1OVRA

Crystal structure of four-helix bundle model di-mn(ii)-df1-l13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords four-helix bundle model di-Mn(II)-DF1-L13
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
total genus 19
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovrA00
1U7MA 5C39A 3FXDA 2KIKA 2QRXA 4JBZA 1Q2NA 4ZNCA 4GODA 1DEEG 3MHVA 5DJUB 2JWDA 4NPDA 2B89A 4K35A 2ZAEB 4EYYQ 4HKZH 1EDLA 2LR2A 1ZW0A 3PH0A 4GOEA 4NPFX 1H0TB 2HR3A 2KS1B 1MFTA 2R44A 4K3AA 4GOFA 1BDDA 3RGUA 2QVAA 1EDIA 1EC5A 1LP1A 1EDJA 1ZXGA 2I8DA 5EFWB 4MN4C 3MZWB 4HB1A 2UWJE 3S1KA 1X0TA 2KI7B 2KZIA 3QWOC 2B88A 3FXEA 2P58A 1EDKA 1JM0A 1LP1B 5K5GB 2Q1KA 1OVRA 1JMBA 5DJTB 2M5AA 1U7JA 2KUBA 4ASWA 2B87A 4ASVA 4NPEA 2RKLA 2M0BA 4WWIA 5CBNA 4CPGA 4IOIH 1Y47A 2LXBA 4HJGH 4ZMDA 1NVOA 2WMMA 4KJMA 3ZDMA 1OVVA 2M5AB 1BDCA 2SPZA 1OVUA 1LT1A 2B87B 2K3RA 4BXLA 5CBOA 2KZJA 1S3JA 2OTKE 1FC2C 1H0TA 1SS1A 2LXCB
chains in the Genus database with same CATH superfamily
3CCEP 3TDKA 3CPWO 3NTNA 1EZVG 3D6ZA 3JCUE 3A7OA 3M0DC 4JPZB 1FZCB 1VQPP 1DEEG 2VRSA 2Q3IA 3WUUA 4WY4A 1SQXD 1NTZG 1KYOD 3GHGA 2N1TC 1G1JA 2C9LY 1NTKG 5CJ0A 3VP9A 3IAOA 1GD2E 1OW8A 1VQLP 1DIPA 4WY4B 3I55P 3CD6P 2NPSD 4OWFA 5AVWB 3RL0B 2O01J 4BRYA 3H1IE 5CJ4A 3MUDA 1U57A 1FJKA 3L74J 1JMBA 3AEAC 1U7JA 2FKWB 1NH4A 2XNDH 2B87A 1SFCA 2QM7A 4WWIA 2OTLP 2PP6A 2MJZA 2Y0DA 1KYOE 3F5HA 5KKZB 2V7QJ 3K5BA 5AVYB 1PP9J 1QL1A 3HE5B 2SPZA 1VF5D 2B87B 1HVVA 4BXLA 1SFCB 2MKVA 2N9BA 2JKVA 1NHLA 1OFCX 2R5DA 1P84H 3D70A 2K9JA 3L70E 2YIUB 2AXTH 1L0LK 1JNMA 3B4SA 4AQRD 2OYIA 2WWWA 1KFNA 1LT9B 1SVFA 4PD4D 3IF4A 3L75J 1LJ2A 2H88C 1UIXA 1JEKA 1ZOYC 4LLHA 1OW6A 1L4AA 1XTCC 2K9JB 5TJHA 1VQ7P 1EC5A 3M9BA 2OYIB 3EWKA 3HD7C 4PV1B 3CCMP 3L74D 3S1KA 3RBZA 1SQVG 3PP5A 1L4AB 4H44C 5APUA 2FYUJ 1H8AA 2P58A 3M91A 1VQOP 4TLFA 4AUWA 5AVVB 1ZLLA 2Y9ZA 3HE4B 5CCHA 2W6JH 1PP9D 2Z4EA 3D71A 2E74C 4UB6E 4PD4E 2C0XA 3L71G 5B5EE 3CLQA 4R4LA 1OXZA 1S2EA 2PGDA 1URQA 1ZR4A 1Y8AA 1YTZT 2FXPA 2W83C 1IJDB 2XZRA 3VN0A 1YHQP 3M9HA 3VP8A 4C7NA 5APYA 1S9KE 1K04A 1LGHB 1X9VA 1NTKJ 1HJBA 3L75D 3FXDA 1MV8A 2IPPA 2DW3A 1IFMA 1N73C 5KAIE 2H43A 1URQB 2K9YA 2WPVB 2WT7A 4PJ0H 1FS0E 5KJ7D 2OTJP 4C7NB 4YTPC 4JQ0D 2QJPB 5BU5A 3AEBC 1SQBK 1OWAA 1ZV8A 1AFOA 3LIDA 2FYUD 1X22A 4C46A 3MZWB 2WT7B 2IBZI 3CXHD 1N7SA 2KB7P 3A3YB 2ZJSE 1IK7A 2WSEJ 3TYYA 1EZVD 3FXEA 1T6AA 1JM0A 1JOCA 3L75E 1NGMB 4OGQD 2A45I 5DJTB 1M90Q 1ZN5A 2GUSA 2FFDA 1N7SB 3TK1A 4I1LA 2IBZD 3E1IA 3CCVP 1CZQA 1KB9D 1BCCE 1VQKP 1LTGC 1NTKD 2ZXXA 1L0ND 4L73A 1OVUA 2FFDB 2BCCD 5CBOA 1TU3F 5KTBA 1H0TA 2FYUE 2BEZF 1U7MA 3FGAD 3VOPA 5H2FH 3PRJA 2IYOA 3M06A 2O01N 2QRXA 2JWDA 4DJGA 1SQVJ 2ZAEB 3CMEP 1RF1C 2FBWC 3PH0A 1H0TB 3L70G 1N8RQ 5KLIC 3A5TA 1SQXK 4GOFA 1J1EB 2IBZE 2I8DA 3V4WA 5AVQB 1KB9E 1K8AQ 2ZFCA 1NTKE 1QGKB 2W8ZA 3CX5H 4U3FD 2RH0A 3RK3C 1L0NE 3L71J 1VL2A 1RHZB 2BCCE 3P8MC 1VF5C 4GKGA 5AVXB 3QH9A 2FYNB 1VQ5P 3Q5RA 2RN0A 1J1DB 5AW1B 2JP3A 3M0DA 3CCQP 3H25A 1YJNP 1IFPA 3E7KA 2W6BA 1K9MQ 1LTBC 1BSHA 3KHUA 3NXSA 2N1TA 1K05A 2ZT9D 1T2KC 3S4RA 