3L36A

Pie12 d-peptide against hiv entry
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l36A00
3M91A 2WTYA 1T2KD 2YO2A 3M0AA 2YO3A 5AW9B 3P7KA 1JNMA 2N9BA 3NXSA 5AW2B 4C7NA 2WT7B 3KDPB 1GU4A 2C9LY 2E42A 3B8EB 3A5TA 1H88A 2QM7A 4C7NB 4DZOA 5AVQB 5AVRB 2KP8A 1SP4A 3MD0A 3KQGA 5AW1B 2Z5IA 3HE5B 2XZRA 3OAKA 4JYBA 1S9KE 3L35A 2IPPA 2Q3IA 2Q5UA 2R5DA 1H8AA 4XE5B 1OWAA 2P2UA 5AVSB 4B86A 1HJBA 5AW3B 5AW6B 1H89A 2P7JA 4I6MC 3TNUA 3VYIA 3L36A 4GKGA 4I2LC 3O8ZA 1HBWA 4KHXA 4HYTB 5APVA 3TNUB 3VTPC 2JJLA 4AYCA 1A02F 1GTWA 2W6AA 1A02J 3V5BA 1X8YA 5APWA 2QM8A 5AVUB 1MV8A 1JUNA 2ZFCA 2WPRA 3VMZA 2XV5A 5APQA 2H7HA 1GD2E 3M0DA 4EOTA 4C46A 3TYYA 3UIAA 2BASA 4M3LA 1GZLA 1CI6A 2W27A 1G2CB 2YNYA 3SWFA 3NFQA 5APXA 3P8MC 1FOSF 3A2AA 1SLQA 2VRSA 3A3YB 5APSA 1OXZA 1HWTC 3NTNA 3HE4A 2XU6A 3P32A 3HTKA 3M9BA 5APTA 4AUWA 2P67A 1FAVA 5AVVB 1HUCA 1J2JB 1FOSE 4JYCA 2WWWA 5AVXB 1NAFA 5AVYB 2R3CA 4GT1A 1GK4A 3NMDA 4AQRD 3VMXA 3I5CA 4LC1A 5AW8B 3VN0A 3LIEA 5AW0B 2WT7A 1CSBA 2R32A 5AW7B 3IR9A 3A7OA 2Z5HA 1CI6B 5AVWB 1IO4A 2Q7CA 2WPQA 4RESB 3TK1A 5AVTB 2WPSA 5AVZB 2R5BA 1KQLA 3HE5A 2C9NY 3T97A 3MGNA 1MFZA 2ZXEB 5APUA 5AW4B 3HE4B 5CMZA 1T2KC 1YYCA 3V4QA 2E43A 3M06A 3V4WA 1NWQA 3M9HA 1MUUA 1S9KD 3LIDA 5AW5B 1DH3A 1GK6A 3VMYA 5APYA 3L37A 1CZQA 1GU5A
chains in the Genus database with same CATH superfamily
1QEXA 3AEDC 1T2KD 3CCEP 3CCSP 1VL2A 5KJ7D 3AEEC 5GTIE 3M0DC 1VQ7P 1KYOE 2WT7B 3KDPB 1GU4A 2C9LY 2FYUD 1NU1D 2QSIA 1PPJG 4DOJA 5KTBA 5KLVG 2V4HA 1OX3A 4L75A 3VYIA 2IYOA 4IL6X 3C9IA 3Q5PA 2B89A 1ZXGA 1SQPD 2A45H 2B88A 3GHGB 1N86A 1IFDA 1Q86Q 3BASA 3MP7B 4C46A 5KLVJ 1G2CB 1NTKD 3SWFA 3NFQA 3G71P 3RL0C 1JOCA 4N78D 3Q3DA 1SFCC 1BCCD 4JBZA 1YJWP 2O1KA 1OIPA 2Y0DA 2A45I 3GMAA 3II6A 3L70G 1Y8AA 1DIPA 4HKZH 2BEQD 1K8AQ 1FZGA 4TLFA 1PL5A 5DJUB 3TF5A 1E5WA 3H1IG 3H1HG 2KS1B 3L70E 2JR8A 4I7ZB 2B87A 3S1KA 1LP1B 4U3FG 4WWIA 1GL2D 2N1TA 3H1IE 3H1HE 5GTHH 2OARA 3KYQA 3JC22 1GW4A 3OW2O 5AVRB 1U7JA 2LR2A 3L70J 5AW1B 3C8VA 1YIJP 4U3FE 2FYUK 4K35A 1WT6A 2M5AA 3L35A 3GLMA 1NU1K 2Q3IA 1H8AA 1SQBD 3H1IJ 4EYYQ 3H1HJ 2FBWC 2M8RA 1ZMEC 3HUSB 5TISH 1Q90D 1KV4A 2WZ7A 2YKPA 3CI9A 5B5EH 1XTGB 3RL0D 1ZRTD 5CJ0A 1DX7A 1MZ9A 1SFCD 1SQPK 2R44A 1KB9E 1AA0A 1AVOA 1KMIZ 2ZT9B 2FFDB 3KZIE 4JPZB 1KILB 1NTKK 3V2QA 1SQXD 1J2JB 1L0NJ 1H0TB 2WSCJ 1M1JB 5EFWB 1NKNA 2QVAA 2FXPA 1LTAC 3AE8C 1P84D 3E7KA 3PLNA 4DT0A 2ZXEB 3V4QA 2IBZG 2G3AA 5KLIB 1Y47A 2WSEH 3GHGC 1IK9A 3HD7B 3CCJP 1KILE 2KLUA 2K88A 2CPSA 1YQ4C 2ZVNB 2IBZE 2OYIA 1KYOD 3O6QB 1TU3F 4Y99C 4JYBA 1EZVI 2IFNA 4W80A 3L75J 3AE9C 1FJPA 3LW5J 3HUSA 1J1EB 2FYNB 1PPJD 2Y0EA 1SQBK 5KLVD 5APVA 4UB8H 3H1LG 1A02F 1GTWA 3N4XA 2NRGA 5B66H 5AVUB 2AXTH 3OA7A 3CLQA 3H1LE 1CI6A 4NPEA 1FJKA 1LT1A 3P8MC 4I7ZC 2CK3H 1FOSF 1HWTC 1HH0A 1FDMA 4AUWA 1H0TA 2D2CD 2OYIC 3H1LJ 3VMXA 1SQXK 1T3UA 1Q81Q 1JY2N 1AJYA 2Z5HA 4EI2A 2OTJP 2WPQA 3HUSC 3MIWA 3T97A 3HE4B 3H32B 1RQUA 1QVGO 3L70D 1BDCA 2YXQB 5E79H 3M0AA 3V2RA 4CPGA 5AW9B 3H1ID 3NXSA 3H1HD 3R2PA 3H1JG 4D6TG 3AECC 3A5TA 5AVQB 2FFDC 2WSFJ 1KILC 3MD0A 1NTMJ 3B5NA 4GOFA 2IDBA 1JY3P 4WBAA 3G6EP 2K9JB 1NU1G 2OTLP 2JWAA 3H1JE 5AW3B 4D6TE 1H89A 1M1JC 1KORA 3B71A 1NU1E 1KD1Q 1BSNA 5KLVK 3A0HH 3H1JJ 4D6TJ 3ABVC 1PIXA 1OVRA 1NTZJ 1L0ND 1KB9D 2W27A 3RK2B 1S5LE 3CMAP 2ZYDA 4OWFA 3NTNA 2M0BA 3HTKA 1NTKG 2JP3A 2GUVA 1YTZI 5AVVB 1FOSE 1P84H 2KSJA 3ZDMA 2IZ1A 3RBXA 5AW8B 5AW0B 1NTKE 2JDIH 3IR9A 4YXDC 4N78E 2FYNC 1KC8Q 1VQOP 3N7NA 1MFZA 1VF5B 2O3JA 3SWKA 2WITA 1N7LA 3AEAC 1SQVG 1SQQG 2ZT9D 1KILD 2PGDA 4W7YA 2V7QJ 5GTIH 1YJ9P 1KYOH 1KFNA 1MFTA 5H2FH 1AQTA 1YI2P 4NPFX 1P84I 2IBZD 1RH5B 1SQQE 2JO1A 2OGUA 4HB1A 1LTJB 1VQNP 2KXPB 1YJNP 4O9BA 1RQVA 2O01N 1SQVJ 1SQBG 1SQQJ 1GMJA 1JMMA 2KK7A 1DEBA 4EIJA 3HD7D 1PZQA 3PTZA 1USEA 1KYOI 1K9MQ 2QM8A 2B9BA 1SQBE 1RE3C 2ZYGA 3Q2YA 3H1LD 4W7ZA 2QJPC 1L0NK 1FU1A 1X22A 3USSA 3OJAB 4R4MA 1NVOA 4GT1A 4EDFA 3W68A 3V6IA 2R32A 2LKMA 1YQ3C 1ZW0A 3M06A 5APYA 2OTKE 4HJGH 2KI7B 1M56D 1IC2A 3RK2C 1URQA 5L8RJ 3P8CE 1LTJA 1OWAA 3U1CA 2YXRB 2W8ZA 3H1JD 4D6TD 2HR3A 5K5GB 1NTZD 2B87B 1EDIA 1HBWA 1RE4A 3WUTA 2N1TB 4Z1MH 3V5BA 1EDKA 