3L36A

Pie12 d-peptide against hiv entry
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
total genus 21
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l36A00
3IR9A 3TNUA 1H8AA 4GKGA 1G2CB 3A7OA 1NAFA 5APSA 2E43A 3M0DA 2YO3A 1HJBA 5AW9B 3M9BA 3VYIA 3O8ZA 2P2UA 1CI6B 1SP4A 2N9BA 3HTKA 4JYCA 3P7KA 2WPSA 1A02J 1GTWA 5APQA 3V4WA 2Z5HA 1FOSE 1GK6A 1SLQA 5AVYB 2Z5IA 3UIAA 3NMDA 3M06A 3MGNA 3A5TA 3L35A 2WTYA 1GK4A 2Q3IA 2XV5A 5APWA 4C7NB 1IO4A 2YNYA 3HE4B 5AW6B 3VN0A 3L36A 4I6MC 4HYTB 4LC1A 1CI6A 2ZXEB 3NTNA 2C9LY 2H7HA 4M3LA 1GD2E 1HWTC 3OAKA 1MUUA 2JJLA 3B8EB 3M9HA 1JUNA 1S9KE 1MFZA 2QM7A 4C7NA 5AW5B 3P32A 5APYA 5AW1B 3V5BA 4AQRD 1NWQA 3HE5B 4AYCA 1JNMA 2C9NY 2WWWA 3HE4A 1FOSF 5AW4B 2ZFCA 1S9KD 5APXA 3VMZA 4AUWA 5AW2B 5AW8B 2R3CA 4RESB 3VMYA 1CZQA 1MV8A 2YO2A 1GU5A 3T97A 1X8YA 3LIEA 5AVZB 5CMZA 5AVXB 3MD0A 2Q7CA 5APVA 1J2JB 4XE5B 4DZOA 2WT7B 2P7JA 3A3YB 3NFQA 2W27A 2BASA 2VRSA 3HE5A 3LIDA 2WPQA 5AVVB 2W6AA 4JYBA 5AVTB 5AVQB 2R5BA 3SWFA 4C46A 5APTA 1A02F 1DH3A 2R5DA 5APUA 5AW3B 2KP8A 4KHXA 1H88A 5AW0B 1GZLA 5AVRB 2WT7A 4EOTA 3TK1A 1GU4A 2P67A 1CSBA 3KQGA 1YYCA 1FAVA 3TYYA 5AVSB 4I2LC 3TNUB 3L37A 1T2KC 2XU6A 3NXSA 2WPRA 3I5CA 1KQLA 4GT1A 1OWAA 1HUCA 3VTPC 2R32A 5AW7B 4B86A 1T2KD 3KDPB 3M0AA 5AVUB 2XZRA 2QM8A 1H89A 3P8MC 2IPPA 3V4QA 1HBWA 1OXZA 3VMXA 5AVWB 3M91A 2Q5UA 3A2AA 2E42A
chains in the Genus database with same CATH superfamily
3TGUG 3CWBD 3PHLA 3GHGC 3TGUJ 2QJPC 1BCCD 3G3ZA 3I56P 2OYIC 1IZNB 1A02J 5CCGA 1SQBG 2WSEJ 3MGNA 3SWKA 2Q3IA 1SQBJ 3AEFC 1M56D 2OARA 1URQA 3VOPA 1GD2E 3JC22 1MUUA 2IX7C 2JJLA 3S4RA 5KKZB 5KJ7D 1JOCA 5KAIE 1KN7A 5APYA 4PJ0E 1IFJA 1SQVK 2K9JA 2NZ2A 1MKMA 1SQXK 1NTMK 3RL0g 1KILC 1NYHA 1FU1A 3BRTB 2KK7A 4KHXA 5AVRB 1UIIA 2FXMA 3MTUE 5H2FE 3TNUB 4OGQB 1T2KC 2A45H 1NU1J 4BXLA 1LNQA 4JPZB 4WY4A 2LXCB 1ZRTD 3V2QA 1PGPA 1U57A 4B86A 4ASVA 1WRGA 5M1BA 4ZMDA 1L0NE 2KLVA 4HB1A 5CCHD 3H1JG 5EFWB 1M57D 3CCSP 2E75C 1YI2P 2N9BA 3FWLA 3C8VA 1JM0A 2Y9ZA 4N78D 4JQ0D 3H1ID 3RK3C 5E79H 3JCUH 4O9BA 1N8RQ 1KYOH 1NTZE 1BSNA 3H32A 4Y99C 2JKVA 2N1TD 4W80A 2IZ1A 1IK7A 2NRGA 2KUBA 1EZVG 4ZKPA 1KORA 2WZ7A 5CCGD 4HH2A 4AUWA 3ZDMA 2Q9IA 2PRRA 2ZYGA 1M1JA 2W8ZA 1BGYG 2WT7B 2I8DA 3CI9A 4IOIH 1VL2A 1BGYJ 4JYBA 1DIPA 2E75B 1VQPP 1RF0A 3B71A 1LTGC 2MJZA 3TK1A 3GF7A 1QX8A 1EC5A 1YYCA 1FAVA 3BASA 2JDIH 2QEXP 2LKMA 3D6YA 1LGHB 3C9IA 1IFNA 3CD6P 3L71G 3PH0A 3M91A 1SFCA 2Q5UA 3L71J 2G3AA 4LLHA 3CCQP 4H0LD 3G4SP 3AEEC 1P84D 4BWNA 2M5AB 1LWUC 3AECC 4GDOA 1LT9C 2AEMA 1SQQD 4WY4D 3AE2C 4L74A 1HJ0A 1JB0J 3L72D 2PGDA 1RQVA 3H25A 3L35A 4MN4C 3AE4C 2P1JA 3S1KA 1VQ6P 4U3FD 1NTKE 2ZT9C 1Y9BA 5C39A 1BSHA 1JMMA 2E5YA 2HG5D 1NWQA 1RF1C 2QJKC 1LTTC 3VMYA 5KAFE 2IBZE 3V6IA 3LIEA 1OVUA 2QE7H 2K37A 3MUDC 2WPQA 3KPEA 1N7SD 2OTLP 1OIPA 4PD4I 1USEA 1GW3A 3AE3C 3SFEC 3BCCG 1GZLA 3V2RA 1LT9B 3L73G 4XA4A 5KLIC 3U1CA 2FYUD 3CXHD 3L74D 5GTIE 1PZQA 1ZW0A 3H1LD 1SQQK 1ZR2A 1JY2N 2AEJA 3TNUA 1YIJP 1G2CB 2J59M 3BRVB 1RF1B 1QEXA 1FZBA 1PP9D 3A0BH 3WUUA 2WSFJ 1DEBA 4N6JA 1RHZB 1VQ5P 4Y28J 5KLVJ 3PLNA 1DX7A 1S2EA 1IJDB 4UB6H 3Q5PA 2AEFA 2P58A 2YXQB 1L0NG 1FBMA 3B8EB 3AEGC 2CPBA 3P32A 5KTBA 1AV1A 1L0NJ 2HODB 3GW6A 2E74C 1GL2A 3O6QB 2Y9YA 2ZYAA 4ASWA 2Q7CA 2FYUK 3W68A 1SVFA 5B66H 3R2PA 1SQPD 1J1EB 1NTZG 2L5GB 5APTA 2BCCJ 1PV3A 2WT7A 1D7MA 4NPFX 1KB9I 1RY3A 2QIWA 1BE3E 2Y0DA 2GUSA 3HTKB 4L75A 5AVWB 3CWBE 2OTKE 1AVOA 2E74B 1VQLP 2YO3A 3CXHH 2HYNA 3HD7C 1CI6B 1S5LX 2Z5HA 2HFED 1LP1B 3A5TA 4LGDE 4IL6X 2CK3H 3FWNA 3U59A 5TISH 1RE3A 4OGQD 4BRYB 2M5AA 3K5BA 2B9BA 1NHLA 1HH0A 1JY3N 1Q82Q 1T8ZA 4AQRD 3HE5B 3AE9C 1H0TB 1MV8A 3TDKA 2KNCB 1X8YA 1DEEG 3IN6A 1QLED 4DZOA 2P7JA 3MZWB 1SQBD 1NTKG 3F89A 1KILD 2W6BA 4PD4H 1YTZI 4C46A 3FX0A 5AW3B 2KP8A 5B5EH 1KV4A 4UB8H 1NTKJ 1L4AB 5DJUB 2QG4A 1YJNP 1ZRTE 3L37A 1EDJA 3NXSA 1KFNA 2JWAA 2R32A 2YIUB 4H44C 1PPJG 2IBZG 5AW7B 1KQFB 1T2KD 4C7RA 2O01N 1HVVA 2WSSH 2RKLA 2KSEA 1Q90D 2WPVB 2YMKA 2KOGA 2E42A 3N7NA 1EZVI 2NPSC 2Y0EA 1RE4A 4IFFA 1J1DB 4I7ZC 1NTMD 1MZ9A 4N78E 3KYQA 3H1IE 3P7KA 2WPSA 1FDOA 1S4XA 2E75D 3L70G 2FXPA 1NU1D 1G2CA 5CHXA 2WITA 2KZJA 4KT0J 5CBOA 