1OVRA

Crystal structure of four-helix bundle model di-mn(ii)-df1-l13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords four-helix bundle model di-Mn(II)-DF1-L13
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 19
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovrA00
2KUBA 2M5AB 3ZDMA 4ZMDA 4GOFA 4IOIH 2RKLA 1LT1A 2ZAEB 5C39A 2SPZA 2Q1KA 3MHVA 1Y47A 2OTKE 4GODA 2B87B 2LXCB 1JMBA 1U7MA 1EDIA 5EFWB 5CBOA 1BDCA 1EDKA 2KIKA 4HJGH 2KS1B 2M0BA 5DJTB 5K5GB 4ASVA 1OVVA 1SS1A 4EYYQ 3PH0A 2R44A 1LP1B 4NPFX 3FXEA 1NVOA 2B88A 2LXBA 1JM0A 4ZNCA 4KJMA 2QRXA 2LR2A 2I8DA 1H0TA 2WMMA 1OVUA 1U7JA 4GOEA 5DJUB 1DEEG 2K3RA 1ZXGA 2KZIA 4WWIA 1H0TB 3S1KA 2M5AA 1Q2NA 2KZJA 3FXDA 1OVRA 1EDLA 2UWJE 4CPGA 5CBNA 1EC5A 2QVAA 1FC2C 4ASWA 4NPDA 2B89A 4K3AA 1EDJA 4BXLA 3QWOC 2HR3A 4HKZH 4JBZA 2JWDA 4HB1A 1ZW0A 1LP1A 1BDDA 1X0TA 1S3JA 3MZWB 4MN4C 2P58A 4K35A 4NPEA 2KI7B 1MFTA 2B87A 3RGUA
chains in the Genus database with same CATH superfamily
3L70G 2M5AB 3U1AA 2E42A 2ZAEB 3HUSB 3K5BA 4U3FJ 3Q5RA 4WY4D 2YXQB 2Y0EA 2GA1A 5AW9B 4HJGH 2E75D 2NRGA 1K05A 3WUUA 1SQPJ 4OGQB 1JNMA 1VQ4P 2FYUE 3NMDA 2JR8A 1J1DC 1KZUB 3CC7P 4KHXA 1RF1B 2A06D 2O01J 3RK2B 3Q3DA 2J58A 3CD6P 3CLQA 1X8YA 4H13D 1U7JA 3ITKA 2WPRA 1JY3P 4PV1C 1UIXA 1QL2A 3H6PA 2QE7H 1RF0A 3HD7D 1SQQJ 4D6TG 3KHUA 2ITAA 2FFDB 3RK3D 3G3ZA 4U3FD 1RE4A 5AVYB 2IFMA 5AVXB 5AW8B 4BXLA 3QWOC 3CCSP 2AEFA 1N73A 3CL3D 1NAYA 1SQPD 3L74G 2Y9YA 3TSIA 4DCKA 3OW2O 2BCCD 2K9JA 1P84D 4NPEA 1NKNA 3RL0C 1BGYG 1LTJA 1BSNA 1AQTA 1VQNP 1YJ9P 1KB9D 3Q5PA 2Y0DA 3P8CD 3L35A 3L72D 2QJKB 1U7MA 2ZVOB 2P67A 3CWBG 5CBOA 1Q90D 3FX0A 1EDKA 2Q3EA 1SFCD 3V5BA 4D6TJ 3L70D 2FXOA 1KQFB 4LLHA 1KQSO 1FZBA 2E74B 1Q82Q 3FXEA 5AVZB 4IL6X 2OYIB 2WQYC 1PV3A 1GL2A 1SLQA 2QJPC 1JY2N 2N1TB 1OIPA 1FZEA 3BCCD 1RE4C 3AEAC 1GZLA 1LTGC 2UWJE 4CPGA 4EIJA 3HTKA 2H88C 2A45I 1SP4A 3GW6A 1KN7A 1VQ9P 1IK9A 1USDA 3GHGB 5AW6B 4PD4I 1FS0E 1UIIA 4M3LA 1L2PA 2IBZD 1HH0A 2JWDA 3IFMA 1LTJC 3TF5A 1JTHB 2V7QH 4OGQD 3OJAB 4L76A 4Z1MH 2A45G 3VMZA 3ZDMA 1EZVE 2KS1A 3L74D 3RK2D 1NTKG 1FDOA 2ZXXA 1L0NG 1KV4A 2V4HA 3KXDA 2XNXA 1BGYD 1PFIA 5AVWB 2PRRA 2KNCA 1QGKB 4NPFX 2OTLP 4H44D 3NFQA 3CWBD 2QG4A 2P7JA 5H2FH 1YJNP 1KMIZ 1FDMA 3OA7A 5KLVE 2WPVB 3CCMP 2Q6QA 1BCCG 2HODB 2ZYGA 1AJYA 1S72P 3F89A 1JY2O 1NTKJ 1QVGO 1L0NJ 1LTSC 3H1HG 2HG5D 3H32A 3H1JJ 5GTHE 1VF5B 3VMAA 1GMJA 1BDDA 3AE8C 1KFNA 1RQVA 2YIUC 1PP9E 1FZGA 2M3BA 3L71E 4Y99B 3AE6C 4AYCA 1SQVK 2IDBA 1LGHB 2E74D 5AVSB 3L4FA 2RH0A 1T2KC 4GDOA 1HJBA 2XDJA 3SWKA 3AECC 5EFWB 1FZFA 1J1EC 1Q7YQ 3CCEP 2JP3A 4H0LD 5E79H 1PZQA 2C9NY 4N78E 2MKVA 1BCCJ 1TU3F 3KZIH 4W7ZA 2H43A 1HUCA 1NOHA 2N1TD 1A02F 4R4MA 4PD4D 1SQBK 2LXBA 1E5WA 3H1HJ 1SQXE 2B9BA 3E1RA 4W7YA 4KT0J 3A7OA 5KKZB 2OTJP 1FZCA 3C8VA 4YTPC 1SVFA 5CCHC 3GMAA 2M5AA 1KILE 1SQVE 2FY8A 2N9BA 5AW3B 4A7PA 1LT9A 3CXHH 4IFDK 1L0LJ 1ZRTD 4I7ZC 1FOSE 1N7SB 1YITP 5E79E 2HR3A 1Y9BA 3O6QB 2E43A 4C7NB 1A02J 3GF3A 3KZIE 2J5UA 4K35A 2ZXEB 1IFMA 1SQBE 3L75D 5B5EH 4H13B 1IC2A 2ZYAA 2K9YA 3H1HD 2Q1KA 2W6JH 1NTMJ 1PGJA 