1ZLLA

Nmr structure of unphosphorylated human phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of phospholamban pentamer reveals a channel-like architecture in membranes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/signaling protein
molecule keywords Cardiac phospholamban
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zllA00
2HYNA 1N7LA 2KYVA 2M3BA 2KB7P 1ZLLA 1FJPA 1FJKA
chains in the Genus database with same CATH superfamily
1KYOD 3CCUP 1VQ7P 1NWQA 2FXPA 2Y9ZA 3MGNA 1T2KC 5AW9B 1KN7A 1IFMA 1L0NE 3B71A 4N78E 5AVVB 2GUVA 2KXPB 3S9OA 1PGJA 1R8EA 3RK3D 1HJ0A 1IFPA 1L4AD 2KK7A 1VF5D 2BEQD 1SQXG 3IFMA 3RBZA 3SFEC 3VN0A 2WTYA 1Q90D 1HUCA 2A06D 2Q3IA 1OW7A 2QM8A 4NPDA 3AE6C 1NJIQ 1PPJD 1ZMEC 3CC4P 4ASWA 3H1IJ 2BCCD 1Z56A 3I5CA 1BCCD 3N7NA 4XE5B 4D6TG 1E5WA 1BDCA 2ZYGA 3EWKA 1VQKP 2C0XA 1AVOA 1FJKA 3CWBE 1OW6A 2FYNC 3NMDA 2KS1A 3VP8A 3WU2E 1FDOA 2A45G 3L70J 3C9IA 1T3UA 4LGDE 2J58A 3F89A 5E79H 1LJ2A 5CCGA 1M90Q 1SFCA 1GMJA 2HR3A 1L2PA 2R3CA 2WPRA 1GW3A 1FE6A 1KB9H 1LTJB 1FZBA 3B5NA 3EFGA 3B5ND 5KAIE 1KILC 2RH0A 3GF7A 1M1JB 2C9NY 3A0BH 1MZ9A 1YJ9P 2FFDA 1BDDA 5DJUB 1N73C 3O8ZA 3AECC 1BE3J 3B5NC 2OTJP 3JCUE 1FZGA 2Q1KA 3CXHI 1VF5C 3B5NB 1WMKA 1PGQA 2D2CC 2QJYC 2YO2A 1ZXGA 4RESB 3CCRP 1JCCA 1SQXJ 3HTKB 2E43A 1N73A 1SQXK 3TYYA 2W6BA 1LT1A 2Q9IA 2RN0A 4PV1D 2FYUG 2NPSD 3L73D 5APVA 1K05A 3L72E 3AE2C 4MN4C 1KQGB 2BCCJ 1VPCA 3CI9A 2P67A 1RF1B 2WITA 4AUWA 1FOSF 3CCEP 5CCHC 5CJ0A 1USDA 2E76B 5M1BA 5AVXB 3A5TA 2IBZD 3KHUA 3MZWB 4OGQC 2B89A 1PPJG 3H1LE 2E74B 3AE7C 2E75C 3V4QA 3WUTA 4ZMDA 5BU8B 5AW8B 3Q5PA 1HVVA 2E75B 1T6AA 1JY3P 3ZDMA 1S5LX 1TU3F 2R44A 2ZFCA 4I7ZB 1HJBA 3AE9C 1SQBE 2I8DA 5KAFE 1LTJA 4JYBA 2BCCE 1KYOI 3Q2YA 2BASA 1SQQG 1PP9J 2XNXA 2OYOA 3L4FA 4IOIH 1N7LA 3FXDA 2K3RA 4PD4D 2GM4A 1HF9A 1RE3C 1N7SB 5BU5A 1IFDA 1FAVA 1R5SA 3H1HE 3M9BA 1AVYA 5H2FE 3HD7C 4BRYA 4BWNA 1KTMA 1ZP0C 4EDFA 4C46A 1L0LG 2JP3A 2LKMA 1KILE 5B66E 1FZCA 2BCCG 3V2PA 1X22A 1VQ4P 2YIUB 1K73Q 3D6YA 1H0TB 1BGYJ 1KMIZ 1HGVA 3WMM0 1P84I 1AQTA 3H1IG 4YXWH 3RK3B 2QJPC 3I56P 1JTHB 2ZJSE 5KLVK 2E74D 5KLIB 1S72P 2K9JB 2QJKB 1DEEG 3H1HJ 3TK1A 2ZT9C 5B5EE 3RL0g 2OYIB 1IFJA 1NTMD 2K9YA 1KYOH 1URQA 1N7SA 1PP9E 2P1JA 3E1IA 3P8CD 4L74A 1KYOE 3PP5A 3P32A 4N3YB 3U59A 1XTGB 4BXLA 3M0DA 4H44D 1ZRTE 2FYUJ 1PFIA 2NPSB 3G4SP 3U1AA 1MFZA 2Z5IA 2POHA 5KJ7C 2A06G 4ZKPA 3O6QA 1UIXA 3RK2D 3T97B 3TSIA 1LWUB 1YYCA 1OZHA 1GL2C 1NHLA 2M5AB 3FXEA 1NTKG 3G71P 1LWUC 1RQVA 1SQPD 3HUSB 3B8EB 4IL6H 3TNUB 1LTAC 3M9HA 3HE5B 4C7NB 2JWDA 3II6A 4RKUJ 1L0NK 4BRYB 3Q5RA 1VQLP 1L0NJ 2WSCJ 3H32B 1EQ7A 3CCLP 1LTGC 1LWUA 1LP1A 1NTKJ 3KXDA 4OVNF 2WPVB 1NTKK 2WSCH 4CPGA 1EXJA 4W7YA 1GZLA 1KQFB 3OJAB 1DX7A 3KQGA 1SQXE 1QLED 5GTIH 2WVRA 1OXZA 4I1LA 1LTSC 4EI2A 3V2QA 1X9VA 4D6TJ 1CW5A 5APUA 5CCGC 3KZIE 2M0BA 1IFIA 4U3FJ 3LW5J 2XV5A 2E76D 3D70A 2O1JA 2WT7B 1NU1K 3FWNA 4N6JA 3L35A 3H1JE 3H1JJ 5GTHH 1H0TA 5AVRB 1NOHA 1BGYD 2SPZA 5KLIC 2N9YB 1LTBC 2ZVOB 3BCCG 4U7JA 1SQPK 1SQVJ 2IYPA 3A3YB 3BCCD 4PJ0E 1JY2N 3T97A 1N73B 3HD7D 4JQ0D 1Q2NA 3GG2A 3L75E 1NTZE 2FXOA 2PRRA 1J1DC 1LTTC 2L5GB 3JCUH 4HJGH 4UB6H 2Z4EA 3BRVB 1YIJP 1KQSO 1DH3A 1IFNA 4PD4H 1W5CE 3JSVC 2N9BA 1SQQK 3IAOA 2Q3EA 2PP6A 3GLMA 3BVHA 2N1TD 2JR8A 3HE4B 2W8ZA 4Y99C 1JTHA 2XZRA 1YI2P 3CD6P 1JMBA 3IF4A 3PRJA 3L37A 2LXBA 5APQA 4Z1MH 4WB4A 1PZQA 2G8YA 2HODB 1DD4A 3V2RA 3SWKA 2H8PD 4TT3H 4HKZH 1SQPG 3D71A 1LTJC 4OH8B 3CMAP 3L73J 4DZOA 1SQBK 2M3BA 5APYA 3RGUA 2XNDH 2HODA 1GL2D 1KILA 2JJLA 2K37A 2JO1A 3KDPB 2YKPA 3C8VA 4KT0J 1CSBA 1PIXA 2MKVA 2FFDC 3HD7A 5BVZA 1UIIA 2IX7C 3VMAA 2E76C 1NVOA 1G1IA 3AE8C 2W6JH 1R5LA 1NTMG 4GOFA 2O01J 1SQBG 1OVRA 1WRGA 3A0HH 1IK9A 1YQ4C 1U7JA 2YNYA 4Y28J 5AVUB 1AFOA 3PHLA 2OYHC 3R4YA 2OTKE 4D6TE 3L71J 1K8AQ 1SP4A 1JM0A 2GUSA 