3B5NB 3L36A 2N1TA 1KYOD 4L73A 1SQBK 3Q5RA 2E76C 3D6ZA 1JUNA 2JO1A 4GOEA 1YJ9P 1S5LH 2FYNB 3VP9A 1FS0E 1LTJC 1NOHA 2C0WA 4IL6H 3CX5I 3KZIE 1QGKB 1AQTA 2YKOA 1W2EA 4IFMA 3RL0C 3BCCE 2VRSA 2HODA 3L73E 2W6AA 4DCKA 3O6QA 1OVVA 5APUA 2WSEH 1FZCC 1PFIA 3A0BE 4EOTA 3FXEA 4HKZH 3E1RA 1W2BO 3KQGA 2YKPA 1U7MA 1X9VA 4PV1C 1LJ2A 1HBWA 1VDFA 3GHGB 1NU1K 2E76B 2QJPB 4UB6E 2OYIB 1OMIA 1P84E 1SQVG 2KI7B 2E43A 1SQXG 3M9BA 5GTHH 1NGMB 1SQQE 3LW5J 2P2UA 3L72E 4JYCA 3HTKA 3PP5A 3RL0B 1U7JA 4U3FE 3OA7A 3CMEP 1G1IA 4OVNF 1BE3G 3HE4B 2D2CC 2WSCJ 1CI6A 3ABVC 1M7LA 1FZCB 3H1JJ 3CWBG 3M9HA 1G1JA 5AW1B 1BCCG 2WWWA 1FOSF 2ZFCA 2E5TA 1KILB 3VMZA 5AW2B 3W67A 3H1HD 3WU2E 4PV1B 1VQMP 5AVZB 4EDFA 2QSIA 1R5LA 3NFQA 3HE5A 1N7SA 4GIFA 1H0TA 3VP8A 2R5DA 2FYUE 1Q2NA 1N73C 3GF3A 1GU4A 3A0HH 1JMBA 3L74E 3H1LE 4WBAA 2FY8A 4OWFA 5AVUB 5BU8B 1L4AA 1GDTA 2KS1B 1PP9E 4DJGA 5TISE 1AVYA 1HGVA 3M0DC 3A7OA 3RK3B 2ZVOB 3CPWO 5APQA 4Y99B 1FOSE 2AXCA 1FC2C 1YHQP 1YQ4C 2WTYA 1YJWP 3N4XA 3MIWA 2OYHC 1MFTA 3WUTA 2AXTE 4M3LA 2V7QJ 1HTLC 2KSJA 5B5EE 5KLVD 3B5NA 2M8RA 3CX5H 3AE1C 1CZQA 3AE6C 1L2PA 4YXWH 2E74D 3H1IG 1S3JA 1VQ7P 1KZUB 2IZ0A 2Q6QA 2FFDC 1SQPE 1LTSC 2K1AA 3HUSC 1A02F 1M1KQ 3II6A 1H88A 2KIKA 2O01J 1PPJE 4EIJA 1KQGB 5AVSB 1VF5C 2QJYC 2RN0A 2FKWB 3I5CA 1Q81Q 1N86A 4D6TD 3VMXA 3D71A 1TU3F 1LWUB 2A06E 2H88C 4GKGA 1LT1A 1BDDA 3L70E 3BCCJ 2ZVNB 3VYIA 3L73J 2BCCD 5CJ4A 2OGUA 1ZV8A 3GHGA 1S5LE 5CCGC 2ZT9B 4OH8B 3L75D 3SSUA 2OYIA 2FFDB 1JY2P 1L4AD 5KLVK 2P10A 1JTHB 3G71P 3HUSB 1OW6A 3EFGA 1URQC 2QJKB 3NTNA 2C9LY 3KXDA 1HWTC 3AEDC 1T3UA 1VF5B 3CMAP 1L0LE 3AE7C 3V5BA 4PJ0H 2N9YB 3HE4A 1S9KD 4TT3H 1NO4A 1SQQG 3PJSK 3V2NA 3H1KE 3L72G 2B88A 2YO2A 1GU5A 1FE6A 1QVGO 1L0NK 1JY2O 2IBZI 2IFNA 2ITAA 4NPEA 3L72J 1J2JB 4RJTA 4U3FG 2KYVA 5KLIB 4U3FJ 1KILA 5AVTB 4CPGA 3P8CD 4L76A 4K3AA 4HJGH 2XNXA 1X0TA 5AW0B 2IYOA 1RQUA 4PD4D 2ZYDA 3B5ND 3VMAA 1X22A 5GTHE 5H2FH 4WY4C 4Z1MH 1Z56A 2WPRA 3RK2C 1OWAA 1E5WA 2OYOA 1KFMA 1SQVE 2XZRA 1SQXE 1OZHA 2B89A 2H8PD 1CW5A 1NTME 4A7PA 3GLMA 1NTZJ 5AW9B 1QVFO 2NPSD 2GUVA 4W7ZA 1EDKA 3CC4P 2KS1A 2KZIA 1YBKA 2FYUG 3V4WA 2J5UA 3HRNA 2HLOA 1GK6A 3CL3D 3L74G 5E79E 3JCUE 4XFJA 1NH4A 1OW7A 2FYUJ 2PFXA 3H1LG 1KYOE 4LC1A 1BCCE 2H7HA 3T97B 1PP9G 1ZLLA 1M8OB 2E76D 1PP9J 1JNMA 3OW2O 3RK2B 1K9MQ 4RESB 1Y8AA 1M1JC 4EYYQ 2O3JA 1VQ8P 4EI2A 5APVA 1ZMEC 1JY3P 4W7YA 3LIDA 5AVVB 3CCRP 1S1CX 3RL0D 1RF0C 3TGUD 1IFIA 3IFMA 4KJMA 1AQ5A 1IC2A 4RO0A 1USDA 1PGQA 1AFOA 1FJPA 5TJHA 1KB9D 3MHVA 1JY3O 2GA1A 4QMAA 1SFCC 3D70A 3HD7B 4PV1D 1SQPG 2BEQD 1SQPJ 1LTAC 4R4MA 3WUVA 2WVRA 2H89C 1VQ9P 2KB7P 1FZEA 1LWUA 5AVYB 1LT9A 3G9RA 1IO4A 3VN0A 4R4LA 4YXDC 1VQOP 1JEKA 1VQ4P 2XKMA 2A06G 3H1HE 1JTHA 2C9NY 2SPZA 1RF1A 2FYZA 1T3JA 2PAJA 5KAFH 3L70J 5KKZC 2B87B 2YMYA 3RK3D 1SFCB 5CMZA 3MD0A 4XE5B 2Q1KA 1JCDA 2BASA 2QRXA 3MUDA 1PL5A 3H1JD 3I55P 2I1KA 1Y47A 4H44B 3EQ2A 1QL2A 1LTIC 1Q7YQ 1OX3A 2YKQA 2K88A 2GM4A 1L0LG 3TYYA 2XU6A 1KQSO 3VTPC 1L0LJ 2NPSB 3H1KG 1OVRA 2O1KA 5GTIH 3CCEP 1E79H 4I7ZB 1H89A 3H1KJ 4JF7A 4OGQC 3SFDC 5K5GB 1NAFA 1EZVD 2QVAA 1KB9H 1M90Q 2C0XA 1QL1A 1SLQA 3NMDA 2A45G 1X79B 2YNYA 1BGYD 4I6MC 2HPCB 3IAOA 1LTJB 1EXJA 2M3EA 1SQVJ 2UWJE 5KLVE 1NTMG 1SQXJ 1GL2C 1EQ7A 5AW4B 1NTMJ 2I1JA 1NU1G 3T97A 3R4YA 1KC8Q 2YXRB 3CX5D 1FDIA 1R5SA 3GMAA 1BE3J 4H13C 3CC2P 2ZT9D 5B66E 3EFFK 3L71D 3M9QA 3LW5H 1LP1A 2R5BA 1KMIZ 1VPCA 2KXPB 3CWBJ 2ZXXA 4BRYA 2W83C 1BCCJ 3RBXA 1CSBA 3EWKA 1NKNA 2WSCH 2K9YA 2HR3A 3FGAD 1HUCA 4D6TE 1VF5D 3KDPB 3M0AA 2IYPA 2IPPA 3V4QA 2G8YA 2R44A 3BVHA 1Q86Q 1N7LA 2KNCA 2JR8A 3IR9A 3AEAC 1GL2B 1JO5A 2BCCE 1NVOA 5APSA 1P84I 1WMKA 1HGZA 1ZXGA 3CXHE 3AE8C 3L75E 4K35A 2D2CB 3HD7A 1NKZB 1PGOA 4H13B 2Z5IA 2W6JH 3M06A 2Y0CA 1GK4A 2XV5A 2M3BA 1RE3C 5APWA 3RBZA 2PP6A 4HYTB 1OW8A 5KJ7C 3KHUA 1GMJA 1NAYA 1VQKP 1URQD 1S9KE 2MKVA 3BCCD 2Q3EA 3L73D 4N3YB 3L4FA 2R3CA 4YPCA 3BATA 3TSIA 4GOFA 2W90A 3IF4A 2W27A 3P8CE 3CCVP 1N73B 3CCJP 4DOJA 1BDCA 4PD4E 3CCMP 3F5HA 2B87A 4UB8E 3G6EP 1K05A 3SWYA 1K8AQ 3H1HG 1WT6A 2FXOA 3CXHI 3H1IJ 1ZR4A 3H1HJ 1DD4A 3CCUP 5CCHC 2V7QH 3RK2D 2WMMA 1OXZA 3CCLP 4JBZA 3A2AA 5BU5A 1RE4C 1H8AA 2POHA 