3HD7B 5APYA 1XTCC 3U59A 1VQKP 1GU5A 1KD1Q 5BVZA 3TDKA 2CK3H 3VYIA 1QL1A 3M9QA 4WVZA 3TGUE 1X79B 2A06G 3CXHE 3V2NA 1NYHA 1IO4A 2HPCB 2ZJSE 1AQ5A 1FZCC 3CI9A 1KYOE 4N6JA 4AQRD 1RH5B 1LTTC 2QM7A 1W2EA 2YXRB 1FBMA 1CZQA 1S9KD 3D6YA 1VF5D 2E76C 2O1KA 4I2LC 1LT9C 5KLIB 1FU1A 1IJDB 1GD2E 1Q86Q 2FYUG 2Q9IA 1NTZG 1FC2C 3VOPA 4ASWA 1MZ9A 2FXPA 3JCUH 2XV5A 2B89A 4R4LA 2YMYA 1KB9I 2QA4P 3NXSA 2WSFJ 2Y9ZA 1JY3N 1LJ2A 1MUUA 3SWFA 3V2PA 4IL6H 1OX3A 2JEEA 1CI6A 2Y0CA 4MN4C 1HTLC 2B87A 3EQ2A 5AVVB 5GTIE 3VTPC 3IAOA 4RO0A 4ZMDA 2OYIA 4UB6H 2SPZA 1ZLLA 1Y47A 5CCGA 3H1ID 1S1CX 1NU1E 3RBXA 3LIEA 1OVVA 2Q3IA 4EYYQ 1BE3E 2BASA 1NTZJ 3AEBC 3CX5H 4L73A 3JCUE 1M7LA 1GW3A 5AW0B 2O01H 1OVUA 2NPSB 1HWTC 4HH2A 1OZHA 2D2CC 3H1LG 2HFED 4IL6E 1JTHA 2BCCJ 3BASA 1N7SD 1H0TB 2K88A 4EI2A 2IBZI 1ZMEC 4BRYB 3BCCG 2FXMA 2QJKC 1OVRA 2AEJA 1PPJE 4W80A 2QJYB 1L4AA 3CMAP 1KILA 3L72J 4UB6E 1ZOYC 4K3AA 1JCDA 4U3FE 1EDJA 2C0XA 2BEZF 1JCCA 3WMM0 1PGQA 1S5LH 3L70J 2IBZG 2IZ1A 4H44B 1X0TA 1GTWA 4GKGA 2WVRA 2FYUD 2Q5UA 1NTZD 1FJPA 2OYIC 3CX5E 3M06A 1JY3O 4WB4A 3VP8A 4GOFA 5CCGC 3H1LJ 2JO1A 2R3SA 3P8CE 1T6AA 4LGDE 1EDIA 1BSHA 4OWFA 2R3CA 1EZVI 2E5TA 3G4SP 3B5ND 3BCCJ 4ASVA 2HODA 5CCHD 1SQQE 5APWA 1AV1A 4IFMA 2W27A 3WU2H 3S9OA 1ZR4A 1EZVG 1YIJP 1S5LE 1J1DB 1YQ4C 1L4AC 1KILC 2KZJA 1JO5A 4EOTA 4EDFA 2I1JA 1EC5A 2KYVA 3L36A 4O9BA 2W83C 4H0LB 3V2QA 3L74J 1URQD 4GT1A 1LWUA 3GF7A 5KAIH 3H1LD 4PV1B 4RKUJ 1RF0C 1OWAA 1U57A 3SSUA 3O8ZA 1BGYJ 4D6TE 4JPZB 2WPQA 1M56D 3RGUA 3BVHA 1OW8A 4HYTB 2FBWC 1N73C 3CWBJ 3SWYA 5C39A 3WU2E 2OTKE 1Q81Q 3CC2P 2NPSD 4LC1A 3MGNA 3AEEC 1DH3A 3A3YB 2DW3A 3EFFK 3RL0B 4WY4A 1IZNB 5KLVK 1DEBA 1R5LA 1CSBA 4L74A 2YKQA 3AEFC 3L71G 5KAIE 2AXCA 5KJ7D 3O6QA 3IF4A 5M1BA 1KQGB 2RMZA 3KPEA 4C7NA 5GTHH 4Y99C 1DEEG 4TLFA 2YNYA 3CC4P 3FGAD 3D6ZA 4DZOA 1M90Q 3C9IA 5B66H 1HGVA 3PP5A 1LWUC 2C0WA 1S5LX 2VRSA 1GL2C 3HD7A 1EZVD 3VMYA 3IR9A 1HJ0A 2LKMA 5AW5B 3TNUA 1G2CB 5KAFH 3VN0A 3Q2YA 3KDPB 4XFJA 3MIWA 4XE5B 3L75G 3L71J 2ZT9C 5KKZC 3VP9A 1SQVG 1SQXK 2K9JB 1VQ7P 2YO3A 5BU5A 2OARA 3TYYA 2KP8A 1AVOA 1M8OB 4WY4C 3F5HA 2WT7B 3AE7C 1RE3A 2E75C 1FOSF 1HGZA 5KLVD 5B66E 3L73G 4JF7A 1LP1B 3CCUP 1SFCA 1GK6A 1NVOA 4JYCA 1NGMB 4ZNCA 2E5YA 1SQBG 1W5CE 3A0BH 1NTKE 1IFPA 1KC8Q 1M1JB 2H8PD 4GOEA 1L0NE 4PV1D 2K3RA 1WT6A 3TK1A 5KAFE 3CXHI 2IPPA 3H1JE 2XZRA 4WWIA 2QEXP 1Q2NA 3L75J 3FXDA 1PP9D 1SQVJ 3L71D 3T97A 3II6A 2FYNC 1RHZB 3RK3C 1DD3A 1EQ7A 1JB0J 1W2BO 2KLUA 2QM8A 2G3AA 1LTBC 3CPWO 1ZRTE 2KSEA 4HKZH 1H8AA 3CMEP 4JBZA 1L0LK 2IX7C 3L73J 3M91A 4N78D 1S3JA 3HUSA 1BCCE 1KORA 3RL0D 1X9VA 4WBAA 4AUWA 2AXTH 3JC22 2XNDH 3A0BE 1KYOH 1JEKA 3H1HE 1JMBA 3H1IG 3H1KG 2YIUB 2PFXA 1NTMK 4BRYA 1RF1A 2KS1B 2WSCH 1SFCC 3AEGC 3HE5B 3CCLP 1S2EA 3AE5C 1SS1A 3HE4B 1SQVD 2R44A 4GIFA 2PAJA 1IFNA 5APUA 2KK7A 4ZKUA 1KTMA 1L0LE 2KNCB 3P8MC 2M3EA 2FFDA 2POHA 1PGPA 3L73D 1FJKA 5L8RJ 5GTIH 5AVQB 1VPCA 4RJTA 1T3UA 3MTUE 2KB7P 1SQBD 1JUNA 2K1AA 3N4XA 2AXTE 1NAFA 3PHLA 3B5NB 3LW5H 3H1IJ 3H1KJ 1NTME 3M0AA 1NU1K 3HUSC 2WSFH 4BWNA 3MP7B 3UIAA 3KQGA 1NHLA 4B86A 4RESB 