3L36A

Pie12 d-peptide against hiv entry
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l36A00
2QM7A 2R5DA 3P8MC 1A02J 2IPPA 1KQLA 4I2LC 3V4WA 3M9BA 5APQA 4GKGA 3P32A 4AYCA 1HJBA 3HE4A 2BASA 4I6MC 2YO3A 3O8ZA 3VTPC 3NXSA 2R5BA 1X8YA 2Q5UA 4C7NA 2Z5HA 3IR9A 2W6AA 4XE5B 5APTA 3A2AA 3NFQA 4AUWA 3HE5B 4KHXA 4EOTA 3A3YB 3M91A 5AW1B 4HYTB 2N9BA 1S9KD 5AW9B 2P7JA 5AW6B 5AVRB 3M0DA 1IO4A 5APSA 1MV8A 5AVWB 1HUCA 5CMZA 3L35A 3LIDA 1GK4A 2R32A 3M9HA 5APUA 3A5TA 2WWWA 1GD2E 3L37A 1GZLA 1JUNA 2E43A 2WPSA 1H8AA 3TNUA 4C46A 1GU4A 4GT1A 3M06A 5AVVB 1OWAA 1GK6A 3MD0A 1OXZA 2Q3IA 4LC1A 3KDPB 4M3LA 5APXA 3VMXA 2ZXEB 2ZFCA 1DH3A 1FOSE 2JJLA 1GTWA 1MUUA 5AVQB 2R3CA 2W27A 3HE5A 2E42A 1FAVA 5APVA 2WT7B 5AW7B 3I5CA 5AW3B 3VMZA 2WPRA 2WTYA 5AVUB 3T97A 4B86A 3OAKA 5AW0B 5AW4B 1YYCA 5AVYB 3KQGA 3MGNA 5AVTB 4C7NB 1H89A 1SP4A 3A7OA 3V4QA 5AW5B 1NAFA 5AVSB 1JNMA 1SLQA 1A02F 4DZOA 2XU6A 2VRSA 1G2CB 2P67A 1CI6B 1H88A 1GU5A 1MFZA 1T2KC 2KP8A 1J2JB 2XZRA 2Q7CA 2QM8A 3TYYA 3VN0A 3V5BA 2H7HA 1HBWA 4JYBA 2YO2A 3HE4B 3TNUB 1CZQA 3P7KA 2WT7A 1CSBA 5AW8B 5AVZB 1T2KD 3SWFA 5AW2B 3HTKA 3TK1A 4JYCA 3B8EB 3LIEA 4AQRD 5APYA 3VMYA 3VYIA 3NMDA 2XV5A 2YNYA 3M0AA 3NTNA 4RESB 5APWA 5AVXB 1NWQA 1HWTC 2WPQA 2P2UA 2C9LY 3UIAA 2Z5IA 1CI6A 3L36A 2C9NY 1S9KE 1FOSF
chains in the Genus database with same CATH superfamily
2ITAA 1OMIA 2ZYGA 1N7SB 3O8ZA 1IC2A 2HR3A 4XE5B 2KZJA 4HJGH 3CXHH 3L72G 4WB4A 1NTMG 3IFMA 3JC22 5AVWB 4N78E 2E76C 5KLVE 2NRGA 1SQPJ 2E43A 1GU4A 1OW8A 4XFJA 1OWAA 1D7MA 3Q5RA 2AXTE 1LT9A 1FZEA 3BASA 3TGUD 2M3EA 1GW3A 5AVQB 3G6EP 1KZUB 1QGKB 3MUDC 1PFIA 1JEKA 2ZT9C 3RK2D 1FZFA 2OGUA 1H89A 2ZXXA 1SP4A 5M1BA 5AW5B 2YXRB 1RF0A 3H1KD 3B5NB 1SQPE 1H88A 2NPSB 4L74A 1KC8Q 2QM8A 2Y9ZA 3PLNA 3CXHE 1S72P 3P7KA 2RKLA 2FYNC 1KILE 