WPQ A;  5AVZ B;  1RE4 A;  1JO5 A;  3BAS A;  3HUS B;  1L4A D;  1H89 A;  1RF0 C;  3C9I A;  2KYV A;  1HJB A;  2E43 A;  4C46 A;  2OYH C;  1NU1 K;  3VP8 A;  1YYC A;  3M06 A;  5AW4 B;  1G1I A;  1LTJ C;  5CCH C;  5AVU B;  2W27 A;  5AW8 B;  3RK2 C;  3P32 A;  2N1T C;  1IFM A;  2Q9I A;  1RF1 B;  3U59 A;  2HYN A;  1T8Z A;  3T97 A;  1RE3 C;  3VTP C;  4WB4 A;  1LT9 B;  2XKM A;  1LWU A;  2C0X A;  4LLH A;  2XDJ A;  3CI9 A;  4N78 E;  1JNM A;  1QL2 A;  4HYT B;  3P7K A;  3LW5 H;  1S9K E;  1GW4 A;  1JUN A;  3II6 A;  1A02 F;  1XTC C;  1N2D C;  5CCH D;  1OWA A;  5APU A;  3RK2 D;  1HUC A;  1KFM A;  1MV8 A;  2N1T D;  3H32 A;  3B5N A;  1XTG B;  5AVS B;  1IFI A;  2Z5I A;  5CJ0 A;  3A7O A;  1CI6 A;  2HPC A;  2O1K A;  4I2L C;  1URQ B;  2R5D A;  2YKQ A;  2LKM A;  4GT1 A;  3RK3 B;  1KIL C;  2NPS B;  5AW6 B;  2OYI C;  2I1J A;  2WIT A;  2POH A;  1HVV A;  5AW1 B;  1L0L K;  1GTW A;  1DH3 A;  3HUS C;  1J1D B;  3VMZ A;  1N7S D;  1JY3 N;  2VRS A;  2PP6 A;  4IFM A;  3P8M C;  1KIL D;  5CCG A;  3TNU B;  5APT A;  1RF1 C;  1NO4 A;  1JMM A;  1LTA C;  1HBW A;  3M9B A;  1YTZ I;  1N73 B;  2FFD B;  3BAT A;  2QM8 A;  3HD7 A;  3IFM A;  3I5C A;  4WBA A;  1EQ7 A;  1SFC A;  3MUD A;  2M8R A;  1NOH A;  3L37 A;  2FYU K;  1HH0 A;  2Q3I A;  3BVH A;  1J2J B;  1CSB A;  2WT7 B;  1N7L A;  3VN0 A;  4Y99 C;  1CW5 A;  3U1C A;  4KHX A;  1LWU B;  4W80 A;  1L4A A;  1SQQ K;  5AW3 B;  4N3Y B;  5KJ7 C;  1IJD B;  2A45 G;  2GUS A;  4I6M C;  1M1J B;  4O9B A;  2NPS C;  3A2A A;  5APY A;  3B8E B;  2YO2 A;  5APV A;  2FYZ A;  3B5N B;  3RL0 B;  1FZC B;  1NTZ K;  3GHG B;  2HPC B;  1CI6 B;  3EQ2 A;  1GL2 C;  1J1D C;  1LGH B;  1LTS C;  2YKP A;  1RF0 A;  2OYH A;  5KJ7 D;  3V5B A;  4LGD E;  1LTJ A;  4AQR D;  2NPS D;  5CCH A;  1ZR4 A;  2N1T A;  5BVZ A;  3M9H A;  1NKZ B;  2FFD C;  2HOD B;  5APX A;  1RE3 A;  4AYC A;  1VPC A;  2P7J A;  2C9L Y;  1GL2 D;  3IR9 A;  1IC2 A;  3SWF A;  2XV5 A;  3L35 A;  4N78 D;  2H7H A;  3V2P A;  3HE4 B;  3MTU E;  1S9K D;  2W6B A;  2N9B A;  1SVF A;  1IFN A;  1WT6 A;  3O8Z A;  1GZL A;  2ZXE B;  1H8A A;  4ZKP A;  4C7N B;  3LIE A;  5AVQ B;  4C7R A;  1HWT C;  3HTK A;  3HRN A;  3NXS A;  3KQG A;  1N7S C;  2QM7 A;  1N7S A;  1SFC B;  3N7N A;  1NKN A;  5APW A;  1GK4 A;  1LTI C;  1M1J C;  5AVY B;  1KIL A;  2R32 A;  2OYI A;  4WY4 C;  5AVW B;  3OJA B;  3HE5 A;  5CMZ A;  1NAF A;  1FZC C;  2CPS A;  3GHG C;  5CHX A;  4JF7 A;  2FKW B;  4HH2 A;  1GDT A;  3HUS A;  2I1K A;  3VP9 A;  1NTK K;  1JY3 O;  2C0W A;  1FZA A;  2XNX A;  1X9V A;  2WPR A;  