1M56D

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
GHVAGSMDITQQEKTFAGFVRMVTWAAVVIVAALIFLALANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 15
structure length 42
sequence length 42
chains with identical sequence J
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07835 COX4_pro_2 Bacterial aa3 type cytochrome c oxidase subunit IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bacterial aa3 type cytochrome c oxidase subunit IV 1m56D00
1M57D 1M56D 1QLED
chains in the Genus database with same CATH superfamily
2C9LY 5CJ4A 2Q3IA 1HWTC 1W2EA 1ZR2A 4PV1C 2QG4A 1N7SD 2I1KA 1PPJD 1X0TA 3L72J 2HODA 3HUSB 3WUTA 3BCCD 3P8CE 4R4MA 1GL2D 1LWUC 1L0LG 2YKPA 2ZT9D 5AVRB 3RGUA 4ZMDA 3NTNA 3CWBE 4QMAA 1EXIA 1SQQE 1QL1A 2P10A 2FBWC 3JCUE 1FU1A 3PHLA 3KZIE 1VQOP 1URQB 5KTBA 1IC2A 1KN7A 4PD4D 1X9VA 2E74B 1NHLA 1URQA 2QJYC 2KS1A 1N2DC 2Z4EA 1AFOA 2E43A 1H8AA 3M0AA 1YI2P 1FBMA 1YJNP 1KFNA 1RQVA 4PJ0H 3U1AA 4XFJA 3M0DC 2VRSA 3M9HA 3AE5C 1M1JC 5APWA 3JSVC 3KHUA 2IDBA 1GW3A 2A06E 5CCHA 1J1EB 3CX5D 1L0LK 2A45H 2UWJE 3WUUA 1MFZA 3SWKA 2P7JA 2JR8A 3MD0A 2E74D 2KI7B 2W6BA 1KB9I 1FZCB 1KYOH 5KAIE 1JMBA 3AE1C 2W90A 1NU1G 2ZVNB 3M06A 3LIEA 3GF3A 2OYIB 1P84E 1S4XA 5AVZB 4OH8B 2J58A 3H1IG 2W27A 3RK3D 4Z1MH 3CMEP 3L74G 3CCSP 2R3CA 3D70A 1KORA 1L0LE 1SQXG 1EXJA 2WQYC 1H88A 3H25A 2R32A 1RY3A 2FYUG 4U3FG 1OW8A 2JO1A 1AVYA 3IAOA 3A5TA 4TT3H 1JMMA 4PV1B 3TGUD 3GW6A 1HBWA 2LR2A 3AE8C 2QEXP 1IJDB 2M8RA 1NU1K 3BCCJ 1L4AA 1CW5A 1PGOA 2E42A 2KZIA 2GUVA 1G1IA 2IBZD 2GA1A 1NTKG 4ZKPA 1KB9D 2OTJP 2XZRA 1LWUA 3I5CA 4ASVA 3OJAB 2OYHC 3PP5A 2QE7H 1NTMG 1IFMA 2QM7A 2ZYDA 2KK7A 2FFDC 4IFFA 2K1AA 4KT0J 5KLVK 1IK9A 3HD7A 3HRNA 2QJYB 3L73D 1A02F 2Q5UA 2FYUK 4BXLA 2PRRA 3CC2P 1NOHA 4H44D 1K73Q 3ITKA 1HUCA 1NU1E 3MZWB 1IFJA 4LGDE 5TJHA 1KMIZ 4YXDC 3H1IE 1M1JB 2Z5IA 2M0BA 1ZRTE 4KJMA 3L74E 1M1JA 3H1HE 1SLQA 3B4SA 3L36A 1NTKK 1VQ9P 3AE9C 1UIXA 1SQXE 1LTJC 2XV5A 2J5UA 1AQ5A 3CX5H 2K9JB 1KD1Q 2R5BA 2FYUE 4U3FE 1BE3E 3BVHA 4GIFA 1T3JA 2ZVOB 4YPCA 2K9JA 4XE5B 1Y9BA 1IFIA 2KZJA 5C39A 1QEXA 1R8EA 1JY2O 4K3AA 2B89A 1IZNB 3BRTB 1RE4C 1LT9C 4K35A 1SQVD 3AEAC 2RKLA 3T97B 4D6TD 3C9IA 2E75C 3E1IA 3CXHH 5KAIH 3VMZA 1T2KD 1USDA 1NTKE 1KQFB 1IFNA 3BASA 5AVXB 2O01H 1ZN5A 1T6AA 2H43A 1BDDA 2O3JA 2A45I 4IL6E 3TGUJ 3B5NB 2AXTH 4Y99C 5KLIC 4DOJA 1MUUA 5KJ7D 1YTZT 2PAJA 1J1DC 2H8PD 2B87A 3AEGC 4BRYA 2BCCG 2NPSC 1VQPP 3H1LG 3CCJP 3SWYA 3V2PA 1E5WA 2IZ1A 3U1CA 1ZLLA 1LT1A 3SFEC 3GHGC 5CJ0A 3S4RA 3KXDA 1MV8A 2OYHA 2H7HA 1Y47A 2N1TC 3HE4B 1VQMP 1S9KE 3L73J 2RMZA 1LJ2A 3B5ND 2P2UA 2FFDA 3V4QA 1GD2E 2E76C 4NPDA 3TF5A 1T3UA 1EDLA 5GTHH 1QGKB 1AA0A 2WPVB 1OX3A 1NTZG 1VF5B 3MUDC 4GDOA 3CWBG 