1KB9H 1PGJA 2BCCG 1VF5C 3PP5A 1XTCC 2M5AB 3FWLA 3KZIH 1PPJE 1VQLP 2GA1A 3A3YB 1K73Q 5KLVE 1EXIA 2BCCE 2Y0CA 5TJHA 1HUCA 2R3CA 3GG2A 3CWBG 4LC1A 3SFEC 3LIEA 1JCDA 1LTGC 1LTJC 2BCCJ 4K3AA 3G3ZA 4WY4A 5BU5A 1IFJA 2O01H 1KB9I 3CCLP 4Y99B 2QEXP 4WVZA 3CWBE 2H8PD 1MUUA 3RK2D 1J1DB 1NAYA 1CZQA 1NTMK 3CWBJ 4OVNF 3B8EB 2QM7A 1SQVD 4C7NB 2Z4EA 1SQQD 2Z5IA 1FZBA 3TSIA 1ZV8A 4OGQC 1ZR2A 1D7MA 5CCGA 2M3EA 4GDOA 1NYHA 3GW6A 1NGMB 4N6JA 2H43A 4HYTB 4L74A 1EXJA 1QL2A 3D70A 1NTZK 2OYIB 2IBZI 2W6AA 5APWA 3I55P 1S2EA 4ASVA 3C1LA 2XV5A 3CX5H 3K5BA 3AE4C 1X0TA 4H44B 2NZ2A 2YNYA 1X79B 1OW6A 1L0NG 5CCHA 1SS1A 1FAVA 1FZFA 2KNCA 3HRNA 1Y9BA 2K9YA 2FXOA 2FKWB 2KIKA 1KQSO 1VDFA 1L0NE 4PV1B 4IOIH 2E75B 1LT9A 1NO4A 3A7OA 1CI6B 1FZCB 5KKZB 5AVTB 3CX5I 1L0LJ 2N1TC 3IAOA 2RH0A 2E74B 1FDIA 3EQ2A 4ZKPA 1HVVA 1MKMA 1U57A 1VPCA 3CC7P 4C7NA 3EFFK 1BGYG 2CPBA 3L75G 3P8CD 4PJ0E 4RKUJ 3T97B 2HFED 1SQVK 2R5DA 1SQQK 3A0BE 1IFMA 1BGYE 3RL0g 3L75E 2WMMA 4WB4A 1ZP0C 2JEEA 2K37A 2Y9ZA 1G1JA 2XNXA 2QIWA 2IX7C 1NKZB 1USDA 1MV8A 1BGYJ 1S5LH 3B5NB 4IFFA 2RN0A 2E5YA 3CCQP 2Q3EA 1J1DC 3A2AA 1JY2P 1AFOA 2IYPA 1FE6A 1S72P 2BCCD 3P32A 4I1LA 1DEEG 2PP6A 2WWWA 1GK4A 1WMKA 1LTIC 3BRTB 4PD4E 3QWOC 1L4AB 2N1TD 2ZAEB 1FZCA 3L72J 1N73A 2KB7P 1S4XA 3L71J 1EQ7A 5GTHE 1VQMP 2WQYC 1AQ5A 4XA4A 3IFMA 3CWBD 1PGOA 1YYCA 2NPSA 2MJZA 2QG4A 3HTKB 2A06G 1HF9A 5AW5B 3V2NA 3VMYA 1BSHA 2QJYB 2HPCA 1G1IA 3KHUA 2YO3A 3E1IA 3P7KA 2A06E 1NTMG 3CXHE 4H44C 4JF7A 2E42A 1KQGB 1EDLA 4H13C 2XZRA 2Q5UA 1NTME 2I8DA 2QJPB 1T6AA 1KN7A 3SSUA 1E79H 2W90A 4I2LC 4PV1C 2E75C 3TNUB 1Z56A 2W6JH 4Y28J 1YTZT 3VMAA 3L74J 1FZCC 5KKZC 1NTZG 1DD4A 1N73C 1EZVG 3CCMP 4KJMA 3TDKA 3JCUE 5KAIE 5KAFE 3TYYA 2NPSC 4UB6E 1ZLLA 3H6PA 1QL1A 1NTZE 2E74C 1EZVE 2OYHA 2XKMA 3PRJA 1K04A 1HTLC 1RF1A 3I56P 5AVXB 1N8RQ 1L4AA 2XDJA 3I5CA 3MUDA 1M7LA 4BRYA 3FGAD 3KXDA 3TK1A 5AVZB 3HE5A 2C9NY 2GUSA 1NOHA 5AW4B 4LLHA 3V4WA 1NWQA 4H44D 2WSEJ 3L4FA 1KQFB 2WTYA 3B5NC 2L91A 4IFDK 2YIUB 1S5LX 3AE3C 4OH8B 3R4YA 1N7SA 3EWKA 4PV1D 2E75D 3OAKA 2OYHC 4C7RA 2IPPA 2Q6QA 4NPDA 1BGYD 2P7JA 3TNUA 3L36A 4GKGA 3L75D 2M3BA 1L4AC 3MUDC 1VQ8P 1JY3O 5KJ7A 1SQVE 1URQB 4H0LC 1RY3A 2E74D 2I1KA 3RK3B 3CC2P 5APQA 1VQ9P 4R4LA 1OW8A 3FXDA 1BCCJ 3D6YA 2QJYC 4YXWH 5CHXA 3G4SP 2IFMA 2J5UA 1OW7A 2C0XA 3JSVC 1ZN5A 1AVYA 5AVYB 1JTHB 2H88C 3CCUP 4MN4C 3D6ZA 1LTTC 1N7SC 4PD4D 4ZNCA 1OVUA 1L0LK 3BCCG 2O1JA 1UIIA 5E79E 5AVWB 3RK3E 2R5BA 3B5ND 3KPEA 2QRXA 4OGQB 1IJDB 1T2KC 1S9KD 2Q1KA 5KJ7C 4LGDE 1RF0A 3BCCE 2ITAA 1LWUA 3TGUG 4IFMA 2KUBA 3M91A 1VQ5P 2FY8A 2YMYA 3G9RA 1JNMA 2AEJA 2A06D 3CXHD 4WY4B 3TGUE 3BCCJ 3M9QA 2SPZA 3U1AA 2K1AA 1N2DC 1JEKA 1NTMD 4I6MC 2OQQA 3TGUJ 4YTPC 1EDJA 1GL2A 1LNQA 1IFIA 2W6BA 3WU2E 1BE3G 1PGPA 2ZXXA 5APXA 1RF0C 1SLQA 1EZVD 1BE3E 2ZYAA 1GW3A 2YIUC 1Q2NA 1JTHA 4JYCA 1NJIQ 2WSCH 3IN6A 3NMDA 1QGKB 1EC5A 1SFCA 3GF7A 3AE2C 4IL6E 2L5GB 1BE3J 2FXMA 3CMEP 1M90Q 5H2FE 4TT3H 2WPSA 1CW5A 5APUA 2P1JA 1GL2C 1FDOA 1URQC 2KNCB 1JO5A 3RK3C 2D2CB 4L73A 1VQ4P 1LT9B 4PJ0H 2KLVA 1W2EA 1IK7A 3A0BH 1OVVA 2UWJE 1RE4C 2YKOA 1IZNB 3ITKA 2E5TA 3LW5H 5BU8B 1LTBC 3CPWO 2R3SA 2QA4P 2KSEA 2KYVA 2HODA 1OFCX 1LTSC 1X8YA 2WPRA 3VMZA 4EOTA 1K05A 4KT0J 2HYNA 3CCRP 4A7PA 3MZWB 1VF5D 2DW3A 2WPVB 2XU6A 3M9BA 2ZVOB 4WY4C 4PD4H 4GIFA 2PRRA 1M57D 1FBMA 2E76B 2J59M 2WT7A 1URQD 5AW7B 3F89A 1AV1A 1L0LG 3AE1C 3RK3D 4JQ0D 3SFDC 4H13B 2LXCB 2FYZA 2P58A 1L0LE 3BCCD 3BRVB 3CXHH 2YO2A 2Y9YA 4PD4I 3GHGA 4DCKA 5CCGC 1JCCA 4U3FJ 1H88A 2G8YA 1N73B 3TGUD 2KP8A 2WSFH 3KQGA 2NPSB 1G2CA 2P2UA 1FZAA 2WVRA 4GOEA 1IFNA 3V2PA 2A45G 2HPCB 3BVHA 4OGQD 3O8ZA 4KHXA 1T3JA 2YKQA 3VTPC 3L73G 2XNDH 3CXHI 1NHLA 3JCUH 1W2BO 5C39A 5KAIH 5KAFH 5CCHC 4UB6H 2BEZF 1GD2E 4WY4D 2I1JA 2BASA 1GZLA 3MTUE 3L73E 1QX8A 2RKLA 2D2CC 4GODA 3SWYA 1BE3D 1LT9C 2KS1A 2QE7H 2WSSH 1QLED 3L72G 3L73J 1LP1A 1YITP 1PFIA 1GDTA 3L71G 2O01J 2HLOA 3GF3A 2H89C 3L72E 2OYHB 2QJKB 2AXCA 1HGZA 3L71E 1KFMA 5DJTB 5CCGD 1RF1B 1GK6A 3CL3D 1IFPA 2N9YB 1T8ZA 2V7QH 1U7MA 2RMZA 2OYOA 5BVZA 4BRYB 4H0LB 4ASWA 1SP4A 3AEBC 3HE5B 1S9KE 4XE5B 1PP9G 3PJSK 5AW6B 2KZJA 3CX5E 2JWDA 2FFDA 1JMBA 