3Q1MA 2WPSA 4OGQC 3TGUD 4I7ZB 3PLNA 2JWAA 4IOIH 1PPJG 3CXHD 1WRGA 3WUTA 1EXIA 2ZYDA 3CX5I 2LXCB 1RF1C 3V2RA 4IFFA 3RK2C 5CHXA 1YYCA 1NWQA 2GUVA 5DJTB 5TJHA 1ZR2A 1URQB 3PH0A 1PIXA 2O1JA 3AE3C 3B71A 1GL2D 4H44C 2N1TA 3H1KD 2FFDC 1DD4A 3W67A 5CMZA 5DJUB 1FDIA 3G6EP 4QMAA 2OYHB 2FYUJ 1SQPK 2CPSA 1HF9A 1P84H 3GHGA 2PGDA 1EDLA 2WSEJ 5CJ0A 4YPCA 2Z4EA 2A06E 1VQ5P 1FZCB 1KB9H 2IYOA 2JDIH 3B4SA 1N7LA 2QSIA 2E76B 2WTYA 1NU1D 1LT9B 2FYZA 3CCRP 4C46A 1G1IA 1JMMA 1SQQK 3E1IA 2P58A 3W68A 5AW7B 2KI7B 1K73Q 1BE3D 2QIWA 3RK3E 2ZVNB 3BATA 1NTZE 1HVVA 1T2KD 3L37A 2E74C 1OW7A 1VDFA 2YKOA 3BRTB 1YTZT 1BDCA 4Y28J 1SQPE 1YTZI 2N9YB 4H0LC 2BCCE 2R5DA 5AW2B 3MD0A 1P84E 5CJ4A 1EXJA 2RN0A 1IFIA 1PPJD 2N1TC 3CCQP 2W6BA 3E7KA 1KB9E 1AFOA 3A5TA 3L72E 2LR2A 2I8DA 1VQPP 1G2CA 1IFJA 4DT0A 1K04A 3Q5SA 2KXPB 1J2JB 2KZIA 3GHGC 3L70E 3P7KA 3ABVC 1ZP0C 1VQLP 1ZN5A 1KFMA 3CX5D 1RY3A 3SFEC 2D2CB 1MKMA 1VQ6P 1LTAC 2GUSA 3M0DA 1GU4A 2WT7A 2YKPA 2L91A 3H1LE 5AVRB 1XTGB 3WUVA 4DJGA 3BRVB 1LP1A 1NKZB 3BCCE 5AVUB 3MZWB 1MFTA 1SQQD 2OYOA 3I55P 1M57D 2JKVA 1DIPA 1FE6A 1M1JA 1CI6B 1GK4A 3MHVA 3PJSK 1CW5A 1YJWP 2B87B 1VQMP 1PGOA 2IBZE 4I1LA 3LIDA 1RQUA 2XKMA 5APTA 5AVTB 2J59M 4YXDC 3H25A 5KLVG 3AE9C 2ZFCA 4OVNF 2WZ7A 2GM4A 1KQLA 2IFNA 1YQ3C 1VL2A 2JJLA 3A2AA 4KJMA 3R4YA 3L74E 1IK7A 1QVFO 2M8RA 1AA0A 1X22A 2E76D 1BGYE 1N8RQ 1DX7A 5APVA 4D6TD 1VF5C 3SFDC 1PP9G 3M0DC 1N7SA 4U7JA 2MJZA 3CWBE 3MUDA 4NPDA 5APSA 1LNQA 1NO4A 1L4AB 2WSSH 1D7MA 1KILB 3HE5A 4TT3H 2G8YA 3HE4A 5KLVJ 2V7QJ 1H89A 2A45H 1M1JC 3H1JG 3AE4C 4PD4H 2P1JA 2QJPB 1ZV8A 1T8ZA 2OGUA 1JOCA 2RKLA 1LT1A 5AW4B 3EFGA 2XU6A 1NTKK 1SQXG 3I56P 2HLOA 1L0NK 2Z5IA 3RL0g 2KIKA 1JY2P 1HBWA 1N73B 5APQA 1PP9J 2BEQD 2HPCA 4JQ0D 2KSJA 2KLVA 2K37A 3GLMA 3B5NA 1R8EA 2I1KA 3D70A 2B88A 3AE2C 1JM0A 5CCHA 3PTZA 1LTJB 2WMMA 3M9BA 2D2CD 1PL5A 3A0HH 1YBKA 3RBZA 3B8EB 1ZXGA 1R5SA 3S1KA 1N7SC 3IN6A 2C9LY 4UB8H 3MUDC 4PD4E 1AVYA 1SQXJ 1Y8AA 3QH9A 3CCJP 4H13C 3R2PA 3G71P 5H2FE 1URQA 2O3JA 1KYOI 1LWUB 1ZW0A 3HD7C 1L0LG 3V6IA 1N2DC 1GL2B 1YI2P 2Q7CA 5CCGD 3TGUG 4JYBA 2Z5HA 1VQ8P 3KYQA 4GODA 3HTKB 3A0HE 3AEDC 1NTKD 2OYHA 2YO2A 1L0ND 3C1LA 3VMXA 1NTMG 2W6AA 3H1JD 4ZKPA 2ZT9B 5K5GB 3B5NC 2W8ZA 2NPSA 4UB8E 1SQBJ 3L75E 1K8AQ 1SQXD 4WY4B 4YXWH 1RE3C 2R32A 5KLIC 1H0TA 1K9MQ 3P32A 5BU8B 3N7NA 2E75B 1QX8A 4PJ0H 1H88A 2OQQA 2AEMA 5KJ7A 1L4AD 1KILD 2IYPA 1QEXA 3L73E 1WMKA 1BCCD 3TGUJ 1QLED 1J1EB 3FWLA 3HRNA 2WITA 5CBNA 2IZ0A 2H7HA 1URQC 5TISH 3M9HA 4L75A 1GDTA 4DOJA 3S4RA 1NU1G 4HB1A 2WWWA 1S9KE 2O01N 1LTIC 2WSCJ 3V4WA 5KTBA 3EWKA 2FYNB 3RK3B 1M1KQ 3V4QA 1BE3G 3TNUB 2KUBA 1OFCX 1E79H 2HYNA 2OYHC 1OXZA 1USEA 1MFZA 2R5BA 1NH4A 1L0LD 4PJ0E 5AW1B 3USSA 1NJIQ 2PP6A 2NPSC 2M0BA 2YMKA 3H32B 1FZAA 3CCVP 1FAVA 5APXA 3OAKA 3G9RA 2L5GB 4XA4A 5B5EE 1MV8A 3I5CA 1P84I 2QRXA 4OH8B 2QJYC 1KYOD 3D71A 3LW5J 5TISE 1G1JA 5KJ7C 3H1IE 1S4XA 3H1KE 1SFCB 3AE1C 1GW4A 1NU1J 1NTMD 4U3FG 1IFDA 3NTNA 3PRJA 1OMIA 3GG2A 1SQPG 1BE3J 2KOGA 2CPBA 4I6MC 3FWNA 2FYUK 1T3JA 2BCCG 1NTZK 3U1CA 2WSEH 2H89C 2QVAA 1VQOP 2P2UA 1YHQP 2NZ2A 3L72G 3T97B 2P10A 4N3YB 2FKWB 3JSVC 1N86A 2W90A 1Z56A 4C7RA 1OW6A 2ZT9D 1SQQG