1L0ND 3PRJA 2NPSA 4IFDK 2DW3A 2CPSA 4NPDA 2JWDA 2OYHB 1GTWA 5BVZA 4WWIA 5L8RJ 1EDIA 3B4SA 5DJTB 4C7NB 1ZOYC 3RGUA 2N1TC 3V2PA 1SS1A 1IFPA 2O01H 2ZXEB 2V4HA 1NTZD 3JSVC 2L91A 2XDJA 1OFCX 4AYCA 3HD7D 5AW8B 4IL6E 2HPCA 3KZIH 1LTJA 1YQ3C 3GG2A 1KTMA 4YTPC 1N2DC 3A3YB 1S72P 3TGUE 2LXBA 2LR2A 3E7KA 5KAIH 3FXDA 3OJAB 2QJYB 3SWFA 2KLUA 1KD1Q 1K04A 4GODA 5KLVG 1FZAA 1SQBE 1FZCA 1KB9E 1SQQJ 4I2LC 1J1EC 2K3RA 2N1TB 1KQLA 4GT1A 2Z4EA 4RKUJ 1FJKA 1KILE 4ZKUA 2WSFH 1IFDA 2QM8A 3USSA 1R8EA 1RH5B 4H0LC 1SFCD 1P84H 3Q1MA 2IFMA 1ZN5A 2QA4P 3O8ZA 2FBWC 1NTZK 1URQB 1ZP0C 1EDLA 4H44D 1AJYA 5AW6B 4D6TG 2K9JB 4DT0A 4D6TJ 1NTKD 2R3SA 5CJ0A 3OAKA 3Q3DA 3ITKA 3CLQA 1NU1E 1MFZA 2QM7A 5AW5B 2BCCG 1FZFA 3RK3E 1T6AA 3L75G 3WU2H 3L74J 3L75J 3E1IA 3H1LJ 1PPJD 2IBZD 1N7SC 3H6PA 4H0LB 1PGJA 3H1JE 2OTJP 1IK9A 1XTCC 4WY4B 5CBNA 3U1AA 1DH3A 1YITP 3C1LA 3MP7B 3A0HE 2RH0A 2A06D 2JEEA 1N73A 3L70D 2A45I 4WB4A 1L4AC 2ZJSE 2ZAEB 1EZVE 1PIXA 2YIUC 3CC7P 2O1JA 2BEZF 3M0DA 4ZNCA 1HJBA 3AEBC 1JCCA 5KJ7A 1NTKK 3H32B 1SP4A 1K73Q 1DD3A 2XNDH 1SQPK 1N7SB 1BGYE 3UIAA 1J1DC 1GW4A 3S9OA 1L0LD 1NJIQ 3H1KD 1KYOI 2OYHA 2AXTH 2OQQA 3AE5C 2J58A 1M1JB 1XTGB 1FDMA 3QH9A 4C7NA 3Q5SA 3B5NC 3WMM0 2M0BA 3CX5E 1GL2D 3PTZA 3Q2YA 4WVZA 5AVXB 1W5CE 3L71E 2FYNC 2WQYC 2H43A 1LTBC 2D2CD 4U7JA 2FFDA 2RMZA 1EXIA 4H13D 5AVQB 3QWOC 2IDBA 5CCHA 3HUSA 1SQVD 1YTZT 1SQXD 2JP3A 1VQNP 2P67A 4TLFA 4I1LA 1IFMA 1UIXA 1FZGA 3P8MC 1HF9A 1BE3D 3TF5A 1L0LK 1AA0A 5APXA
chains in the Genus database with same CATH topology
3IR9A 4GKGA 1GL2B 1JO5A 5APSA 2YO3A 1HGZA 3GHGC 3VYIA 2HYNA 5CJ4A 3HD7C 1CI6B 1ZV8A 3G3ZA 3GHGA 5CCGC 2OYIC 1A02J 4OH8B 3HD7A 1NKZB 5CCGA 2OYIA 2Z5HA 2HFED 2FFDB 2Z5IA 1JY2P 3M06A 1L4AD 3MGNA 3A5TA 5KLVK 1GK4A 2Q3IA 2M3BA 1RE3C 2XV5A 5APWA 4LGDE 1JTHB 3U59A 3HUSB 1RE3A 2PP6A 3EFGA 1URQC 4HYTB 2OARA 5KJ7C 3NTNA 2C9LY 1URQA 3VOPA 1GD2E 1HWTC 1NHLA 1URQD 1HH0A 1MUUA 2IX7C 1T3UA 1JY3N 2JJLA 5KJ7D 1S9KE 1JOCA 1T8ZA 5APYA 3V5BA 4AQRD 3HE5B 4N3YB 1IFJA 3L4FA 3HE4A 1S9KD 1SQVK 1NO4A 3V2NA 2R3CA 1SQXK 1MV8A 2YO2A 1GU5A 3BATA 1L0NK 1JY2O 1X8YA 2IFNA 3TSIA 1NTMK 1J2JB 4DZOA 2P7JA 2W27A 3P8CE 1KILC 1FU1A 1N73B 2KYVA 4DOJA 1KILA 5AVTB 1KILD 2W6BA 3P8CD 1YTZI 4C46A 3BRTB 5AW3B 2KP8A 2XNXA 4KHXA 5AW0B 1L4AB 3SWYA 3B5ND 5AVRB 2FXMA 3MTUE 1WT6A 3TNUB 3L37A 4WY4C 1T2KC 1Z56A 2A45H 3NXSA 2WPRA 1ZR4A 3RK2C 1KFNA 1OWAA 4WY4A 3V2QA 2R32A 1E5WA 5AW7B 1KFMA 4B86A 1T2KD 4C7RA 1WRGA 2XZRA 1HVVA 5CCHC 3RK2D 2H8PD 1OXZA 2KLVA 2KOGA 5CCHD 1CW5A 3A2AA 5BU5A 2E42A 1RE4C 3N7NA 1H8AA 2POHA 2NPSC 4IFFA 1RE4A 1J1DB 2NPSA 4IFDK 5AW9B 2CPSA 2NPSD 2GUVA 4W7ZA 1MZ9A 4N78E 3KYQA 2N9BA 3P7KA 2WPSA 2OYHB 1GTWA 5BVZA 3V4WA 3HRNA 2HLOA 4N78D 1GK6A 1G2CA 3CL3D 3RK3C 4C7NB 1NH4A 4O9BA 2N1TC 5CHXA 2WITA 3V2PA 3B5NB 3L36A 4LC1A 2N1TA 3H32A 2O01H 4Y99C 2N1TD 2ZXEB 4W80A 2H7HA 1SQBK 1ZLLA 1JUNA 2XDJA 4ZKPA 1JNMA 4AYCA 3HD7D 2WZ7A 3VP9A 5CCGD 3RK2B 4HH2A 1LTJC 1NOHA 2C0WA 4AUWA 2Q9IA 5AW8B 4RESB 2HPCA 1M1JC 1LTJA 2YKOA 1W2EA 1M1JA 5APVA 2WT7B 1N2DC 3A3YB 4IFMA 3RL0C 1JY3P 4W7YA 3CI9A 2VRSA 3LIDA 2HODA 5AVVB 2W6AA 4JYBA 3RL0D 3OJAB 1RF0C 3SWFA 5APUA 1IFIA 1RF0A 2WSEH 3IFMA 1FZCC 1PFIA 1LTGC 1AQ5A 2MJZA 3TK1A 1FZAA 1IC2A 4EOTA 1FZCA 3KQGA 1YYCA 1FAVA 3BASA 1AFOA 4I2LC 1J1EC 2YKPA 2N1TB 1FJPA 1KQLA 4GT1A 2Z4EA 2LKMA 1FJKA 4ZKUA 1X9VA 2WSFH 1LGHB 1IFDA 3C9IA 2QM8A 1JY3O 1HBWA 1IFNA 1VDFA 3GHGB 1SFCC 1NU1K 3HD7B 2OYIB 3M91A 2Q5UA 1SFCA 1SFCD 4LLHA 2E43A 2IFMA 1ZN5A 3M9BA 1LTAC 3O8ZA 2P2UA 4JYCA 3HTKA 1NTZK 1LWUC 2KB7P 1URQB 1LT9C 4WY4D 1FZEA 3PP5A 1LWUA 5AVYB 3RL0B 1LT9A 3L35A 3OA7A 2P1JA 1IO4A 1G1IA 3HE4B 5AW6B 3VN0A 1CI6A 5CJ0A 1M7LA 1FZCB 3OAKA 3CLQA 1JMMA 3M9HA 2XKMA 1MFZA 2QM7A 5AW5B 1G1JA 5AW1B 2HG5D 1JTHA 1NWQA 1RF1C 1LTTC 2C9NY 2WWWA 1FZFA 1FOSF 2ZFCA 1KILB 3VMZA 5AW2B 1RF1A 2FYZA 1T3JA 3VMYA 2PAJA 3LIEA 2YMYA 5AVZB 3RK3D 1SFCB 5CMZA 3E1IA 3MD0A 4XE5B 1N7SC 3H6PA 3NFQA 1JCDA 2BASA 3HE5A 1N7SA 2WPQA 4GIFA 3KPEA 1N7SD 3MUDA 1IK9A 1XTCC 3VP8A 4WY4B 3U1AA 1DH3A 2R5DA 1GW3A 2I1KA 1GZLA 3V2RA 1LT9B 3EQ2A 1QL2A 1LTIC 2YKQA 4XA4A 1N73C 1GU4A 2GM4A 3U1CA 2JEEA 3TYYA 