4JYCA 1R5LA 3B8EB 3GMAA 1LT9B 1RE4C 4RKUJ 1JCCA 3FWLA 3TDKA 2C9NY 1NU1G 1L2PA 2R5DA 4D6TD 1L0LG 1JY3O 3P8MC 3CLQA 2Z4EA 5APQA 3P32A 4NPDA 2YO3A 1N7SC 3I56P 2D2CD 5KLIB 1JCDA 4EOTA 2N9BA 3PH0A 2RH0A 1N73B 1EDIA 2E5TA 2KSEA 3AE4C 2QE7H 1MFTA 2ZAEB 1FC2C 1NTMK 3M06A 5APXA 1S4XA 2ZXEB 4NPEA 1KYOD 1VDFA 3HE5A 4JBZA 3L71D 3H1IG 5KAFE 5AW3B 1IFPA 1PGQA 2OARA 2O1JA 4ZMDA 5DJUB 1EDLA 1SLQA 1PP9D 2VRSA 1PV3A 1Y47A 1KYOI 5CCHA 1CW5A 5GTHH 3B4SA 3B5NC 1LNQA 4JYBA 4RJTA 2NPSC 1PIXA 1NTMJ 3AE5C 1QVFO 1T2KD 3L75D 2XV5A 1LWUA 3AE2C 4GDOA 3L74G 1LT9C 2Q3EA 1M7LA 4HKZH 2HPCA 3CWBJ 2QJYB 4R4MA 5B66E 2KZIA 1OFCX 1X79B 1KTMA 2LXBA 2IBZD 1NU1K 2YIUB 1NTME 1RF0C 1NH4A 1L0LK 1LJ2A 4AUWA 3L70D 3A3YB 2E5YA 3PRJA 4IL6H 3E1IA 5KLIC 1KMIZ 5GTHE 5APUA 3L37A 1EZVG 1N73C 3VMAA 1Q82Q 3SFDC 1BE3D 2IBZI 3CWBE 5KJ7D 1OXZA 1NTZG 1M1JA 2WSCH 1AVYA 1HH0A 2E75D 1SQQJ 2E42A 4L73A 2QG4A 5KLVD 3E7KA 3CD6P 5BU8B 1K04A 1L0LJ 5B5EH 1N86A 3KXDA 1U7MA 4EI2A 2K37A 4PD4I 4CPGA 2KLVA 3CCSP 2IX7C 3P8CE 1L4AB 1U7JA 2FKWB 3LIEA 2FXMA 1JY2P 2A45H 5AVXB 1RY3A 1L0LE 2V7QJ 2HG5D 3ABVC 1LTBC 3K5BA 3U59A 4H0LB 4W7ZA 3HD7D 4GKGA 1KILD 3HE4A 3W68A 2QJYC 4C7NA 2YIUC 2K9YA 5CCHC 2K3RA 1N7LA 3WUUA 4H13B 3CXHI 3D71A 1GK4A 2W6BA 4UB8E 1Y8AA 2WITA 4OGQB 3C8VA 1VQNP 2KUBA 3H1IE 1GL2D 3KZIH 5KJ7A 1N2DC 2K88A 2W27A 2M5AA 3L74J 2WPRA 5AVUB 3OAKA 3RBZA 1NTZK 2FFDA 4C7NB 2RN0A 4A7PA 2GA1A 4RO0A 1QL1A 2KLUA 1CI6B 2KXPB 1T8ZA 3IN6A 1GU5A 2IFMA 1BCCG 2KP8A 3LW5H 4OWFA 4YXDC 1M8OB 4ZNCA 1USEA 3E1RA 5AW8B 4WY4B 3L74E 3SSUA 2JP3A 5TISE 1L4AC 3CPWO 3NTNA 3CCLP 1R5SA 1FOSF 2MKVA 3RL0D 3B71A 1NTZJ 3V6IA 3KZIE 2R44A 4I2LC 2B87B 2A06E 1HJBA 1K73Q 1FDIA 4H0LC 2KOGA 4BRYB 2UWJE 1S2EA 1SQBJ 2OTKE 1JB0J 3M0DA 2LKMA 3M9HA 3AEDC 1GZLA 3H1HD 2G3AA 3CX5H 4H13C 1NTZE 3H1JG 