chains in the Genus database with same CATH topology
2KUBA 2M5AB 3ZDMA 4ZMDA 4GOFA 4IOIH 2RKLA 1LT1A 2ZAEB 5C39A 2SPZA 2Q1KA 3MHVA 1Y47A 2OTKE 4GODA 2B87B 2LXCB 1JMBA 1U7MA 1EDIA 5EFWB 5CBOA 1BDCA 1EDKA 2KIKA 4HJGH 2KS1B 2M0BA 5DJTB 5K5GB 4ASVA 1OVVA 1SS1A 4EYYQ 3PH0A 2R44A 1LP1B 4NPFX 3FXEA 1NVOA 2B88A 2LXBA 1JM0A 4ZNCA 4KJMA 2QRXA 2LR2A 2I8DA 1H0TA 2WMMA 1OVUA 1U7JA 4GOEA 5DJUB 1DEEG 2K3RA 1ZXGA 2KZIA 4WWIA 1H0TB 3S1KA 2M5AA 1Q2NA 2KZJA 3FXDA 1OVRA 1EDLA 2UWJE 4CPGA 5CBNA 1EC5A 2QVAA 1FC2C 4ASWA 4NPDA 2B89A 4K3AA 1EDJA 4BXLA 3QWOC 2HR3A 4HKZH 4JBZA 2JWDA 4HB1A 1ZW0A 1LP1A 1BDDA 1X0TA 1S3JA 3MZWB 4MN4C 2P58A 4K35A 4NPEA 2KI7B 1MFTA 2B87A 3RGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUB A;  2M5A B;  3ZDM A;  4ZMD A;  4GOF A;  4IOI H;  2RKL A;  1LT1 A;  2ZAE B;  5C39 A;  2SPZ A;  2Q1K A;  3MHV A;  1Y47 A;  2OTK E;  4GOD A;  2B87 B;  2LXC B;  1JMB A;  1U7M A;  1EDI A;  5EFW B;  5CBO A;  1BDC A;  1EDK A;  2KIK A;  4HJG H;  2KS1 B;  2M0B A;  5DJT B;  5K5G B;  4ASV A;  1OVV A;  1SS1 A;  4EYY Q;  3PH0 A;  2R44 A;  1LP1 B;  4NPF X;  3FXE A;  1NVO A;  2B88 A;  2LXB A;  1JM0 A;  4ZNC A;  4KJM A;  2QRX A;  2LR2 A;  2I8D A;  1H0T A;  2WMM A;  1OVU A;  1U7J A;  4GOE A;  5DJU B;  1DEE G;  2K3R A;  1ZXG A;  2KZI A;  4WWI A;  1H0T B;  3S1K A;  2M5A A;  1Q2N A;  2KZJ A;  3FXD A;  1OVR A;  1EDL A;  2UWJ E;  4CPG A;  5CBN A;  1EC5 A;  2QVA A;  1FC2 C;  4ASW A;  4NPD A;  2B89 A;  4K3A A;  1EDJ A;  4BXL A;  3QWO C;  2HR3 A;  4HKZ H;  4JBZ A;  2JWD A;  4HB1 A;  1ZW0 A;  1LP1 A;  1BDD A;  1X0T A;  1S3J A;  3MZW B;  4MN4 C;  2P58 A;  4K35 A;  4NPE A;  2KI7 B;  1MFT A;  2B87 A;  3RGU A; 
#chains in the Genus database with same CATH topology
 3L70 G;  2M5A B;  3U1A A;  2E42 A;  2ZAE B;  3HUS B;  3K5B A;  4U3F J;  3Q5R A;  4WY4 D;  2YXQ B;  2Y0E A;  2GA1 A;  5AW9 B;  4HJG H;  2E75 D;  2NRG A;  1K05 A;  3WUU A;  1SQP J;  4OGQ B;  1JNM A;  1VQ4 P;  2FYU E;  3NMD A;  2JR8 A;  1J1D C;  1KZU B;  3CC7 P;  4KHX A;  1RF1 B;  2A06 D;  2O01 J;  3RK2 B;  3Q3D A;  2J58 A;  3CD6 P;  3CLQ A;  1X8Y A;  4H13 D;  1U7J A;  3ITK A;  2WPR A;  1JY3 P;  4PV1 C;  1UIX A;  1QL2 A;  3H6P A;  2QE7 H;  1RF0 A;  3HD7 D;  1SQQ J;  4D6T G;  3KHU A;  2ITA A;  2FFD B;  3RK3 D;  3G3Z A;  4U3F D;  1RE4 A;  5AVY B;  2IFM A;  5AVX B;  5AW8 B;  4BXL A;  3QWO C;  3CCS P;  2AEF A;  1N73 A;  3CL3 D;  1NAY A;  1SQP D;  3L74 G;  2Y9Y A;  3TSI A;  4DCK A;  3OW2 O;  2BCC D;  2K9J A;  1P84 D;  4NPE A;  1NKN A;  3RL0 C;  1BGY G;  1LTJ A;  1BSN A;  1AQT A;  1VQN P;  1YJ9 P;  1KB9 D;  3Q5P A;  2Y0D A;  3P8C D;  3L35 A;  3L72 D;  2QJK B;  1U7M A;  2ZVO B;  2P67 A;  3CWB G;  5CBO A;  1Q90 D;  3FX0 A;  1EDK A;  2Q3E A;  1SFC D;  3V5B A;  4D6T J;  3L70 D;  2FXO A;  1KQF B;  4LLH A;  1KQS O;  1FZB A;  2E74 B;  1Q82 Q;  3FXE A;  5AVZ B;  4IL6 X;  2OYI B;  2WQY C;  1PV3 A;  1GL2 A;  1SLQ A;  2QJP C;  1JY2 N;  2N1T B;  1OIP A;  1FZE A;  3BCC D;  1RE4 