2E75C 2CK3H 1CW5A 3O8ZA 3BRTB 2BASA 2Y9YA 3RK2D 3I5CA 2E5YA 3HRNA 1SQVD 2N1TB 2KS1A 3HUSC 2P2UA 3A0BE 4U3FE 1GK6A 1PL5A 1DEBA 2WPQA 3H1HJ 3MHVA 2WSFJ 1NTME 3SWKA 4L76A 4I7ZB 1L2PA 2KS1B 1KILE 2QJKC 3G6EP 1YITP 1LTTC 2WSEH 1AJYA 3AEFC 1QVGO 2KI7B 3GW6A 1WMKA 1JY2P 3M9QA 3PJSK 1JCCA 1QX8A 2ZYGA 4RO0A 3H1LE 4JYBA 1ZR2A 3L75G 3CC4P 4IOIH 5GTHH 5E79E 4ZMDA 1PV3A 1HJ0A 3RL0D 3AE6C 3L70J 3SFDC 3HD7A 1LTJC 1PGOA 1M8OB 3H1HD 3Q5PA 2C0WA 1BCCG 2LXCB 2Q5UA 1BE3E 1G1IA 1HF9A 1PFIA 2D2CB 3AEGC 1P84I 4O9BA 3B5NA 1FDIA 1SQPJ 2FXOA 4XA4A 2PRRA 2GM4A 3MGNA 1KQSO 1IZNB 2M3BA 3C8VA 1SFCD 3KZIE 3SFEC 3KQGA 1EDJA 1RE3C 5BVZA 3OAKA 2FYUK 2WPRA 2IBZG 1JB0J 3H1HE 1EDKA 4YXDC 1E79H 4EI2A 1N73A 2Q1KA 1N86A 1OVRA 1L0NG 3PTZA 2KUBA 2OYHC 5KAFH 2BCCG 2YXRB 2AEJA 3GHGB 3L70D 1JY3P 1HH0A 5GTIH 4EOTA 2AXCA 4PV1D 1JY3O 4LGDE 1NTZK 3WMM0 1GL2C 4HJGH 3Q1MA 1N73B 3ZDMA 2O1KA 3B8EB 1H89A 1NTKK 3NFQA 3IR9A 3V4QA 1AV1A 1SQPD 4N78D 4JYCA 4Y28J 2YNYA 1VQMP 1AQTA 2KK7A 4BRYB 1P84E 4H0LC 3BVHA 2JWAA 4ZNCA 3USSA 3V2QA 3U1CA 1DD3A 2NRGA 3JC22 4U3FG 3TF5A 4LC1A 5AVSB 2QE7H 2IFNA 1MFTA 5CCHD 3BCCJ 2GA1A 1K73Q 3SSUA 2IFMA 1NTMG 1KQGB 3GF7A 1NYHA 4ZKPA 3G9RA 2LKMA 2JR8A 2ZT9C 4MN4C 2FYZA 5KLVJ 1NKNA 3BATA 2QJYC 1FJPA 5AW7B 5AVUB 2ZYAA 1KYOH 3AE7C 1VQNP 1EQ7A 1JUNA 1N2DC 1HWTC 2ZVOB 1CSBA 1Q90D 3D6YA 2WPSA 4KT0J 1SQPE 1JTHA 4N78E 3VMYA 4EIJA 1BCCJ 1RE4C 2M5AA 1S9KD 3AECC 2K88A 1RF1A 1RQVA 3MP7B 2L91A 1JTHB 3H1LG 3B5NC 2M5AB 4U7JA 1R5LA 3LW5J 1RF1B 1RQUA 3GLMA 3AE4C 1AVYA 1N7SD 5KLIB 2KLUA 3PHLA 2KSEA 5CCGD 1FAVA 4H13C 2R3CA 1SQVK 2Z5IA 3V2PA 3BCCD 1BE3G 2LR2A 2E76C 3W68A 5KLVD 3R4YA 3RK3B 1MFZA 1YJ9P 1L0NJ 1OZHA 1VF5B 4IL6H 5AW4B 1GU4A 2BCCJ 5EFWB 1ZMEC 3S9OA 3OJAB 4UB6H 2HPCA 2KP8A 4PD4H 2UWJE 2QA4P 4WBAA 4QMAA 1X0TA 1BCCD 5B5EH 3RL0C 1SQQE 1QL2A 4EDFA 3QWOC 3HUSA 1HBWA 3KXDA 3H1KG 3O6QA 1Q86Q 2YKPA 2E75B 2O01H 4ASWA 4M3LA 3RBXA 2WITA 2HPCB 3H1HG 2P10A 3BCCE 2B9BA 1E5WA 2KXPB 3MTUE 5KAIH 2M0BA 1GMJA 1LTSC 3HUSB 3MIWA 5KLVE 3TSIA 2QG4A 3O6QB 4KJMA 3AEEC 4U3FJ 2E42A 1NAFA 2V7QH 1Z56A 1IO4A 1USEA 1PZQA 1NTMJ 5B66H 1LT9C 3CCJP 3H32A 3EFFK 1NO4A 1LWUC 1JCDA 1M7LA 1W2EA 1ZW0A 3EQ2A 1S5LH 2Z5HA 3CI9A 4I2LC 1EXJA 3H32B 2M3EA 2NPSC 3W67A 4DCKA 2WTYA 1YYCA 1MZ9A 4Y99C 1KN7A 3TNUA 1LTJA 2Q3EA 5APVA 1DX7A 2BEQD 1PGQA 3H1LJ 3A0HH 2WZ7A 2QIWA 3N4XA 3V2RA 2JDIH 2R5BA 2Q6QA 2YO2A 3TNUB 3CXHH 4NPEA 1LTJB 1NJIQ 1SQPG 1KZUB 3BRVB 1NTMD 1BE3J 1GW4A 1RE3A 2JEEA 1KILD 2V4HA 1ZRTD 2Y0CA 2Q7CA 2QSIA 2WSSH 3ABVC 3ITKA 4ZKUA 1DH3A 1KB9H 2CPBA 2XKMA 1YTZI 1YQ3C 5DJUB 1SQBJ 3A2AA 4EYYQ 3VYIA 1FZGA 4IFDK 2J59M 2OYHA 3H1KJ 5CHXA 1L0LE 3L36A 2QVAA 2E43A 1OMIA 1WRGA 3WU2H 3H1LD 1S72P 1GL2A 1OW7A 3I56P 2XU6A 4L74A 2D2CD 2OYHB 1NU1G 1MUUA 2H7HA 3L73D 1CI6A 1ZRTE 5K5GB 3L72D 3L37A 3V6IA 1GL2B 2OARA 1S4XA 3AE2C 4DT0A 1BE3D 1WT6A 5CCGC 1SQQG 3A0BH 3FWNA 2WSCJ 2RMZA 2RKLA 1GK4A 4CPGA 1FBMA 3WUVA 3VMAA 1FOSE 4A7PA 4H0LB 2WMMA 2W90A 4GDOA 1JY2O 3B71A 1FZEA 3BCCG 4WVZA 1FDOA 3IFMA 1M1JC 1SQBD 2OTKE 5KLVG 4WY4D 3AE8C 1HTLC 3AE9C 5KJ7C 5AW0B 5AW2B 