3L74G 1KILA 5CCHD 2E76C 1DD3A 2J58A 2JJLA 4AYCA 2YMKA 4ZKUA 5TISE 1PP9E 2GM4A 3H1KG 1M1JA 3AEGC 3FXEA 3L74E 4ZMDA 5B5EE 1JUNA 2ZFCA 1N7SB 1KTMA 3UIAA 1M8OB 4QMAA 5CJ4A 3H1KE 1SVFA 1PP9J 2AEFA 1OXZA 5APTA 3BATA 2JKVA 3HD7A 1JY2O 2PFXA 3H1KJ 3RBZA 1S3JA 2POHA 1HJ0A 1CSBA 3WMM0 3H25A 1JM0A 5CBOA 1IO4A 3O6QA 1FC2C 2ZT9C 2HG5D 2E43A 3AE5C 4U3FD 2FYUG 1DH3A 1Q82Q 1L0LD 3L37A 5CBNA 4U7JA 3Q5SA 3PHLA 3CCVP 1M1KQ 2N9BA 5AW2B 2FYUE 1NH4A 1RHZB 4DZOA 2K3RA 1KZUB 1R5LA 2E76D 4BXLA 4YPCA 1VQ6P 1OZHA 1SQPG 5KLIC 5AVSB 1HGVA 3HD7C 1LWUB 2P10A 4H13D 2FYUJ 1NU1J 3WUVA 1SQPE 3WU2H 3FWNA 1ZOYC 1A02J 4UB8E 1JY3N 1L2PA 2C0WA 2QJKC 1BCCG 4RO0A 5B66E 2AXTE 1RF1C 1PGQA 3L73D 1W5CE 1J1EC 1SQPJ 2VRSA 5APSA 3VP8A 2Q9IA 3HE4A 1BCCE 1RE3A 2NPSD 3H32A 2IZ0A 1GL2B 2W83C 3W67A 4DJGA 3IF4A 2ZJSE 1NAFA 2LXBA 1NTKJ 1R8EA 3AEFC 4AQRD 4IL6H 3VN0A 4XFJA 4L76A 3S9OA 1VQKP 2Q7CA 1YBKA 1FZEA 5M1BA 3L72D 3MGNA 1LGHB 1PV3A 3M9HA 2K9JA 4HH2A 3RGUA 1BDDA 3L71D 3PH0A 3WUUA 1GU5A 3RL0B 3E1RA 1SFCB 2KZIA 3VOPA 4BWNA 3FX0A 1R5SA 3AE7C 2AEMA 3Q1MA 3EFGA 3B4SA 4B86A 1HJBA 1LJ2A 3CX5D 3U59A 1UIXA 2MKVA 1PP9D 1VQPP 3D71A 3CC4P 1SQBJ 1ZRTE 1L4AD 3L74D 2H7HA 3A0HE 3M0DA 3VP9A 1OMIA 3S4RA 1SQXG 4M3LA 4H0LD 1WRGA 3H1KD 3F5HA 3QH9A 2KOGA 3MHVA 2P67A 1SQXE 2HODB 1S1CX 1X9VA 3AE6C 1P84E 4N3YB 1Q7YQ 2PAJA 1QVFO 1LWUC 4RESB 1SQXJ 1N7SD 1YHQP 1KQLA 3Q5RA 4RJTA 5CMZA 3CD6P 3LIDA 1FS0E 1ZR4A 1JB0J
chains in the Genus database with same CATH topology
1T2KD 1KFNA 1G1IA 2YO2A 2YO3A 5KJ7D 3E1IA 3P7KA 3M0DC 3GHGA 4JF7A 2WT7B 3KDPB 1GU4A 2C9LY 2E42A 5CCGC 1JCCA 1H88A 1N73B 2KP8A 2WSFH 4DOJA 5KTBA 3KQGA 2XZRA 2NPSB 1LTJB 2Q5UA 1G2CA 2P2UA 1FZAA 4O9BA 3V2PA 1IFNA 2A45G 3VYIA 2HPCB 4I2LC 3BVHA 3O8ZA 4KHXA 3TNUB 1T3JA 2YKQA 1Z56A 1JMMA 3C9IA 3VTPC 1DEBA 4EIJA 1YTZT 3HD7D 2A45H 1FZCC 3GHGB 1N86A 1IFDA 1N73C 1NHLA 3BASA 2QM8A 5CCHC 1GD2E 1RE3C 4C46A 3TYYA 4WY4D 2I1JA 2BASA 2NPSC 1GZLA 3MTUE 1G2CB 1ZLLA 3H6PA 3SWFA 3NFQA 4W7ZA 1QL1A 3RL0C 1L0NK 1JOCA 2OYHA 4N78D 2XKMA 1FU1A 3SWYA 1SFCC 1LT9C 3OJAB 1HTLC 1RF1A 5AVXB 4GT1A 2O1KA 1L4AA 2XDJA 3I5CA 3MUDA 1M7LA 2A45I 2R32A 1GDTA 1PFIA 3II6A 3TK1A 2HLOA 2LKMA 5AVZB 1FZGA 3HE5A 2C9NY 2OYHB 2GUSA 1NOHA 5AW4B 4LLHA 1E5WA 1HGZA 3M06A 3V4WA 1NWQA 3L4FA 1KFMA 5CCGD 1RF1B 1GK6A 5APYA 3CL3D 1T8ZA 2WTYA 3B5NC 4IFDK 1GL2D 2N1TA 1IC2A 3RK2C 1URQA 2OARA 3KYQA 5BVZA 1GW4A 5AVRB 3P8CE 4OH8B 1SP4A 1N7SA 5AW1B 1LTJA 3HE5B 3OAKA 1S9KE 2OYHC 2FYUK 4C7RA 1WT6A 3L35A 2IPPA 1NU1K 2Q3IA 1H8AA 4XE5B 1OWAA 3U1CA 5AW6B 2FFDA 2M8RA 2P7JA 3TNUA 1KILA 3HUSB 3L36A 4GKGA 5CCHD 2M3BA 2J58A 1L4AC 1HBWA 1RE4A 2WZ7A 2JJLA 4AYCA 1JY3O 2YKPA 4ZKUA 2N1TB 5KJ7A 3CI9A 2GM4A 1URQB 1XTGB 1M1JA 1RY3A 2I1KA 3RL0D 3V5BA 3RK3B 1JUNA 5CJ0A 2ZFCA 1MZ9A 1N7SB 1DX7A 1SFCD 1SQPK 5APQA 3PP5A 1XTCC 3UIAA 5CJ4A 1SVFA 3A3YB 2FFDB 1OXZA 1KILB 5CHXA 2IFMA 1NTKK 5APTA 3BATA 2C0XA 3V2QA 3HD7A 1ZN5A 1HUCA 1J2JB 5AVYB 1JTHB 2R3CA 1M1JB 1NKNA 1LTTC 1JY2O 1LTAC 1N7SC 4LC1A 3LIEA 1JCDA 1LTGC 1LTJC 2POHA 1CSBA 3G3ZA 4WY4A 5BU5A 1IFJA 1L0LK 3WMM0 2O01H 2O1JA 5AVWB 1IO4A 4Y99B 2R5BA 3B5ND 3KPEA 2ZXEB 2HG5D 1IJDB 1T2KC 3V4QA 2H8PD 2E43A 1MUUA 3RK2D 2WSEH 1S9KD 1J1DB 3GHGC 1IK9A 4LGDE 1RF0A 5KJ7C 3HD7B 1DH3A 1LWUA 4IFMA 3L37A 1CZQA 2CPSA 3M91A 1NTMK 2YMYA 1JNMA 2N9BA 5AW2B 2OYIA 1NH4A 4WY4B 3B8EB 2QM7A 4C7NB 4DZOA 2Z4EA 1KZUB 4Y99C 2Z5IA 3M9QA 1FZBA 4JYBA 3TSIA 2IFNA 4W80A 1ZV8A 3U1AA 1ZR2A 5AVSB 1N2DC 1HGVA 1FJPA 3HUSA 3HD7C 5CCGA 1J1EB 1LWUB 4I6MC 1SQBK 4N6JA 2H43A 4HYTB 5APVA 1GL2A 1QL2A 1A02F 1IFIA 1GTWA 1NTZK 2W6BA 2OYIB 3N4XA 2W6AA 1A02J 5APWA 1JY3N 5AVUB 2C0WA 2XV5A 3OA7A 3CLQA 1CI6A 1RF1C 2YNYA 1X79B 1FJKA 5APXA 1RF0C 3P8MC 1FOSF 1J1EC 1SLQA 2VRSA 5APSA 3VP8A 2Q9IA 1HWTC 5CCHA 3HE4A 1GW3A 1HH0A 1RE3A 2NPSD 3H32A 1GL2B 4AUWA 1FDMA 1FAVA 1JTHA 1FZFA 3HRNA 4JYCA 2OYIC 1NAFA 2FKWB 2WSCH 3NMDA 4AQRD 1VDFA 3VMXA 3VN0A 1SQXK 1SFCA 1LT9A 1T3UA 1NO4A 2L5GB 2FXMA 3A7OA 1JY2N 2Z5HA 1CI6B 1FZCB 2Q7CA 2WPQA 5AVTB 2WPSA 1CW5A 3HUSC 1FZEA 3MIWA 3T97A 3MGNA 5APUA 3HE4B 1LGHB 2N1TC 3H32B 3M9HA 4HH2A 2P1JA 1GL2C 1URQC 1JO5A 3RK3C 1GU5A 3RL0B 3M0AA 