C;  3AEA C;  1GZL A;  1LTG C;  2UWJ E;  4CPG A;  4EIJ A;  3HTK A;  2H88 C;  2A45 I;  1SP4 A;  3GW6 A;  1KN7 A;  1VQ9 P;  1IK9 A;  1USD A;  3GHG B;  5AW6 B;  4PD4 I;  1FS0 E;  1UII A;  4M3L A;  1L2P A;  2IBZ D;  1HH0 A;  2JWD A;  3IFM A;  1LTJ C;  3TF5 A;  1JTH B;  2V7Q H;  4OGQ D;  3OJA B;  4L76 A;  4Z1M H;  2A45 G;  3VMZ A;  3ZDM A;  1EZV E;  2KS1 A;  3L74 D;  3RK2 D;  1NTK G;  1FDO A;  2ZXX A;  1L0N G;  1KV4 A;  2V4H A;  3KXD A;  2XNX A;  1BGY D;  1PFI A;  5AVW B;  2PRR A;  2KNC A;  1QGK B;  4NPF X;  2OTL P;  4H44 D;  3NFQ A;  3CWB D;  2QG4 A;  2P7J A;  5H2F H;  1YJN P;  1KMI Z;  1FDM A;  3OA7 A;  5KLV E;  2WPV B;  3CCM P;  2Q6Q A;  1BCC G;  2HOD B;  2ZYG A;  1AJY A;  1S72 P;  3F89 A;  1JY2 O;  1NTK J;  1QVG O;  1L0N J;  1LTS C;  3H1H G;  2HG5 D;  3H32 A;  3H1J J;  5GTH E;  1VF5 B;  3VMA A;  1GMJ A;  1BDD A;  3AE8 C;  1KFN A;  1RQV A;  2YIU C;  1PP9 E;  1FZG A;  2M3B A;  3L71 E;  4Y99 B;  3AE6 C;  4AYC A;  1SQV K;  2IDB A;  1LGH B;  2E74 D;  5AVS B;  3L4F A;  2RH0 A;  1T2K C;  4GDO A;  1HJB A;  2XDJ A;  3SWK A;  3AEC C;  5EFW B;  1FZF A;  1J1E C;  1Q7Y Q;  3CCE P;  2JP3 A;  4H0L D;  5E79 H;  1PZQ A;  2C9N Y;  4N78 E;  2MKV A;  1BCC J;  1TU3 F;  3KZI H;  4W7Z A;  2H43 A;  1HUC A;  1NOH A;  2N1T D;  1A02 F;  4R4M A;  4PD4 D;  1SQB K;  2LXB A;  1E5W A;  3H1H J;  1SQX E;  2B9B A;  3E1R A;  4W7Y A;  4KT0 J;  3A7O A;  5KKZ B;  2OTJ P;  1FZC A;  3C8V A;  4YTP C;  1SVF A;  5CCH C;  3GMA A;  2M5A A;  1KIL E;  1SQV E;  2FY8 A;  2N9B A;  5AW3 B;  4A7P A;  1LT9 A;  3CXH H;  4IFD K;  1L0L J;  1ZRT D;  4I7Z C;  1FOS E;  1N7S B;  1YIT P;  5E79 E;  2HR3 A;  1Y9B A;  3O6Q B;  2E43 A;  4C7N B;  1A02 J;  3GF3 A;  3KZI E;  2J5U A;  4K35 A;  2ZXE B;  1IFM A;  1SQB E;  3L75 D;  5B5E H;  4H13 B;  1IC2 A;  2ZYA A;  2K9Y A;  3H1H D;  2Q1K A;  2W6J H;  1NTM J;  1PGJ A;  3HD7 B;  5APY A;  1XTC C;  3U59 A;  1VQK P;  1GU5 A;  1KD1 Q;  5BVZ A;  3TDK A;  2CK3 H;  3VYI A;  1QL1 A;  3M9Q A;  4WVZ A;  3TGU E;  1X79 B;  2A06 G;  3CXH E;  3V2N A;  1NYH A;  1IO4 A;  2HPC B;  2ZJS E;  1AQ5 A;  1FZC C;  3CI9 A;  1KYO E;  4N6J A;  4AQR D;  1RH5 B;  1LTT C;  2QM7 A;  1W2E A;  2YXR B;  1FBM A;  1CZQ A;  1S9K D;  3D6Y A;  1VF5 D;  2E76 C;  2O1K A;  4I2L C;  1LT9 C;  5KLI B;  1FU1 A;  1IJD B;  1GD2 E;  1Q86 Q;  2FYU G;  2Q9I A;  1NTZ G;  1FC2 C;  3VOP A;  4ASW A;  1MZ9 A;  2FXP A;  3JCU H;  2XV5 A;  2B89 A;  4R4L A;  2YMY A;  1KB9 I;  2QA4 P;  3NXS A;  2WSF J;  2Y9Z A;  1JY3 N;  1LJ2 A;  1MUU A;  3SWF A;  3V2P A;  4IL6 H;  1OX3 A;  2JEE A;  1CI6 A;  2Y0C A;  4MN4 C;  1HTL C;  2B87 A;  3EQ2 A;  5AVV B;  5GTI E;  3VTP C;  3IAO A;  4RO0 A;  4ZMD A;  2OYI A;  4UB6 H;  2SPZ A;  1ZLL A;  1Y47 A;  5CCG A;  3H1I D;  1S1C X;  1NU1 E;  3RBX A;  3LIE A;  1OVV A;  2Q3I A;  4EYY Q;  1BE3 E;  2BAS A;  1NTZ J;  3AEB C;  3CX5 H;  4L73 A;  3JCU E;  1M7L A;  1GW3 A;  5AW0 B;  2O01 H;  1OVU A;  2NPS B;  1HWT C;  4HH2 A;  1OZH A;  2D2C C;  3H1L G;  2HFE D;  4IL6 E;  1JTH A;  2BCC J;  3BAS A;  1N7S D;  1H0T B;  2K88 A;  