2YKQA 1HGZA 1OZHA 3A2AA 1HGVA 2WZ7A 3LW5J 1KYOD 1SQPD 5AVYB 3M9QA 1EDIA 1M7LA 2HYNA 1YJWP 1LTJA 2YIUB 2RN0A 1YTZI 4W7ZA 2KSJA 1M90Q 1NAYA 4C46A 1SQBD 1CI6A 1GU5A 3K5BA 4OGQD 3FWNA 1OVRA 2IZ0A 5KKZC 1KFMA 4DJGA 4N6JA 3H1JD 5CHXA 1U7JA 2KUBA 3GMAA 2KSEA 1SQVJ 2YKOA 5APUA 4PD4I 4D6TJ 1EZVI 1SFCC 2BCCE 5H2FH 1RE4A 1LT9A 1VF5D 4WVZA 2V7QJ 3AE3C 2NRGA 2KNCB 3H1LE 4A7PA 3A3YB 1Q86Q 4I1LA 3IN6A 1G2CA 3V2NA 3NFQA 2YXQB 2NZ2A 2KP8A 3RK2D 1Y8AA 2JWAA 1YIJP 4CPGA 4Y99B 3S1KA 3CX5I 1J1DB 2HODB 1KQLA 3AEBC 1FJPA 3PJSK 1L4AC 5CCGD 3RL0C 4WB4A 3HTKA 2C0XA 3H1KD 2NPSB 1BCCG 2OGUA 1NVOA 2N9YB 2G3AA 2E5TA 1SP4A 3A7OA 4IL6H 2NPSA 1XTCC 4WWIA 4JQ0D 3P8CD 1YITP 1NTZE 2CPBA 1JY2N 3CXHI 3KPEA 2WSFH 3L75D 2WT7B 2D2CC 4O9BA 2B9BA 2FXMA 3VYIA 3HD7C 3GHGA 1JTHB 2KS1B 3CCMP 2N1TB 2WT7A 3UIAA 5E79H 2K3RA 1L0NG 1EZVD 1SQQD 1YYCA 2P1JA 1JTHA 2N1TA 2JWDA 3L35A 3CCEP 2BEQD 2E76B 1RQUA 3G71P 1QL2A 1YQ4C 1YJ9P 1TU3F 3I56P 1U7MA 5AVQB 1M8OB 1EQ7A 2AEMA 1BSHA 1JY2P 3GF7A 1N73C 4H13C 2WTYA 1JNMA 3MUDA 1SQPJ 3KQGA 3A0HE 3C1LA 1RF0C 1URQD 1Z56A 2W6AA 3L70G 2Q7CA 4DT0A 1K04A 1LTGC 2IBZI 2A06D 2QA4P 4KHXA 3JC22 4Y28J 4YXWH 3D71A 5KAFE 1SQBJ 4W7YA 1L0NK 3H1JJ 4RESB 3CD6P 1KV4A 1FC2C 3CXHD 1M57D 3KYQA 5CCHD 3OA7A 3RK3E 5APTA 1FE6A 1BCCE 2W83C 2K37A 3W67A 1RH5B 4EYYQ 1SFCA 3H1HG 3P32A 1WMKA 3II6A 4N3YB 2N9BA 5KLVG 3B8EB 1BE3G 1JCDA 1A02J 2HR3A 4OWFA 1IK7A 2WSCH 4L73A 1DX7A 1L0NE 1S72P 1L4AB 3TGUE 5TISE 2ITAA 3FXEA 3H1KJ 2W8ZA 1GK6A 1DD3A 5GTIE 3CI9A 3SSUA 1JB0J 2Y9YA 3KDPB 2AEFA 1LWUB 1RF1C 2IPPA 3H6PA 1KB9E 2OYOA 2WPRA 4UB8E 2Y0CA 3L75J 1ZV8A 3E1RA 5AW3B 2OTKE 2W6JH 1FZFA 4GOFA 3HD7B 3Q5RA 4EIJA 2WPQA 3NMDA 2AXCA 1KILC 1SQQJ 3L70E 1USEA 4ZKUA 1NAFA 2M5AA 1QVGO 4PV1D 3O6QB 1JOCA 1X8YA 1IO4A 3E7KA 5APYA 1Q2NA 3A0BE 1FZEA 1U57A 1ZR4A 3MHVA 3O6QA 2KB7P 1GTWA 3JCUH 1BGYD 3L72G 2GUSA 3KZIH 3MIWA 3TNUA 3RBZA 3VTPC 3TYYA 4GKGA 1NU1D 1ZMEC 3WU2E 2HLOA 3D6YA 1SQVK 4H13B 3AE7C 4L76A 3H1ID 1W2BO 2LXCB 1FZBA 1N73A 1N86A 1ZRTD 5KLVE 1RF0A 1OXZA 1NKZB 2FXOA 1N7LA 1SQXD 2Z5HA 2GM4A 1NWQA 1PGQA 2HPCB 2PP6A 5AW5B 1JUNA 3A0HH 2HPCA 4AYCA 3VMYA 2K9YA 1OFCX 3M91A 2RH0A 3P7KA 1FDOA 1E79H 1ZOYC 3R4YA 2O01J 4ASWA 2A45G 1S3JA 1SQVE 3CMAP 2YMYA 1XTGB 2ZJSE 4H13D 2O01N 2QRXA 4WY4A 1N7SC 1WT6A 1P84H 1QLED 3VMXA 1SS1A 1LTSC 1GL2C 3CL3D 1NTKD 3TDKA 2ZXXA 4HYTB 4I7ZC 1Q81Q 2H88C 3CCVP 2ZT9C 1KTMA 3F5HA 2B87B 4BRYB 1K8AQ 1KYOI 1NTMD 2XU6A 1DH3A 2IYPA 5BVZA 1JCCA 4U7JA 1S5LX 3L72E 1RF1B 4GODA 1DIPA 4H0LC 2FXPA 4GOEA 1RF1A 3L4FA 1FDMA 3CLQA 4BWNA 2OYHB 2XKMA 3ABVC 1HJBA 2KIKA 1OW6A 1H0TB 2QM8A 2L91A 2FFDB 2ZYGA 1AQTA 2QJKC 2QVAA 4GT1A 1H0TA 1K9MQ 3PLNA 3HE5B 1KILA 3VOPA 1PPJG 4I2LC 5B5EE 3HE5A 1S9KD 1Q7YQ 