1VQ5P 1ZR2A 1RF1A 1G1IA 4OGQC 1IJDB 2JWAA 4HH2A 1MUUA 5CCGC 2N9YB 1FAVA 1GL2A 4U3FJ 2IYPA 3N4XA 1HTLC 3CC4P 2HODA 3A0HH 1VF5B 3MGNA 2N1TB 3BATA 3A7OA 2I8DA 3CWBD 3AEEC 2IDBA 3H32B 1A02F 4DZOA 2P67A 1MFZA 3PHLA 1J2JB 2Q7CA 1FZCB 2XKMA 1LTTC 1CSBA 2J58A 1BGYJ 1VQ4P 1SQXG 1MKMA 5AW2B 1RF1B 1VQ6P 3WUVA 3VYIA 1PPJE 3CX5E 4WY4C 2P2UA 1ZRTE 1G2CA 1OW6A 3CL3D 3P8CD 4EIJA 2H43A 4GOFA 1KQLA 1YQ4C 1SQQD 2PFXA 1S5LH 1X22A 2OTJP 1ZXGA 2YKOA 2XNDH 1NGMB 1L0LD 5DJTB 3RK3B 4K35A 3CCEP 3V2PA 3CC7P 2FYZA 2PP6A 1ZW0A 1OZHA 3L4FA 1BCCJ 5C39A 2WPSA 1H8AA 3TNUA 2KNCA 5AVVB 1RH5B 1NKZB 2Q3IA 4PD4E 1AJYA 1NTKG 1LTIC 1KORA 2WT7B 2C0WA 2B9BA 3HTKB 1YYCA 3OJAB 1LT1A 3OW2O 1QX8A 1EQ7A 3QWOC 2P58A 4DT0A 2AEJA 5AVSB 1BCCE 1VF5C 1S5LE 1J1DB 2N1TC 3GHGA 3KHUA 4GIFA 3M9QA 3A0BE 2OYOA 1HBWA 3G4SP 1LTSC 3TNUB 4TLFA 2JEEA 1FZCC 1YJNP 5AVZB 2YMYA 1EXJA 3U1CA 2YMKA 1RF1C 3H1JJ 2O01H 4N3YB 1YHQP 2K9JA 4ZKUA 2FXPA 2WSSH 3V4WA 1KN7A 3L74D 3H1LG 2Y0EA 2W6AA 3L73J 1FS0E 2O01J 4N6JA 1PZQA 1BSNA 1SVFA 3BCCJ 3KYQA 1X9VA 1SFCD 1VQKP 2XDJA 5CMZA 3RK3C 3H1JE 5K5GB 2A06D 2WWWA 2QSIA 3ZDMA 1IK7A 1IZNB 4OVNF 1IFMA 2PGDA 2OYHA 2DW3A 1YJ9P 3S1KA 2K1AA 3BVHA 2H8PD 2V4HA 3EWKA 4H44B 5KAIH 5APVA 3L73E 1FE6A 1OW7A 3VMZA 1SQVD 3Q2YA 1AQTA 1NTZD 3BCCE 3V2RA 1NTKK 1ZLLA 2QJKB 1Z56A 4Y28J 1EZVI 3GW6A 1YQ3C 1J1DC 1SQBD 2RMZA 2WZ7A 2YO2A 1S3JA 2OYHB 1E5WA 2A45G 2P1JA 1ZR4A 2JO1A 2HLOA 1RE3A 5CBNA 2WQYC 4LGDE 1JY2O 3HRNA 1LP1A 2BEZF 2QM7A 1YITP 2QIWA 1PGOA 5L8RJ 3CCRP 3CI9A 3AE6C 3L72J 1NTKJ 4AYCA 4U3FD 3WU2H 3CC2P 4Z1MH 1P84H 1PPJD 2IYOA 3IR9A 2BEQD 1NYHA 3AE9C 4W7YA 4EYYQ 1ZRTD 3HE5B 3H1KG 1ZMEC 5CHXA 3Q1MA 3JCUH 1MV8A 5CJ0A 4PJ0H 3LIDA 2R32A 2W6JH 3RK2B 1SFCA 4C46A 4WBAA 3L72E 1K9MQ 1KFNA 1KB9H 3CX5I 1BGYD 1NTKE 2KS1A 1FOSE 1JM0A 2G8YA 3WMM0 3AE8C 