3H1KD 3L73E 1RE4A 4GOEA 4NPFX 3L72E 3JSVC 2ZXEB 3TGUD 4YXWH 3CWBD 4K3AA 3AEDC 3CL3D 3H1JJ 3EFGA 3CCLP 1N7LA 3GG2A 1NWQA 3KYQA 1FU1A 3HD7B 1ZP0C 3MD0A 4I6MC 4OGQC 3CC2P 3GF3A 4XFJA 1FZAA 1HGVA 1SQBE 3C1LA 5BU8B 2FXMA 4H44B 4UB8H 1KYOI 4D6TD 2Q9IA 1GTWA 3OW2O 5TISH 2FY8A 2ZVNB 3B5NB 1NKZB 2N9YB 3H1KE 4B86A 1DD4A 4HYTB 1P84D 5KAFE 2I1JA 5CBNA 5GTIE 2A06D 2E74B 4TT3H 1IFIA 3U59A 2KOGA 4H13B 4Z1MH 3TGUE 2P67A 5APTA 3CWBE 1LNQA 1R8EA 1PIXA 2KZJA 1RF0C 2HG5D 1FC2C 3HTKA 2E76B 3KZIH 2P1JA 2A45G 1VQ4P 3JCUH 2ITAA 4WB4A 3F89A 5L8RJ 1NU1J 1L4AD 4I7ZC 1BGYD 3KDPB 3G71P 3H1JD 5AW9B 2P7JA 1VQ8P 1EDLA 3FWLA 4D6TE 1PPJD 1KV4A 3HTKB 5AVRB 1L0NK 2WSFH 2O3JA 1M57D 2Y0EA 5AW8B 1M56D 1IFJA 2YKOA 1SQQJ 2KSJA 3HE5A 2A06E 2AXTE 5AVZB 1QEXA 1T3JA 2IZ0A 4OVNF 1KMIZ 3Q3DA 1L0LG 4IL6X 2C9NY 1SQXE 2XDJA 5AW3B 1KILC 2M8RA 4PD4I 2WSCH 3RK3D 5APQA 1Q82Q 1IC2A 2G8YA 1YI2P 1LT9A 4HH2A 1Y9BA 1LWUA 1D7MA 1URQD 3SWYA 1BGYE 2L5GB 3H1JE 3RK2C 1KORA 1PPJE 3FX0A 1Y47A 3P32A 1KTMA 1FZBA 1T2KD 2NPSA 3RL0g 1LWUB 1NTMK 5APSA 1NU1D 2E75D 2YXQB 1Q7YQ 2W6AA 2NZ2A 1T8ZA 4GT1A 4N6JA 1J2JB 2KIKA 2D2CC 4JBZA 4RJTA 3P7KA 1IFNA 2YO3A 1YIJP 2B89A 3L4FA 2NPSB 3HE4A 3RK3E 1SQQD 4Y99B 2R3SA 3R2PA 2I1KA 3L73G 1FZCC 3RGUA 2QEXP 3IN6A 3L72G 3Q2YA 4IL6E 4HB1A 1A02J 1S5LX 3C9IA 4YPCA 1QLED 2OGUA 4PJ0E 1JY2N 1NU1E 1LTIC 4KHXA 1NTZJ 3LIEA 2IYPA 2YKQA 2W27A 1YBKA 4WY4C 1KD1Q 1RH5B 3UIAA 3GHGC 3H6PA 1JMMA 3II6A 2IZ1A 1KC8Q 1VDFA 1SQBG 2PAJA 1YJWP 3L35A 3L74E 4C7RA 3CXHI 1LTAC 3CX5I 1HGZA 2LXBA 4DOJA 3CCUP 2HFED 1RY3A 1BDCA 1H88A 1EZVI 3CMAP 5KKZC 2HODA 3MUDC 3VTPC 4OH8B 3TGUG 1PP9E 1PGJA 3CWBG 2YMYA 1KQLA 5B66E 2XV5A 4NPDA 1L0LJ 1W2BO 2PFXA 1SFCC 3CX5D 1KB9I 5APWA 3G4SP 4JF7A 5CCGA 2HR3A 3G3ZA 1X8YA 2HODB 1OIPA 2R44A 2YIUC 1BSNA 1PGPA 1S5LE 5H2FE 1ZXGA 4D6TG 2QJKB 2KNCA 1NTZD 1MKMA 3WUTA 3KPEA 3H1IG 1M1JA 3AE1C 2B88A 1FDMA 2A06G 2YMKA 2OYIC 5KJ7A 2N1TD 3V5BA 3A0HE 4IFFA 2POHA 1A02F 4PV1C 2KNCB 1KQFB 3VMZA 1SQXG 3M0AA 1JY3N 4W80A 1M1JB 3SWFA 2IX7C 3CXHE 1L4AC 3CX5E 1OVVA 1EZVE 1OX3A 3CCRP 1HUCA 1UIIA 4BWNA 1BGYG 1LT1A 3H1JG 2K3RA 1GL2D 1L0LD 3L73J 1R5SA 1PPJG 1NOHA 1EXIA 4XE5B 4DZOA 1NTZE 3LW5H 3L72J 1SP4A 4GODA 5APXA 3VMXA 5CCHC 4HKZH 4H0LD 2O1JA 2R32A 3PLNA 1S1CX 5M1BA 1GDTA 2OQQA 1VQ9P 4W7YA 4OGQB 2J58A 1SLQA 1USDA 1FZFA 1URQC 2K1AA 1EDIA 1VQ6P 5AW5B 1NAYA 2HLOA 1SQPK 3WU2E 2WQYC 1QVFO 2G3AA 2QJPC 3V2NA 3Q5SA 1RF0A 2A45H 1VPCA 3GMAA 1IFDA 2J5UA 1GU5A 1XTGB 2IDBA 2CPSA 2JJLA 4ASVA 2AEMA 3TGUJ 3CWBJ 2GUVA 1W5CE 3HD7D 3CC7P 3N7NA 3E1RA 1N7SC 3BASA 1FOSF 4H44D 3U1AA 2H8PD 1AQ5A 3L74G 1S3JA 3B5ND 2JO1A 5C39A 2H89C 4D6TJ 3L71D 5AW6B 1CI6B 1NU1K 1KILA 1Q2NA 3AE5C 4RESB 2HYNA 4AYCA 2FFDC 3AE3C 1T3UA 3H1IJ 4R4MA 5GTHE 2E74D 4K35A 1YQ4C 4H13D 1PP9G 2XNXA 2K37A 4RKUJ 3P8CD 1SQQK 1BDDA 1GZLA 1SQVE 2E76D 1KILB 4IFMA 1LP1A 2ZYDA 1SQXJ 1Q81Q 2AEFA 1X79B 1KFMA 1G2CA 4GIFA 1M1KQ 1JO5A 1IK9A 1GW3A 2ZT9B 2KZIA 3T97A 2QJYB 1FE6A 5CMZA 1AA0A 2OYOA 1J1EC 5AVTB 3RK2B 1BGYJ 1LP1B 5KLVK 2KLVA 3L71E 1G2CB 4N3YB 4L75A 4UB8E 1AVOA 4W7ZA 5TISE 3T97B 3CCSP 2FYNC 5E79H 1J1DC 1FZCA 2KYVA 1NVOA 2WVRA 3OA7A 2QM8A 2FYUG 3P8CE 2E5TA 3NMDA 3H1ID 1SS1A