1KB9D 1ZR2A 1DEBA 2D2CB 3L75J 1YTZT 2A45H 3L70D 5CCHA 2IFNA 2KS1B 3CX5D 1P84D 1FDMA 2WPSA 1GK4A 3AE1C 1SQQE 1LT9A 5KLVJ 2OTLP 3M0DC 2N1TC 3W68A 1OVUA 3HTKA 3LIEA 2KSJA 4DOJA 2FBWC 4GOEA 1E79H 3TGUG 3HE5A 1GL2A 1MV8A 1L4AC 2FYNB 3QH9A 1YTZI 3TGUD 2AEMA 1G2CB 3V6IA 4UB8E 1AV1A 5GTIE 1YJWP 1SVFA 1OW8A 2FYUE 3NTNA 4HB1A 4HYTB 1SFCD 3BATA 1BCCG 3KZIH 3SSUA 3ABVC 5AW2B 4EYYQ 2HPCB 3GHGC 3L36A 3L72D 4H13D 2ZYAA 2O3JA 2Y0DA 4DJGA 1S9KE 1MKMA 3RK2C 4ASVA 1NTKE 3RK3C 1RH5B 2IFMA 2H89C 1GTWA 3G9RA 1ZLLA 2KNCA 4H13C 3GHGA 1VQOP 1G1JA 1NAYA 4H13B 5H2FH 5CCHD 3H1LD 4H0LC 4YTPC 2ZT9B 1EZVG 2KIKA 1SFCB 1M1JC 4WY4D 2E5TA 2AEJA 1ZOYC 1FS0E 3AE4C 1LT9B 3O6QB 5APSA 5AW0B 5KLVD 2B87B 4H0LD 4WBAA 1FJPA 3BCCE 3M91A 1FZCB 2YMYA 3IR9A 4IFMA 3N4XA 4PD4E 1NTZD 2QJKC 3WUUA 5CMZA 3MP7B 4I2LC 1XTCC 3BASA 3VOPA 5KJ7A 5KKZC 2AXTH 1SQVG 1GK6A 1NTZG 4OWFA 3L74D 3R2PA 1WT6A 3CX5E 3SFDC 2K9JA 2IZ1A 1OIPA 3AEGC 5AW4B 3CX5H 1SQBJ 2CPSA 4PD4I 5CCGD 1NGMB 1VQNP 1BSHA 1KILD 2J5UA 1RF0A 2FKWB 1YQ3C 2WSSH 3A7OA 3BRTB 3H1JG 4IL6X 4LLHA 4JBZA 1IK7A 4OGQD 4AYCA 4EOTA 1KZUB 3NXSA 1Y47A 4UB8H 4DCKA 5K5GB 4U3FE 4HH2A 2H88C 2Q7CA 3F5HA 1GL2B 2W83C 1RF0C 1S1CX 1U7MA 1ZV8A 4WY4C 2WPQA 2H43A 1JUNA 1JY3N 5C39A 5AW6B 2IBZI 2FY8A 2ZXEB 2QM7A 1CI6B 1NTMK 4A7PA 1JY3O 2RMZA 1Q86Q 2O01N 2NRGA 2O1KA 3FX0A 4WY4A 3U1CA 1CZQA 1W2BO 4L73A 1IJDB 5CBNA 1ZRTD 4YXDC 2HPCA 4R4LA 3CMEP 1N86A 5L8RJ 1L0NG 1ZR4A 3H6PA 2PGDA 2IBZE 3CXHD 1Q82Q 1SLQA 1PGOA 2VRSA 3AEBC 2J59M 1T2KD 2CPBA 4W80A 1EDIA 1NKZB 1SQPE 1T8ZA 1ZN5A 1RF1C 3AE3C 1X0TA 1RQUA 1VQMP 1HBWA 2E74C 4GIFA 3S4RA 3Q3DA 1VQ9P 1QL2A 5TJHA 3HD7B 4GT1A 2ZYDA 3CWBJ 2A45I 3FGAD 2HG5D 2O01H 1M56D 1SQVD 5AW1B 1QVFO 1IC2A 2KP8A 2QIWA 5AVTB 2E75D 4PV1C 5KLVG 4NPEA 2KNCB 4GKGA 3RL0C 1M8OB 3D6ZA 1URQB 2FFDB 1BE3E 4GDOA 1GU4A 2IDBA 3P7KA 2C0WA 1EC5A 3TGUE 2MJZA 3OAKA 1PV3A 2IYOA 1USEA 1GU5A 1KQLA 2C9LY 1NYHA 2WSEH 4IL6E 4C7RA 2Y0CA 3WUVA 1L4AA 1NTME 2QE7H 3L74J 3P8CE 4EIJA 1W2EA 1S4XA 3L75G 1FZCC 1FC2C 2KI7B 1A02F 1KV4A 3MUDA 3GW6A 1JY2P 1NKNA 3H1LG 3L73E 1NU1J 3AEEC 4TLFA 3OA7A 5KJ7D 2AXCA 2I1JA 3VMXA 5KAIH 3CCMP 1L0ND 4N78D 2LXCB 3M06A 3H1IE 2BEZF 4I7ZC 4DT0A 3V4WA 1RE3A 3MIWA 3H25A 1DIPA 2KZJA 1EXIA 1J1EC 3HUSA 3H1LJ 3L72G 2Q6QA 1SQPJ 1SQVK 2M5AA 1VDFA 2ZT9D 3L74E 3RL0D 2A06E 3S1KA 3USSA 1VQ5P 2H7HA 5AW5B 2K88A 1QEXA 3C1LA 1EDLA 1FZEA 5B5EH 3AE5C 5GTHE 3L74G 5APWA 3CCVP 3HUSC 2ZXXA 3TDKA 1SQBD 3L72J 2L91A 1VQ8P 1LNQA 2W90A 3B4SA 2OQQA 1JEKA 1LT9C 2KB7P 1NTMJ 3CL3D 2XDJA 1K04A 2YIUC 2WSFH 1NTZJ 2JWAA 1M57D 1OWAA 1VL2A 2Y0EA 3FWLA 1NTZK 2P7JA 3H1HD 2CK3H 3RL0B 2YMKA 4RJTA 1N7SC 3H1KJ 1VF5B 3AEFC 3TGUJ 1BE3G 1YBKA 2B87A 2ZVNB 3P8MC 4H44C 3G6EP 3CCJP 3E7KA 1GD2E 1JOCA 3AEAC 2KSEA 4H44B 5CHXA 5TISH 1H89A 1KD1Q 1JCDA 2N1TB 2OGUA 1SS1A 3CWBG 5KAFH 3CXHH 2NZ2A 2E42A 1Y9BA 5APTA 2HFED 4XFJA 3H1KD 1RE4A 1AQ5A 3UIAA 1KB9E 1VQ6P 3L75D 1BSNA 1QVGO 2P58A 5AVQB 1PP9D 2KUBA 4KHXA 4K3AA 1PL5A 2YO3A 3L71D 1FZFA 1J2JB 2R5DA 1U57A 1S2EA 2ITAA 3K5BA 1KB9I 1KFNA 3PTZA 3E1RA 1OX3A 1G2CA 2JKVA 2OYIA 5CBOA 1M1JA 3W67A 2XKMA 3JC22 3PH0A 1EZVI 2KZIA 2R5BA 4C7NA 2OARA 2QJYB 1JMMA 3A2AA 2QA4P 1K9MQ 3IN6A 1LTIC 1KFMA 2OYIC 1RF1A 3VMYA 5DJTB 5AVZB 2Z5HA 4PJ0H 2WWWA 1H8AA 1JY2O 2YXQB 1EDJA 4LC1A 3LIDA 3MTUE 1FBMA 1NU1D 1HH0A 1N8RQ 4UB6E 1NAFA 5APXA 1URQD 1SQXD 3M0AA 1S9KD 2I1KA 2XU6A 3AEDC 1AJYA 3KYQA 4AQRD 1X8YA 1AA0A 2G3AA 2PFXA 2RKLA 4K35A 1IO4A 1BE3D 2GA1A 2AEFA 2KOGA 1S5LE 2IPPA 2JDIH 1S5LH 2FXMA 1JNMA 3SWFA 3GMAA 4O9BA 3WU2H 2OYHB 1NH4A 3CC2P 4YPCA 2W6AA 1MFTA 2M8RA 2QG4A 5AVSB 2D2CD 1N2DC 2DW3A 1KC8Q 3HRNA 5KLVE 3EFFK 1PPJE 3CCQP 1KORA 3H1KG 2B88A 3CPWO 1CI6A 2Y9YA 1X79B 2W27A 5EFWB 1SFCC 2B9BA 2KLUA 2WMMA 3SWYA 4B86A 3MD0A 5B66H 3A0BE 3BCCJ 3CWBD 2WSFJ 3GF3A 1BCCJ 3V2NA 4ZNCA 2ZAEB 