4EI2 A;  2IBZ I;  1ZME C;  4BRY B;  3BCC G;  2FXM A;  2QJK C;  1OVR A;  2AEJ A;  1PPJ E;  4W80 A;  2QJY B;  1L4A A;  3CMA P;  1KIL A;  3L72 J;  4UB6 E;  1ZOY C;  4K3A A;  1JCD A;  4U3F E;  1EDJ A;  2C0X A;  2BEZ F;  1JCC A;  3WMM 0;  1PGQ A;  1S5L H;  3L70 J;  2IBZ G;  2IZ1 A;  4H44 B;  1X0T A;  1GTW A;  4GKG A;  2WVR A;  2FYU D;  2Q5U A;  1NTZ D;  1FJP A;  2OYI C;  3CX5 E;  3M06 A;  1JY3 O;  4WB4 A;  3VP8 A;  4GOF A;  5CCG C;  3H1L J;  2JO1 A;  2R3S A;  3P8C E;  1T6A A;  4LGD E;  1EDI A;  1BSH A;  4OWF A;  2R3C A;  1EZV I;  2E5T A;  3G4S P;  3B5N D;  3BCC J;  4ASV A;  2HOD A;  5CCH D;  1SQQ E;  5APW A;  1AV1 A;  4IFM A;  2W27 A;  3WU2 H;  3S9O A;  1ZR4 A;  1EZV G;  1YIJ P;  1S5L E;  1J1D B;  1YQ4 C;  1L4A C;  1KIL C;  2KZJ A;  1JO5 A;  4EOT A;  4EDF A;  2I1J A;  1EC5 A;  2KYV A;  3L36 A;  4O9B A;  2W83 C;  4H0L B;  3V2Q A;  3L74 J;  1URQ D;  4GT1 A;  1LWU A;  3GF7 A;  5KAI H;  3H1L D;  4PV1 B;  4RKU J;  1RF0 C;  1OWA A;  1U57 A;  3SSU A;  3O8Z A;  1BGY J;  4D6T E;  4JPZ B;  2WPQ A;  1M56 D;  3RGU A;  3BVH A;  1OW8 A;  4HYT B;  2FBW C;  1N73 C;  3CWB J;  3SWY A;  5C39 A;  3WU2 E;  2OTK E;  1Q81 Q;  3CC2 P;  2NPS D;  4LC1 A;  3MGN A;  3AEE C;  1DH3 A;  3A3Y B;  2DW3 A;  3EFF K;  3RL0 B;  4WY4 A;  1IZN B;  5KLV K;  1DEB A;  1R5L A;  1CSB A;  4L74 A;  2YKQ A;  3AEF C;  3L71 G;  5KAI E;  2AXC A;  5KJ7 D;  3O6Q A;  3IF4 A;  5M1B A;  1KQG B;  2RMZ A;  3KPE A;  4C7N A;  5GTH H;  4Y99 C;  1DEE G;  4TLF A;  2YNY A;  3CC4 P;  3FGA D;  3D6Z A;  4DZO A;  1M90 Q;  3C9I A;  5B66 H;  1HGV A;  3PP5 A;  1LWU C;  2C0W A;  1S5L X;  2VRS A;  1GL2 C;  3HD7 A;  1EZV D;  3VMY A;  3IR9 A;  1HJ0 A;  2LKM A;  5AW5 B;  3TNU A;  1G2C B;  5KAF H;  3VN0 A;  3Q2Y A;  3KDP B;  4XFJ A;  3MIW A;  4XE5 B;  3L75 G;  3L71 J;  2ZT9 C;  5KKZ C;  3VP9 A;  1SQV G;  1SQX K;  2K9J B;  1VQ7 P;  2YO3 A;  5BU5 A;  2OAR A;  3TYY A;  2KP8 A;  1AVO A;  1M8O B;  4WY4 C;  3F5H A;  2WT7 B;  3AE7 C;  1RE3 A;  2E75 C;  1FOS F;  1HGZ A;  5KLV D;  5B66 E;  3L73 G;  4JF7 A;  1LP1 B;  3CCU P;  1SFC A;  1GK6 A;  1NVO A;  4JYC A;  1NGM B;  4ZNC A;  2E5Y A;  1SQB G;  1W5C E;  3A0B H;  1NTK E;  1IFP A;  1KC8 Q;  1M1J B;  2H8P D;  4GOE A;  1L0N E;  4PV1 D;  2K3R A;  1WT6 A;  3TK1 A;  5KAF E;  3CXH I;  2IPP A;  3H1J E;  2XZR A;  4WWI A;  2QEX P;  1Q2N A;  3L75 J;  3FXD A;  1PP9 D;  1SQV J;  3L71 D;  3T97 A;  3II6 A;  2FYN C;  1RHZ B;  3RK3 C;  1DD3 A;  1EQ7 A;  1JB0 J;  1W2B O;  2KLU A;  2QM8 A;  2G3A A;  1LTB C;  3CPW O;  1ZRT E;  2KSE A;  4HKZ H;  1H8A A;  3CME P;  4JBZ A;  1L0L K;  2IX7 C;  3L73 J;  3M91 A;  4N78 D;  1S3J A;  3HUS A;  1BCC E;  1KOR A;  3RL0 D;  1X9V A;  4WBA A;  4AUW A;  2AXT H;  3JC2 2;  2XND H;  3A0B E;  1KYO H;  1JEK A;  3H1H E;  1JMB A;  3H1I G;  3H1K G;  2YIU B;  2PFX A;  1NTM K;  4BRY A;  1RF1 A;  2KS1 B;  2WSC H;  1SFC C;  3AEG C;  3HE5 B;  3CCL P;  1S2E A;  3AE5 C;  1SS1 A;  3HE4 B;  1SQV D;  2R44 A;  4GIF A;  2PAJ A;  1IFN A;  5APU A;  2KK7 A;  4ZKU A;  1KTM A;  1L0L E;  2KNC B;  3P8M C;  2M3E