1N73A 2XU6A 4WBAA 2A45I 4WB4A 1L4AC 3VTPC 2NPSB 2O1KA 5AVUB 1SQQK 5BU8B 1L4AA 1ZR2A 1H89A 1GDTA 4JF7A 1JY2N 1HGVA 3TNUA 3M0DC 1G2CB 2J59M 3BRVB 1RF1B 3A7OA 1NAFA 1FZBA 2O1JA 3M0DA 1HJBA 3RK3B 1JCCA 5KJ7A 1DEBA 4N6JA 1NTKK 2C0XA 3H32B 1QL1A 1SP4A 1SQPK 5APQA 4Y99B 1N7SB 1FOSE 1SLQA 3UIAA 1J1DC 3NMDA 1DX7A 1GW4A 1IJDB 2WTYA 2A45G 1X79B 2YNYA 3N4XA 3MIWA 2OYHC 4I6MC 2HPCB 2OYHA 1LTJB 4M3LA 1FBMA 2J58A 1M1JB 3B8EB 1XTGB 1FDMA 1HTLC 2CPBA 2KSJA 4C7NA 3P32A 5KTBA 1GL2C 3B5NC 2HODB 3WMM0 1EQ7A 5AW4B 1GL2A 5APXA 3B5NA 2M8RA 1GL2D 1CZQA 2I1JA 3T97A 5AVXB 1KZUB 2Q7CA 2H43A 2FFDC 2FYUK 1LTBC 1SVFA 2FFDA 3M9QA 1LTSC 3LW5H 3R2PA 5AVQB 3HUSC 2R5BA 1J1EB 1VPCA 2L5GB 5APTA 1A02F 5CCHA 3HUSA 1YTZT 3II6A 1H88A 2WT7A 4EIJA 2P67A 1CSBA 5AVSB 1RY3A 1NKNA 4I1LA 1IFMA 2WSCH 2FKWB 3I5CA 1FZGA 1HUCA 1N86A 3KDPB 3M0AA 2GUSA 3P8MC 2IPPA 3V4QA 3BVHA 3HTKB 1N7LA 3VMXA 5AVWB 1L0LK 1LWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR9 A;  3TNU A;  1H8A A;  4GKG A;  1G2C B;  3A7O A;  1NAF A;  5APS A;  2E43 A;  3M0D A;  2YO3 A;  1HJB A;  5AW9 B;  3M9B A;  3VYI A;  3O8Z A;  2P2U A;  1CI6 B;  1SP4 A;  2N9B A;  3HTK A;  4JYC A;  3P7K A;  2WPS A;  1A02 J;  1GTW A;  5APQ A;  3V4W A;  2Z5H A;  1FOS E;  1GK6 A;  1SLQ A;  5AVY B;  2Z5I A;  3UIA A;  3NMD A;  3M06 A;  3MGN A;  3A5T A;  3L35 A;  2WTY A;  1GK4 A;  2Q3I A;  2XV5 A;  5APW A;  4C7N B;  1IO4 A;  2YNY A;  3HE4 B;  5AW6 B;  3VN0 A;  3L36 A;  4I6M C;  4HYT B;  4LC1 A;  1CI6 A;  2ZXE B;  3NTN A;  2C9L Y;  2H7H A;  4M3L A;  1GD2 E;  1HWT C;  3OAK A;  1MUU A;  2JJL A;  3B8E B;  3M9H A;  1JUN A;  1S9K E;  1MFZ A;  2QM7 A;  4C7N A;  5AW5 B;  3P32 A;  5APY A;  5AW1 B;  3V5B A;  4AQR D;  1NWQ A;  3HE5 B;  4AYC A;  1JNM A;  2C9N Y;  2WWW A;  3HE4 A;  1FOS F;  5AW4 B;  2ZFC A;  1S9K D;  5APX A;  3VMZ A;  4AUW A;  5AW2 B;  5AW8 B;  2R3C A;  4RES B;  3VMY A;  1CZQ A;  1MV8 A;  2YO2 A;  1GU5 A;  3T97 A;  1X8Y A;  3LIE A;  5AVZ B;  5CMZ A;  5AVX B;  3MD0 A;  2Q7C A;  5APV A;  1J2J B;  4XE5 B;  4DZO A;  2WT7 B;  2P7J A;  3A3Y B;  3NFQ A;  2W27 A;  2BAS A;  2VRS A;  3HE5 A;  3LID A;  2WPQ A;  5AVV B;  2W6A A;  4JYB A;  5AVT B;  5AVQ B;  2R5B A;  3SWF A;  4C46 A;  5APT A;  1A02 F;  1DH3 A;  2R5D A;  5APU A;  5AW3 B;  2KP8 A;  4KHX A;  1H88 A;  5AW0 B;  1GZL A;  5AVR B;  2WT7 A;  4EOT A;  3TK1 A;  1GU4 A;  2P67 A;  1CSB A;  3KQG A;  1YYC A;  1FAV A;  3TYY A;  5AVS B;  4I2L C;  3TNU B;  3L37 A;  1T2K C;  2XU6 A;  3NXS A;  2WPR A;  3I5C A;  1KQL A;  4GT1 A;  1OWA A;  1HUC A;  3VTP C;  2R32 A;  5AW7 B;  4B86 A;  1T2K D;  3KDP B;  3M0A A;  5AVU B;  2XZR A;  2QM8 A;  1H89 A;  3P8M C;  2IPP A;  3V4Q A;  1HBW A;  1OXZ A;  3VMX A;  5AVW B;  3M91 A;  2Q5U A;  3A2A A;  2E42 A; 
#chains in the Genus database with same CATH topology
 3TGU G;  3CWB D;  3PHL A;  3GHG C;  3TGU J;  2QJP C;  1BCC D;  3G3Z A;  3I56 P;  2OYI C;  1IZN B;  1A02 J;  5CCG A;  1SQB G;  2WSE J;  3MGN A;  3SWK A;  2Q3I A;  1SQB J;  3AEF C;  1M56 D;  2OAR A;  1URQ A;  3VOP A;  1GD2 E;  3JC2 2;  1MUU A;  2IX7 C;  2JJL A;  3S4R A;  5KKZ B;  5KJ7 D;  1JOC A;  5KAI E;  1KN7 A;  5APY A;  4PJ0 E;  1IFJ A;  1SQV K;  2K9J A;  2NZ2 A;  1MKM A;  1SQX K;  1NTM K;  3RL0 g;  1KIL C;  1NYH A;  1FU1 A;  3BRT B;  2KK7 A;  4KHX A;  5AVR B;  1UII A;  2FXM A;  3MTU E;  5H2F E;  3TNU B;  4OGQ B;  1T2K C;  2A45 H;  1NU1 J;  4BXL A;  1LNQ A;  4JPZ B;  4WY4 A;  2LXC B;  1ZRT D;  3V2Q A;  1PGP A;  1U57 A;  4B86 A;  4ASV A;  1WRG A;  5M1B A;  4ZMD A;  1L0N E;  2KLV A;  4HB1 A;  5CCH D;  3H1J G;  5EFW B;  1M57 D;  3CCS P;  2E75 C;  1YI2 P;  2N9B A;  3FWL A;  3C8V A;  1JM0 A;  2Y9Z A;  4N78 D;  4JQ0 D;  3H1I D;  3RK3 C;  5E79 H;  3JCU H;  4O9B A;  1N8R Q;  1KYO H;  1NTZ E;  1BSN A;  3H32 A;  4Y99 C;  2JKV A;  2N1T D;  4W80 A;  2IZ1 A;  1IK7 A;  2NRG A;  2KUB A;  1EZV G;  4ZKP A;  1KOR A;  2WZ7 A;  5CCG D;  4HH2 A;  4AUW A;  3ZDM A;  2Q9I A;  2PRR A;  2ZYG A;  1M1J A;  2W8Z A;  1BGY G;  2WT7 B;  2I8D A;  3CI9 A;  4IOI H;  1VL2 A;  1BGY J;  4JYB A;  1DIP A;  2E75 B;  1VQP P;  1RF0 A;  3B71 A;  1LTG C;  2MJZ A;  