1MZ9 A;  4IFF A;  4WY4 D;  5AW7 B;  3MIW A;  1HTL C;  3V2R A;  1NHL A;  1RF1 A;  1VDF A;  3LID A;  4DZO A;  2FXM A;  1SLQ A;  1OXZ A;  2GUV A;  5AVX B;  1LT9 C;  3V4W A;  1LT9 A;  1SQP K;  3WMM 0;  3OAK A;  2Z5H A;  3VYI A;  1JCC A;  1JOC A;  2OYH B;  1JY2 N;  3M0A A;  2OAR A;  2HLO A;  2O1J A;  1H88 A;  1NTM K;  1G1J A;  2IPP A;  1FOS E;  5KTB A;  2J58 A;  3V2Q A;  1URQ C;  1YTZ T;  4W7Y A;  5KLV K;  1FBM A;  3L4F A;  1JY3 P;  1GD2 E;  3V4Q A;  1FU1 A;  5KJ7 A;  3RK3 C;  1IFJ A;  2NPS A;  2R5B A;  1T2K C;  1SQB K;  2YMY A;  3H32 B;  1FOS F;  3TYY A;  3CLQ A;  2IFN A;  2Z4E A;  5AW2 B;  2JJL A;  4ZKU A;  3UIA A;  1GL2 A;  3CL3 D;  3M9Q A;  2BAS A;  1URQ D;  2A45 H;  1G2C A;  3OA7 A;  4EIJ A;  2WSC H;  3P8C E;  3RK3 D;  2E42 A;  1JY2 P;  1X8Y A;  1T2K D;  4AUW A;  3M91 A;  1NWQ A;  2KP8 A;  4GIF A;  4JYC A;  1T3J A;  2KLV A;  1N73 C;  2FFD A;  1LTG C;  1RE4 C;  1FZF A;  2H8P D;  1GW3 A;  3NFQ A;  3VMX A;  3KPE A;  1LTB C;  1KQL A;  3EFG A;  3SWY A;  1JTH A;  2ZFC A;  3G3Z A;  2PAJ A;  2L5G B;  4JYB A;  1FJP A;  2WWW A;  4I1L A;  3NTN A;  2GM4 A;  2WT7 A;  3BRT B;  1SQV K;  1AFO A;  1M7L A;  1A02 J;  3U1A A;  5BU5 A;  1DX7 A;  5AVT B;  3A5T A;  1LWU C;  2KB7 P;  1KFN A;  3HD7 B;  4RES B;  2O01 H;  1LTT C;  1WRG A;  1GU5 A;  1M1J A;  3PP5 A;  3NMD A;  1ZN5 A;  4WY4 A;  3B5N C;  4Y99 B;  4IFD K;  3RL0 C;  2Q5U A;  1FZC A;  3TSI A;  3GHG A;  2XZR A;  1L0N K;  4XE5 B;  2YNY A;  1L4A B;  1SP4 A;  1ZV8 A;  1HGZ A;  1FDM A;  2IFM A;  3M0D C;  3M0D A;  2XU6 A;  2C9N Y;  1J1E B;  1FZB A;  1AQ5 A;  1MFZ A;  2YO3 A;  3B5N D;  3RL0 D;  2HOD A;  3N4X A;  1JCD A;  4LC1 A;  1FJK A;  1GL2 B;  2P1J A;  1G2C B;  1GU4 A;  1PFI A;  2R3C A;  3H6P A;  1NH4 A;  4N6J A;  1X79 B;  3HE4 A;  2H43 A;  1QL1 A;  1LTJ B;  4M3L A;  2HG5 D;  1GK6 A;  4XA4 A;  5CCG C;  3RK2 B;  2KSJ A;  1JY2 O;  1N86 A;  2Q7C A;  2HFE D;  2N1T B;  1ZR2 A;  3TK1 A;  1IO4 A;  2YKO A;  3V2N A;  1KZU B;  4C7N A;  5BU8 B;  3E1I A;  1Z56 A;  5AVV B;  4B86 A;  5AW0 B;  2IX7 C;  1DEB A;  3HD7 C;  2P67 A;  3KYQ A;  5APS A;  1IK9 A;  1HGV A;  1SQX K;  4W7Z A;  1URQ A;  2KOG A;  5APQ A;  2CPB A;  1SFC C;  1JTH B;  2WPS A;  3VMY A;  3L36 A;  1CZQ A;  5AW5 B;  4DOJ A;  1RY3 A;  5CJ4 A;  5CCG D;  5AW9 B;  1MUU A;  1W2E A;  3KDP B;  3R2P A;  3BRV B;  5AVR B;  1FZG A;  2M3B A;  3HTK B;  2WTY A;  2WSE H;  1IFD A;  3VOP A;  3MD0 A;  1FZE A;  1L4A C;  3HD7 D;  3MGN A;  1N7S B;  2A45 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...