2CK3H 3G71P 1W5CE 4B86A 4PV1D 4H44C 2WPVB 3RL0g 1LWUB 2M8RA 4UB6H 2B88A 4YXWH 3R4YA 1W2BO 1M1KQ 3F5HA 3WU2E 1VQ8P 4PD4D 1P84E 2HPCB 2QJKC 2B89A 5CJ4A 2ZVOB 4N78D 3QH9A 1NU1J 3TK1A 1T3JA 1UIXA 3EQ2A 5E79H 4IFDK 2OYHC 5APWA 3O6QA 1NAYA 3GF7A 3C9IA 2D2CB 2WSCJ 1URQD 3MTUE 3L71G 2I1JA 4IL6E 1NU1E 1M1JB 1SQPD 2OYIA 4HB1A 1PP9G 3AEAC 5AW6B 4EDFA 2JR8A 3CXHD 1GD2E 1NJIQ 1KV4A 3W67A 3H1IJ 1AVOA 3O6QB 3RK2C 1S5LX 4M3LA 1HJ0A 3L75G 3CCUP 2E76D 4NPFX 2GUSA 5B5EE 1AQ5A 5GTIH 5E79E 1JY3N 3H1JD 3T97A 2JWDA 1KQSO 2ZVNB 4I1LA 4K3AA 2ZT9D 1S1CX 1YTZI 1LWUC 2KI7B 4C7RA 2H89C 1NOHA 1QL2A 3L73D 3L70G 3H1KJ 3HE4B 1KD1Q 1PGJA 3BCCD 3CCQP 4U7JA 1N8RQ 4YTPC 1BE3G 2Y0DA 4JQ0D 2Z5IA 3MHVA 1NKNA 2M3BA 2XNXA 1RQVA 2P10A 3T97B 3PTZA 1LTJA 2D2CC 1DIPA 5GTIE 3TF5A 1URQA 4I6MC 4IOIH 3H1KE 2Q5UA 3HUSA 4QMAA 3CCMP 3A2AA 2M5AB 3LW5J 2FYUG 4HYTB 5AW9B 2P7JA 2FY8A 1M1JC 1X0TA 1N7SD 2E75B 1KQFB 2FFDB 3A5TA 1ZN5A 1YBKA 1K05A 1KYOH 4GT1A 3OA7A 1Q81Q 3F89A 1FBMA 3HD7A 1KILA 4IFFA 2ZFCA 1DH3A 4W80A 2NZ2A 1LTJB 5BU5A 3VP8A 2GUVA 1EZVE 1TU3F 5AW7B 1EXIA 2W8ZA 2OQQA 1DEEG 5AVYB 3KQGA 3HUSB 2Y9YA 3EFGA 3JSVC 3V4QA 1XTGB 1QVGO 3L72D 1IFJA 5EFWB 1NTMD 1NTKD 1JTHA 2FBWC 1T2KC 2KB7P 3MUDA 1OIPA 1GW4A 3S4RA 1GDTA 4L75A 3CCVP 3VP9A 1L0NG 2H7HA 4LLHA 3FGAD 1PP9J 3HD7B 1KILB 3B5ND 1QLED 2NPSD 3UIAA 3BRVB 3AEFC 3H6PA 2BASA 1RE4A 3VTPC 1PP9E 1IFDA 1NHLA 2O1KA 1GL2B 1P84I 5KJ7C 2HODB 2J59M 3SFEC 5KKZB 1N7SA 2E75C 3L70J 2FYUK 2FFDC 3A0HE 3Q3DA 1NU1D 3RGUA 5KTBA 1KB9I 2R3SA 1BE3J 4L76A 2SPZA 1LTJC 2WTYA 1EC5A 2C0XA 2AXTH 3N7NA 1URQC 2FXOA 1G2CB 3HUSC 1Q86Q 4BWNA 4DCKA 3L70E 4ASVA 2KK7A 1OVVA 1KFMA 3RL0B 2QJPB 3MZWB 1VQLP 1CZQA 2FYUJ 4IL6X 1EDJA 1BE3E 3H1HG 1L0NK 2C9LY 3H1ID 4WVZA 3HD7C 1KILC 1VQ7P 2CPSA 3B5NA 3CMEP 3MP7B 2NPSA 1VL2A 3M0DC 