3TK1 A;  3GF7 A;  1QX8 A;  1EC5 A;  1YYC A;  1FAV A;  3BAS A;  2JDI H;  2QEX P;  2LKM A;  3D6Y A;  1LGH B;  3C9I A;  1IFN A;  3CD6 P;  3L71 G;  3PH0 A;  3M91 A;  1SFC A;  2Q5U A;  3L71 J;  2G3A A;  4LLH A;  3CCQ P;  4H0L D;  3G4S P;  3AEE C;  1P84 D;  4BWN A;  2M5A B;  1LWU C;  3AEC C;  4GDO A;  1LT9 C;  2AEM A;  1SQQ D;  4WY4 D;  3AE2 C;  4L74 A;  1HJ0 A;  1JB0 J;  3L72 D;  2PGD A;  1RQV A;  3H25 A;  3L35 A;  4MN4 C;  3AE4 C;  2P1J A;  3S1K A;  1VQ6 P;  4U3F D;  1NTK E;  2ZT9 C;  1Y9B A;  5C39 A;  1BSH A;  1JMM A;  2E5Y A;  2HG5 D;  1NWQ A;  1RF1 C;  2QJK C;  1LTT C;  3VMY A;  5KAF E;  2IBZ E;  3V6I A;  3LIE A;  1OVU A;  2QE7 H;  2K37 A;  3MUD C;  2WPQ A;  3KPE A;  1N7S D;  2OTL P;  1OIP A;  4PD4 I;  1USE A;  1GW3 A;  3AE3 C;  3SFE C;  3BCC G;  1GZL A;  3V2R A;  1LT9 B;  3L73 G;  4XA4 A;  5KLI C;  3U1C A;  2FYU D;  3CXH D;  3L74 D;  5GTI E;  1PZQ A;  1ZW0 A;  3H1L D;  1SQQ K;  1ZR2 A;  1JY2 N;  2AEJ A;  3TNU A;  1YIJ P;  1G2C B;  2J59 M;  3BRV B;  1RF1 B;  1QEX A;  1FZB A;  1PP9 D;  3A0B H;  3WUU A;  2WSF J;  1DEB A;  4N6J A;  1RHZ B;  1VQ5 P;  4Y28 J;  5KLV J;  3PLN A;  1DX7 A;  1S2E A;  1IJD B;  4UB6 H;  3Q5P A;  2AEF A;  2P58 A;  2YXQ B;  1L0N G;  1FBM A;  3B8E B;  3AEG C;  2CPB A;  3P32 A;  5KTB A;  1AV1 A;  1L0N J;  2HOD B;  3GW6 A;  2E74 C;  1GL2 A;  3O6Q B;  2Y9Y A;  2ZYA A;  4ASW A;  2Q7C A;  2FYU K;  3W68 A;  1SVF A;  5B66 H;  3R2P A;  1SQP D;  1J1E B;  1NTZ G;  2L5G B;  5APT A;  2BCC J;  1PV3 A;  2WT7 A;  1D7M A;  4NPF X;  1KB9 I;  1RY3 A;  2QIW A;  1BE3 E;  2Y0D A;  2GUS A;  3HTK B;  4L75 A;  5AVW B;  3CWB E;  2OTK E;  1AVO A;  2E74 B;  1VQL P;  2YO3 A;  3CXH H;  2HYN A;  3HD7 C;  1CI6 B;  1S5L X;  2Z5H A;  2HFE D;  1LP1 B;  3A5T A;  4LGD E;  4IL6 X;  2CK3 H;  3FWN A;  3U59 A;  5TIS H;  1RE3 A;  4OGQ D;  4BRY B;  2M5A A;  3K5B A;  2B9B A;  1NHL A;  1HH0 A;  1JY3 N;  1Q82 Q;  1T8Z A;  4AQR D;  3HE5 B;  3AE9 C;  1H0T B;  1MV8 A;  3TDK A;  2KNC B;  1X8Y A;  1DEE G;  3IN6 A;  1QLE D;  4DZO A;  2P7J A;  3MZW B;  1SQB D;  1NTK G;  3F89 A;  1KIL D;  2W6B A;  4PD4 H;  1YTZ I;  4C46 A;  3FX0 A;  5AW3 B;  2KP8 A;  5B5E H;  1KV4 A;  4UB8 H;  1NTK J;  1L4A B;  5DJU B;  2QG4 A;  1YJN P;  1ZRT E;  3L37 A;  1EDJ A;  3NXS A;  1KFN A;  2JWA A;  2R32 A;  2YIU B;  4H44 C;  1PPJ G;  2IBZ G;  5AW7 B;  1KQF B;  1T2K D;  4C7R A;  2O01 N;  1HVV A;  2WSS H;  2RKL A;  2KSE A;  1Q90 D;  2WPV B;  2YMK A;  2KOG A;  2E42 A;  3N7N A;  1EZV I;  2NPS C;  2Y0E A;  1RE4 A;  4IFF A;  1J1D B;  4I7Z C;  1NTM D;  1MZ9 A;  4N78 E;  3KYQ A;  3H1I E;  3P7K A;  2WPS A;  1FDO A;  1S4X A;  2E75 D;  3L70 G;  2FXP A;  1NU1 D;  1G2C A;  5CHX A;  2WIT A;  2KZJ A;  4KT0 J;  5CBO A;  3B5N B;  3L36 A;  2N1T A;  1KYO D;  4L73 A;  1SQB K;  3Q5R A;  2E76 C;  3D6Z A;  1JUN A;  2JO1 A;  4GOE A;  1YJ9 P;  1S5L H;  2FYN B;  3VP9 A;  1FS0 E;  1LTJ C;  1NOH A;  2C0W A;  4IL6 H;  3CX5 I;  3KZI E;  1QGK B;  1AQT A;  2YKO A;  1W2E A;  4IFM A;  3RL0 C;  3BCC E;  2VRS A;  2HOD A;  3L73 E;  2W6A A;  4DCK A;  3O6Q A;  1OVV A;  5APU A;  2WSE H;  1FZC C;  1PFI A;  3A0B E;  4EOT A;  3FXE A;  4HKZ H;  3E1R A;  1W2B O;  3KQG A;  2YKP A;  1U7M A;  1X9V A;  4PV1 C;  1LJ2 A;  1HBW A;  1VDF A;  3GHG B;  1NU1 K;  2E76 B;  2QJP B;  4UB6 E;  2OYI B;  1OMI A;  1P84 E;  1SQV G;  2KI7 B;  2E43 A;  1SQX G;  3M9B A;  5GTH H;  1NGM B;  1SQQ E;  3LW5 J;  2P2U A;  3L72 E;  4JYC A;  3HTK A;  3PP5 A;  3RL0 B;  1U7J A;  4U3F E;  3OA7 A;  3CME P;  1G1I A;  4OVN F;  1BE3 G;  3HE4 B;  2D2C C;  2WSC J;  1CI6 A;  3ABV C;  1M7L A;  1FZC B;  3H1J J;  3CWB G;  3M9H A;  1G1J A;  5AW1 B;  1BCC G;  2WWW A;  1FOS F;  2ZFC A;  2E5T A;  1KIL B;  3VMZ A;  5AW2 B;  3W67 A;  3H1H D;  3WU2 E;  4PV1 B;  1VQM P;  5AVZ B;  4EDF A;  2QSI A;  1R5L A;  3NFQ A;  3HE5 A;  1N7S A;  4GIF A;  1H0T A;  3VP8 A;  2R5D A;  2FYU E;  1Q2N A;  1N73 C;  3GF3 A;  1GU4 A;  3A0H H;  1JMB A;  3L74 E;  3H1L E;  4WBA A;  2FY8 A;  4OWF A;  5AVU B;  5BU8 B;  1L4A A;  1GDT A;  2KS1 B;  1PP9 E;  4DJG A;  5TIS E;  1AVY A;  1HGV A;  3M0D C;  3A7O A;  3RK3 B;  2ZVO B;  3CPW