1IZNB 3H1ID 4Y99B 3MUDC 4JPZB 5AW7B 2YXRB 3CX5I 4OGQB 4PV1B 3RK2B 3VMZA 2KLVA 1L4AB 1FOSE 4KJMA 2OYHA 4XA4A 1RY3A 4W7ZA 5E79E 4U3FG 4QMAA 2NPSA 4WVZA 3HE4A 2WSEJ 2WT7A 1YJNP 1FDIA 1FZAA 1L0LE 1QGKB 4U3FD 2Q5UA 1EZVD 3A0HE 1M7LA 3VYIA 3QWOC 3H1HG 3RBXA 2NPSC 2P2UA 1T3JA 4JYCA 1NU1G 2K1AA 4JF7A 2R32A 3MHVA 1HWTC 4WY4B 1URQC 5TISE 1PGPA 1EDKA 1NTKD 2LR2A 2JEEA 1KILB 1LP1B 2R3SA 1S3JA 2YKOA 4I6MC 1L0LK 1Q7YQ 3CXHE 1JB0J 1L0LJ 3CC7P 2UWJE 3L73G 3GHGB 3RK3E 4WWIA 1NO4A 4NPFX 3TNUA 5AVYB 4ZKUA 4M3LA 3H1JD 3I55P 1J1EB 1OFCX 2N1TA 1BGYE 4GODA 1SQQJ 2V7QH 4R4MA 2V4HA 3H1KE 1GDTA 1ZW0A 1RHZB 2V7QJ 3L71G 2P10A 4H0LB 1BCCE 3ITKA 5KKZB 4D6TD 1M1KQ 3TF5A 2HYNA 1Q81Q 1Y8AA 5CJ4A 2KYVA 3M9QA 1HTLC 3PJSK 3V5BA 1RE4C 3CLQA 3L71E 2QSIA 2QEXP 3L70E 3Q1MA 1SQVE 1YITP 3CCSP 2QJPB 2QVAA 1P84E 1A02J 3Q5SA 4IFDK 1JO5A 1MUUA 1SQQD 3H32A 1P84H 1N7SD 1FU1A 1QL1A 3NFQA 1OVVA 2WZ7A 1BGYG 1LGHB 1DD3A 1PP9G 3VP9A 1VQPP 2FYUK 5AW3B 5AVWB 2IZ0A 5KTBA 4RO0A 4L75A 1GW4A 1L0LD 3G3ZA 2QRXA 2HLOA 1HGZA 1EZVE 2M3EA 2YKQA 1D7MA 3KPEA 3LW5H 4L76A 1H88A 1QX8A 2PAJA 2WQYC 2IBZG 1NU1E 3EQ2A 3OW2O 1J1DB 2FYZA 3L70G 1YHQP 1OMIA 2FYUD 2E5YA 2AXTE 4IFFA 3PLNA 3VTPC
chains in the Genus database with same CATH topology
1NWQA 1T2KC 3MGNA 5AW9B 1IFMA 4N78E 5AVVB 2GUVA 3RK3D 3IFMA 1L4AD 3VN0A 2WTYA 2Q3IA 1HUCA 2QM8A 1Z56A 3I5CA 3N7NA 4XE5B 1E5WA 2C0XA 1FJKA 3NMDA 3VP8A 2A45G 5CCGA 3C9IA 1T3UA 4LGDE 2J58A 1SFCA 2R3CA 2WPRA 1GW3A 1LTJB 3B5NA 1FZBA 3EFGA 3B5ND 1KILC 1M1JB 2C9NY 1MZ9A 2FFDA 1N73C 3O8ZA 3B5NC 1FZGA 3B5NB 2YO2A 4RESB 1JCCA 3HTKB 2E43A 1N73A 1SQXK 3TYYA 2W6BA 2Q9IA 5APVA 2NPSD 1VPCA 3CI9A 2P67A 1RF1B 2WITA 4AUWA 1FOSF 5CCHC 5CJ0A 3A5TA 5AVXB 3V4QA 5BU8B 5AW8B 1HVVA 1JY3P 2ZFCA 1HJBA 1LTJA 4JYBA 2BASA 2XNXA 3L4FA 2GM4A 1N7LA 1RE3C 1N7SB 5BU5A 1IFDA 1FAVA 3M9BA 3HD7C 4C46A 2LKMA 1FZCA 3V2PA 3WMM0 1HGVA 3RK3B 1JTHB 5KLVK 3TK1A 2OYIB 1IFJA 3P8CD 1URQA 1N7SA 2P1JA 3E1IA 3V2QA 3BVHA 3PP5A 3P32A 4N3YB 3U59A 1XTGB 3M0DA 1PFIA 2NPSB 3U1AA 1MFZA 2Z5IA 2POHA 5KJ7C 4ZKPA 3RK2D 3TSIA 1LWUB 1YYCA 1GL2C 1NHLA 1LWUC 3HUSB 3B8EB 3TNUB 1LTAC 3M9HA 3HE5B 4C7NB 3II6A 1L0NK 3H32B 1EQ7A 1LTGC 1LWUA 1NTKK 2WSCH 4W7YA 1GZLA 3OJAB 1DX7A 3KQGA 1OXZA 4I1LA 1LTSC 1X9VA 1CW5A 5APUA 5CCGC 1IFIA 2XV5A 2O1JA 2WT7B 1NU1K 4N6JA 3L35A 5AVRB 1NOHA 1LTBC 1SQPK 3A3YB 3T97A 1JY2N 1N73B 3HD7D 1J1DC 1LTTC 2L5GB 2Z4EA 3BRVB 1DH3A 1IFNA 2N9BA 1SQQK 2PP6A 2N1TD 3HE4B 4Y99C 1JTHA 2XZRA 3L37A 5APQA 4WB4A 2HODB 3V2RA 2H8PD 1LTJC 4OH8B 4DZOA 1SQBK 2M3BA 5APYA 2HODA 1GL2D 1KILA 2JJLA 3KDPB 2YKPA 1CSBA 2FFDC 3HD7A 5BVZA 2IX7C 1G1IA 1WRGA 1IK9A 2YNYA 5AVUB 1AFOA 2OYHC 1SP4A 2GUSA 1ZR2A 1DEBA 1YTZT 2A45H 5CCHA 2IFNA 1FDMA 2WPSA 1GK4A 1LT9A 3M0DC 2N1TC 3HTKA 3LIEA 2KSJA 4DOJA 3HE5A 1GL2A 1MV8A 1L4AC 1YTZI 1G2CB 1SVFA 3NTNA 4HYTB 1SFCD 3BATA 2HPCB 5AW2B 3GHGC 3L36A 1S9KE 3RK2C 3RK3C 2IFMA 1GTWA 1ZLLA 3GHGA 1G1JA 5CCHD 1SFCB 1M1JC 4WY4D 5APSA 5AW0B 1LT9B 1FJPA 4WBAA 3M91A 1FZCB 2YMYA 3IR9A 4IFMA 3N4XA 5CMZA 3VOPA 4I2LC 3BASA 1XTCC 5KJ7A 1GK6A 3R2PA 1WT6A 5AW4B 5CCGD 2CPSA 1KILD 4LLHA 1RF0A 2FKWB 3A7OA 3BRTB 4AYCA 4EOTA 1KZUB 3NXSA 4HH2A 2Q7CA 1GL2B 1RF0C 1ZV8A 4WY4C 1JUNA 2H43A 2WPQA 1JY3N 5AW6B 2ZXEB 2QM7A 1CI6B 1NTMK 1JY3O 2O1KA 4WY4A 3U1CA 1CZQA 2HPCA 1IJDB 1N86A 1ZR4A 3H6PA 1SLQA 2VRSA 2J59M 1T2KD 2CPBA 4W80A 1NKZB 1T8ZA 1ZN5A 1RF1C 1HBWA 4GIFA 1QL2A 3HD7B 4GT1A 2A45I 2HG5D 2O01H 5AW1B 1IC2A 2KP8A 5AVTB 4GKGA 3RL0C 1URQB 2FFDB 1GU4A 3P7KA 2C0WA 2MJZA 3OAKA 1GU5A 1KQLA 2C9LY 2WSEH 4C7RA 1L4AA 3P8CE 4EIJA 1W2EA 1FZCC 1A02F 3MUDA 1JY2P 1NKNA 5KJ7D 3OA7A 1H88A 2I1JA 3VMXA 4N78D 3M06A 3V4WA 1RE3A 3MIWA 1J1EC 3HUSA 1SQVK 1VDFA 2H7HA 3RL0D 5AW5B 1FZEA 5APWA 3HUSC 1LT9C 2KB7P 3CL3D 2XDJA 2WSFH 1OWAA 3RL0B 1NTZK 2P7JA 1N7SC 3P8MC 1GD2E 