3M9BA 2KNCB 3SWYA 4TT3H 2FYUE 1G1JA 1VPCA 2Z5HA 2YXQB 3CWBG 2BCCG 4ZKPA 1SQXK 1SS1A 1ZV8A 2IZ0A 2A45I 5APSA 1NO4A 3EFFK 1GL2C 3L35A 2L5GB 1JUNA 1H0TA 4DOJA 1L0NJ 5CCHD 1RHZB 3MD0A 3FXDA 5KKZC 3GHGB 3KPEA 1GTWA 2M0BA 3AEBC 3V2NA 1LGHB 1N73A 5AW0B 5AVTB 1JO5A 3VOPA 1NAFA 1E79H 1SQQG 3USSA 2XU6A 2PAJA 5KAFH 1SQXJ 1L0NE 1DX7A 1BDDA 2K9JB 1EZVD 1YIJP 1H0TB 2E74D 1XTCC 1IFNA 1EDKA 4OH8B 2Q9IA 2IZ1A 3RL0C 2QJPC 3FWNA 3VMYA 2O3JA 2YNYA 2KIKA 2WPQA 1J1EB 1YTZT 1W2EA 2O01N 1L4AD 1SQXE 3AEGC 2QA4P 1YJWP 1VQOP 1WT6A 2R5BA 1USDA 2OTLP 3RK3E 1PL5A 3M91A 5B66H 1FJPA 1GMJA 4DJGA 4H0LD 1AV1A 3TGUG 2KSJA 4XA4A 5KAIE 2PRRA 3CX5D 2LXCB 4ASWA 1FJKA 3H1HJ 4H13D 3MIWA 3GHGC 4WWIA 3AE1C 1MZ9A 1IFIA 2HFED 4OGQD 2AEMA 1Q7YQ 5CCGD 4JF7A 1LP1B 2H88C 2YKQA 4GOEA 2XZRA 1R8EA 1Q2NA 2I1KA 2HYNA 3VN0A 2BCCJ 3FXEA 1SQQK 1FU1A 3GLMA 3H1HE 1DD3A 1RQUA 4D6TG 1T3UA 1FZGA 2A06G 5CBOA 3M0AA 1NWQA 3BRTB 4JPZB 1S9KE 3R2PA 1JY3P 3H1LJ 3Q5PA 1T6AA 2WSEH 1J1EC 1A02J 3IF4A 4GODA 4WY4D 1BSHA 1SFCB 3GF3A 1L4AA 1SQVG 2BCCE 3JCUE 4PJ0E 1BCCD 2KS1B 3AECC 2AEFA 5APTA 3NFQA 2JKVA 4KHXA 1HGVA 5AW1B 2ZJSE 1UIIA 1KB9E 1ZP0C 1YI2P 2WSEJ 1IO4A 1HUCA 1PGPA 2E74B 3PJSK 4R4LA 3U1AA 2W90A 3H1LE 5BVZA 1SQBG 2FYUD 1M56D 1M90Q 2JJLA 2V7QH 2R3CA 4UB6E 4UB8H 1M57D 3I5CA 1FZAA 5AW4B 1SQQE 1HF9A 4BXLA 3PP5A 3C1LA 4U3FG 1JOCA 3CMAP 4KJMA 5CCGA 1RE3C 3S9OA 1PPJG 3TSIA 3TYYA 1U57A 3V5BA 1VF5D 2N1TD 2MJZA 1WRGA 2GM4A 3SWFA 4I7ZB 3TGUJ 2OYIB 3NMDA 4RESB 2KYVA 1L0ND 1KQGB 2IBZG 1CI6A 1FZBA 1BGYG 3AE7C 1K8AQ 2WMMA 5TISH 1OVUA 4Y99B 4WY4A 1SFCC 1X8YA 1VQMP 3D6ZA 1DD4A 3IAOA 2JDIH 3TGUE 2WSFH 5TJHA 1VQ9P 2QRXA 1SQVK 1SQXD 3ITKA 1JMMA 2ZYDA 5H2FH 2Y0CA 3Q5SA 2POHA 2B87A 4PV1B 2E74C 5KLVG 3V2QA 3KDPB 3VMXA 4D6TJ 3RK3D 2Q1KA 4BRYA 1FDMA 1JY2N 2WSFJ 1SQBK 1BDCA 