O;  5APQ A;  4Y99 B;  1FOS E;  2AXC A;  1FC2 C;  1YHQ P;  1YQ4 C;  2WTY A;  1YJW P;  3N4X A;  3MIW A;  2OYH C;  1MFT A;  3WUT A;  2AXT E;  4M3L A;  2V7Q J;  1HTL C;  2KSJ A;  5B5E E;  5KLV D;  3B5N A;  2M8R A;  3CX5 H;  3AE1 C;  1CZQ A;  3AE6 C;  1L2P A;  4YXW H;  2E74 D;  3H1I G;  1S3J A;  1VQ7 P;  1KZU B;  2IZ0 A;  2Q6Q A;  2FFD C;  1SQP E;  1LTS C;  2K1A A;  3HUS C;  1A02 F;  1M1K Q;  3II6 A;  1H88 A;  2KIK A;  2O01 J;  1PPJ E;  4EIJ A;  1KQG B;  5AVS B;  1VF5 C;  2QJY C;  2RN0 A;  2FKW B;  3I5C A;  1Q81 Q;  1N86 A;  4D6T D;  3VMX A;  3D71 A;  1TU3 F;  1LWU B;  2A06 E;  2H88 C;  4GKG A;  1LT1 A;  1BDD A;  3L70 E;  3BCC J;  2ZVN B;  3VYI A;  3L73 J;  2BCC D;  5CJ4 A;  2OGU A;  1ZV8 A;  3GHG A;  1S5L E;  5CCG C;  2ZT9 B;  4OH8 B;  3L75 D;  3SSU A;  2OYI A;  2FFD B;  1JY2 P;  1L4A D;  5KLV K;  2P10 A;  1JTH B;  3G71 P;  3HUS B;  1OW6 A;  3EFG A;  1URQ C;  2QJK B;  3NTN A;  2C9L Y;  3KXD A;  1HWT C;  3AED C;  1T3U A;  1VF5 B;  3CMA P;  1L0L E;  3AE7 C;  3V5B A;  4PJ0 H;  2N9Y B;  3HE4 A;  1S9K D;  4TT3 H;  1NO4 A;  1SQQ G;  3PJS K;  3V2N A;  3H1K E;  3L72 G;  2B88 A;  2YO2 A;  1GU5 A;  1FE6 A;  1QVG O;  1L0N K;  1JY2 O;  2IBZ I;  2IFN A;  2ITA A;  4NPE A;  3L72 J;  1J2J B;  4RJT A;  4U3F G;  2KYV A;  5KLI B;  4U3F J;  1KIL A;  5AVT B;  4CPG A;  3P8C D;  4L76 A;  4K3A A;  4HJG H;  2XNX A;  1X0T A;  5AW0 B;  2IYO A;  1RQU A;  4PD4 D;  2ZYD A;  3B5N D;  3VMA A;  1X22 A;  5GTH E;  5H2F H;  4WY4 C;  4Z1M H;  1Z56 A;  2WPR A;  3RK2 C;  1OWA A;  1E5W A;  2OYO A;  1KFM A;  1SQV E;  2XZR A;  1SQX E;  1OZH A;  2B89 A;  2H8P D;  1CW5 A;  1NTM E;  4A7P A;  3GLM A;  1NTZ J;  5AW9 B;  1QVF O;  2NPS D;  2GUV A;  4W7Z A;  1EDK A;  3CC4 P;  2KS1 A;  2KZI A;  1YBK A;  2FYU G;  3V4W A;  2J5U A;  3HRN A;  2HLO A;  1GK6 A;  3CL3 D;  3L74 G;  5E79 E;  3JCU E;  4XFJ A;  1NH4 A;  1OW7 A;  2FYU J;  2PFX A;  3H1L G;  1KYO E;  4LC1 A;  1BCC E;  2H7H A;  3T97 B;  1PP9 G;  1ZLL A;  1M8O B;  2E76 D;  1PP9 J;  1JNM A;  3OW2 O;  3RK2 B;  1K9M Q;  4RES B;  1Y8A A;  1M1J C;  4EYY Q;  2O3J A;  1VQ8 P;  4EI2 A;  5APV A;  1ZME C;  1JY3 P;  4W7Y A;  3LID A;  5AVV B;  3CCR P;  1S1C X;  3RL0 D;  1RF0 C;  3TGU D;  1IFI A;  3IFM A;  4KJM A;  1AQ5 A;  1IC2 A;  4RO0 A;  1USD A;  1PGQ A;  1AFO A;  1FJP A;  5TJH A;  1KB9 D;  3MHV A;  1JY3 O;  2GA1 A;  4QMA A;  1SFC C;  3D70 A;  3HD7 B;  4PV1 D;  1SQP G;  2BEQ D;  1SQP J;  1LTA C;  4R4M A;  3WUV A;  2WVR A;  2H89 C;  1VQ9 P;  2KB7 P;  1FZE A;  1LWU A;  5AVY B;  1LT9 A;  3G9R A;  1IO4 A;  3VN0 A;  4R4L A;  4YXD C;  1VQO P;  1JEK A;  1VQ4 P;  2XKM A;  2A06 G;  3H1H E;  1JTH A;  2C9N Y;  2SPZ A;  1RF1 A;  2FYZ A;  1T3J A;  2PAJ A;  5KAF H;  3L70 J;  5KKZ C;  2B87 B;  2YMY A;  3RK3 D;  1SFC B;  5CMZ A;  3MD0 A;  4XE5 B;  2Q1K A;  1JCD A;  2BAS A;  2QRX A;  3MUD A;  1PL5 A;  3H1J D;  3I55 P;  2I1K A;  1Y47 A;  4H44 B;  3EQ2 A;  1QL2 A;  1LTI C;  1Q7Y Q;  1OX3 A;  2YKQ A;  2K88 A;  2GM4 A;  1L0L G;  3TYY A;  2XU6 A;  1KQS O;  3VTP C;  1L0L J;  2NPS B;  3H1K G;  1OVR A;  2O1K A;  5GTI H;  3CCE P;  1E79 H;  4I7Z B;  1H89 A;  3H1K J;  4JF7 A;  4OGQ C;  3SFD C;  5K5G B;  1NAF A;  1EZV D;  2QVA A;  1KB9 H;  1M90 Q;  2C0X A;  1QL1 A;  1SLQ A;  3NMD A;  2A45 G;  1X79 B;  2YNY A;  1BGY D;  4I6M C;  2HPC B;  3IAO A;  1LTJ B;  1EXJ A;  2M3E A;  1SQV J;  2UWJ E;  5KLV E;  1NTM G;  1SQX J;  1GL2 C;  1EQ7 A;  5AW4 B;  1NTM J;  2I1J A;  1NU1 G;  3T97 A;  3R4Y A;  1KC8 Q;  2YXR B;  3CX5 D;  1FDI A;  1R5S A;  3GMA A;  1BE3 J;  4H13 C;  3CC2 P;  2ZT9 D;  5B66 E;  3EFF K;  3L71 D;  3M9Q A;  3LW5 H;  1LP1 A;  2R5B A;  1KMI Z;  1VPC A;  2KXP B;  3CWB J;  2ZXX A;  4BRY A;  2W83 C;  1BCC J;  3RBX A;  1CSB A;  3EWK A;  1NKN A;  2WSC H;  2K9Y A;  2HR3 A;  3FGA D;  1HUC A;  4D6T E;  1VF5 D;  3KDP B;  3M0A A;  2IYP A;  2IPP A;  3V4Q A;  2G8Y A;  2R44 A;  3BVH A;  1Q86 Q;  1N7L A;  2KNC A;  2JR8 A;  3IR9 A;  3AEA C;  1GL2 B;  1JO5 A;  2BCC E;  1NVO A;  5APS A;  1P84 I;  1WMK A;  1HGZ A;  1ZXG A;  3CXH E;  3AE8 C;  3L75 E;  4K35 A;  2D2C B;  3HD7 A;  1NKZ B;  1PGO A;  4H13 