chains in the Genus database with same CATH topology
1U7MA 5C39A 3FXDA 2KIKA 2QRXA 4JBZA 1Q2NA 4ZNCA 4GODA 1DEEG 3MHVA 5DJUB 2JWDA 4NPDA 2B89A 4K35A 2ZAEB 4EYYQ 4HKZH 1EDLA 2LR2A 1ZW0A 3PH0A 4GOEA 4NPFX 1H0TB 2HR3A 2KS1B 1MFTA 2R44A 4K3AA 4GOFA 1BDDA 3RGUA 2QVAA 1EDIA 1EC5A 1LP1A 1EDJA 1ZXGA 2I8DA 5EFWB 4MN4C 3MZWB 4HB1A 2UWJE 3S1KA 1X0TA 2KI7B 2KZIA 3QWOC 2B88A 3FXEA 2P58A 1EDKA 1JM0A 1LP1B 5K5GB 2Q1KA 1OVRA 1JMBA 5DJTB 2M5AA 1U7JA 2KUBA 4ASWA 2B87A 4ASVA 4NPEA 2RKLA 2M0BA 4WWIA 5CBNA 4CPGA 4IOIH 1Y47A 2LXBA 4HJGH 4ZMDA 1NVOA 2WMMA 4KJMA 3ZDMA 1OVVA 2M5AB 1BDCA 2SPZA 1OVUA 1LT1A 2B87B 2K3RA 4BXLA 5CBOA 2KZJA 1S3JA 2OTKE 1FC2C 1H0TA 1SS1A 2LXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7M A;  5C39 A;  3FXD A;  2KIK A;  2QRX A;  4JBZ A;  1Q2N A;  4ZNC A;  4GOD A;  1DEE G;  3MHV A;  5DJU B;  2JWD A;  4NPD A;  2B89 A;  4K35 A;  2ZAE B;  4EYY Q;  4HKZ H;  1EDL A;  2LR2 A;  1ZW0 A;  3PH0 A;  4GOE A;  4NPF X;  1H0T B;  2HR3 A;  2KS1 B;  1MFT A;  2R44 A;  4K3A A;  4GOF A;  1BDD A;  3RGU A;  2QVA A;  1EDI A;  1EC5 A;  1LP1 A;  1EDJ A;  1ZXG A;  2I8D A;  5EFW B;  4MN4 C;  3MZW B;  4HB1 A;  2UWJ E;  3S1K A;  1X0T A;  2KI7 B;  2KZI A;  3QWO C;  2B88 A;  3FXE A;  2P58 A;  1EDK A;  1JM0 A;  1LP1 B;  5K5G B;  2Q1K A;  1OVR A;  1JMB A;  5DJT B;  2M5A A;  1U7J A;  2KUB A;  4ASW A;  2B87 A;  4ASV A;  4NPE A;  2RKL A;  2M0B A;  4WWI A;  5CBN A;  4CPG A;  4IOI H;  1Y47 A;  2LXB A;  4HJG H;  4ZMD A;  1NVO A;  2WMM A;  4KJM A;  3ZDM A;  1OVV A;  2M5A B;  1BDC A;  2SPZ A;  1OVU A;  1LT1 A;  2B87 B;  2K3R A;  4BXL A;  5CBO A;  2KZJ A;  1S3J A;  2OTK E;  1FC2 C;  1H0T A;  1SS1 A;  2LXC B; 
#chains in the Genus database with same CATH topology
 3CCE P;  3TDK A;  3CPW O;  3NTN A;  1EZV G;  3D6Z A;  3JCU E;  3A7O A;  3M0D C;  4JPZ B;  1FZC B;  1VQP P;  1DEE G;  2VRS A;  2Q3I A;  3WUU A;  4WY4 A;  1SQX D;  1NTZ G;  1KYO D;  3GHG A;  2N1T C;  1G1J A;  2C9L Y;  1NTK G;  5CJ0 A;  3VP9 A;  3IAO A;  1GD2 E;  1OW8 A;  1VQL P;  1DIP A;  4WY4 B;  3I55 P;  3CD6 P;  2NPS D;  4OWF A;  5AVW B;  3RL0 B;  2O01 J;  4BRY A;  3H1I E;  5CJ4 A;  3MUD A;  1U57 A;  1FJK A;  3L74 J;  1JMB A;  3AEA C;  1U7J A;  2FKW B;  1NH4 A;  2XND H;  2B87 A;  1SFC A;  2QM7 A;  4WWI A;  2OTL P;  2PP6 A;  2MJZ A;  2Y0D A;  1KYO E;  3F5H A;  5KKZ B;  2V7Q J;  3K5B A;  5AVY B;  1PP9 J;  1QL1 A;  3HE5 B;  2SPZ A;  1VF5 D;  2B87 B;  1HVV A;  4BXL A;  1SFC B;  2MKV A;  2N9B A;  2JKV A;  1NHL A;  1OFC X;  2R5D A;  1P84 H;  3D70 A;  2K9J A;  3L70 E;  2YIU B;  2AXT H;  1L0L K;  1JNM A;  3B4S A;  4AQR D;  2OYI A;  2WWW A;  1KFN A;  1LT9 B;  1SVF A;  4PD4 D;  3IF4 A;  3L75 J;  1LJ2 A;  2H88 C;  1UIX A;  1JEK A;  1ZOY C;  4LLH A;  1OW6 A;  1L4A A;  1XTC C;  2K9J B;  5TJH A;  1VQ7 P;  1EC5 A;  3M9B A;  2OYI B;  3EWK A;  3HD7 C;  4PV1 B;  3CCM P;  3L74 D;  3S1K A;  3RBZ A;  1SQV G;  3PP5 A;  1L4A B;  4H44 C;  5APU A;  2FYU J;  1H8A A;  2P58 