1JOCA 5CHXA 1H89A 1JCDA 2N1TB 2E42A 5APTA 2HFED 1RE4A 1AQ5A 3UIAA 5AVQB 4KHXA 2YO3A 1FZFA 1J2JB 2R5DA 1KFNA 1G2CA 2OYIA 1M1JA 2XKMA 2R5BA 4C7NA 2OARA 1JMMA 3A2AA 1LTIC 1KFMA 2OYIC 1RF1A 3VMYA 5AVZB 2Z5HA 1H8AA 2WWWA 1JY2O 4LC1A 3LIDA 3MTUE 1FBMA 1HH0A 5APXA 1NAFA 1URQD 3M0AA 1S9KD 2I1KA 2XU6A 3KYQA 4AQRD 1X8YA 1IO4A 2KOGA 2IPPA 2FXMA 1JNMA 3SWFA 2OYHB 4O9BA 1NH4A 2W6AA 5AVSB 2M8RA 1N2DC 3HRNA 1CI6A 1X79B 2W27A 4B86A 1SFCC 3SWYA 3MD0A 3V2NA 4Y99B 5AW7B 3VMZA 3RK2B 2KLVA 1L4AB 1FOSE 2OYHA 4XA4A 1RY3A 4W7ZA 2NPSA 2WT7A 3HE4A 1FZAA 2Q5UA 3VYIA 1M7LA 2NPSC 2P2UA 1T3JA 4JYCA 4JF7A 2R32A 1HWTC 4WY4B 1URQC 2JEEA 1KILB 2YKOA 4I6MC 1L0LK 3GHGB 4ZKUA 1NO4A 3TNUA 5AVYB 4M3LA 1J1EB 2N1TA 1GDTA 2HYNA 5CJ4A 2KYVA 3M9QA 1HTLC 3V5BA 1RE4C 3CLQA 1A02J 1JO5A 4IFDK 1MUUA 3NFQA 3H32A 1QL1A 1N7SD 1FU1A 2WZ7A 3VP9A 1LGHB 2FYUK 5AW3B 5AVWB 5KTBA 1GW4A 3G3ZA 3LW5H 2HLOA 1HGZA 2YKQA 3KPEA 2PAJA 3EQ2A 1J1DB 2FYZA 4IFFA 3VTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYN A;  1N7L A;  2KYV A;  2M3B A;  2KB7 P;  1ZLL A;  1FJP A;  1FJK A; 
#chains in the Genus database with same CATH topology
 1KYO D;  3CCU P;  1VQ7 P;  1NWQ A;  2FXP A;  2Y9Z A;  3MGN A;  1T2K C;  5AW9 B;  1KN7 A;  1IFM A;  1L0N E;  3B71 A;  4N78 E;  5AVV B;  2GUV A;  2KXP B;  3S9O A;  1PGJ A;  1R8E A;  3RK3 D;  1HJ0 A;  1IFP A;  1L4A D;  2KK7 A;  1VF5 D;  2BEQ D;  1SQX G;  3IFM A;  3RBZ A;  3SFE C;  3VN0 A;  2WTY A;  1Q90 D;  1HUC A;  2A06 D;  2Q3I A;  1OW7 A;  2QM8 A;  4NPD A;  3AE6 C;  1NJI Q;  1PPJ D;  1ZME C;  3CC4 P;  4ASW A;  3H1I J;  2BCC D;  1Z56 A;  3I5C A;  1BCC D;  3N7N A;  4XE5 B;  4D6T G;  1E5W A;  1BDC A;  2ZYG A;  3EWK A;  1VQK P;  2C0X A;  1AVO A;  1FJK A;  3CWB E;  1OW6 A;  2FYN C;  3NMD A;  2KS1 A;  3VP8 A;  3WU2 E;  1FDO A;  2A45 G;  3L70 J;  3C9I A;  1T3U A;  4LGD E;  2J58 A;  3F89 A;  5E79 H;  1LJ2 A;  5CCG A;  1M90 Q;  1SFC A;  1GMJ A;  2HR3 A;  1L2P A;  2R3C A;  2WPR A;  1GW3 A;  1FE6 A;  1KB9 H;  1LTJ B;  1FZB A;  3B5N A;  3EFG A;  3B5N D;  5KAI E;  1KIL C;  2RH0 A;  3GF7 A;  1M1J B;  2C9N Y;  3A0B H;  1MZ9 A;  1YJ9 P;  2FFD A;  1BDD A;  5DJU B;  1N73 C;  3O8Z A;  3AEC C;  1BE3 J;  3B5N C;  2OTJ P;  3JCU E;  1FZG A;  2Q1K A;  3CXH I;  1VF5 C;  3B5N B;  1WMK A;  1PGQ A;  2D2C C;  2QJY C;  2YO2 A;  1ZXG A;  4RES B;  3CCR P;  1JCC A;  1SQX J;  3HTK B;  2E43 A;  1N73 A;  1SQX K;  3TYY A;  2W6B A;  1LT1 A;  2Q9I A;  2RN0 A;  4PV1 D;  2FYU G;  2NPS D;  3L73 D;  5APV A;  1K05 A;  3L72 E;  3AE2 C;  4MN4 C;  1KQG B;  2BCC J;  1VPC A;  3CI9 A;  2P67 A;  1RF1 B;  2WIT A;  4AUW A;  1FOS F;  3CCE P;  5CCH C;  5CJ0 A;  1USD A;  2E76 B;  5M1B A;  5AVX B;  3A5T A;  2IBZ D;  3KHU A;  3MZW B;  4OGQ C;  2B89 A;  1PPJ G;  3H1L E;  2E74 B;  3AE7 C;  2E75 C;  3V4Q A;  3WUT A;  4ZMD A;  5BU8 B;  5AW8 B;  3Q5P A;  1HVV A;  2E75 B;  1T6A A;  1JY3 P;  3ZDM A;  1S5L X;  1TU3 F;  2R44 A;  2ZFC A;  4I7Z B;  1HJB A;  3AE9 C;  1SQB E;  2I8D A;  5KAF E;  1LTJ A;  4JYB A;  2BCC E;  1KYO I;  3Q2Y A;  2BAS A;  1SQQ G;  1PP9 J;  2XNX A;  2OYO A;  3L4F A;  4IOI H;  1N7L A;  3FXD A;  2K3R A;  4PD4 D;  2GM4 A;  1HF9 A;  1RE3 C;  1N7S B;  5BU5 A;  1IFD A;  1FAV A;  1R5S A;  3H1H E;  3M9B A;  1AVY A;  5H2F E;  3HD7 C;  4BRY A;  4BWN A;  1KTM A;  1ZP0 C;  4EDF A;  4C46 A;  1L0L G;  2JP3 A;  2LKM A;  1KIL E;  5B66 E;  1FZC A;  2BCC G;  3V2P A;  1X22 A;  1VQ4 P;  2YIU B;  1K73 Q;  3D6Y A;  1H0T B;  1BGY J;  1KMI Z;  1HGV A;  3WMM 0;  1P84 I;  1AQT A;  3H1I G;  4YXW H;  3RK3 B;  2QJP C;  3I56 P;  1JTH B;  2ZJS E;  5KLV K;  2E74 D;  5KLI B;  1S72 P;  2K9J B;  2QJK B;  1DEE G;  3H1H J;  3TK1 A;  2ZT9 C;  5B5E E;  3RL0 g;  2OYI B;  1IFJ A;  1NTM D;  2K9Y A;  1KYO H;  1URQ A;  1N7S A;  1PP9 E;  2P1J A;  3E1I A;  