B;  2Z5I A;  2W6J H;  3M06 A;  2Y0C A;  1GK4 A;  2XV5 A;  2M3B A;  1RE3 C;  5APW A;  3RBZ A;  2PP6 A;  4HYT B;  1OW8 A;  5KJ7 C;  3KHU A;  1GMJ A;  1NAY A;  1VQK P;  1URQ D;  1S9K E;  2MKV A;  3BCC D;  2Q3E A;  3L73 D;  4N3Y B;  3L4F A;  2R3C A;  4YPC A;  3BAT A;  3TSI A;  4GOF A;  2W90 A;  3IF4 A;  2W27 A;  3P8C E;  3CCV P;  1N73 B;  3CCJ P;  4DOJ A;  1BDC A;  4PD4 E;  3CCM P;  3F5H A;  2B87 A;  4UB8 E;  3G6E P;  1K05 A;  3SWY A;  1K8A Q;  3H1H G;  1WT6 A;  2FXO A;  3CXH I;  3H1I J;  1ZR4 A;  3H1H J;  1DD4 A;  3CCU P;  5CCH C;  2V7Q H;  3RK2 D;  2WMM A;  1OXZ A;  3CCL P;  4JBZ A;  3A2A A;  5BU5 A;  1RE4 C;  1H8A A;  2POH A;  1L0N D;  3PRJ A;  2NPS A;  4IFD K;  2DW3 A;  2CPS A;  4NPD A;  2JWD A;  2OYH B;  1GTW A;  5BVZ A;  4WWI A;  5L8R J;  1EDI A;  3B4S A;  5DJT B;  4C7N B;  1ZOY C;  3RGU A;  2N1T C;  3V2P A;  1SS1 A;  1IFP A;  2O01 H;  2ZXE B;  2V4H A;  1NTZ D;  3JSV C;  2L91 A;  2XDJ A;  1OFC X;  4AYC A;  3HD7 D;  5AW8 B;  4IL6 E;  2HPC A;  3KZI H;  1LTJ A;  1YQ3 C;  3GG2 A;  1KTM A;  4YTP C;  1N2D C;  3A3Y B;  1S72 P;  3TGU E;  2LXB A;  2LR2 A;  3E7K A;  5KAI H;  3FXD A;  3OJA B;  2QJY B;  3SWF A;  2KLU A;  1KD1 Q;  1K04 A;  4GOD A;  5KLV G;  1FZA A;  1SQB E;  1FZC A;  1KB9 E;  1SQQ J;  4I2L C;  1J1E C;  2K3R A;  2N1T B;  1KQL A;  4GT1 A;  2Z4E A;  4RKU J;  1FJK A;  1KIL E;  4ZKU A;  2WSF H;  1IFD A;  2QM8 A;  3USS A;  1R8E A;  1RH5 B;  4H0L C;  1SFC D;  1P84 H;  3Q1M A;  2IFM A;  1ZN5 A;  2QA4 P;  3O8Z A;  2FBW C;  1NTZ K;  1URQ B;  1ZP0 C;  1EDL A;  4H44 D;  1AJY A;  5AW6 B;  4D6T G;  2K9J B;  4DT0 A;  4D6T J;  1NTK D;  2R3S A;  5CJ0 A;  3OAK A;  3Q3D A;  3ITK A;  3CLQ A;  1NU1 E;  1MFZ A;  2QM7 A;  5AW5 B;  2BCC G;  1FZF A;  3RK3 E;  1T6A A;  3L75 G;  3WU2 H;  3L74 J;  3L75 J;  3E1I A;  3H1L J;  1PPJ D;  2IBZ D;  1N7S C;  3H6P A;  4H0L B;  1PGJ A;  3H1J E;  2OTJ P;  1IK9 A;  1XTC C;  4WY4 B;  5CBN A;  3U1A A;  1DH3 A;  1YIT P;  3C1L A;  3MP7 B;  3A0H E;  2RH0 A;  2A06 D;  2JEE A;  1N73 A;  3L70 D;  2A45 I;  4WB4 A;  1L4A C;  2ZJS E;  2ZAE B;  1EZV E;  1PIX A;  2YIU C;  3CC7 P;  2O1J A;  2BEZ F;  3M0D A;  4ZNC A;  1HJB A;  3AEB C;  1JCC A;  5KJ7 A;  1NTK K;  3H32 B;  1SP4 A;  1K73 Q;  1DD3 A;  2XND H;  1SQP K;  1N7S B;  1BGY E;  3UIA A;  1J1D C;  1GW4 A;  3S9O A;  1L0L D;  1NJI Q;  3H1K D;  1KYO I;  2OYH A;  2AXT H;  2OQQ A;  3AE5 C;  2J58 A;  1M1J B;  1XTG B;  1FDM A;  3QH9 A;  4C7N A;  3Q5S A;  3B5N C;  3WMM 0;  2M0B A;  3CX5 E;  1GL2 D;  3PTZ A;  3Q2Y A;  4WVZ A;  5AVX B;  1W5C E;  3L71 E;  2FYN C;  2WQY C;  2H43 A;  1LTB C;  2D2C D;  4U7J A;  2FFD A;  2RMZ A;  1EXI A;  4H13 D;  5AVQ B;  3QWO C;  2IDB A;  5CCH A;  3HUS A;  1SQV D;  1YTZ T;  1SQX D;  2JP3 A;  1VQN P;  2P67 A;  4TLF A;  4I1L A;  1IFM A;  1UIX A;  1FZG A;  3P8M C;  1HF9 A;  1BE3 D;  3TF5 A;  1L0L K;  1AA0 A;  5APX A; 
#chains in the Genus database with same CATH homology
 3IR9 A;  4GKG A;  1GL2 B;  1JO5 A;  5APS A;  2YO3 A;  1HGZ A;  3GHG C;  3VYI A;  2HYN A;  5CJ4 A;  3HD7 C;  1CI6 B;  1ZV8 A;  3G3Z A;  3GHG A;  5CCG C;  2OYI C;  1A02 J;  4OH8 B;  3HD7 A;  1NKZ B;  5CCG A;  2OYI A;  2Z5H A;  2HFE D;  2FFD B;  2Z5I A;  1JY2 P;  3M06 A;  1L4A D;  3MGN A;  3A5T A;  5KLV K;  1GK4 A;  2Q3I A;  2M3B A;  1RE3 C;  2XV5 A;  5APW A;  4LGD E;  1JTH B;  3U59 A;  3HUS B;  1RE3 A;  2PP6 A;  3EFG A;  1URQ C;  4HYT B;  2OAR A;  5KJ7 C;  3NTN A;  2C9L Y;  1URQ A;  3VOP A;  1GD2 E;  1HWT C;  1NHL A;  1URQ D;  1HH0 A;  1MUU A;  2IX7 C;  1T3U A;  1JY3 N;  2JJL A;  5KJ7 D;  1S9K E;  1JOC A;  1T8Z A;  5APY A;  3V5B A;  4AQR D;  3HE5 B;  4N3Y B;  1IFJ A;  3L4F A;  3HE4 A;  1S9K D;  1SQV K;  1NO4 A;  3V2N A;  2R3C A;  1SQX K;  1MV8 A;  2YO2 A;  1GU5 A;  3BAT A;  1L0N K;  1JY2 O;  1X8Y A;  2IFN A;  3TSI A;  1NTM K;  1J2J B;  4DZO A;  2P7J A;  2W27 A;  3P8C E;  1KIL C;  1FU1 A;  1N73 B;  2KYV A;  4DOJ A;  1KIL A;  5AVT B;  1KIL D;  2W6B A;  3P8C D;  1YTZ I;  4C46 A;  3BRT B;  5AW3 B;  2KP8 A;  2XNX A;  4KHX A;  5AW0 B;  1L4A B;  3SWY A;  3B5N D;  5AVR B;  2FXM A;  3MTU E;  1WT6 A;  3TNU B;  3L37 