A;  3M91 A;  1VQO P;  4TLF A;  4AUW A;  5AVV B;  1ZLL A;  2Y9Z A;  3HE4 B;  5CCH A;  2W6J H;  1PP9 D;  2Z4E A;  3D71 A;  2E74 C;  4UB6 E;  4PD4 E;  2C0X A;  3L71 G;  5B5E E;  3CLQ A;  4R4L A;  1OXZ A;  1S2E A;  2PGD A;  1URQ A;  1ZR4 A;  1Y8A A;  1YTZ T;  2FXP A;  2W83 C;  1IJD B;  2XZR A;  3VN0 A;  1YHQ P;  3M9H A;  3VP8 A;  4C7N A;  5APY A;  1S9K E;  1K04 A;  1LGH B;  1X9V A;  1NTK J;  1HJB A;  3L75 D;  3FXD A;  1MV8 A;  2IPP A;  2DW3 A;  1IFM A;  1N73 C;  5KAI E;  2H43 A;  1URQ B;  2K9Y A;  2WPV B;  2WT7 A;  4PJ0 H;  1FS0 E;  5KJ7 D;  2OTJ P;  4C7N B;  4YTP C;  4JQ0 D;  2QJP B;  5BU5 A;  3AEB C;  1SQB K;  1OWA A;  1ZV8 A;  1AFO A;  3LID A;  2FYU D;  1X22 A;  4C46 A;  3MZW B;  2WT7 B;  2IBZ I;  3CXH D;  1N7S A;  2KB7 P;  3A3Y B;  2ZJS E;  1IK7 A;  2WSE J;  3TYY A;  1EZV D;  3FXE A;  1T6A A;  1JM0 A;  1JOC A;  3L75 E;  1NGM B;  4OGQ D;  2A45 I;  5DJT B;  1M90 Q;  1ZN5 A;  2GUS A;  2FFD A;  1N7S B;  3TK1 A;  4I1L A;  2IBZ D;  3E1I A;  3CCV P;  1CZQ A;  1KB9 D;  1BCC E;  1VQK P;  1LTG C;  1NTK D;  2ZXX A;  1L0N D;  4L73 A;  1OVU A;  2FFD B;  2BCC D;  5CBO A;  1TU3 F;  5KTB A;  1H0T A;  2FYU E;  2BEZ F;  1U7M A;  3FGA D;  3VOP A;  5H2F H;  3PRJ A;  2IYO A;  3M06 A;  2O01 N;  2QRX A;  2JWD A;  4DJG A;  1SQV J;  2ZAE B;  3CME P;  1RF1 C;  2FBW C;  3PH0 A;  1H0T B;  3L70 G;  1N8R Q;  5KLI C;  3A5T A;  1SQX K;  4GOF A;  1J1E B;  2IBZ E;  2I8D A;  3V4W A;  5AVQ B;  1KB9 E;  1K8A Q;  2ZFC A;  1NTK E;  1QGK B;  2W8Z A;  3CX5 H;  4U3F D;  2RH0 A;  3RK3 C;  1L0N E;  3L71 J;  1VL2 A;  1RHZ B;  2BCC E;  3P8M C;  1VF5 C;  4GKG A;  5AVX B;  3QH9 A;  2FYN B;  1VQ5 P;  3Q5R A;  2RN0 A;  1J1D B;  5AW1 B;  2JP3 A;  3M0D A;  3CCQ P;  3H25 A;  1YJN P;  1IFP A;  3E7K A;  2W6B A;  1K9M Q;  1LTB C;  1BSH A;  3KHU A;  3NXS A;  2N1T A;  1K05 A;  2ZT9 D;  1T2K C;  3S4R A;  2E75 C;  2CK3 H;  1CW5 A;  3O8Z A;  3BRT B;  2BAS A;  2Y9Y A;  3RK2 D;  3I5C A;  2E5Y A;  3HRN A;  1SQV D;  2N1T B;  2KS1 A;  3HUS C;  2P2U A;  3A0B E;  4U3F E;  1GK6 A;  1PL5 A;  1DEB A;  2WPQ A;  3H1H J;  3MHV A;  2WSF J;  1NTM E;  3SWK A;  4L76 A;  4I7Z B;  1L2P A;  2KS1 B;  1KIL E;  2QJK C;  3G6E P;  1YIT P;  1LTT C;  2WSE H;  1AJY A;  3AEF C;  1QVG O;  2KI7 B;  3GW6 A;  1WMK A;  1JY2 P;  3M9Q A;  3PJS K;  1JCC A;  1QX8 A;  2ZYG A;  4RO0 A;  3H1L E;  4JYB A;  1ZR2 A;  3L75 G;  3CC4 P;  4IOI H;  5GTH H;  5E79 E;  4ZMD A;  1PV3 A;  1HJ0 A;  3RL0 D;  3AE6 C;  3L70 J;  3SFD C;  3HD7 A;  1LTJ C;  1PGO A;  1M8O B;  3H1H D;  3Q5P A;  2C0W A;  1BCC G;  2LXC B;  2Q5U A;  1BE3 E;  1G1I A;  1HF9 A;  1PFI A;  2D2C B;  3AEG C;  1P84 I;  4O9B A;  3B5N A;  1FDI A;  1SQP J;  2FXO A;  4XA4 A;  2PRR A;  2GM4 A;  3MGN A;  1KQS O;  1IZN B;  2M3B A;  3C8V A;  1SFC D;  3KZI E;  3SFE C;  3KQG A;  1EDJ A;  1RE3 C;  5BVZ A;  3OAK A;  2FYU K;  2WPR A;  2IBZ G;  1JB0 J;  3H1H E;  1EDK A;  4YXD C;  1E79 H;  4EI2 A;  1N73 A;  2Q1K A;  1N86 A;  1OVR A;  1L0N G;  3PTZ A;  2KUB A;  2OYH C;  5KAF H;  2BCC G;  2YXR B;  2AEJ A;  3GHG B;  3L70 D;  1JY3 