3P8C D;  4L74 A;  1KYO E;  3PP5 A;  3P32 A;  4N3Y B;  3U59 A;  1XTG B;  4BXL A;  3M0D A;  4H44 D;  1ZRT E;  2FYU J;  1PFI A;  2NPS B;  3G4S P;  3U1A A;  1MFZ A;  2Z5I A;  2POH A;  5KJ7 C;  2A06 G;  4ZKP A;  3O6Q A;  1UIX A;  3RK2 D;  3T97 B;  3TSI A;  1LWU B;  1YYC A;  1OZH A;  1GL2 C;  1NHL A;  2M5A B;  3FXE A;  1NTK G;  3G71 P;  1LWU C;  1RQV A;  1SQP D;  3HUS B;  3B8E B;  4IL6 H;  3TNU B;  1LTA C;  3M9H A;  3HE5 B;  4C7N B;  2JWD A;  3II6 A;  4RKU J;  1L0N K;  4BRY B;  3Q5R A;  1VQL P;  1L0N J;  2WSC J;  3H32 B;  1EQ7 A;  3CCL P;  1LTG C;  1LWU A;  1LP1 A;  1NTK J;  3KXD A;  4OVN F;  2WPV B;  1NTK K;  2WSC H;  4CPG A;  1EXJ A;  4W7Y A;  1GZL A;  1KQF B;  3OJA B;  1DX7 A;  3KQG A;  1SQX E;  1QLE D;  5GTI H;  2WVR A;  1OXZ A;  4I1L A;  1LTS C;  4EI2 A;  3V2Q A;  1X9V A;  4D6T J;  1CW5 A;  5APU A;  5CCG C;  3KZI E;  2M0B A;  1IFI A;  4U3F J;  3LW5 J;  2XV5 A;  2E76 D;  3D70 A;  2O1J A;  2WT7 B;  1NU1 K;  3FWN A;  4N6J A;  3L35 A;  3H1J E;  3H1J J;  5GTH H;  1H0T A;  5AVR B;  1NOH A;  1BGY D;  2SPZ A;  5KLI C;  2N9Y B;  1LTB C;  2ZVO B;  3BCC G;  4U7J A;  1SQP K;  1SQV J;  2IYP A;  3A3Y B;  3BCC D;  4PJ0 E;  1JY2 N;  3T97 A;  1N73 B;  3HD7 D;  4JQ0 D;  1Q2N A;  3GG2 A;  3L75 E;  1NTZ E;  2FXO A;  2PRR A;  1J1D C;  1LTT C;  2L5G B;  3JCU H;  4HJG H;  4UB6 H;  2Z4E A;  3BRV B;  1YIJ P;  1KQS O;  1DH3 A;  1IFN A;  4PD4 H;  1W5C E;  3JSV C;  2N9B A;  1SQQ K;  3IAO A;  2Q3E A;  2PP6 A;  3GLM A;  3BVH A;  2N1T D;  2JR8 A;  3HE4 B;  2W8Z A;  4Y99 C;  1JTH A;  2XZR A;  1YI2 P;  3CD6 P;  1JMB A;  3IF4 A;  3PRJ A;  3L37 A;  2LXB A;  5APQ A;  4Z1M H;  4WB4 A;  1PZQ A;  2G8Y A;  2HOD B;  1DD4 A;  3V2R A;  3SWK A;  2H8P D;  4TT3 H;  4HKZ H;  1SQP G;  3D71 A;  1LTJ C;  4OH8 B;  3CMA P;  3L73 J;  4DZO A;  1SQB K;  2M3B A;  5APY A;  3RGU A;  2XND H;  2HOD A;  1GL2 D;  1KIL A;  2JJL A;  2K37 A;  2JO1 A;  3KDP B;  2YKP A;  3C8V A;  4KT0 J;  1CSB A;  1PIX A;  2MKV A;  2FFD C;  3HD7 A;  5BVZ A;  1UII A;  2IX7 C;  3VMA A;  2E76 C;  1NVO A;  1G1I A;  3AE8 C;  2W6J H;  1R5L A;  1NTM G;  4GOF A;  2O01 J;  1SQB G;  1OVR A;  1WRG A;  3A0H H;  1IK9 A;  1YQ4 C;  1U7J A;  2YNY A;  4Y28 J;  5AVU B;  1AFO A;  3PHL A;  2OYH C;  3R4Y A;  2OTK E;  4D6T E;  3L71 J;  1K8A Q;  1SP4 A;  1JM0 A;  2GUS A;  1KB9 D;  1ZR2 A;  1DEB A;  2D2C B;  3L75 J;  1YTZ T;  2A45 H;  3L70 D;  5CCH A;  2IFN A;  2KS1 B;  3CX5 D;  1P84 D;  1FDM A;  2WPS A;  1GK4 A;  3AE1 C;  1SQQ E;  1LT9 A;  5KLV J;  2OTL P;  3M0D C;  2N1T C;  3W68 A;  1OVU A;  3HTK A;  3LIE A;  2KSJ A;  4DOJ A;  2FBW C;  4GOE A;  1E79 H;  3TGU G;  3HE5 A;  1GL2 A;  1MV8 A;  1L4A C;  2FYN B;  3QH9 A;  1YTZ I;  3TGU D;  2AEM A;  1G2C B;  3V6I A;  4UB8 E;  1AV1 A;  5GTI E;  1YJW P;  1SVF A;  1OW8 A;  2FYU E;  3NTN A;  4HB1 A;  4HYT B;  1SFC D;  3BAT A;  1BCC G;  3KZI H;  3SSU A;  3ABV C;  5AW2 B;  4EYY Q;  2HPC B;  3GHG C;  3L36 A;  3L72 D;  4H13 D;  2ZYA A;  2O3J A;  2Y0D A;  4DJG A;  1S9K E;  1MKM A;  3RK2 C;  4ASV A;  1NTK E;  3RK3 C;  1RH5 B;  2IFM A;  2H89 C;  1GTW A;  3G9R A;  1ZLL A;  2KNC A;  4H13 C;  3GHG A;  1VQO P;  1G1J A;  1NAY A;  4H13 B;  5H2F H;  5CCH D;  3H1L D;  4H0L C;  4YTP C;  2ZT9 B;  1EZV G;  2KIK A;  1SFC B;  1M1J C;  4WY4 D;  2E5T A;  2AEJ A;  1ZOY C;  1FS0 E;  3AE4 C;  1LT9 B;  3O6Q B;  5APS A;  5AW0 B;  5KLV D;  2B87 B;  4H0L D;  4WBA A;  1FJP A;  3BCC E;  3M91 A;  1FZC B;  2YMY A;  3IR9 A;  4IFM A;  3N4X A;  4PD4 E;  1NTZ D;  2QJK C;  3WUU A;  5CMZ A;  3MP7 B;  4I2L C;  1XTC C;  3BAS A;  3VOP A;  5KJ7 A;  5KKZ C;  2AXT H;  1SQV G;  1GK6 A;  1NTZ G;  4OWF A;  3L74 D;  3R2P A;  1WT6 A;  3CX5 E;  3SFD C;  2K9J A;  2IZ1 A;  1OIP A;  3AEG C;  5AW4 B;  3CX5 H;  1SQB J;  2CPS A;  4PD4 I;  5CCG D;  1NGM B;  