1BGYJ 4PJ0E 2JJLA 3H1KG 3RL0g 1SQBK 3BCCG 2E74C 1Q82Q 1NU1J 3IF4A 3Q3DA 1KILE 3MTUE 1UIIA 3H1IJ 1PGPA 3L75G 1LTJB 3RK3C 1FZGA 3R2PA 2YO3A 1EZVG 1CI6B 1SQXJ 3AEDC 2HFED 1JY3N 1OMIA 2XNDH 1J1EC 3L71D 4JF7A 1AJYA 2JDIH 2B88A 4C7RA 3WMM0 1SQBE 1GU4A 1N8RQ 4N78E 3AE6C 3VN0A 1LT9B 1AV1A 3H1JE 1NJIQ 2XDJA 1FZCC 1LNQA 2E75B 3M9BA 3CPWO 4JYCA 1H89A 1G2CB 3CC4P 1LGHB 5K5GB 2BCCD 1N7SA 3BRVB 1S2EA 3CCRP 1HJ0A 1PGJA 5BU5A 1NTKJ 5B66E 2Q6QA 3H1LD 4R4LA 3CCUP 1JY3P 1Q90D 2JKVA 1GL2A 1PV3A 4OVNF 3V2RA 5KLIB 2WSEH 3IFMA 3HTKB 1PP9D 1NTMJ 1EDJA 1FS0E 1OVUA 1QX8A 5APVA 1PPJE 1J2JB 3P8MC 3FGAD 2HG5D 3H1KE 2E75D 3BCCE 2WSFJ 1GDTA 4H0LB 2IYOA 1MKMA 4H44C 3Q1MA 2ZYAA 1YQ3C 3GHGB 2G8YA 1X22A 3L75E 3HUSA 1P84I 2QJKB 1NTZD 3NXSA 1GZLA 3CWBD 5CBNA 2I8DA 4PD4E 4IFMA 3TGUG 1EZVE 2FYNC 3EFGA 3G3ZA 5L8RJ 5AW7B 1KQSO 1BDCA 5M1BA 2H89C 2YNYA 2NPSD 1R5SA 2POHA 2K88A 2IBZG 3H32B 5APXA 4DCKA 1WRGA 4H0LD 5AVVB 3PTZA 2QIWA 4ZNCA 1PIXA 3H32A 2Q9IA 1NKNA 5B5EH 3V2QA 4I6MC 2AEJA 3RK3B 4TLFA 3CX5E 3RBXA 1VQLP 3G9RA 2N1TD 1NH4A 2P58A 3CCQP 1DEBA 2R3SA 3EFFK 3N4XA 3L73G 5AW4B 1T2KC 3L71J 1L2PA 2C9NY 3OAKA 2P67A 5AW0B 5KKZB 5AW6B 2E76D 1AVOA 1BGYG 1EC5A 2M3BA 2FYZA 3D6ZA 1YBKA 1G1JA 1GMJA 1FAVA 3CXHE 1SFCB 3V5BA 2PGDA 4WY4C 1VQ8P 1P84D 5APQA 1FZCA 4B86A 1M1KQ 1LTIC 5KJ7C 3S9OA 1ZP0C 3CC7P 1VQ6P 1GW4A 5DJUB 2QSIA 2BCCJ 1LTBC 2OYIA 1PZQA 2IFNA 1BCCD 4NPEA 2WSCJ 3SFDC 3H1LJ 3W68A 4YTPC 4AQRD 1L0LD 2AXTE 1RE3A 1FOSF 1PFIA 1PP9J 4JPZB 1NGMB 1VQ5P 2YXRB 1X79B 3RL0B 2LXBA 3IR9A 4UB6E 2IX7C 1SFCD 5B66H 1L0ND 2QJPC 3EWKA 1SQVG 3B5NC 4D6TG 3QH9A 1VL2A 1S1CX 2IBZE 2KYVA 5AW8B 2WWWA 3AEEC 4H44B 1JEKA 2OTLP 3N7NA 2KLVA 1JY3O 3OW2O 2R5DA 3V6IA 2MJZA 3GG2A 4LC1A 2D2CB 1JO5A 3AE2C 2M5AB 1NTZJ 4HJGH 3CWBJ 3MGNA 3ZDMA 2C0WA 1EDKA 2Y0EA 2YO2A 2FYNB 2R44A 1NO4A 2WSSH 1GK4A 3V4WA 1MFTA 3L73E 1L4AD 4JYBA 3RL0D 3L70D 1SQXK 3TNUB 2FY8A 5GTHE 3G6EP 1YHQP 1BGYE 3FXDA 1LTTC 4IOIH 4PD4H 4OGQC 1N73B 3L37A 2LKMA 1LTAC 2KLUA 2O1JA 4JBZA 2D2CD 3VMAA 4RJTA 3Q5PA 3HD7D 3AECC 3L74D 2ZAEB 3M0DA 1VF5C 4LLHA 1S5LE 3H1HD 3BATA 1OWAA 2BASA 2J59M 5AVUB 5KLVD 2Y9ZA 2OARA 2FYUD 4U3FD 3FWLA 1VQKP 1BE3D 2CPSA 3PH0A 2YIUC 1M56D 5H2FE 1NTMK 3RK2C 4M3LA 2ZFCA 4WY4B 1VDFA 5KAFH 2FKWB 2KOGA 5AW9B 4D6TE 2MKVA 2WPSA 2WVRA 3Q5SA 3SWFA 4EDFA 5CCGC 1BCCJ 5KJ7A 5BU8B 3EQ2A 3O8ZA 1SQPG 2SPZA 4WBAA 1JM0A 2DW3A 1L0LJ 4IFDK 2E5YA 3FX0A 3AEFC 4HKZH 3T97A 4RKUJ 1IFPA 3L71G 3G4SP 3Q2YA 1HTLC 1SQBG 3U59A 1DEEG 3H1JG 2JEEA 4MN4C 1NTME 1L0NJ 4NPFX 2PFXA 2QJPB 4WY4D 1SVFA 4L75A 5AVTB 1R5LA 1VQNP 1KZUB 1NYHA 1OVVA 2ZXEB 3B5NA 1FDIA 5TISH 1IFDA 3HUSC 3L72D 1HF9A 5CBOA 1OW7A 5E79E 1PL5A 4DZOA 4UB6H 5GTIH 1KQGB 2CK3H 1KILB 3AE4C 2M3EA 