3EQ2A 4ZKPA 3V2RA 1SFCB 5AW9B 1HVVA 1LT9B 1VPCA 3VOPA 3NXSA 4C7NA 3R2PA 3A5TA 2KLVA 5AVQB 2CPBA 2FFDC 1W2EA 1KILC 3MD0A 3EFGA 3P8CD 3B5NA 1JY3P 1RE4C 4WBAA 2HFED 2YKOA 1SQVK 2R5DA 1SQQK 4B86A 1HJBA 3LW5H 5AW3B 5BU8B 1LTBC 1IFMA 1H89A 1M1JC 3U59A 4WB4A 2JEEA 2KYVA 2HODA 1G1JA 2XNXA 1LTSC 2IX7C 5KLVK 1X8YA 1NKZB 1L4AD 1MV8A 2WPRA 3VMZA 3B5NB 4IFFA 2H7HA 3M0DA 3VP9A 4EOTA 1J1DC 4M3LA 2W27A 1WRGA 3RK2B 2HYNA 3A2AA 1JY2P 1AFOA 3NTNA 2XU6A 3P32A 2KOGA 4I1LA 3HTKA 3M9BA 2P67A 4WY4C 2GUVA 2PP6A 1YTZI 5AVVB 2HODB 1FOSE 2WWWA 2KSJA 4GIFA 1GK4A 1FBMA 1LTIC 1X9VA 3BRTB 2J59M 5AW8B 1L4AB 2N1TD 4N3YB 5AW0B 2WT7A 1FZCA 1URQD 5AW7B 2PAJA 3IR9A 1N73A 1LWUC 4RESB 3RK3D 4N78E 2KB7P 1N7SD 3N7NA 1KQLA 1EQ7A 1MFZA 1AQ5A 4XA4A 3IFMA 5CMZA 1YYCA 2NPSA 2MJZA 3HTKB 2FYZA 2WITA 1N7LA 3LIDA 5AW5B 3BRVB 3V2NA 3VMYA 1KILD 1ZR4A 2HPCA 4W7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M91 A;  2WTY A;  1T2K D;  2YO2 A;  3M0A A;  2YO3 A;  5AW9 B;  3P7K A;  1JNM A;  2N9B A;  3NXS A;  5AW2 B;  4C7N A;  2WT7 B;  3KDP B;  1GU4 A;  2C9L Y;  2E42 A;  3B8E B;  3A5T A;  1H88 A;  2QM7 A;  4C7N B;  4DZO A;  5AVQ B;  5AVR B;  2KP8 A;  1SP4 A;  3MD0 A;  3KQG A;  5AW1 B;  2Z5I A;  3HE5 B;  2XZR A;  3OAK A;  4JYB A;  1S9K E;  3L35 A;  2IPP A;  2Q3I A;  2Q5U A;  2R5D A;  1H8A A;  4XE5 B;  1OWA A;  2P2U A;  5AVS B;  4B86 A;  1HJB A;  5AW3 B;  5AW6 B;  1H89 A;  2P7J A;  4I6M C;  3TNU A;  3VYI A;  3L36 A;  4GKG A;  4I2L C;  3O8Z A;  1HBW A;  4KHX A;  4HYT B;  5APV A;  3TNU B;  3VTP C;  2JJL A;  4AYC A;  1A02 F;  1GTW A;  2W6A A;  1A02 J;  3V5B A;  1X8Y A;  5APW A;  2QM8 A;  5AVU B;  1MV8 A;  1JUN A;  2ZFC A;  2WPR A;  3VMZ A;  2XV5 A;  5APQ A;  2H7H A;  1GD2 E;  3M0D A;  4EOT A;  4C46 A;  3TYY A;  3UIA A;  2BAS A;  4M3L A;  1GZL A;  1CI6 A;  2W27 A;  1G2C B;  2YNY A;  3SWF A;  3NFQ A;  5APX A;  3P8M C;  1FOS F;  3A2A A;  1SLQ A;  2VRS A;  3A3Y B;  5APS A;  1OXZ A;  1HWT C;  3NTN A;  3HE4 A;  2XU6 A;  3P32 A;  3HTK A;  3M9B A;  5APT A;  4AUW A;  2P67 A;  1FAV A;  5AVV B;  1HUC A;  1J2J B;  1FOS E;  4JYC A;  2WWW A;  5AVX B;  1NAF A;  5AVY B;  2R3C A;  4GT1 A;  1GK4 A;  3NMD A;  4AQR D;  3VMX A;  3I5C A;  4LC1 A;  5AW8 B;  3VN0 A;  3LIE A;  5AW0 B;  2WT7 A;  1CSB A;  2R32 A;  5AW7 B;  3IR9 A;  3A7O A;  2Z5H A;  1CI6 B;  5AVW B;  1IO4 A;  2Q7C A;  2WPQ A;  4RES B;  3TK1 A;  5AVT B;  2WPS A;  5AVZ B;  2R5B A;  1KQL A;  3HE5 A;  2C9N Y;  3T97 A;  3MGN A;  1MFZ A;  2ZXE B;  5APU A;  5AW4 B;  3HE4 B;  5CMZ A;  1T2K C;  1YYC A;  3V4Q A;  2E43 A;  3M06 A;  3V4W A;  1NWQ A;  3M9H A;  1MUU A;  1S9K D;  3LID A;  5AW5 B;  1DH3 A;  1GK6 A;  3VMY A;  5APY A;  3L37 A;  1CZQ A;  1GU5 A; 
#chains in the Genus database with same CATH topology
 1QEX A;  3AED C;  1T2K D;  3CCE P;  3CCS P;  1VL2 A;  5KJ7 D;  3AEE C;  5GTI E;  3M0D C;  1VQ7 P;  1KYO E;  2WT7 B;  3KDP B;  1GU4 A;  2C9L Y;  2FYU D;  1NU1 D;  2QSI A;  1PPJ G;  4DOJ A;  5KTB A;  5KLV G;  2V4H A;  1OX3 A;  4L75 A;  3VYI A;  2IYO A;  4IL6 X;  3C9I A;  3Q5P A;  2B89 A;  1ZXG A;  1SQP D;  2A45 H;  2B88 A;  3GHG B;  1N86 A;  1IFD A;  1Q86 Q;  3BAS A;  3MP7 B;  4C46 A;  5KLV J;  1G2C B;  1NTK D;  3SWF A;  3NFQ A;  3G71 P;  3RL0 C;  1JOC A;  4N78 D;  3Q3D A;  1SFC C;  1BCC D;  4JBZ A;  1YJW P;  2O1K A;  1OIP A;  2Y0D A;  2A45 I;  3GMA A;  3II6 A;  3L70 G;  1Y8A A;  1DIP A;  4HKZ H;  2BEQ D;  1K8A Q;  1FZG A;  4TLF A;  1PL5 A;  5DJU B;  3TF5 A;  1E5W A;  3H1I G;  3H1H G;  2KS1 B;  3L70 E;  2JR8 A;  4I7Z B;  2B87 A;  3S1K A;  1LP1 B;  4U3F G;  4WWI A;  1GL2 D;  2N1T A;  3H1I E;  3H1H E;  5GTH H;  2OAR A;  3KYQ A;  3JC2 2;  1GW4 A;  3OW2 O;  5AVR B;  1U7J A;  2LR2 A;  3L70 J;  5AW1 B;  3C8V A;  1YIJ P;  4U3F E;  2FYU K;  4K35 A;  1WT6 A;  2M5A A;  3L35 A;  3GLM A;  1NU1 K;  2Q3I A;  1H8A A;  1SQB D;  3H1I J;  4EYY Q;  3H1H J;  2FBW C;  2M8R A;  1ZME C;  3HUS B;  5TIS H;  1Q90 D;  1KV4 A;  2WZ7 A;  2YKP A;  3CI9 A;  5B5E H;  1XTG B;  3RL0 D;  1ZRT D;  5CJ0 A;  1DX7 A;  1MZ9 A;  1SFC D;  1SQP K;  2R44 A;  1KB9 E;  1AA0 A;  1AVO A;  1KMI Z;  2ZT9 B;  