1VQN P;  1BSH A;  1KIL D;  2J5U A;  1RF0 A;  2FKW B;  1YQ3 C;  2WSS H;  3A7O A;  3BRT B;  3H1J G;  4IL6 X;  4LLH A;  4JBZ A;  1IK7 A;  4OGQ D;  4AYC A;  4EOT A;  1KZU B;  3NXS A;  1Y47 A;  4UB8 H;  4DCK A;  5K5G B;  4U3F E;  4HH2 A;  2H88 C;  2Q7C A;  3F5H A;  1GL2 B;  2W83 C;  1RF0 C;  1S1C X;  1U7M A;  1ZV8 A;  4WY4 C;  2WPQ A;  2H43 A;  1JUN A;  1JY3 N;  5C39 A;  5AW6 B;  2IBZ I;  2FY8 A;  2ZXE B;  2QM7 A;  1CI6 B;  1NTM K;  4A7P A;  1JY3 O;  2RMZ A;  1Q86 Q;  2O01 N;  2NRG A;  2O1K A;  3FX0 A;  4WY4 A;  3U1C A;  1CZQ A;  1W2B O;  4L73 A;  1IJD B;  5CBN A;  1ZRT D;  4YXD C;  2HPC A;  4R4L A;  3CME P;  1N86 A;  5L8R J;  1L0N G;  1ZR4 A;  3H6P A;  2PGD A;  2IBZ E;  3CXH D;  1Q82 Q;  1SLQ A;  1PGO A;  2VRS A;  3AEB C;  2J59 M;  1T2K D;  2CPB A;  4W80 A;  1EDI A;  1NKZ B;  1SQP E;  1T8Z A;  1ZN5 A;  1RF1 C;  3AE3 C;  1X0T A;  1RQU A;  1VQM P;  1HBW A;  2E74 C;  4GIF A;  3S4R A;  3Q3D A;  1VQ9 P;  1QL2 A;  5TJH A;  3HD7 B;  4GT1 A;  2ZYD A;  3CWB J;  2A45 I;  3FGA D;  2HG5 D;  2O01 H;  1M56 D;  1SQV D;  5AW1 B;  1QVF O;  1IC2 A;  2KP8 A;  2QIW A;  5AVT B;  2E75 D;  4PV1 C;  5KLV G;  4NPE A;  2KNC B;  4GKG A;  3RL0 C;  1M8O B;  3D6Z A;  1URQ B;  2FFD B;  1BE3 E;  4GDO A;  1GU4 A;  2IDB A;  3P7K A;  2C0W A;  1EC5 A;  3TGU E;  2MJZ A;  3OAK A;  1PV3 A;  2IYO A;  1USE A;  1GU5 A;  1KQL A;  2C9L Y;  1NYH A;  2WSE H;  4IL6 E;  4C7R A;  2Y0C A;  3WUV A;  1L4A A;  1NTM E;  2QE7 H;  3L74 J;  3P8C E;  4EIJ A;  1W2E A;  1S4X A;  3L75 G;  1FZC C;  1FC2 C;  2KI7 B;  1A02 F;  1KV4 A;  3MUD A;  3GW6 A;  1JY2 P;  1NKN A;  3H1L G;  3L73 E;  1NU1 J;  3AEE C;  4TLF A;  3OA7 A;  5KJ7 D;  2AXC A;  2I1J A;  3VMX A;  5KAI H;  3CCM P;  1L0N D;  4N78 D;  2LXC B;  3M06 A;  3H1I E;  2BEZ F;  4I7Z C;  4DT0 A;  3V4W A;  1RE3 A;  3MIW A;  3H25 A;  1DIP A;  2KZJ A;  1EXI A;  1J1E C;  3HUS A;  3H1L J;  3L72 G;  2Q6Q A;  1SQP J;  1SQV K;  2M5A A;  1VDF A;  2ZT9 D;  3L74 E;  3RL0 D;  2A06 E;  3S1K A;  3USS A;  1VQ5 P;  2H7H A;  5AW5 B;  2K88 A;  1QEX A;  3C1L A;  1EDL A;  1FZE A;  5B5E H;  3AE5 C;  5GTH E;  3L74 G;  5APW A;  3CCV P;  3HUS C;  2ZXX A;  3TDK A;  1SQB D;  3L72 J;  2L91 A;  1VQ8 P;  1LNQ A;  2W90 A;  3B4S A;  2OQQ A;  1JEK A;  1LT9 C;  2KB7 P;  1NTM J;  3CL3 D;  2XDJ A;  1K04 A;  2YIU C;  2WSF H;  1NTZ J;  2JWA A;  1M57 D;  1OWA A;  1VL2 A;  2Y0E A;  3FWL A;  1NTZ K;  2P7J A;  3H1H D;  2CK3 H;  3RL0 B;  2YMK A;  4RJT A;  1N7S C;  3H1K J;  1VF5 B;  3AEF C;  3TGU J;  1BE3 G;  1YBK A;  2B87 A;  2ZVN B;  3P8M C;  4H44 C;  3G6E P;  3CCJ P;  3E7K A;  1GD2 E;  1JOC A;  3AEA C;  2KSE A;  4H44 B;  5CHX A;  5TIS H;  1H89 A;  1KD1 Q;  1JCD A;  2N1T B;  2OGU A;  1SS1 A;  3CWB G;  5KAF H;  3CXH H;  2NZ2 A;  2E42 A;  1Y9B A;  5APT A;  2HFE D;  4XFJ A;  3H1K D;  1RE4 A;  1AQ5 A;  3UIA A;  1KB9 E;  1VQ6 P;  3L75 D;  1BSN A;  1QVG O;  2P58 A;  5AVQ B;  1PP9 D;  2KUB A;  4KHX A;  4K3A A;  1PL5 A;  2YO3 A;  3L71 D;  1FZF A;  1J2J B;  2R5D A;  1U57 A;  1S2E A;  2ITA A;  3K5B A;  1KB9 I;  1KFN A;  3PTZ A;  3E1R A;  1OX3 A;  1G2C A;  2JKV A;  2OYI A;  5CBO A;  1M1J A;  3W67 A;  2XKM A;  3JC2 2;  3PH0 A;  1EZV I;  2KZI A;  2R5B A;  4C7N A;  2OAR A;  2QJY B;  1JMM A;  3A2A A;  2QA4 P;  1K9M Q;  3IN6 A;  1LTI C;  1KFM A;  2OYI C;  1RF1 A;  3VMY A;  5DJT B;  5AVZ B;  2Z5H A;  4PJ0 H;  2WWW A;  1H8A A;  1JY2 O;  2YXQ B;  1EDJ A;  4LC1 A;  3LID A;  3MTU E;  1FBM A;  1NU1 D;  1HH0 A;  1N8R Q;  4UB6 E;  1NAF A;  5APX A;  1URQ D;  1SQX D;  3M0A A;  1S9K D;  2I1K A;  2XU6 A;  3AED C;  1AJY A;  3KYQ A;  4AQR D;  1X8Y A;  1AA0 A;  2G3A A;  2PFX A;  2RKL A;  4K35 A;  1IO4 A;  1BE3 D;  2GA1 A;  2AEF A;  2KOG A;  1S5L E;  2IPP A;  2JDI H;  1S5L H;  2FXM A;  1JNM A;  3SWF A;  3GMA A;  4O9B A;  