1SQPK 3CCLP 1FJKA 2Q3EA 5EFWB 1LP1B 4HH2A 3VP9A 1PP9G 1KB9H 1RHZB 2BEZF 1KC8Q 3L70J 4UB8H 3LIDA 1LP1A 1URQC 1VQ4P 3WUVA 1QVFO 2Y0DA 5AW1B 4W80A 2Q1KA 2WMMA 3HE4A 1CZQA 1ZXGA 1W5CE 1DD4A 1HH0A 4OGQB 2O1KA 3F89A 3B71A 3A0BH 3QWOC 1VPCA 1CSBA 2JP3A 4EI2A 3L74J 1MZ9A 5AVSB 4IL6X 5CCHC 1SQPE 1KYOE 1KILD 1FZAA 3H1HJ 3MP7B 1SQQG 1FOSE 2V4HA 2YMKA 3WU2H 3PRJA 1VQ7P 5KLVJ 4RO0A 1OIPA 5CMZA 3L71E 4HB1A 2KXPB 2FYUJ 4U3FJ 1BSNA 1BE3J 4L74A 3I55P 3LW5H 3RK2B 4EOTA 1K05A 3VP8A 1S5LH 5DJTB 4N78D 2OYIC 1N7SB 2IFMA 3GLMA 1T8ZA 4C7NB 4XA4A 5AW2B 1HVVA 2L5GB 1D7MA 5CCGA 2WSEJ 4AUWA 1GL2B 1RE3C 4C7NA 3USSA 2A06G 2I1JA 4I7ZB 3TK1A 2WITA 2ZT9B 2XNXA 3C8VA 1NTZK 2KNCA 1ZW0A 1SQQK 5APSA 1PP9E 2OQQA 2V7QH 5AVWB 3TSIA
chains in the Genus database with same CATH topology
1M57D 1M56D 1QLED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M57 D;  1M56 D;  1QLE D; 
#chains in the Genus database with same CATH topology
 2C9L Y;  5CJ4 A;  2Q3I A;  1HWT C;  1W2E A;  1ZR2 A;  4PV1 C;  2QG4 A;  1N7S D;  2I1K A;  1PPJ D;  1X0T A;  3L72 J;  2HOD A;  3HUS B;  3WUT A;  3BCC D;  3P8C E;  4R4M A;  1GL2 D;  1LWU C;  1L0L G;  2YKP A;  2ZT9 D;  5AVR B;  3RGU A;  4ZMD A;  3NTN A;  3CWB E;  4QMA A;  1EXI A;  1SQQ E;  1QL1 A;  2P10 A;  2FBW C;  3JCU E;  1FU1 A;  3PHL A;  3KZI E;  1VQO P;  1URQ B;  5KTB A;  1IC2 A;  1KN7 A;  4PD4 D;  1X9V A;  2E74 B;  1NHL A;  1URQ A;  2QJY C;  2KS1 A;  1N2D C;  2Z4E A;  1AFO A;  2E43 A;  1H8A A;  3M0A A;  1YI2 P;  1FBM A;  1YJN P;  1KFN A;  1RQV A;  4PJ0 H;  3U1A A;  4XFJ A;  3M0D C;  2VRS A;  3M9H A;  3AE5 C;  1M1J C;  5APW A;  3JSV C;  3KHU A;  2IDB A;  1GW3 A;  2A06 E;  5CCH A;  1J1E B;  3CX5 D;  1L0L K;  2A45 H;  2UWJ E;  3WUU A;  1MFZ A;  3SWK A;  2P7J A;  2JR8 A;  3MD0 A;  2E74 D;  2KI7 B;  2W6B A;  1KB9 I;  1FZC B;  1KYO H;  5KAI E;  1JMB A;  3AE1 C;  2W90 A;  1NU1 G;  2ZVN B;  3M06 A;  3LIE A;  3GF3 A;  2OYI B;  1P84 E;  1S4X A;  5AVZ B;  4OH8 B;  2J58 A;  3H1I G;  2W27 A;  3RK3 D;  4Z1M H;  3CME P;  3L74 G;  3CCS P;  2R3C A;  3D70 A;  1KOR A;  1L0L E;  1SQX G;  1EXJ A;  2WQY C;  1H88 A;  3H25 A;  2R32 A;  1RY3 A;  2FYU G;  4U3F G;  1OW8 A;  2JO1 A;  1AVY A;  3IAO A;  3A5T A;  4TT3 H;  1JMM A;  4PV1 B;  3TGU D;  3GW6 A;  1HBW A;  2LR2 A;  3AE8 C;  2QEX P;  1IJD B;  2M8R A;  1NU1 K;  3BCC J;  1L4A A;  1CW5 A;  1PGO A;  2E42 A;  2KZI A;  2GUV A;  1G1I A;  2IBZ D;  2GA1 A;  1NTK G;  4ZKP A;  1KB9 D;  2OTJ P;  2XZR A;  1LWU A;  3I5C A;  4ASV A;  3OJA B;  2OYH C;  3PP5 A;  2QE7 H;  1NTM G;  1IFM A;  2QM7 A;  2ZYD A;  2KK7 A;  2FFD C;  4IFF A;  2K1A A;  4KT0 J;  5KLV K;  1IK9 A;  3HD7 A;  3HRN A;  2QJY B;  3L73 D;  1A02 F;  2Q5U A;  