2IFNA 1VQPP 1JMBA 1JNMA 1OX3A 1AA0A 1HVVA 1WMKA 1SQVJ 1AFOA 1SQPG 4D6TE 3H25A 1URQB 2WVRA 1HGZA 3WUTA 3G3ZA 5APYA 2L91A 2N1TA 3II6A 5H2FE 3L71J 4KT0J 3H32A 4IFMA 4I7ZC 2OYIC 1GK6A 1FZCA 1SQVE 3RBXA 2IPPA 3CCJP 3SWKA 1Q90D 4MN4C 2ZYAA 3NXSA 4YPCA 4Y99C 1KYOE 2E76B 1S9KD 1FDOA 1P84D 3D6YA 1NVOA 3L71E 5AVRB 2LR2A 3I55P 3L75J 3FX0A 1SQBE 2QVAA 1IK9A 3L73G 2BCCD 3D70A 4O9BA 1JTHB 2QEXP 4LC1A 1QEXA 3BCCG 4PV1C 2ZT9B 1OVRA 1KB9D 5KLVK 1DEBA 3H1LD 4U3FE 3L75E 4PD4H 1Y9BA 1LTAC 2Q6QA 2YKPA 3AE3C 4H44D 2W83C 2FYNB 2CPBA 2AXCA 2WT7A 2J5UA 3GG2A 3HTKA 2IBZE 4AQRD 1LTGC 1SQPK 3A0BH 1BGYE 1HWTC 5KLVJ 3L36A 1ZOYC 3G9RA
chains in the Genus database with same CATH topology
3RL0D 1L4AD 1URQD 1N7SB 4I2LC 3MTUE 2I1JA 1HJBA 3O8ZA 1IC2A 1WT6A 2R5BA 2KOGA 1M1JB 4XE5B 2OYIA 3M91A 1FJPA 4WB4A 5AW6B 3IFMA 3M0DA 2LKMA 5AVWB 4N78E 3M9HA 1GD2E 2KSJA 1GZLA 4XA4A 2E43A 1GU4A 3RK2C 1OWAA 1ZR2A 1RF1A 4M3LA 1G1IA 1LT9A 1IJDB 1FZEA 4HH2A 2GUSA 3BASA 1MUUA 1AQ5A 1FJKA 1GW3A 5AVQB 5CCGC 1KZUB 3MIWA 1FAVA 3GHGC 1GL2A 1PFIA 1MZ9A 1IFIA 3RK2D 3N4XA 1JY3N 1HTLC 2HFED 1FZFA 3T97A 2HODA 3MGNA 1H89A 2N1TB 1SP4A 3BATA 3A7OA 4I1LA 5AW5B 5CCGD 1RF0A 3H32B 1A02F 4DZOA 1YTZI 2P67A 3B5NB 4JF7A 1H88A 1LWUC 2YKQA 1MFZA 2NPSB 1J2JB 4C7RA 2XZRA 2Q7CA 1FZCB 1NOHA 1QL2A 2QM8A 2XKMA 2I1KA 2HYNA 3VN0A 1LTTC 1SQQK 3HE4B 1FU1A 3P7KA 1CSBA 2J58A 5AW2B 1T3UA 1RF1B 4JYCA 3B8EB 1FZGA 1LT9B 1RE4C 3VYIA 3M0AA 4WY4C 1NWQA 1JCCA 2P2UA 3BRTB 2Z5IA 1G2CA 1NKNA 2M3BA 2XNXA 2C9NY 1S9KE 3CL3D 3R2PA 1JY3P 3P8CD 4EIJA 2R5DA 2WSEH 1JY3O 1LTJA 3P8MC 2H43A 1J1EC 1A02J 1KQLA 3CLQA 4WY4D 2Z4EA 1SFCB 5APQA 3P32A 1L4AA 1URQA 4I6MC 2YO3A 1N7SC 2YKOA 2Q5UA 3HUSA 5APTA 3A2AA 3NFQA 1JCDA 4EOTA 4KHXA 1HGVA 3RK3B 5AW1B 4HYTB 2N9BA 5AW9B 3V2PA 2P7JA 2FYZA 2PP6A 1M1JC 1N73B 