3WU2 H;  2OYH B;  1NH4 A;  3CC2 P;  4YPC A;  2W6A A;  1MFT A;  2M8R A;  2QG4 A;  5AVS B;  2D2C D;  1N2D C;  2DW3 A;  1KC8 Q;  3HRN A;  5KLV E;  3EFF K;  1PPJ E;  3CCQ P;  1KOR A;  3H1K G;  2B88 A;  3CPW O;  1CI6 A;  2Y9Y A;  1X79 B;  2W27 A;  5EFW B;  1SFC C;  2B9B A;  2KLU A;  2WMM A;  3SWY A;  4B86 A;  3MD0 A;  5B66 H;  3A0B E;  3BCC J;  3CWB D;  2WSF J;  3GF3 A;  1BCC J;  3V2N A;  4ZNC A;  2ZAE B;  1IZN B;  3H1I D;  4Y99 B;  3MUD C;  4JPZ B;  5AW7 B;  2YXR B;  3CX5 I;  4OGQ B;  4PV1 B;  3RK2 B;  3VMZ A;  2KLV A;  1L4A B;  1FOS E;  4KJM A;  2OYH A;  4XA4 A;  1RY3 A;  4W7Z A;  5E79 E;  4U3F G;  4QMA A;  2NPS A;  4WVZ A;  3HE4 A;  2WSE J;  2WT7 A;  1YJN P;  1FDI A;  1FZA A;  1L0L E;  1QGK B;  4U3F D;  2Q5U A;  1EZV D;  3A0H E;  1M7L A;  3VYI A;  3QWO C;  3H1H G;  3RBX A;  2NPS C;  2P2U A;  1T3J A;  4JYC A;  1NU1 G;  2K1A A;  4JF7 A;  2R32 A;  3MHV A;  1HWT C;  4WY4 B;  1URQ C;  5TIS E;  1PGP A;  1EDK A;  1NTK D;  2LR2 A;  2JEE A;  1KIL B;  1LP1 B;  2R3S A;  1S3J A;  2YKO A;  4I6M C;  1L0L K;  1Q7Y Q;  3CXH E;  1JB0 J;  1L0L J;  3CC7 P;  2UWJ E;  3L73 G;  3GHG B;  3RK3 E;  4WWI A;  1NO4 A;  4NPF X;  3TNU A;  5AVY B;  4ZKU A;  4M3L A;  3H1J D;  3I55 P;  1J1E B;  1OFC X;  2N1T A;  1BGY E;  4GOD A;  1SQQ J;  2V7Q H;  4R4M A;  2V4H A;  3H1K E;  1GDT A;  1ZW0 A;  1RHZ B;  2V7Q J;  3L71 G;  2P10 A;  4H0L B;  1BCC E;  3ITK A;  5KKZ B;  4D6T D;  1M1K Q;  3TF5 A;  2HYN A;  1Q81 Q;  1Y8A A;  5CJ4 A;  2KYV A;  3M9Q A;  1HTL C;  3PJS K;  3V5B A;  1RE4 C;  3CLQ A;  3L71 E;  2QSI A;  2QEX P;  3L70 E;  3Q1M A;  1SQV E;  1YIT P;  3CCS P;  2QJP B;  2QVA A;  1P84 E;  1A02 J;  3Q5S A;  4IFD K;  1JO5 A;  1MUU A;  1SQQ D;  3H32 A;  1P84 H;  1N7S D;  1FU1 A;  1QL1 A;  3NFQ A;  1OVV A;  2WZ7 A;  1BGY G;  1LGH B;  1DD3 A;  1PP9 G;  3VP9 A;  1VQP P;  2FYU K;  5AW3 B;  5AVW B;  2IZ0 A;  5KTB A;  4RO0 A;  4L75 A;  1GW4 A;  1L0L D;  3G3Z A;  2QRX A;  2HLO A;  1HGZ A;  1EZV E;  2M3E A;  2YKQ A;  1D7M A;  3KPE A;  3LW5 H;  4L76 A;  1H88 A;  1QX8 A;  2PAJ A;  2WQY C;  2IBZ G;  1NU1 E;  3EQ2 A;  3OW2 O;  1J1D B;  2FYZ A;  3L70 G;  1YHQ P;  1OMI A;  2FYU D;  2E5Y A;  2AXT E;  4IFF A;  3PLN A;  3VTP C; 
#chains in the Genus database with same CATH homology
 1NWQ A;  1T2K C;  3MGN A;  5AW9 B;  1IFM A;  4N78 E;  5AVV B;  2GUV A;  3RK3 D;  3IFM A;  1L4A D;  3VN0 A;  2WTY A;  2Q3I A;  1HUC A;  2QM8 A;  1Z56 A;  3I5C A;  3N7N A;  4XE5 B;  1E5W A;  2C0X A;  1FJK A;  3NMD A;  3VP8 A;  2A45 G;  5CCG A;  3C9I A;  1T3U A;  4LGD E;  2J58 A;  1SFC A;  2R3C A;  2WPR A;  1GW3 A;  1LTJ B;  3B5N A;  1FZB A;  3EFG A;  3B5N D;  1KIL C;  1M1J B;  2C9N Y;  1MZ9 A;  2FFD A;  1N73 C;  3O8Z A;  3B5N C;  1FZG A;  3B5N B;  2YO2 A;  4RES B;  1JCC A;  3HTK B;  2E43 A;  1N73 A;  1SQX K;  3TYY A;  2W6B A;  2Q9I A;  5APV A;  2NPS D;  1VPC A;  3CI9 A;  2P67 A;  1RF1 B;  2WIT A;  4AUW A;  1FOS F;  5CCH C;  5CJ0 A;  3A5T A;  5AVX B;  3V4Q A;  5BU8 B;  5AW8 B;  1HVV A;  1JY3 P;  2ZFC A;  1HJB A;  1LTJ A;  4JYB A;  2BAS A;  2XNX A;  3L4F A;  2GM4 A;  1N7L A;  1RE3 C;  1N7S B;  5BU5 A;  1IFD A;  1FAV A;  3M9B A;  3HD7 C;  4C46 A;  2LKM A;  1FZC A;  3V2P A;  3WMM 0;  1HGV A;  3RK3 B;  1JTH B;  5KLV K;  3TK1 A;  2OYI B;  1IFJ A;  3P8C D;  1URQ A;  1N7S A;  2P1J A;  3E1I A;  3V2Q A;  3BVH A;  3PP5 A;  3P32 A;  4N3Y B;  3U59 A;  1XTG B;  3M0D A;  1PFI A;  2NPS B;  3U1A A;  1MFZ A;  2Z5I A;  2POH A;  5KJ7 C;  4ZKP A;  3RK2 D;  3TSI A;  1LWU B;  1YYC A;  1GL2 C;  1NHL A;  1LWU C;  3HUS B;  3B8E B;  3TNU B;  1LTA C;  3M9H A;  3HE5 B;  4C7N B;  3II6 A;  1L0N K;  3H32 B;  1EQ7 A;  1LTG C;  1LWU A;  1NTK K;  2WSC H;  4W7Y A;  1GZL A;  3OJA B;  1DX7 A;  3KQG A;  1OXZ A;  4I1L A;  1LTS C;  1X9V A;  1CW5 A;  5APU