2FFD B;  3KZI E;  4JPZ B;  1KIL B;  1NTK K;  3V2Q A;  1SQX D;  1J2J B;  1L0N J;  1H0T B;  2WSC J;  1M1J B;  5EFW B;  1NKN A;  2QVA A;  2FXP A;  1LTA C;  3AE8 C;  1P84 D;  3E7K A;  3PLN A;  4DT0 A;  2ZXE B;  3V4Q A;  2IBZ G;  2G3A A;  5KLI B;  1Y47 A;  2WSE H;  3GHG C;  1IK9 A;  3HD7 B;  3CCJ P;  1KIL E;  2KLU A;  2K88 A;  2CPS A;  1YQ4 C;  2ZVN B;  2IBZ E;  2OYI A;  1KYO D;  3O6Q B;  1TU3 F;  4Y99 C;  4JYB A;  1EZV I;  2IFN A;  4W80 A;  3L75 J;  3AE9 C;  1FJP A;  3LW5 J;  3HUS A;  1J1E B;  2FYN B;  1PPJ D;  2Y0E A;  1SQB K;  5KLV D;  5APV A;  4UB8 H;  3H1L G;  1A02 F;  1GTW A;  3N4X A;  2NRG A;  5B66 H;  5AVU B;  2AXT H;  3OA7 A;  3CLQ A;  3H1L E;  1CI6 A;  4NPE A;  1FJK A;  1LT1 A;  3P8M C;  4I7Z C;  2CK3 H;  1FOS F;  1HWT C;  1HH0 A;  1FDM A;  4AUW A;  1H0T A;  2D2C D;  2OYI C;  3H1L J;  3VMX A;  1SQX K;  1T3U A;  1Q81 Q;  1JY2 N;  1AJY A;  2Z5H A;  4EI2 A;  2OTJ P;  2WPQ A;  3HUS C;  3MIW A;  3T97 A;  3HE4 B;  3H32 B;  1RQU A;  1QVG O;  3L70 D;  1BDC A;  2YXQ B;  5E79 H;  3M0A A;  3V2R A;  4CPG A;  5AW9 B;  3H1I D;  3NXS A;  3H1H D;  3R2P A;  3H1J G;  4D6T G;  3AEC C;  3A5T A;  5AVQ B;  2FFD C;  2WSF J;  1KIL C;  3MD0 A;  1NTM J;  3B5N A;  4GOF A;  2IDB A;  1JY3 P;  4WBA A;  3G6E P;  2K9J B;  1NU1 G;  2OTL P;  2JWA A;  3H1J E;  5AW3 B;  4D6T E;  1H89 A;  1M1J C;  1KOR A;  3B71 A;  1NU1 E;  1KD1 Q;  1BSN A;  5KLV K;  3A0H H;  3H1J J;  4D6T J;  3ABV C;  1PIX A;  1OVR A;  1NTZ J;  1L0N D;  1KB9 D;  2W27 A;  3RK2 B;  1S5L E;  3CMA P;  2ZYD A;  4OWF A;  3NTN A;  2M0B A;  3HTK A;  1NTK G;  2JP3 A;  2GUV A;  1YTZ I;  5AVV B;  1FOS E;  1P84 H;  2KSJ A;  3ZDM A;  2IZ1 A;  3RBX A;  5AW8 B;  5AW0 B;  1NTK E;  2JDI H;  3IR9 A;  4YXD C;  4N78 E;  2FYN C;  1KC8 Q;  1VQO P;  3N7N A;  1MFZ A;  1VF5 B;  2O3J A;  3SWK A;  2WIT A;  1N7L A;  3AEA C;  1SQV G;  1SQQ G;  2ZT9 D;  1KIL D;  2PGD A;  4W7Y A;  2V7Q J;  5GTI H;  1YJ9 P;  1KYO H;  1KFN A;  1MFT A;  5H2F H;  1AQT A;  1YI2 P;  4NPF X;  1P84 I;  2IBZ D;  1RH5 B;  1SQQ E;  2JO1 A;  2OGU A;  4HB1 A;  1LTJ B;  1VQN P;  2KXP B;  1YJN P;  4O9B A;  1RQV A;  2O01 N;  1SQV J;  1SQB G;  1SQQ J;  1GMJ A;  1JMM A;  2KK7 A;  1DEB A;  4EIJ A;  3HD7 D;  1PZQ A;  3PTZ A;  1USE A;  1KYO I;  1K9M Q;  2QM8 A;  2B9B A;  1SQB E;  1RE3 C;  2ZYG A;  3Q2Y A;  3H1L D;  4W7Z A;  2QJP C;  1L0N K;  1FU1 A;  1X22 A;  3USS A;  3OJA B;  4R4M A;  1NVO A;  4GT1 A;  4EDF A;  3W68 A;  3V6I A;  2R32 A;  2LKM A;  1YQ3 C;  1ZW0 A;  3M06 A;  5APY A;  2OTK E;  4HJG H;  2KI7 B;  1M56 D;  1IC2 A;  3RK2 C;  1URQ A;  5L8R J;  3P8C E;  1LTJ A;  1OWA A;  3U1C A;  2YXR B;  2W8Z A;  3H1J D;  4D6T D;  2HR3 A;  5K5G B;  1NTZ D;  2B87 B;  1EDI A;  1HBW A;  1RE4 A;  3WUT A;  2N1T B;  4Z1M H;  3V5B A;  1EDK A;  1KB9 H;  1PGJ A;  2BCC G;  1VF5 C;  3PP5 A;  1XTC C;  2M5A B;  3FWL A;  3KZI H;  1PPJ E;  1VQL P;  2GA1 A;  3A3Y B;  1K73 Q;  5KLV E;  1EXI A;  2BCC E;  2Y0C A;  5TJH A;  1HUC A;  2R3C A;  3GG2 A;  3CWB G;  4LC1 A;  3SFE C;  3LIE A;  1JCD A;  1LTG C;  1LTJ C;  2BCC J;  4K3A A;  3G3Z A;  4WY4 A;  5BU5 A;  1IFJ A;  2O01 H;  1KB9 I;  3CCL P;  4Y99 B;  2QEX P;  4WVZ A;  3CWB E;  2H8P D;  1MUU A;  3RK2 D;  1J1D B;  1NAY A;  1CZQ A;  1NTM K;  3CWB J;  4OVN F;  3B8E B;  2QM7 A;  1SQV D;  4C7N B;  2Z4E A;  1SQQ D;  2Z5I A;  1FZB A;  3TSI A;  1ZV8 A;  4OGQ C;  1ZR2 A;  1D7M A;  5CCG A;  2M3E A;  4GDO A;  1NYH A;  3GW6 A;  1NGM B;  4N6J A;  2H43 A;  4HYT B;  4L74 A;  1EXJ A;  1QL2 A;  3D70 A;  1NTZ K;  2OYI B;  2IBZ I;  2W6A A;  5APW A;  3I55 P;  1S2E A;  4ASV A;  3C1L A;  2XV5 A;  3CX5 H;  3K5B A;  3AE4 C;  1X0T A;  4H44 B;  2NZ2 A;  2YNY A;  1X79 B;  1OW6 A;  1L0N G;  5CCH A;  1SS1 A;  1FAV A;  1FZF A;  2KNC A;  3HRN A;  1Y9B A;  2K9Y A;  2FXO A;  2FKW B;  2KIK A;  1KQS O;  1VDF A;  1L0N E;  4PV1 B;  4IOI H;  2E75 B;  1LT9 A;  1NO4 A;  3A7O A;  1CI6 B;  1FZC B;  5KKZ B;  5AVT B;  3CX5 I;  1L0L J;  2N1T C;  3IAO A;  2RH0 A;  2E74 B;  1FDI A;  3EQ2 A;  4ZKP A;  1HVV A;  1MKM A;  1U57 A;  1VPC A;  3CC7 P;  4C7N A;  3EFF K;  1BGY G;  2CPB A;  3L75 G;  