2FYU K;  4BXL A;  2PRR A;  3CC2 P;  1NOH A;  4H44 D;  1K73 Q;  3ITK A;  1HUC A;  1NU1 E;  3MZW B;  1IFJ A;  4LGD E;  5TJH A;  1KMI Z;  4YXD C;  3H1I E;  1M1J B;  2Z5I A;  2M0B A;  1ZRT E;  4KJM A;  3L74 E;  1M1J A;  3H1H E;  1SLQ A;  3B4S A;  3L36 A;  1NTK K;  1VQ9 P;  3AE9 C;  1UIX A;  1SQX E;  1LTJ C;  2XV5 A;  2J5U A;  1AQ5 A;  3CX5 H;  2K9J B;  1KD1 Q;  2R5B A;  2FYU E;  4U3F E;  1BE3 E;  3BVH A;  4GIF A;  1T3J A;  2ZVO B;  4YPC A;  2K9J A;  4XE5 B;  1Y9B A;  1IFI A;  2KZJ A;  5C39 A;  1QEX A;  1R8E A;  1JY2 O;  4K3A A;  2B89 A;  1IZN B;  3BRT B;  1RE4 C;  1LT9 C;  4K35 A;  1SQV D;  3AEA C;  2RKL A;  3T97 B;  4D6T D;  3C9I A;  2E75 C;  3E1I A;  3CXH H;  5KAI H;  3VMZ A;  1T2K D;  1USD A;  1NTK E;  1KQF B;  1IFN A;  3BAS A;  5AVX B;  2O01 H;  1ZN5 A;  1T6A A;  2H43 A;  1BDD A;  2O3J A;  2A45 I;  4IL6 E;  3TGU J;  3B5N B;  2AXT H;  4Y99 C;  5KLI C;  4DOJ A;  1MUU A;  5KJ7 D;  1YTZ T;  2PAJ A;  1J1D C;  2H8P D;  2B87 A;  3AEG C;  4BRY A;  2BCC G;  2NPS C;  1VQP P;  3H1L G;  3CCJ P;  3SWY A;  3V2P A;  1E5W A;  2IZ1 A;  3U1C A;  1ZLL A;  1LT1 A;  3SFE C;  3GHG C;  5CJ0 A;  3S4R A;  3KXD A;  1MV8 A;  2OYH A;  2H7H A;  1Y47 A;  2N1T C;  3HE4 B;  1VQM P;  1S9K E;  3L73 J;  2RMZ A;  1LJ2 A;  3B5N D;  2P2U A;  2FFD A;  3V4Q A;  1GD2 E;  2E76 C;  4NPD A;  3TF5 A;  1T3U A;  1EDL A;  5GTH H;  1QGK B;  1AA0 A;  2WPV B;  1OX3 A;  1NTZ G;  1VF5 B;  3MUD C;  4GDO A;  3CWB G;  2YKQ A;  1HGZ A;  1OZH A;  3A2A A;  1HGV A;  2WZ7 A;  3LW5 J;  1KYO D;  1SQP D;  5AVY B;  3M9Q A;  1EDI A;  1M7L A;  2HYN A;  1YJW P;  1LTJ A;  2YIU B;  2RN0 A;  1YTZ I;  4W7Z A;  2KSJ A;  1M90 Q;  1NAY A;  4C46 A;  1SQB D;  1CI6 A;  1GU5 A;  3K5B A;  4OGQ D;  3FWN A;  1OVR A;  2IZ0 A;  5KKZ C;  1KFM A;  4DJG A;  4N6J A;  3H1J D;  5CHX A;  1U7J A;  2KUB A;  3GMA A;  2KSE A;  1SQV J;  2YKO A;  5APU A;  4PD4 I;  4D6T J;  1EZV I;  1SFC C;  2BCC E;  5H2F H;  1RE4 A;  1LT9 A;  1VF5 D;  4WVZ A;  2V7Q J;  3AE3 C;  2NRG A;  2KNC B;  3H1L E;  4A7P A;  3A3Y B;  1Q86 Q;  4I1L A;  3IN6 A;  1G2C A;  3V2N A;  3NFQ A;  2YXQ B;  2NZ2 A;  2KP8 A;  3RK2 D;  1Y8A A;  2JWA A;  1YIJ P;  4CPG A;  4Y99 B;  3S1K A;  3CX5 I;  1J1D B;  2HOD B;  1KQL A;  3AEB C;  1FJP A;  3PJS K;  1L4A C;  5CCG D;  3RL0 C;  4WB4 A;  3HTK A;  2C0X A;  3H1K D;  2NPS B;  1BCC G;  2OGU A;  1NVO A;  2N9Y B;  2G3A A;  2E5T A;  1SP4 A;  3A7O A;  4IL6 H;  2NPS A;  1XTC C;  4WWI A;  4JQ0 D;  3P8C D;  1YIT P;  1NTZ E;  2CPB A;  1JY2 N;  3CXH I;  3KPE A;  2WSF H;  3L75 D;  2WT7 B;  2D2C C;  4O9B A;  2B9B A;  2FXM A;  3VYI A;  3HD7 C;  3GHG A;  1JTH B;  2KS1 B;  3CCM P;  2N1T B;  2WT7 A;  3UIA A;  5E79 H;  2K3R A;  1L0N