P;  1HH0 A;  5GTI H;  4EOT A;  2AXC A;  4PV1 D;  1JY3 O;  4LGD E;  1NTZ K;  3WMM 0;  1GL2 C;  4HJG H;  3Q1M A;  1N73 B;  3ZDM A;  2O1K A;  3B8E B;  1H89 A;  1NTK K;  3NFQ A;  3IR9 A;  3V4Q A;  1AV1 A;  1SQP D;  4N78 D;  4JYC A;  4Y28 J;  2YNY A;  1VQM P;  1AQT A;  2KK7 A;  4BRY B;  1P84 E;  4H0L C;  3BVH A;  2JWA A;  4ZNC A;  3USS A;  3V2Q A;  3U1C A;  1DD3 A;  2NRG A;  3JC2 2;  4U3F G;  3TF5 A;  4LC1 A;  5AVS B;  2QE7 H;  2IFN A;  1MFT A;  5CCH D;  3BCC J;  2GA1 A;  1K73 Q;  3SSU A;  2IFM A;  1NTM G;  1KQG B;  3GF7 A;  1NYH A;  4ZKP A;  3G9R A;  2LKM A;  2JR8 A;  2ZT9 C;  4MN4 C;  2FYZ A;  5KLV J;  1NKN A;  3BAT A;  2QJY C;  1FJP A;  5AW7 B;  5AVU B;  2ZYA A;  1KYO H;  3AE7 C;  1VQN P;  1EQ7 A;  1JUN A;  1N2D C;  1HWT C;  2ZVO B;  1CSB A;  1Q90 D;  3D6Y A;  2WPS A;  4KT0 J;  1SQP E;  1JTH A;  4N78 E;  3VMY A;  4EIJ A;  1BCC J;  1RE4 C;  2M5A A;  1S9K D;  3AEC C;  2K88 A;  1RF1 A;  1RQV A;  3MP7 B;  2L91 A;  1JTH B;  3H1L G;  3B5N C;  2M5A B;  4U7J A;  1R5L A;  3LW5 J;  1RF1 B;  1RQU A;  3GLM A;  3AE4 C;  1AVY A;  1N7S D;  5KLI B;  2KLU A;  3PHL A;  2KSE A;  5CCG D;  1FAV A;  4H13 C;  2R3C A;  1SQV K;  2Z5I A;  3V2P A;  3BCC D;  1BE3 G;  2LR2 A;  2E76 C;  3W68 A;  5KLV D;  3R4Y A;  3RK3 B;  1MFZ A;  1YJ9 P;  1L0N J;  1OZH A;  1VF5 B;  4IL6 H;  5AW4 B;  1GU4 A;  2BCC J;  5EFW B;  1ZME C;  3S9O A;  3OJA B;  4UB6 H;  2HPC A;  2KP8 A;  4PD4 H;  2UWJ E;  2QA4 P;  4WBA A;  4QMA A;  1X0T A;  1BCC D;  5B5E H;  3RL0 C;  1SQQ E;  1QL2 A;  4EDF A;  3QWO C;  3HUS A;  1HBW A;  3KXD A;  3H1K G;  3O6Q A;  1Q86 Q;  2YKP A;  2E75 B;  2O01 H;  4ASW A;  4M3L A;  3RBX A;  2WIT A;  2HPC B;  3H1H G;  2P10 A;  3BCC E;  2B9B A;  1E5W A;  2KXP B;  3MTU E;  5KAI H;  2M0B A;  1GMJ A;  1LTS C;  3HUS B;  3MIW A;  5KLV E;  3TSI A;  2QG4 A;  3O6Q B;  4KJM A;  3AEE C;  4U3F J;  2E42 A;  1NAF A;  2V7Q H;  1Z56 A;  1IO4 A;  1USE A;  1PZQ A;  1NTM J;  5B66 H;  1LT9 C;  3CCJ P;  3H32 A;  3EFF K;  1NO4 A;  1LWU C;  1JCD A;  1M7L A;  1W2E A;  1ZW0 A;  3EQ2 A;  1S5L H;  2Z5H A;  3CI9 A;  4I2L C;  1EXJ A;  3H32 B;  2M3E A;  2NPS C;  3W67 A;  4DCK A;  2WTY A;  1YYC A;  1MZ9 A;  4Y99 C;  1KN7 A;  3TNU A;  1LTJ A;  2Q3E A;  5APV A;  1DX7 A;  2BEQ D;  1PGQ A;  3H1L J;  3A0H H;  2WZ7 A;  2QIW A;  3N4X A;  3V2R A;  2JDI H;  2R5B A;  2Q6Q A;  2YO2 A;  3TNU B;  3CXH H;  4NPE A;  1LTJ B;  1NJI Q;  1SQP G;  1KZU B;  3BRV B;  1NTM D;  1BE3 J;  1GW4 A;  1RE3 A;  2JEE A;  1KIL D;  2V4H A;  1ZRT D;  2Y0C A;  2Q7C A;  2QSI A;  2WSS H;  3ABV C;  3ITK A;  4ZKU A;  1DH3 A;  1KB9 H;  2CPB A;  2XKM A;  1YTZ I;  1YQ3 C;  5DJU B;  1SQB J;  3A2A A;  4EYY Q;  3VYI A;  1FZG A;  4IFD K;  2J59 M;  2OYH A;  3H1K J;  5CHX A;  1L0L E;  3L36 A;  2QVA A;  2E43 A;  1OMI A;  1WRG A;  3WU2 H;  3H1L D;  1S72 P;  1GL2 A;  1OW7 A;  3I56 P;  2XU6 A;  4L74 A;  2D2C D;  2OYH B;  1NU1 G;  1MUU A;  2H7H A;  3L73 D;  1CI6 A;  1ZRT E;  5K5G B;  3L72 D;  3L37 A;  3V6I A;  1GL2 B;  2OAR A;  1S4X A;  3AE2 C;  4DT0 A;  1BE3 D;  1WT6 A;  5CCG C;  