1N7SD 1IO4A 3L4FA 1HUCA 2FFDB 3A5TA 3U1AA 1ZN5A 2WPSA 5BVZA 1H8AA 3TNUA 4GT1A 1NTMK 3OA7A 3M06A 5AVVB 1NKZB 2Q3IA 1FBMA 5APXA 3HD7A 1KILA 4IFFA 2ZXEB 2ZFCA 1DH3A 4W80A 2JJLA 1LTJB 5BU5A 3VP8A 1VDFA 2R3CA 3HE5A 2GUVA 1LTIC 2WT7B 5AW7B 3I5CA 1FZAA 5AW3B 2C0WA 5AW4B 3HTKB 1YYCA 3OJAB 2OARA 5AVYB 3KQGA 2O1JA 3HUSB 1EQ7A 3EFGA 3V4QA 1XTGB 5AVSB 1SLQA 3PP5A 1IFJA 2VRSA 1JOCA 1J1DB 2N1TC 1JTHA 5CCGA 5CCHA 1CW5A 1RE3C 2KB7P 1T2KC 3GHGA 3MUDA 1GW4A 1GDTA 4GIFA 3M9QA 3TSIA 3B5NC 3TYYA 3V5BA 3VP9A 2H7HA 1HBWA 1LTSC 4JYBA 4LLHA 2NPSC 3TNUB 2JEEA 1FZCC 2N1TD 2MJZA 1WRGA 5AVZB 2GM4A 1T2KD 3SWFA 3HD7B 1KILB 2YMYA 3B5ND 2OYIB 3NMDA 2XV5A 3U1CA 1LWUA 4RESB 2KYVA 2NPSD 1RF1C 3UIAA 1LT9C 1CI6A 2O01H 1FZBA 3BRVB 1M7LA 3H6PA 4N3YB 2HPCA 4ZKUA 3V4WA 2BASA 1RE4A 1X79B 4Y99B 1NU1K 3VTPC 4WY4A 1SFCC 1X8YA 1RF0C 1NH4A 1L0LK 2W6AA 1IFDA 1NHLA 2O1KA 4AUWA 3A3YB 1GL2B 4N6JA 2WSFH 5KJ7C 1SQVK 1SVFA 3E1IA 2HODB 2J59M 3KYQA 1X9VA 1SFCD 1JMMA 2XDJA 5CMZA 3RK3C 5APUA 2WWWA 3L37A 1N73C 1N7SA 2POHA 2FYUK 1IFMA 5KJ7D 2FFDC 2OYHA 1OXZA 3V2QA 3KDPB 3VMXA 3RK3D 1FDMA 3BVHA 1JY2N 1M1JA 5KTBA 2WSCH 2H8PD 1HH0A 1SQBK 2E42A 5APVA 3VMZA 1LTJC 2IFNA 2WTYA 2C0XA 5BU8B 3N7NA 1URQC 3V2RA 1JNMA 1NTKK 1ZLLA 1N86A 1HVVA 3HUSC 1G2CB 1Z56A 1AFOA 2KLVA 2IX7C 3P8CE 1J1DC 1KFMA 2YO2A 2WZ7A 3RL0B 1L4AB 1URQB 1CZQA 2OYHB 1E5WA 2A45G 2FKWB 2P1JA 1HGZA 1ZR4A 3G3ZA 3LIEA 2FXMA 5APYA 2HLOA 2N1TA 3II6A 1L0NK 1JY2P 1RE3A 2A45H 5AVXB 1RY3A 3H32A 2C9LY 3HD7C 4LGDE 1KILC 1JY2O 3HRNA 2CPSA 4IFMA 3B5NA 2OYIC 1GK6A 2HG5D 2QM7A 2NPSA 1LTBC 1FZCA 3U59A 3M0DC 2IPPA 3CI9A 4W7ZA 3M9BA 3HD7D 4GKGA 3SWYA 1KILD 4AYCA 3HE4A 3NXSA 1G1JA 4C7NA 1VPCA 2Z5HA 3IR9A 4W7YA 4Y99C 3HE5B 4ZKPA 1S9KD 5CCHC 1SQXK 1ZV8A 1N7LA 5AVRB 5CHXA 2A45I 5APSA 1MV8A 5CJ0A 1NO4A 1GL2C 