G;  1EZV D;  1SQQ D;  1YYC A;  2P1J A;  1JTH A;  2N1T A;  2JWD A;  3L35 A;  3CCE P;  2BEQ D;  2E76 B;  1RQU A;  3G71 P;  1QL2 A;  1YQ4 C;  1YJ9 P;  1TU3 F;  3I56 P;  1U7M A;  5AVQ B;  1M8O B;  1EQ7 A;  2AEM A;  1BSH A;  1JY2 P;  3GF7 A;  1N73 C;  4H13 C;  2WTY A;  1JNM A;  3MUD A;  1SQP J;  3KQG A;  3A0H E;  3C1L A;  1RF0 C;  1URQ D;  1Z56 A;  2W6A A;  3L70 G;  2Q7C A;  4DT0 A;  1K04 A;  1LTG C;  2IBZ I;  2A06 D;  2QA4 P;  4KHX A;  3JC2 2;  4Y28 J;  4YXW H;  3D71 A;  5KAF E;  1SQB J;  4W7Y A;  1L0N K;  3H1J J;  4RES B;  3CD6 P;  1KV4 A;  1FC2 C;  3CXH D;  1M57 D;  3KYQ A;  5CCH D;  3OA7 A;  3RK3 E;  5APT A;  1FE6 A;  1BCC E;  2W83 C;  2K37 A;  3W67 A;  1RH5 B;  4EYY Q;  1SFC A;  3H1H G;  3P32 A;  1WMK A;  3II6 A;  4N3Y B;  2N9B A;  5KLV G;  3B8E B;  1BE3 G;  1JCD A;  1A02 J;  2HR3 A;  4OWF A;  1IK7 A;  2WSC H;  4L73 A;  1DX7 A;  1L0N E;  1S72 P;  1L4A B;  3TGU E;  5TIS E;  2ITA A;  3FXE A;  3H1K J;  2W8Z A;  1GK6 A;  1DD3 A;  5GTI E;  3CI9 A;  3SSU A;  1JB0 J;  2Y9Y A;  3KDP B;  2AEF A;  1LWU B;  1RF1 C;  2IPP A;  3H6P A;  1KB9 E;  2OYO A;  2WPR A;  4UB8 E;  2Y0C A;  3L75 J;  1ZV8 A;  3E1R A;  5AW3 B;  2OTK E;  2W6J H;  1FZF A;  4GOF A;  3HD7 B;  3Q5R A;  4EIJ A;  2WPQ A;  3NMD A;  2AXC A;  1KIL C;  1SQQ J;  3L70 E;  1USE A;  4ZKU A;  1NAF A;  2M5A A;  1QVG O;  4PV1 D;  3O6Q B;  1JOC A;  1X8Y A;  1IO4 A;  3E7K A;  5APY A;  1Q2N A;  3A0B E;  1FZE A;  1U57 A;  1ZR4 A;  3MHV A;  3O6Q A;  2KB7 P;  1GTW A;  3JCU H;  1BGY D;  3L72 G;  2GUS A;  3KZI H;  3MIW A;  3TNU A;  3RBZ A;  3VTP C;  3TYY A;  4GKG A;  1NU1 D;  1ZME C;  3WU2 E;  2HLO A;  3D6Y A;  1SQV K;  4H13 B;  3AE7 C;  4L76 A;  3H1I D;  1W2B O;  2LXC B;  1FZB A;  1N73 A;  1N86 A;  1ZRT D;  5KLV E;  1RF0 A;  1OXZ A;  1NKZ B;  2FXO A;  1N7L A;  1SQX D;  2Z5H A;  2GM4 A;  1NWQ A;  1PGQ A;  2HPC B;  2PP6 A;  5AW5 B;  1JUN A;  3A0H H;  2HPC A;  4AYC A;  3VMY A;  2K9Y A;  1OFC X;  3M91 A;  2RH0 A;  3P7K A;  1FDO A;  1E79 H;  1ZOY C;  3R4Y A;  2O01 J;  4ASW A;  2A45 G;  1S3J A;  1SQV E;  3CMA P;  2YMY A;  1XTG B;  2ZJS E;  4H13 D;  2O01 N;  2QRX A;  4WY4 A;  1N7S C;  1WT6 A;  1P84 H;  1QLE D;  3VMX A;  1SS1 A;  1LTS C;  1GL2 C;  3CL3 D;  1NTK D;  3TDK A;  2ZXX A;  4HYT B;  4I7Z C;  1Q81 Q;  2H88 C;  3CCV P;  2ZT9 C;  1KTM A;  3F5H A;  2B87 B;  4BRY B;  1K8A Q;  1KYO I;  1NTM D;  2XU6 A;  1DH3 A;  2IYP A;  5BVZ A;  1JCC A;  4U7J A;  1S5L X;  3L72 E;  1RF1 B;  4GOD A;  1DIP A;  4H0L C;  2FXP A;  4GOE A;  1RF1 A;  3L4F A;  1FDM A;  3CLQ A;  4BWN A;  2OYH B;  2XKM A;  3ABV C;  1HJB A;  2KIK A;  1OW6 A;  1H0T B;  2QM8 A;  2L91 A;  2FFD B;  2ZYG A;  1AQT A;  2QJK C;  2QVA A;  4GT1 A;  1H0T