1SQQ G;  3A0B H;  3FWN A;  2WSC J;  2RMZ A;  2RKL A;  1GK4 A;  4CPG A;  1FBM A;  3WUV A;  3VMA A;  1FOS E;  4A7P A;  4H0L B;  2WMM A;  2W90 A;  4GDO A;  1JY2 O;  3B71 A;  1FZE A;  3BCC G;  4WVZ A;  1FDO A;  3IFM A;  1M1J C;  1SQB D;  2OTK E;  5KLV G;  4WY4 D;  3AE8 C;  1HTL C;  3AE9 C;  5KJ7 C;  5AW0 B;  5AW2 B;  3H1K D;  3L73 E;  1RE4 A;  4GOE A;  4NPF X;  3L72 E;  3JSV C;  2ZXE B;  3TGU D;  4YXW H;  3CWB D;  4K3A A;  3AED C;  3CL3 D;  3H1J J;  3EFG A;  3CCL P;  1N7L A;  3GG2 A;  1NWQ A;  3KYQ A;  1FU1 A;  3HD7 B;  1ZP0 C;  3MD0 A;  4I6M C;  4OGQ C;  3CC2 P;  3GF3 A;  4XFJ A;  1FZA A;  1HGV A;  1SQB E;  3C1L A;  5BU8 B;  2FXM A;  4H44 B;  4UB8 H;  1KYO I;  4D6T D;  2Q9I A;  1GTW A;  3OW2 O;  5TIS H;  2FY8 A;  2ZVN B;  3B5N B;  1NKZ B;  2N9Y B;  3H1K E;  4B86 A;  1DD4 A;  4HYT B;  1P84 D;  5KAF E;  2I1J A;  5CBN A;  5GTI E;  2A06 D;  2E74 B;  4TT3 H;  1IFI A;  3U59 A;  2KOG A;  4H13 B;  4Z1M H;  3TGU E;  2P67 A;  5APT A;  3CWB E;  1LNQ A;  1R8E A;  1PIX A;  2KZJ A;  1RF0 C;  2HG5 D;  1FC2 C;  3HTK A;  2E76 B;  3KZI H;  2P1J A;  2A45 G;  1VQ4 P;  3JCU H;  2ITA A;  4WB4 A;  3F89 A;  5L8R J;  1NU1 J;  1L4A D;  4I7Z C;  1BGY D;  3KDP B;  3G71 P;  3H1J D;  5AW9 B;  2P7J A;  1VQ8 P;  1EDL A;  3FWL A;  4D6T E;  1PPJ D;  1KV4 A;  3HTK B;  5AVR B;  1L0N K;  2WSF H;  2O3J A;  1M57 D;  2Y0E A;  5AW8 B;  1M56 D;  1IFJ A;  2YKO A;  1SQQ J;  2KSJ A;  3HE5 A;  2A06 E;  2AXT E;  5AVZ B;  1QEX A;  1T3J A;  2IZ0 A;  4OVN F;  1KMI Z;  3Q3D A;  1L0L G;  4IL6 X;  2C9N Y;  1SQX E;  2XDJ A;  5AW3 B;  1KIL C;  2M8R A;  4PD4 I;  2WSC H;  3RK3 D;  5APQ A;  1Q82 Q;  1IC2 A;  2G8Y A;  1YI2 P;  1LT9 A;  4HH2 A;  1Y9B A;  1LWU A;  1D7M A;  1URQ D;  3SWY A;  1BGY E;  2L5G B;  3H1J E;  3RK2 C;  1KOR A;  1PPJ E;  3FX0 A;  1Y47 A;  3P32 A;  1KTM A;  1FZB A;  1T2K D;  2NPS A;  3RL0 g;  1LWU B;  1NTM K;  5APS A;  1NU1 D;  2E75 D;  2YXQ B;  1Q7Y Q;  2W6A A;  2NZ2 A;  1T8Z A;  4GT1 A;  4N6J A;  1J2J B;  2KIK A;  2D2C C;  4JBZ A;  4RJT A;  3P7K A;  1IFN A;  2YO3 A;  1YIJ P;  2B89 A;  3L4F A;  2NPS B;  3HE4 A;  3RK3 E;  1SQQ D;  4Y99 B;  2R3S A;  3R2P A;  2I1K A;  3L73 G;  1FZC C;  3RGU A;  2QEX P;  3IN6 A;  3L72 G;  3Q2Y A;  4IL6 E;  4HB1 A;  1A02 J;  1S5L X;  3C9I A;  4YPC A;  1QLE D;  2OGU A;  4PJ0 E;  1JY2 N;  1NU1 E;  1LTI C;  4KHX A;  1NTZ J;  3LIE A;  2IYP A;  2YKQ A;  2W27 A;  1YBK A;  4WY4 C;  1KD1 Q;  1RH5 B;  3UIA A;  3GHG C;  3H6P A;  1JMM A;  3II6 A;  2IZ1 A;  1KC8 Q;  1VDF A;  1SQB G;  2PAJ A;  1YJW P;  3L35 A;  3L74 E;  4C7R A;  3CXH I;  1LTA C;  3CX5 I;  1HGZ A;  2LXB A;  4DOJ A;  3CCU P;  2HFE D;  1RY3 A;  1BDC A;  1H88 A;  1EZV I;  3CMA P;  5KKZ C;  2HOD A;  3MUD C;  3VTP C;  4OH8 B;  3TGU G;  1PP9 E;  1PGJ A;  3CWB G;  2YMY A;  1KQL A;  5B66 E;  2XV5 A;  4NPD A;  1L0L J;  1W2B O;  2PFX A;  1SFC C;  3CX5 D;  1KB9 I;  5APW A;  3G4S P;  4JF7 A;  5CCG A;  2HR3 A;  3G3Z A;  1X8Y A;  2HOD B;  1OIP A;  2R44 A;  2YIU C;  1BSN A;  1PGP A;  1S5L E;  5H2F E;  1ZXG A;  4D6T G;  2QJK B;  2KNC A;  