A;  2FFD A;  2POH A;  1PGP A;  3L73 D;  1FJK A;  5L8R J;  5GTI H;  5AVQ B;  1VPC A;  4RJT A;  1T3U A;  3MTU E;  2KB7 P;  1SQB D;  1JUN A;  2K1A A;  3N4X A;  2AXT E;  1NAF A;  3PHL A;  3B5N B;  3LW5 H;  3H1I J;  3H1K J;  1NTM E;  3M0A A;  1NU1 K;  3HUS C;  2WSF H;  4BWN A;  3MP7 B;  3UIA A;  3KQG A;  1NHL A;  4B86 A;  4RES B;  3Q1M A;  2WPS A;  4OGQ C;  3TGU D;  4I7Z B;  3PLN A;  2JWA A;  4IOI H;  1PPJ G;  3CXH D;  1WRG A;  3WUT A;  1EXI A;  2ZYD A;  3CX5 I;  2LXC B;  1RF1 C;  3V2R A;  4IFF A;  3RK2 C;  5CHX A;  1YYC A;  1NWQ A;  2GUV A;  5DJT B;  5TJH A;  1ZR2 A;  1URQ B;  3PH0 A;  1PIX A;  2O1J A;  3AE3 C;  3B71 A;  1GL2 D;  4H44 C;  2N1T A;  3H1K D;  2FFD C;  1DD4 A;  3W67 A;  5CMZ A;  5DJU B;  1FDI A;  3G6E P;  4QMA A;  2OYH B;  2FYU J;  1SQP K;  2CPS A;  1HF9 A;  1P84 H;  3GHG A;  2PGD A;  1EDL A;  2WSE J;  5CJ0 A;  4YPC A;  2Z4E A;  2A06 E;  1VQ5 P;  1FZC B;  1KB9 H;  2IYO A;  2JDI H;  3B4S A;  1N7L A;  2QSI A;  2E76 B;  2WTY A;  1NU1 D;  1LT9 B;  2FYZ A;  3CCR P;  4C46 A;  1G1I A;  1JMM A;  1SQQ K;  3E1I A;  2P58 A;  3W68 A;  5AW7 B;  2KI7 B;  1K73 Q;  1BE3 D;  2QIW A;  3RK3 E;  2ZVN B;  3BAT A;  1NTZ E;  1HVV A;  1T2K D;  3L37 A;  2E74 C;  1OW7 A;  1VDF A;  2YKO A;  3BRT B;  1YTZ T;  1BDC A;  4Y28 J;  1SQP E;  1YTZ I;  2N9Y B;  4H0L C;  2BCC E;  2R5D A;  5AW2 B;  3MD0 A;  1P84 E;  5CJ4 A;  1EXJ A;  2RN0 A;  1IFI A;  1PPJ D;  2N1T C;  3CCQ P;  2W6B A;  3E7K A;  1KB9 E;  1AFO A;  3A5T A;  3L72 E;  2LR2 A;  2I8D A;  1VQP P;  1G2C A;  1IFJ A;  4DT0 A;  1K04 A;  3Q5S A;  2KXP B;  1J2J B;  2KZI A;  3GHG C;  3L70 E;  3P7K A;  3ABV C;  1ZP0 C;  1VQL P;  1ZN5 A;  1KFM A;  3CX5 D;  1RY3 A;  3SFE C;  2D2C B;  1MKM A;  1VQ6 P;  1LTA C;  2GUS A;  3M0D A;  1GU4 A;  2WT7 A;  2YKP A;  2L91 A;  3H1L E;  5AVR B;  1XTG B;  3WUV A;  4DJG A;  3BRV B;  1LP1 A;  1NKZ B;  3BCC E;  5AVU B;  3MZW B;  1MFT A;  1SQQ D;  2OYO A;  3I55 P;  1M57 D;  2JKV A;  1DIP A;  1FE6 A;  1M1J A;  1CI6 B;  1GK4 A;  3MHV A;  3PJS K;  1CW5 A;  1YJW P;  2B87 B;  1VQM P;  1PGO A;  2IBZ E;  4I1L A;  3LID A;  1RQU A;  2XKM A;  5APT A;  5AVT B;  2J59 M;  4YXD C;  3H25 A;  5KLV G;  3AE9 C;  2ZFC A;  4OVN F;  2WZ7 A;  2GM4 A;  1KQL A;  2IFN A;  1YQ3 C;  1VL2 A;  2JJL A;  3A2A A;  4KJM A;  3R4Y A;  3L74 E;  1IK7 A;  1QVF O;  2M8R A;  1AA0 A;  1X22 A;  2E76 D;  1BGY E;  1N8R Q;  1DX7 A;  5APV A;  4D6T D;  1VF5 C;  3SFD C;  1PP9 G;  3M0D C;  1N7S A;  4U7J A;  2MJZ A;  3CWB E;  3MUD A;  4NPD A;  5APS A;  1LNQ A;  1NO4 A;  1L4A B;  2WSS H;  1D7M A;  1KIL B;  3HE5 A;  4TT3 H;  2G8Y A;  3HE4 A;  5KLV J;  2V7Q J;  1H89 A;  2A45 H;  1M1J C;  3H1J G;  3AE4 C;  4PD4 H;  2P1J A;  2QJP B;  1ZV8 A;  1T8Z A;  2OGU A;  1JOC A;  2RKL A;  1LT1 A;  5AW4 B;  3EFG A;  2XU6 A;  1NTK K;  1SQX G;  3I56 P;  2HLO A;  1L0N K;  2Z5I A;  3RL0 g;  2KIK A;  1JY2 P;  1HBW A;  1N73 B;  5APQ A;  1PP9 J;  2BEQ D;  2HPC A;  4JQ0 D;  2KSJ A;  2KLV A;  2K37 A;  3GLM A;  3B5N A;  1R8E A;  2I1K A;  3D70 A;  2B88 A;  3AE2 C;  1JM0 A;  5CCH A;  