A;  1K9M Q;  3PLN A;  3HE5 B;  1KIL A;  3VOP A;  1PPJ G;  4I2L C;  5B5E E;  3HE5 A;  1S9K D;  1Q7Y Q;  1BGY J;  4PJ0 E;  2JJL A;  3H1K G;  3RL0 g;  1SQB K;  3BCC G;  2E74 C;  1Q82 Q;  1NU1 J;  3IF4 A;  3Q3D A;  1KIL E;  3MTU E;  1UII A;  3H1I J;  1PGP A;  3L75 G;  1LTJ B;  3RK3 C;  1FZG A;  3R2P A;  2YO3 A;  1EZV G;  1CI6 B;  1SQX J;  3AED C;  2HFE D;  1JY3 N;  1OMI A;  2XND H;  1J1E C;  3L71 D;  4JF7 A;  1AJY A;  2JDI H;  2B88 A;  4C7R A;  3WMM 0;  1SQB E;  1GU4 A;  1N8R Q;  4N78 E;  3AE6 C;  3VN0 A;  1LT9 B;  1AV1 A;  3H1J E;  1NJI Q;  2XDJ A;  1FZC C;  1LNQ A;  2E75 B;  3M9B A;  3CPW O;  4JYC A;  1H89 A;  1G2C B;  3CC4 P;  1LGH B;  5K5G B;  2BCC D;  1N7S A;  3BRV B;  1S2E A;  3CCR P;  1HJ0 A;  1PGJ A;  5BU5 A;  1NTK J;  5B66 E;  2Q6Q A;  3H1L D;  4R4L A;  3CCU P;  1JY3 P;  1Q90 D;  2JKV A;  1GL2 A;  1PV3 A;  4OVN F;  3V2R A;  5KLI B;  2WSE H;  3IFM A;  3HTK B;  1PP9 D;  1NTM J;  1EDJ A;  1FS0 E;  1OVU A;  1QX8 A;  5APV A;  1PPJ E;  1J2J B;  3P8M C;  3FGA D;  2HG5 D;  3H1K E;  2E75 D;  3BCC E;  2WSF J;  1GDT A;  4H0L B;  2IYO A;  1MKM A;  4H44 C;  3Q1M A;  2ZYA A;  1YQ3 C;  3GHG B;  2G8Y A;  1X22 A;  3L75 E;  3HUS A;  1P84 I;  2QJK B;  1NTZ D;  3NXS A;  1GZL A;  3CWB D;  5CBN A;  2I8D A;  4PD4 E;  4IFM A;  3TGU G;  1EZV E;  2FYN C;  3EFG A;  3G3Z A;  5L8R J;  5AW7 B;  1KQS O;  1BDC A;  5M1B A;  2H89 C;  2YNY A;  2NPS D;  1R5S A;  2POH A;  2K88 A;  2IBZ G;  3H32 B;  5APX A;  4DCK A;  1WRG A;  4H0L D;  5AVV B;  3PTZ A;  2QIW A;  4ZNC A;  1PIX A;  3H32 A;  2Q9I A;  1NKN A;  5B5E H;  3V2Q A;  4I6M C;  2AEJ A;  3RK3 B;  4TLF A;  3CX5 E;  3RBX A;  1VQL P;  3G9R A;  2N1T D;  1NH4 A;  2P58 A;  3CCQ P;  1DEB A;  2R3S A;  3EFF K;  3N4X A;  3L73 G;  5AW4 B;  1T2K C;  3L71 J;  1L2P A;  2C9N Y;  3OAK A;  2P67 A;  5AW0 B;  5KKZ B;  5AW6 B;  2E76 D;  1AVO A;  1BGY G;  1EC5 A;  2M3B A;  2FYZ A;  3D6Z A;  1YBK A;  1G1J A;  1GMJ A;  1FAV A;  3CXH E;  1SFC B;  3V5B A;  2PGD A;  4WY4 C;  1VQ8 P;  1P84 D;  5APQ A;  1FZC A;  4B86 A;  1M1K Q;  1LTI C;  5KJ7 C;  3S9O A;  1ZP0 C;  3CC7 P;  1VQ6 P;  1GW4 A;  5DJU B;  2QSI A;  2BCC J;  1LTB C;  2OYI A;  1PZQ A;  2IFN A;  1BCC D;  4NPE A;  2WSC J;  3SFD C;  3H1L J;  3W68 A;  4YTP C;  4AQR D;  1L0L D;  2AXT E;  1RE3 A;  1FOS F;  1PFI A;  1PP9 J;  4JPZ B;  1NGM B;  1VQ5 P;  2YXR B;  1X79 B;  3RL0 B;  2LXB A;  3IR9 A;  4UB6 E;  2IX7 C;  1SFC D;  5B66 H;  1L0N D;  2QJP C;  3EWK A;  1SQV G;  3B5N C;  4D6T G;  3QH9 A;  1VL2 A;  1S1C X;  2IBZ E;  2KYV A;  5AW8 B;  2WWW A;  3AEE C;  4H44 B;  1JEK A;  2OTL P;  3N7N A;  2KLV A;  1JY3 O;  3OW2 O;  2R5D A;  3V6I A;  2MJZ A;  3GG2 A;  4LC1 A;  2D2C B;  1JO5 A;  