3P8C D;  4PJ0 E;  4RKU J;  3T97 B;  2HFE D;  1SQV K;  2R5D A;  1SQQ K;  3A0B E;  1IFM A;  1BGY E;  3RL0 g;  3L75 E;  2WMM A;  4WB4 A;  1ZP0 C;  2JEE A;  2K37 A;  2Y9Z A;  1G1J A;  2XNX A;  2QIW A;  2IX7 C;  1NKZ B;  1USD A;  1MV8 A;  1BGY J;  1S5L H;  3B5N B;  4IFF A;  2RN0 A;  2E5Y A;  3CCQ P;  2Q3E A;  1J1D C;  3A2A A;  1JY2 P;  1AFO A;  2IYP A;  1FE6 A;  1S72 P;  2BCC D;  3P32 A;  4I1L A;  1DEE G;  2PP6 A;  2WWW A;  1GK4 A;  1WMK A;  1LTI C;  3BRT B;  4PD4 E;  3QWO C;  1L4A B;  2N1T D;  2ZAE B;  1FZC A;  3L72 J;  1N73 A;  2KB7 P;  1S4X A;  3L71 J;  1EQ7 A;  5GTH E;  1VQM P;  2WQY C;  1AQ5 A;  4XA4 A;  3IFM A;  3CWB D;  1PGO A;  1YYC A;  2NPS A;  2MJZ A;  2QG4 A;  3HTK B;  2A06 G;  1HF9 A;  5AW5 B;  3V2N A;  3VMY A;  1BSH A;  2QJY B;  2HPC A;  1G1I A;  3KHU A;  2YO3 A;  3E1I A;  3P7K A;  2A06 E;  1NTM G;  3CXH E;  4H44 C;  4JF7 A;  2E42 A;  1KQG B;  1EDL A;  4H13 C;  2XZR A;  2Q5U A;  1NTM E;  2I8D A;  2QJP B;  1T6A A;  1KN7 A;  3SSU A;  1E79 H;  2W90 A;  4I2L C;  4PV1 C;  2E75 C;  3TNU B;  1Z56 A;  2W6J H;  4Y28 J;  1YTZ T;  3VMA A;  3L74 J;  1FZC C;  5KKZ C;  1NTZ G;  1DD4 A;  1N73 C;  1EZV G;  3CCM P;  4KJM A;  3TDK A;  3JCU E;  5KAI E;  5KAF E;  3TYY A;  2NPS C;  4UB6 E;  1ZLL A;  3H6P A;  1QL1 A;  1NTZ E;  2E74 C;  1EZV E;  2OYH A;  2XKM A;  3PRJ A;  1K04 A;  1HTL C;  1RF1 A;  3I56 P;  5AVX B;  1N8R Q;  1L4A A;  2XDJ A;  3I5C A;  3MUD A;  1M7L A;  4BRY A;  3FGA D;  3KXD A;  3TK1 A;  5AVZ B;  3HE5 A;  2C9N Y;  2GUS A;  1NOH A;  5AW4 B;  4LLH A;  3V4W A;  1NWQ A;  4H44 D;  2WSE J;  3L4F A;  1KQF B;  2WTY A;  3B5N C;  2L91 A;  4IFD K;  2YIU B;  1S5L X;  3AE3 C;  4OH8 B;  3R4Y A;  1N7S A;  3EWK A;  4PV1 D;  2E75 D;  3OAK A;  2OYH C;  4C7R A;  2IPP A;  2Q6Q A;  4NPD A;  1BGY D;  2P7J A;  3TNU A;  3L36 A;  4GKG A;  3L75 D;  2M3B A;  1L4A C;  3MUD C;  1VQ8 P;  1JY3 O;  5KJ7 A;  1SQV E;  1URQ B;  4H0L C;  1RY3 A;  2E74 D;  2I1K A;  3RK3 B;  3CC2 P;  5APQ A;  1VQ9 P;  4R4L A;  1OW8 A;  3FXD A;  1BCC J;  3D6Y A;  2QJY C;  4YXW H;  5CHX A;  3G4S P;  2IFM A;  2J5U A;  1OW7 A;  2C0X A;  3JSV C;  1ZN5 A;  1AVY A;  5AVY B;  1JTH B;  2H88 C;  3CCU P;  4MN4 C;  3D6Z A;  1LTT C;  1N7S C;  4PD4 D;  4ZNC A;  1OVU A;  1L0L K;  3BCC G;  2O1J A;  1UII A;  5E79 E;  5AVW B;  3RK3 E;  2R5B A;  3B5N D;  3KPE A;  2QRX A;  4OGQ B;  1IJD B;  1T2K C;  1S9K D;  2Q1K A;  5KJ7 C;  4LGD E;  1RF0 A;  3BCC E;  2ITA A;  1LWU A;  3TGU G;  4IFM A;  2KUB A;  3M91 A;  1VQ5 P;  2FY8 A;  2YMY A;  3G9R A;  1JNM A;  2AEJ A;  2A06 D;  3CXH D;  4WY4 B;  3TGU E;  3BCC J;  3M9Q A;  2SPZ A;  3U1A A;  2K1A A;  1N2D C;  1JEK A;  1NTM D;  4I6M C;  2OQQ A;  3TGU J;  4YTP C;  1EDJ A;  1GL2 A;  1LNQ A;  1IFI A;  2W6B A;  3WU2 E;  1BE3 G;  1PGP A;  2ZXX A;  5APX A;  1RF0 C;  1SLQ A;  1EZV D;  1BE3 E;  2ZYA A;  1GW3 A;  2YIU C;  1Q2N A;  1JTH A;  4JYC A;  1NJI Q;  2WSC H;  3IN6 A;  3NMD A;  1QGK B;  1EC5 A;  1SFC A;  3GF7 A;  3AE2 C;  4IL6 E;  2L5G B;  1BE3 J;  2FXM A;  3CME P;  1M90 Q;  5H2F E;  4TT3 H;  2WPS A;  1CW5 A;  5APU A;  2P1J A;  1GL2 C;  1FDO A;  1URQ C;  2KNC B;  1JO5 A;  3RK3 C;  2D2C B;  4L73 A;  1VQ4 P;  1LT9 B;  4PJ0 H;  2KLV A;  1W2E A;  1IK7 A;  3A0B H;  1OVV A;  2UWJ E;  1RE4 C;  2YKO A;  1IZN B;  3ITK A;  2E5T A;  3LW5 H;  5BU8 B;  1LTB C;  3CPW O;  2R3S A;  2QA4 P;  2KSE A;  2KYV A;  2HOD A;  1OFC X;  1LTS C;  1X8Y A;  2WPR A;  3VMZ A;  4EOT A;  1K05 A;  4KT0 J;  2HYN A;  3CCR P;  4A7P A;  3MZW B;  1VF5 D;  2DW3 A;  2WPV B;  2XU6 A;  3M9B A;  2ZVO B;  4WY4 C;  4PD4 H;  4GIF A;  2PRR A;  1M57 D;  1FBM A;  2E76 B;  2J59 M;  2WT7 A;  1URQ D;  5AW7 B;  3F89 A;  1AV1 A;  1L0L G;  3AE1 C;  3RK3 D;  4JQ0 D;  3SFD C;  4H13 B;  2LXC B;  2FYZ A;  2P58 A;  1L0L E;  3BCC D;  3BRV B;  3CXH H;  2YO2 A;  2Y9Y A;  4PD4 I;  3GHG A;  4DCK A;  5CCG C;  1JCC A;  4U3F J;  1H88 A;  2G8Y A;  1N73 B;  3TGU D;  2KP8 A;  2WSF H;  3KQG A;  2NPS B;  1G2C A;  2P2U A;  1FZA A;  2WVR A;  4GOE A;  1IFN A;  3V2P A;  2A45 G;  2HPC B;  3BVH A;  4OGQ D;  3O8Z A;  4KHX A;  1T3J A;  2YKQ A;  3VTP C;  3L73 