A;  4WY4 C;  1T2K C;  1Z56 A;  2A45 H;  3NXS A;  2WPR A;  1ZR4 A;  3RK2 C;  1KFN A;  1OWA A;  4WY4 A;  3V2Q A;  2R32 A;  1E5W A;  5AW7 B;  1KFM A;  4B86 A;  1T2K D;  4C7R A;  1WRG A;  2XZR A;  1HVV A;  5CCH C;  3RK2 D;  2H8P D;  1OXZ A;  2KLV A;  2KOG A;  5CCH D;  1CW5 A;  3A2A A;  5BU5 A;  2E42 A;  1RE4 C;  3N7N A;  1H8A A;  2POH A;  2NPS C;  4IFF A;  1RE4 A;  1J1D B;  2NPS A;  4IFD K;  5AW9 B;  2CPS A;  2NPS D;  2GUV A;  4W7Z A;  1MZ9 A;  4N78 E;  3KYQ A;  2N9B A;  3P7K A;  2WPS A;  2OYH B;  1GTW A;  5BVZ A;  3V4W A;  3HRN A;  2HLO A;  4N78 D;  1GK6 A;  1G2C A;  3CL3 D;  3RK3 C;  4C7N B;  1NH4 A;  4O9B A;  2N1T C;  5CHX A;  2WIT A;  3V2P A;  3B5N B;  3L36 A;  4LC1 A;  2N1T A;  3H32 A;  2O01 H;  4Y99 C;  2N1T D;  2ZXE B;  4W80 A;  2H7H A;  1SQB K;  1ZLL A;  1JUN A;  2XDJ A;  4ZKP A;  1JNM A;  4AYC A;  3HD7 D;  2WZ7 A;  3VP9 A;  5CCG D;  3RK2 B;  4HH2 A;  1LTJ C;  1NOH A;  2C0W A;  4AUW A;  2Q9I A;  5AW8 B;  4RES B;  2HPC A;  1M1J C;  1LTJ A;  2YKO A;  1W2E A;  1M1J A;  5APV A;  2WT7 B;  1N2D C;  3A3Y B;  4IFM A;  3RL0 C;  1JY3 P;  4W7Y A;  3CI9 A;  2VRS A;  3LID A;  2HOD A;  5AVV B;  2W6A A;  4JYB A;  3RL0 D;  3OJA B;  1RF0 C;  3SWF A;  5APU A;  1IFI A;  1RF0 A;  2WSE H;  3IFM A;  1FZC C;  1PFI A;  1LTG C;  1AQ5 A;  2MJZ A;  3TK1 A;  1FZA A;  1IC2 A;  4EOT A;  1FZC A;  3KQG A;  1YYC A;  1FAV A;  3BAS A;  1AFO A;  4I2L C;  1J1E C;  2YKP A;  2N1T B;  1FJP A;  1KQL A;  4GT1 A;  2Z4E A;  2LKM A;  1FJK A;  4ZKU A;  1X9V A;  2WSF H;  1LGH B;  1IFD A;  3C9I A;  2QM8 A;  1JY3 O;  1HBW A;  1IFN A;  1VDF A;  3GHG B;  1SFC C;  1NU1 K;  3HD7 B;  2OYI B;  3M91 A;  2Q5U A;  1SFC A;  1SFC D;  4LLH A;  2E43 A;  2IFM A;  1ZN5 A;  3M9B A;  1LTA C;  3O8Z A;  2P2U A;  4JYC A;  3HTK A;  1NTZ K;  1LWU C;  2KB7 P;  1URQ B;  1LT9 C;  4WY4 D;  1FZE A;  3PP5 A;  1LWU A;  5AVY B;  3RL0 B;  1LT9 A;  3L35 A;  3OA7 A;  2P1J A;  1IO4 A;  1G1I A;  3HE4 B;  5AW6 B;  3VN0 A;  1CI6 A;  5CJ0 A;  1M7L A;  1FZC B;  3OAK A;  3CLQ A;  1JMM A;  3M9H A;  2XKM A;  1MFZ A;  2QM7 A;  5AW5 B;  1G1J A;  5AW1 B;  2HG5 D;  1JTH A;  1NWQ A;  1RF1 C;  1LTT C;  2C9N Y;  2WWW A;  1FZF A;  1FOS F;  2ZFC A;  1KIL B;  3VMZ A;  5AW2 B;  1RF1 A;  2FYZ A;  1T3J A;  3VMY A;  2PAJ A;  3LIE A;  2YMY A;  5AVZ B;  3RK3 D;  1SFC B;  5CMZ A;  3E1I A;  3MD0 A;  4XE5 B;  1N7S C;  3H6P A;  3NFQ A;  1JCD A;  2BAS A;  3HE5 A;  1N7S A;  2WPQ A;  4GIF A;  3KPE A;  1N7S D;  3MUD A;  1IK9 A;  1XTC C;  3VP8 A;  4WY4 B;  3U1A A;  1DH3 A;  2R5D A;  1GW3 A;  2I1K A;  1GZL A;  3V2R A;  1LT9 B;  3EQ2 A;  1QL2 A;  1LTI C;  2YKQ A;  4XA4 A;  1N73 C;  1GU4 A;  2GM4 A;  3U1C A;  2JEE A;  3TYY A;  1N73 A;  2XU6 A;  4WBA A;  2A45 I;  4WB4 A;  1L4A C;  3VTP C;  2NPS B;  2O1K A;  5AVU B;  1SQQ K;  5BU8 B;  1L4A A;  1ZR2 A;  1H89 A;  1GDT A;  4JF7 A;  1JY2 N;  1HGV A;  3TNU A;  3M0D C;  1G2C B;  2J59 M;  3BRV B;  1RF1 B;  3A7O A;  1NAF A;  1FZB A;  2O1J A;  3M0D A;  1HJB A;  3RK3 B;  1JCC A;  5KJ7 A;  1DEB A;  4N6J A;  1NTK K;  2C0X A;  3H32 B;  1QL1 A;  1SP4 A;  1SQP K;  5APQ A;  4Y99 B;  1N7S B;  1FOS E;  1SLQ A;  3UIA A;  1J1D C;  3NMD A;  1DX7 A;  1GW4 A;  1IJD B;  2WTY A;  2A45 G;  1X79 B;  2YNY A;  3N4X A;  3MIW A;  2OYH C;  4I6M C;  2HPC B;  2OYH A;  1LTJ B;  4M3L A;  1FBM A;  2J58 A;  1M1J B;  3B8E B;  1XTG B;  1FDM A;  1HTL C;  2CPB A;  2KSJ A;  4C7N A;  3P32 A;  5KTB A;  1GL2 C;  3B5N C;  2HOD B;  3WMM 0;  1EQ7 A;  5AW4 B;  1GL2 A;  5APX A;  3B5N A;  2M8R A;  1GL2 D;  1CZQ A;  2I1J A;  3T97 A;  5AVX B;  1KZU B;  2Q7C A;  2H43 A;  2FFD C;  2FYU K;  1LTB C;  1SVF A;  2FFD A;  3M9Q A;  1LTS C;  3LW5 H;  3R2P A;  5AVQ B;  3HUS C;  2R5B A;  1J1E B;  1VPC A;  2L5G B;  5APT A;  1A02 F;  5CCH A;  3HUS A;  1YTZ T;  3II6 A;  1H88 A;  2WT7 A;  4EIJ A;  2P67 A;  1CSB A;  5AVS B;  1RY3 A;  1NKN A;  4I1L A;  1IFM A;  2WSC H;  2FKW B;  3I5C A;  1FZG A;  1HUC A;  1N86 A;  3KDP B;  3M0A A;  2GUS A;  3P8M C;  2IPP A;  3V4Q A;  3BVH A;  3HTK B;  1N7L A;  3VMX A;  5AVW B;  1L0L K;  1LWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...