3AE2 C;  2M5A B;  1NTZ J;  4HJG H;  3CWB J;  3MGN A;  3ZDM A;  2C0W A;  1EDK A;  2Y0E A;  2YO2 A;  2FYN B;  2R44 A;  1NO4 A;  2WSS H;  1GK4 A;  3V4W A;  1MFT A;  3L73 E;  1L4A D;  4JYB A;  3RL0 D;  3L70 D;  1SQX K;  3TNU B;  2FY8 A;  5GTH E;  3G6E P;  1YHQ P;  1BGY E;  3FXD A;  1LTT C;  4IOI H;  4PD4 H;  4OGQ C;  1N73 B;  3L37 A;  2LKM A;  1LTA C;  2KLU A;  2O1J A;  4JBZ A;  2D2C D;  3VMA A;  4RJT A;  3Q5P A;  3HD7 D;  3AEC C;  3L74 D;  2ZAE B;  3M0D A;  1VF5 C;  4LLH A;  1S5L E;  3H1H D;  3BAT A;  1OWA A;  2BAS A;  2J59 M;  5AVU B;  5KLV D;  2Y9Z A;  2OAR A;  2FYU D;  4U3F D;  3FWL A;  1VQK P;  1BE3 D;  2CPS A;  3PH0 A;  2YIU C;  1M56 D;  5H2F E;  1NTM K;  3RK2 C;  4M3L A;  2ZFC A;  4WY4 B;  1VDF A;  5KAF H;  2FKW B;  2KOG A;  5AW9 B;  4D6T E;  2MKV A;  2WPS A;  2WVR A;  3Q5S A;  3SWF A;  4EDF A;  5CCG C;  1BCC J;  5KJ7 A;  5BU8 B;  3EQ2 A;  3O8Z A;  1SQP G;  2SPZ A;  4WBA A;  1JM0 A;  2DW3 A;  1L0L J;  4IFD K;  2E5Y A;  3FX0 A;  3AEF C;  4HKZ H;  3T97 A;  4RKU J;  1IFP A;  3L71 G;  3G4S P;  3Q2Y A;  1HTL C;  1SQB G;  3U59 A;  1DEE G;  3H1J G;  2JEE A;  4MN4 C;  1NTM E;  1L0N J;  4NPF X;  2PFX A;  2QJP B;  4WY4 D;  1SVF A;  4L75 A;  5AVT B;  1R5L A;  1VQN P;  1KZU B;  1NYH A;  1OVV A;  2ZXE B;  3B5N A;  1FDI A;  5TIS H;  1IFD A;  3HUS C;  3L72 D;  1HF9 A;  5CBO A;  1OW7 A;  5E79 E;  1PL5 A;  4DZO A;  4UB6 H;  5GTI H;  1KQG B;  2CK3 H;  1KIL B;  3AE4 C;  2M3E A;  1SQP K;  3CCL P;  1FJK A;  2Q3E A;  5EFW B;  1LP1 B;  4HH2 A;  3VP9 A;  1PP9 G;  1KB9 H;  1RHZ B;  2BEZ F;  1KC8 Q;  3L70 J;  4UB8 H;  3LID A;  1LP1 A;  1URQ C;  1VQ4 P;  3WUV A;  1QVF O;  2Y0D A;  5AW1 B;  4W80 A;  2Q1K A;  2WMM A;  3HE4 A;  1CZQ A;  1ZXG A;  1W5C E;  1DD4 A;  1HH0 A;  4OGQ B;  2O1K A;  3F89 A;  3B71 A;  3A0B H;  3QWO C;  1VPC A;  1CSB A;  2JP3 A;  4EI2 A;  3L74 J;  1MZ9 A;  5AVS B;  4IL6 X;  5CCH C;  1SQP E;  1KYO E;  1KIL D;  1FZA A;  3H1H J;  3MP7 B;  1SQQ G;  1FOS E;  2V4H A;  2YMK A;  3WU2 H;  3PRJ A;  1VQ7 P;  5KLV J;  4RO0 A;  1OIP A;  5CMZ A;  3L71 E;  4HB1 A;  2KXP B;  2FYU J;  4U3F J;  1BSN A;  1BE3 J;  4L74 A;  3I55 P;  3LW5 H;  3RK2 B;  4EOT A;  1K05 A;  3VP8 A;  1S5L H;  5DJT B;  4N78 D;  2OYI C;  1N7S B;  2IFM A;  3GLM A;  1T8Z A;  4C7N B;  4XA4 A;  5AW2 B;  1HVV A;  2L5G B;  1D7M A;  5CCG A;  2WSE J;  4AUW A;  1GL2 B;  1RE3 C;  4C7N A;  3USS A;  2A06 G;  2I1J A;  4I7Z B;  3TK1 A;  2WIT A;  2ZT9 B;  2XNX A;  3C8V A;  1NTZ K;  2KNC A;  1ZW0 A;  1SQQ K;  5APS A;  1PP9 E;  2OQQ A;  2V7Q H;  5AVW B;  3TSI A; 
#chains in the Genus database with same CATH homology
 1M57 D;  1M56 D;  1QLE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...