G;  2XND H;  3CXH I;  1NHL A;  3JCU H;  1W2B O;  5C39 A;  5KAI H;  5KAF H;  5CCH C;  4UB6 H;  2BEZ F;  1GD2 E;  4WY4 D;  2I1J A;  2BAS A;  1GZL A;  3MTU E;  3L73 E;  1QX8 A;  2RKL A;  2D2C C;  4GOD A;  3SWY A;  1BE3 D;  1LT9 C;  2KS1 A;  2QE7 H;  2WSS H;  1QLE D;  3L72 G;  3L73 J;  1LP1 A;  1YIT P;  1PFI A;  1GDT A;  3L71 G;  2O01 J;  2HLO A;  3GF3 A;  2H89 C;  3L72 E;  2OYH B;  2QJK B;  2AXC A;  1HGZ A;  3L71 E;  1KFM A;  5DJT B;  5CCG D;  1RF1 B;  1GK6 A;  3CL3 D;  1IFP A;  2N9Y B;  1T8Z A;  2V7Q H;  1U7M A;  2RMZ A;  2OYO A;  5BVZ A;  4BRY B;  4H0L B;  4ASW A;  1SP4 A;  3AEB C;  3HE5 B;  1S9K E;  4XE5 B;  1PP9 G;  3PJS K;  5AW6 B;  2KZJ A;  3CX5 E;  2JWD A;  2FFD A;  1JMB A;  3L74 G;  1KIL A;  5CCH D;  2E76 C;  1DD3 A;  2J58 A;  2JJL A;  4AYC A;  2YMK A;  4ZKU A;  5TIS E;  1PP9 E;  2GM4 A;  3H1K G;  1M1J A;  3AEG C;  3FXE A;  3L74 E;  4ZMD A;  5B5E E;  1JUN A;  2ZFC A;  1N7S B;  1KTM A;  3UIA A;  1M8O B;  4QMA A;  5CJ4 A;  3H1K E;  1SVF A;  1PP9 J;  2AEF A;  1OXZ A;  5APT A;  3BAT A;  2JKV A;  3HD7 A;  1JY2 O;  2PFX A;  3H1K J;  3RBZ A;  1S3J A;  2POH A;  1HJ0 A;  1CSB A;  3WMM 0;  3H25 A;  1JM0 A;  5CBO A;  1IO4 A;  3O6Q A;  1FC2 C;  2ZT9 C;  2HG5 D;  2E43 A;  3AE5 C;  4U3F D;  2FYU G;  1DH3 A;  1Q82 Q;  1L0L D;  3L37 A;  5CBN A;  4U7J A;  3Q5S A;  3PHL A;  3CCV P;  1M1K Q;  2N9B A;  5AW2 B;  2FYU E;  1NH4 A;  1RHZ B;  4DZO A;  2K3R A;  1KZU B;  1R5L A;  2E76 D;  4BXL A;  4YPC A;  1VQ6 P;  1OZH A;  1SQP G;  5KLI C;  5AVS B;  1HGV A;  3HD7 C;  1LWU B;  2P10 A;  4H13 D;  2FYU J;  1NU1 J;  3WUV A;  1SQP E;  3WU2 H;  3FWN A;  1ZOY C;  1A02 J;  4UB8 E;  1JY3 N;  1L2P A;  2C0W A;  2QJK C;  1BCC G;  4RO0 A;  5B66 E;  2AXT E;  1RF1 C;  1PGQ A;  3L73 D;  1W5C E;  1J1E C;  1SQP J;  2VRS A;  5APS A;  3VP8 A;  2Q9I A;  3HE4 A;  1BCC E;  1RE3 A;  2NPS D;  3H32 A;  2IZ0 A;  1GL2 B;  2W83 C;  3W67 A;  4DJG A;  3IF4 A;  2ZJS E;  1NAF A;  2LXB A;  1NTK J;  1R8E A;  3AEF C;  4AQR D;  4IL6 H;  3VN0 A;  4XFJ A;  4L76 A;  3S9O A;  1VQK P;  2Q7C A;  1YBK A;  1FZE A;  5M1B A;  3L72 D;  3MGN A;  1LGH B;  1PV3 A;  3M9H A;  2K9J A;  4HH2 A;  3RGU A;  1BDD A;  3L71 D;  3PH0 A;  3WUU A;  1GU5 A;  3RL0 B;  3E1R A;  1SFC B;  2KZI A;  3VOP A;  4BWN A;  3FX0 A;  1R5S A;  3AE7 C;  2AEM A;  3Q1M A;  3EFG A;  3B4S A;  4B86 A;  1HJB A;  1LJ2 A;  3CX5 D;  3U59 A;  1UIX A;  2MKV A;  1PP9 D;  1VQP P;  3D71 A;  3CC4 P;  1SQB J;  1ZRT E;  1L4A D;  3L74 D;  2H7H A;  3A0H E;  3M0D A;  3VP9 A;  1OMI A;  3S4R A;  1SQX G;  4M3L A;  4H0L D;  1WRG A;  3H1K D;  3F5H A;  3QH9 A;  2KOG A;  3MHV A;  2P67 A;  1SQX E;  2HOD B;  1S1C X;  1X9V A;  3AE6 C;  1P84 E;  4N3Y B;  1Q7Y Q;  2PAJ A;  1QVF O;  1LWU C;  4RES B;  1SQX J;  1N7S D;  1YHQ P;  1KQL A;  3Q5R A;  4RJT A;  5CMZ A;  3CD6 P;  3LID A;  1FS0 E;  1ZR4 A;  1JB0 J; 
#chains in the Genus database with same CATH homology
 1T2K D;  1KFN A;  1G1I A;  2YO2 A;  2YO3 A;  5KJ7 D;  3E1I A;  3P7K A;  3M0D C;  3GHG A;  4JF7 A;  2WT7 B;  3KDP B;  1GU4 A;  2C9L Y;  2E42 A;  5CCG C;  1JCC A;  1H88 A;  1N73 B;  2KP8 A;  2WSF H;  4DOJ A;  5KTB A;  3KQG A;  2XZR A;  2NPS B;  1LTJ B;  2Q5U A;  1G2C A;  2P2U A;  1FZA A;  4O9B A;  3V2P A;  1IFN A;  2A45 G;  3VYI A;  2HPC B;  4I2L C;  3BVH A;  3O8Z A;  4KHX A;  3TNU B;  1T3J A;  2YKQ A;  1Z56 A;  1JMM A;  3C9I A;  3VTP C;  1DEB A;  4EIJ A;  1YTZ T;  3HD7 D;  2A45 H;  1FZC C;  3GHG B;  1N86 A;  1IFD A;  1N73 C;  1NHL A;  3BAS A;  2QM8 A;  5CCH C;  1GD2 E;  1RE3 C;  4C46 A;  3TYY A;  4WY4 D;  2I1J A;  2BAS A;  2NPS C;  1GZL A;  3MTU E;  1G2C B;  1ZLL A;  3H6P A;  3SWF A;  3NFQ A;  4W7Z A;  1QL1 A;  3RL0 C;  1L0N K;  1JOC A;  2OYH A;  4N78 D;  2XKM A;  1FU1 A;  3SWY A;  1SFC C;  1LT9 C;  3OJA B;  1HTL C;  1RF1 A;  5AVX B;  4GT1 A;  2O1K A;  1L4A A;  2XDJ A;  3I5C A;  3MUD A;  1M7L A;  2A45 I;  2R32 A;  1GDT A;  1PFI A;  3II6 A;  3TK1 A;  2HLO A;  2LKM A;  5AVZ B;  1FZG A;  3HE5 A;  2C9N Y;  2OYH B;  2GUS A;  1NOH A;  5AW4 B;  4LLH A;  1E5W A;  1HGZ A;  3M06 A;  3V4W A;  1NWQ A;  3L4F A;  1KFM A;  5CCG