A;  5CCG C;  1IFI A;  2XV5 A;  2O1J A;  2WT7 B;  1NU1 K;  4N6J A;  3L35 A;  5AVR B;  1NOH A;  1LTB C;  1SQP K;  3A3Y B;  3T97 A;  1JY2 N;  1N73 B;  3HD7 D;  1J1D C;  1LTT C;  2L5G B;  2Z4E A;  3BRV B;  1DH3 A;  1IFN A;  2N9B A;  1SQQ K;  2PP6 A;  2N1T D;  3HE4 B;  4Y99 C;  1JTH A;  2XZR A;  3L37 A;  5APQ A;  4WB4 A;  2HOD B;  3V2R A;  2H8P D;  1LTJ C;  4OH8 B;  4DZO A;  1SQB K;  2M3B A;  5APY A;  2HOD A;  1GL2 D;  1KIL A;  2JJL A;  3KDP B;  2YKP A;  1CSB A;  2FFD C;  3HD7 A;  5BVZ A;  2IX7 C;  1G1I A;  1WRG A;  1IK9 A;  2YNY A;  5AVU B;  1AFO A;  2OYH C;  1SP4 A;  2GUS A;  1ZR2 A;  1DEB A;  1YTZ T;  2A45 H;  5CCH A;  2IFN A;  1FDM A;  2WPS A;  1GK4 A;  1LT9 A;  3M0D C;  2N1T C;  3HTK A;  3LIE A;  2KSJ A;  4DOJ A;  3HE5 A;  1GL2 A;  1MV8 A;  1L4A C;  1YTZ I;  1G2C B;  1SVF A;  3NTN A;  4HYT B;  1SFC D;  3BAT A;  2HPC B;  5AW2 B;  3GHG C;  3L36 A;  1S9K E;  3RK2 C;  3RK3 C;  2IFM A;  1GTW A;  1ZLL A;  3GHG A;  1G1J A;  5CCH D;  1SFC B;  1M1J C;  4WY4 D;  5APS A;  5AW0 B;  1LT9 B;  1FJP A;  4WBA A;  3M91 A;  1FZC B;  2YMY A;  3IR9 A;  4IFM A;  3N4X A;  5CMZ A;  3VOP A;  4I2L C;  3BAS A;  1XTC C;  5KJ7 A;  1GK6 A;  3R2P A;  1WT6 A;  5AW4 B;  5CCG D;  2CPS A;  1KIL D;  4LLH A;  1RF0 A;  2FKW B;  3A7O A;  3BRT B;  4AYC A;  4EOT A;  1KZU B;  3NXS A;  4HH2 A;  2Q7C A;  1GL2 B;  1RF0 C;  1ZV8 A;  4WY4 C;  1JUN A;  2H43 A;  2WPQ A;  1JY3 N;  5AW6 B;  2ZXE B;  2QM7 A;  1CI6 B;  1NTM K;  1JY3 O;  2O1K A;  4WY4 A;  3U1C A;  1CZQ A;  2HPC A;  1IJD B;  1N86 A;  1ZR4 A;  3H6P A;  1SLQ A;  2VRS A;  2J59 M;  1T2K D;  2CPB A;  4W80 A;  1NKZ B;  1T8Z A;  1ZN5 A;  1RF1 C;  1HBW A;  4GIF A;  1QL2 A;  3HD7 B;  4GT1 A;  2A45 I;  2HG5 D;  2O01 H;  5AW1 B;  1IC2 A;  2KP8 A;  5AVT B;  4GKG A;  3RL0 C;  1URQ B;  2FFD B;  1GU4 A;  3P7K A;  2C0W A;  2MJZ A;  3OAK A;  1GU5 A;  1KQL A;  2C9L Y;  2WSE H;  4C7R A;  1L4A A;  3P8C E;  4EIJ A;  1W2E A;  1FZC C;  1A02 F;  3MUD A;  1JY2 P;  1NKN A;  5KJ7 D;  3OA7 A;  1H88 A;  2I1J A;  3VMX A;  4N78 D;  3M06 A;  3V4W A;  1RE3 A;  3MIW A;  1J1E C;  3HUS A;  1SQV K;  1VDF A;  2H7H A;  3RL0 D;  5AW5 B;  1FZE A;  5APW A;  3HUS C;  1LT9 C;  2KB7 P;  3CL3 D;  2XDJ A;  2WSF H;  1OWA A;  3RL0 B;  1NTZ K;  2P7J A;  1N7S C;  3P8M C;  1GD2 E;  1JOC A;  5CHX A;  1H89 A;  1JCD A;  2N1T B;  2E42 A;  5APT A;  2HFE D;  1RE4 A;  1AQ5 A;  3UIA A;  5AVQ B;  4KHX A;  2YO3 A;  1FZF A;  1J2J B;  2R5D A;  1KFN A;  1G2C A;  2OYI A;  1M1J A;  2XKM A;  2R5B A;  4C7N A;  2OAR A;  1JMM A;  3A2A A;  1LTI C;  1KFM A;  2OYI C;  1RF1 A;  3VMY A;  5AVZ B;  2Z5H A;  1H8A A;  2WWW A;  1JY2 O;  4LC1 A;  3LID A;  3MTU E;  1FBM A;  1HH0 A;  5APX A;  1NAF A;  1URQ D;  3M0A A;  1S9K D;  2I1K A;  2XU6 A;  3KYQ A;  4AQR D;  1X8Y A;  1IO4 A;  2KOG A;  2IPP A;  2FXM A;  1JNM A;  3SWF A;  2OYH B;  4O9B A;  1NH4 A;  2W6A A;  5AVS B;  2M8R A;  1N2D C;  3HRN A;  1CI6 A;  1X79 B;  2W27 A;  4B86 A;  1SFC C;  3SWY A;  3MD0 A;  3V2N A;  4Y99 B;  5AW7 B;  3VMZ A;  3RK2 B;  2KLV A;  1L4A B;  1FOS E;  2OYH A;  4XA4 A;  1RY3 A;  4W7Z A;  2NPS A;  2WT7 A;  3HE4 A;  1FZA A;  2Q5U A;  3VYI A;  1M7L A;  2NPS C;  2P2U A;  1T3J A;  4JYC A;  4JF7 A;  2R32 A;  1HWT C;  4WY4 B;  1URQ C;  2JEE A;  1KIL B;  2YKO A;  4I6M C;  1L0L K;  3GHG B;  4ZKU A;  1NO4 A;  3TNU A;  5AVY B;  4M3L A;  1J1E B;  2N1T A;  1GDT A;  2HYN A;  5CJ4 A;  2KYV A;  3M9Q A;  1HTL C;  3V5B A;  1RE4 C;  3CLQ A;  1A02 J;  1JO5 A;  4IFD K;  1MUU A;  3NFQ A;  3H32 A;  1QL1 A;  1N7S D;  1FU1 A;  2WZ7 A;  3VP9 A;  1LGH B;  2FYU K;  5AW3 B;  5AVW B;  5KTB A;  1GW4 A;  3G3Z A;  3LW5 H;  2HLO A;  1HGZ A;  2YKQ A;  3KPE A;  2PAJ A;  3EQ2 A;  1J1D B;  2FYZ A;  4IFF A;  3VTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...