3PTZ A;  1LTJ B;  2WMM A;  3M9B A;  2D2C D;  1PL5 A;  3A0H H;  1YBK A;  3RBZ A;  3B8E B;  1ZXG A;  1R5S A;  3S1K A;  1N7S C;  3IN6 A;  2C9L Y;  4UB8 H;  3MUD C;  4PD4 E;  1AVY A;  1SQX J;  1Y8A A;  3QH9 A;  3CCJ P;  4H13 C;  3R2P A;  3G71 P;  5H2F E;  1URQ A;  2O3J A;  1KYO I;  1LWU B;  1ZW0 A;  3HD7 C;  1L0L G;  3V6I A;  1N2D C;  1GL2 B;  1YI2 P;  2Q7C A;  5CCG D;  3TGU G;  4JYB A;  2Z5H A;  1VQ8 P;  3KYQ A;  4GOD A;  3HTK B;  3A0H E;  3AED C;  1NTK D;  2OYH A;  2YO2 A;  1L0N D;  3C1L A;  3VMX A;  1NTM G;  2W6A A;  3H1J D;  4ZKP A;  2ZT9 B;  5K5G B;  3B5N C;  2W8Z A;  2NPS A;  4UB8 E;  1SQB J;  3L75 E;  1K8A Q;  1SQX D;  4WY4 B;  4YXW H;  1RE3 C;  2R32 A;  5KLI C;  1H0T A;  1K9M Q;  3P32 A;  5BU8 B;  3N7N A;  2E75 B;  1QX8 A;  4PJ0 H;  1H88 A;  2OQQ A;  2AEM A;  5KJ7 A;  1L4A D;  1KIL D;  2IYP A;  1QEX A;  3L73 E;  1WMK A;  1BCC D;  3TGU J;  1QLE D;  1J1E B;  3FWL A;  3HRN A;  2WIT A;  5CBN A;  2IZ0 A;  2H7H A;  1URQ C;  5TIS H;  3M9H A;  4L75 A;  1GDT A;  4DOJ A;  3S4R A;  1NU1 G;  4HB1 A;  2WWW A;  1S9K E;  2O01 N;  1LTI C;  2WSC J;  3V4W A;  5KTB A;  3EWK A;  2FYN B;  3RK3 B;  1M1K Q;  3V4Q A;  1BE3 G;  3TNU B;  2KUB A;  1OFC X;  1E79 H;  2HYN A;  2OYH C;  1OXZ A;  1USE A;  1MFZ A;  2R5B A;  1NH4 A;  1L0L D;  4PJ0 E;  5AW1 B;  3USS A;  1NJI Q;  2PP6 A;  2NPS C;  2M0B A;  2YMK A;  3H32 B;  1FZA A;  3CCV P;  1FAV A;  5APX A;  3OAK A;  3G9R A;  2L5G B;  4XA4 A;  5B5E E;  1MV8 A;  3I5C A;  1P84 I;  2QRX A;  4OH8 B;  2QJY C;  1KYO D;  3D71 A;  3LW5 J;  5TIS E;  1G1J A;  5KJ7 C;  3H1I E;  1S4X A;  3H1K E;  1SFC B;  3AE1 C;  1GW4 A;  1NU1 J;  1NTM D;  4U3F G;  1IFD A;  3NTN A;  3PRJ A;  1OMI A;  3GG2 A;  1SQP G;  1BE3 J;  2KOG A;  2CPB A;  4I6M C;  3FWN A;  2FYU K;  1T3J A;  2BCC G;  1NTZ K;  3U1C A;  2WSE H;  2H89 C;  2QVA A;  1VQO P;  2P2U A;  1YHQ P;  2NZ2 A;  3L72 G;  3T97 B;  2P10 A;  4N3Y B;  2FKW B;  3JSV C;  1N86 A;  2W90 A;  1Z56 A;  4C7R A;  1OW6 A;  2ZT9 D;  1SQQ G; 
#chains in the Genus database with same CATH homology
 2KUB A;  2M5A B;  3ZDM A;  4ZMD A;  4GOF A;  4IOI H;  2RKL A;  1LT1 A;  2ZAE B;  5C39 A;  2SPZ A;  2Q1K A;  3MHV A;  1Y47 A;  2OTK E;  4GOD A;  2B87 B;  2LXC B;  1JMB A;  1U7M A;  1EDI A;  5EFW B;  5CBO A;  1BDC A;  1EDK A;  2KIK A;  4HJG H;  2KS1 B;  2M0B A;  5DJT B;  5K5G B;  4ASV A;  1OVV A;  1SS1 A;  4EYY Q;  3PH0 A;  2R44 A;  1LP1 B;  4NPF X;  3FXE A;  1NVO A;  2B88 A;  2LXB A;  1JM0 A;  4ZNC A;  4KJM A;  2QRX A;  2LR2 A;  2I8D A;  1H0T A;  2WMM A;  1OVU A;  1U7J A;  4GOE A;  5DJU B;  1DEE G;  2K3R A;  1ZXG A;  2KZI A;  4WWI A;  1H0T B;  3S1K A;  2M5A A;  1Q2N A;  2KZJ A;  3FXD A;  1OVR A;  1EDL A;  2UWJ E;  4CPG A;  5CBN A;  1EC5 A;  2QVA A;  1FC2 C;  4ASW A;  4NPD A;  2B89 A;  4K3A A;  1EDJ A;  4BXL A;  3QWO C;  2HR3 A;  4HKZ H;  4JBZ A;  2JWD A;  4HB1 A;  1ZW0 A;  1LP1 A;  1BDD A;  1X0T A;  1S3J A;  3MZW B;  4MN4 C;  2P58 A;  4K35 A;  4NPE A;  2KI7 B;  1MFT A;  2B87 A;  3RGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...