D;  1RF1 B;  1GK6 A;  5APY A;  3CL3 D;  1T8Z A;  2WTY A;  3B5N C;  4IFD K;  1GL2 D;  2N1T A;  1IC2 A;  3RK2 C;  1URQ A;  2OAR A;  3KYQ A;  5BVZ A;  1GW4 A;  5AVR B;  3P8C E;  4OH8 B;  1SP4 A;  1N7S A;  5AW1 B;  1LTJ A;  3HE5 B;  3OAK A;  1S9K E;  2OYH C;  2FYU K;  4C7R A;  1WT6 A;  3L35 A;  2IPP A;  1NU1 K;  2Q3I A;  1H8A A;  4XE5 B;  1OWA A;  3U1C A;  5AW6 B;  2FFD A;  2M8R A;  2P7J A;  3TNU A;  1KIL A;  3HUS B;  3L36 A;  4GKG A;  5CCH D;  2M3B A;  2J58 A;  1L4A C;  1HBW A;  1RE4 A;  2WZ7 A;  2JJL A;  4AYC A;  1JY3 O;  2YKP A;  4ZKU A;  2N1T B;  5KJ7 A;  3CI9 A;  2GM4 A;  1URQ B;  1XTG B;  1M1J A;  1RY3 A;  2I1K A;  3RL0 D;  3V5B A;  3RK3 B;  1JUN A;  5CJ0 A;  2ZFC A;  1MZ9 A;  1N7S B;  1DX7 A;  1SFC D;  1SQP K;  5APQ A;  3PP5 A;  1XTC C;  3UIA A;  5CJ4 A;  1SVF A;  3A3Y B;  2FFD B;  1OXZ A;  1KIL B;  5CHX A;  2IFM A;  1NTK K;  5APT A;  3BAT A;  2C0X A;  3V2Q A;  3HD7 A;  1ZN5 A;  1HUC A;  1J2J B;  5AVY B;  1JTH B;  2R3C A;  1M1J B;  1NKN A;  1LTT C;  1JY2 O;  1LTA C;  1N7S C;  4LC1 A;  3LIE A;  1JCD A;  1LTG C;  1LTJ C;  2POH A;  1CSB A;  3G3Z A;  4WY4 A;  5BU5 A;  1IFJ A;  1L0L K;  3WMM 0;  2O01 H;  2O1J A;  5AVW B;  1IO4 A;  4Y99 B;  2R5B A;  3B5N D;  3KPE A;  2ZXE B;  2HG5 D;  1IJD B;  1T2K C;  3V4Q A;  2H8P D;  2E43 A;  1MUU A;  3RK2 D;  2WSE H;  1S9K D;  1J1D B;  3GHG C;  1IK9 A;  4LGD E;  1RF0 A;  5KJ7 C;  3HD7 B;  1DH3 A;  1LWU A;  4IFM A;  3L37 A;  1CZQ A;  2CPS A;  3M91 A;  1NTM K;  2YMY A;  1JNM A;  2N9B A;  5AW2 B;  2OYI A;  1NH4 A;  4WY4 B;  3B8E B;  2QM7 A;  4C7N B;  4DZO A;  2Z4E A;  1KZU B;  4Y99 C;  2Z5I A;  3M9Q A;  1FZB A;  4JYB A;  3TSI A;  2IFN A;  4W80 A;  1ZV8 A;  3U1A A;  1ZR2 A;  5AVS B;  1N2D C;  1HGV A;  1FJP A;  3HUS A;  3HD7 C;  5CCG A;  1J1E B;  1LWU B;  4I6M C;  1SQB K;  4N6J A;  2H43 A;  4HYT B;  5APV A;  1GL2 A;  1QL2 A;  1A02 F;  1IFI A;  1GTW A;  1NTZ K;  2W6B A;  2OYI B;  3N4X A;  2W6A A;  1A02 J;  5APW A;  1JY3 N;  5AVU B;  2C0W A;  2XV5 A;  3OA7 A;  3CLQ A;  1CI6 A;  1RF1 C;  2YNY A;  1X79 B;  1FJK A;  5APX A;  1RF0 C;  3P8M C;  1FOS F;  1J1E C;  1SLQ A;  2VRS A;  5APS A;  3VP8 A;  2Q9I A;  1HWT C;  5CCH A;  3HE4 A;  1GW3 A;  1HH0 A;  1RE3 A;  2NPS D;  3H32 A;  1GL2 B;  4AUW A;  1FDM A;  1FAV A;  1JTH A;  1FZF A;  3HRN A;  4JYC A;  2OYI C;  1NAF A;  2FKW B;  2WSC H;  3NMD A;  4AQR D;  1VDF A;  3VMX A;  3VN0 A;  1SQX K;  1SFC A;  1LT9 A;  1T3U A;  1NO4 A;  2L5G B;  2FXM A;  3A7O A;  1JY2 N;  2Z5H A;  1CI6 B;  1FZC B;  2Q7C A;  2WPQ A;  5AVT B;  2WPS A;  1CW5 A;  3HUS C;  1FZE A;  3MIW A;  3T97 A;  3MGN A;  5APU A;  3HE4 B;  1LGH B;  2N1T C;  3H32 B;  3M9H A;  4HH2 A;  2P1J A;  1GL2 C;  1URQ C;  1JO5 A;  3RK3 C;  1GU5 A;  3RL0 B;  3M0A A;  3EQ2 A;  4ZKP A;  3V2R A;  1SFC B;  5AW9 B;  1HVV A;  1LT9 B;  1VPC A;  3VOP A;  3NXS A;  4C7N A;  3R2P A;  3A5T A;  2KLV A;  5AVQ B;  2CPB A;  2FFD C;  1W2E A;  1KIL C;  3MD0 A;  3EFG A;  3P8C D;  3B5N A;  1JY3 P;  1RE4 C;  4WBA A;  2HFE D;  2YKO A;  1SQV K;  2R5D A;  1SQQ K;  4B86 A;  1HJB A;  3LW5 H;  5AW3 B;  5BU8 B;  1LTB C;  1IFM A;  1H89 A;  1M1J C;  3U59 A;  4WB4 A;  2JEE A;  2KYV A;  2HOD A;  1G1J A;  2XNX A;  1LTS C;  2IX7 C;  5KLV K;  1X8Y A;  1NKZ B;  1L4A D;  1MV8 A;  2WPR A;  3VMZ A;  3B5N B;  4IFF A;  2H7H A;  3M0D A;  3VP9 A;  4EOT A;  1J1D C;  4M3L A;  2W27 A;  1WRG A;  3RK2 B;  2HYN A;  3A2A A;  1JY2 P;  1AFO A;  3NTN A;  2XU6 A;  3P32 A;  2KOG A;  4I1L A;  3HTK A;  3M9B A;  2P67 A;  4WY4 C;  2GUV A;  2PP6 A;  1YTZ I;  5AVV B;  2HOD B;  1FOS E;  2WWW A;  2KSJ A;  4GIF A;  1GK4 A;  1FBM A;  1LTI C;  1X9V A;  3BRT B;  2J59 M;  5AW8 B;  1L4A B;  2N1T D;  4N3Y B;  5AW0 B;  2WT7 A;  1FZC A;  1URQ D;  5AW7 B;  2PAJ A;  3IR9 A;  1N73 A;  1LWU C;  4RES B;  3RK3 D;  4N78 E;  2KB7 P;  1N7S D;  3N7N A;  1KQL A;  1EQ7 A;  1MFZ A;  1AQ5 A;  4XA4 A;  3IFM A;  5CMZ A;  1YYC A;  2NPS A;  2MJZ A;  3HTK B;  2FYZ A;  2WIT A;  1N7L A;  3LID A;  5AW5 B;  3BRV B;  3V2N A;  3VMY A;  1KIL D;  1ZR4 A;  2HPC A;  4W7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...