1NTZ D;  1MKM A;  3WUT A;  3KPE A;  3H1I G;  1M1J A;  3AE1 C;  2B88 A;  1FDM A;  2A06 G;  2YMK A;  2OYI C;  5KJ7 A;  2N1T D;  3V5B A;  3A0H E;  4IFF A;  2POH A;  1A02 F;  4PV1 C;  2KNC B;  1KQF B;  3VMZ A;  1SQX G;  3M0A A;  1JY3 N;  4W80 A;  1M1J B;  3SWF A;  2IX7 C;  3CXH E;  1L4A C;  3CX5 E;  1OVV A;  1EZV E;  1OX3 A;  3CCR P;  1HUC A;  1UII A;  4BWN A;  1BGY G;  1LT1 A;  3H1J G;  2K3R A;  1GL2 D;  1L0L D;  3L73 J;  1R5S A;  1PPJ G;  1NOH A;  1EXI A;  4XE5 B;  4DZO A;  1NTZ E;  3LW5 H;  3L72 J;  1SP4 A;  4GOD A;  5APX A;  3VMX A;  5CCH C;  4HKZ H;  4H0L D;  2O1J A;  2R32 A;  3PLN A;  1S1C X;  5M1B A;  1GDT A;  2OQQ A;  1VQ9 P;  4W7Y A;  4OGQ B;  2J58 A;  1SLQ A;  1USD A;  1FZF A;  1URQ C;  2K1A A;  1EDI A;  1VQ6 P;  5AW5 B;  1NAY A;  2HLO A;  1SQP K;  3WU2 E;  2WQY C;  1QVF O;  2G3A A;  2QJP C;  3V2N A;  3Q5S A;  1RF0 A;  2A45 H;  1VPC A;  3GMA A;  1IFD A;  2J5U A;  1GU5 A;  1XTG B;  2IDB A;  2CPS A;  2JJL A;  4ASV A;  2AEM A;  3TGU J;  3CWB J;  2GUV A;  1W5C E;  3HD7 D;  3CC7 P;  3N7N A;  3E1R A;  1N7S C;  3BAS A;  1FOS F;  4H44 D;  3U1A A;  2H8P D;  1AQ5 A;  3L74 G;  1S3J A;  3B5N D;  2JO1 A;  5C39 A;  2H89 C;  4D6T J;  3L71 D;  5AW6 B;  1CI6 B;  1NU1 K;  1KIL A;  1Q2N A;  3AE5 C;  4RES B;  2HYN A;  4AYC A;  2FFD C;  3AE3 C;  1T3U A;  3H1I J;  4R4M A;  5GTH E;  2E74 D;  4K35 A;  1YQ4 C;  4H13 D;  1PP9 G;  2XNX A;  2K37 A;  4RKU J;  3P8C D;  1SQQ K;  1BDD A;  1GZL A;  1SQV E;  2E76 D;  1KIL B;  4IFM A;  1LP1 A;  2ZYD A;  1SQX J;  1Q81 Q;  2AEF A;  1X79 B;  1KFM A;  1G2C A;  4GIF A;  1M1K Q;  1JO5 A;  1IK9 A;  1GW3 A;  2ZT9 B;  2KZI A;  3T97 A;  2QJY B;  1FE6 A;  5CMZ A;  1AA0 A;  2OYO A;  1J1E C;  5AVT B;  3RK2 B;  1BGY J;  1LP1 B;  5KLV K;  2KLV A;  3L71 E;  1G2C B;  4N3Y B;  4L75 A;  4UB8 E;  1AVO A;  4W7Z A;  5TIS E;  3T97 B;  3CCS P;  2FYN C;  5E79 H;  1J1D C;  1FZC A;  2KYV A;  1NVO A;  2WVR A;  3OA7 A;  2QM8 A;  2FYU G;  3P8C E;  2E5T A;  3NMD A;  3H1I D;  1SS1 A; 
#chains in the Genus database with same CATH homology
 1U7M A;  5C39 A;  3FXD A;  2KIK A;  2QRX A;  4JBZ A;  1Q2N A;  4ZNC A;  4GOD A;  1DEE G;  3MHV A;  5DJU B;  2JWD A;  4NPD A;  2B89 A;  4K35 A;  2ZAE B;  4EYY Q;  4HKZ H;  1EDL A;  2LR2 A;  1ZW0 A;  3PH0 A;  4GOE A;  4NPF X;  1H0T B;  2HR3 A;  2KS1 B;  1MFT A;  2R44 A;  4K3A A;  4GOF A;  1BDD A;  3RGU A;  2QVA A;  1EDI A;  1EC5 A;  1LP1 A;  1EDJ A;  1ZXG A;  2I8D A;  5EFW B;  4MN4 C;  3MZW B;  4HB1 A;  2UWJ E;  3S1K A;  1X0T A;  2KI7 B;  2KZI A;  3QWO C;  2B88 A;  3FXE A;  2P58 A;  1EDK A;  1JM0 A;  1LP1 B;  5K5G B;  2Q1K A;  1OVR A;  1JMB A;  5DJT B;  2M5A A;  1U7J A;  2KUB A;  4ASW A;  2B87 A;  4ASV A;  4NPE A;  2RKL A;  2M0B A;  4WWI A;  5CBN A;  4CPG A;  4IOI H;  1Y47 A;  2LXB A;  4HJG H;  4ZMD A;  1NVO A;  2WMM A;  4KJM A;  3ZDM A;  1OVV A;  2M5A B;  1BDC A;  2SPZ A;  1OVU A;  1LT1 A;  2B87 B;  2K3R A;  4BXL A;  5CBO A;  2KZJ A;  1S3J A;  2OTK E;  1FC2 C;  1H0T A;  1SS1 A;  2LXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...