3L35A 2L5GB 1GK4A 2R32A 3LIDA 3RK2B 1IK9A 2W6BA 1JUNA 4DOJA 1SFCA 4C46A 2WITA 5CCHD 4WBAA 3MD0A 4O9BA 1JTHB 1KFNA 4LC1A 3GHGB 1GL2D 1FOSE 5KJ7A 3KPEA 1GTWA 1N2DC 3WMM0 2W27A 3V2NA 1LGHB 5KLVK 1DEBA 2WPRA 1N73A 5AVUB 4B86A 3OAKA 5AW0B 1NTZK 5AVTB 2FFDA 1JO5A 4C7NB 3VOPA 1LWUB 2M8RA 1NAFA 1QL1A 2XU6A 2PAJA 1CI6B 1LTAC 2YKPA 1T8ZA 1GU5A 1DX7A 2IFMA 2KP8A 3LW5H 2HPCB 5CJ4A 2CPBA 1XTCC 4N78D 1IFNA 2WT7A 5AW8B 4WY4B 4OH8B 3HTKA 2Q9IA 3TK1A 3RL0C 1T3JA 3EQ2A 1L4AC 4AQRD 1LTGC 1SQPK 3VMYA 2YNYA 3NTNA 2OYHC 5APWA 4IFDK 1HWTC 2WPQA 1J1EB 1YTZT 3C9IA 1W2EA 3L36A 1FOSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM7 A;  2R5D A;  3P8M C;  1A02 J;  2IPP A;  1KQL A;  4I2L C;  3V4W A;  3M9B A;  5APQ A;  4GKG A;  3P32 A;  4AYC A;  1HJB A;  3HE4 A;  2BAS A;  4I6M C;  2YO3 A;  3O8Z A;  3VTP C;  3NXS A;  2R5B A;  1X8Y A;  2Q5U A;  4C7N A;  2Z5H A;  3IR9 A;  2W6A A;  4XE5 B;  5APT A;  3A2A A;  3NFQ A;  4AUW A;  3HE5 B;  4KHX A;  4EOT A;  3A3Y B;  3M91 A;  5AW1 B;  4HYT B;  2N9B A;  1S9K D;  5AW9 B;  2P7J A;  5AW6 B;  5AVR B;  3M0D A;  1IO4 A;  5APS A;  1MV8 A;  5AVW B;  1HUC A;  5CMZ A;  3L35 A;  3LID A;  1GK4 A;  2R32 A;  3M9H A;  5APU A;  3A5T A;  2WWW A;  1GD2 E;  3L37 A;  1GZL A;  1JUN A;  2E43 A;  2WPS A;  1H8A A;  3TNU A;  4C46 A;  1GU4 A;  4GT1 A;  3M06 A;  5AVV B;  1OWA A;  1GK6 A;  3MD0 A;  1OXZ A;  2Q3I A;  4LC1 A;  3KDP B;  4M3L A;  5APX A;  3VMX A;  2ZXE B;  2ZFC A;  1DH3 A;  1FOS E;  2JJL A;  1GTW A;  1MUU A;  5AVQ B;  2R3C A;  2W27 A;  3HE5 A;  2E42 A;  1FAV A;  5APV A;  2WT7 B;  5AW7 B;  3I5C A;  5AW3 B;  3VMZ A;  2WPR A;  2WTY A;  5AVU B;  3T97 A;  4B86 A;  3OAK A;  5AW0 B;  5AW4 B;  1YYC A;  5AVY B;  3KQG A;  3MGN A;  5AVT B;  4C7N B;  1H89 A;  1SP4 A;  3A7O A;  3V4Q A;  5AW5 B;  1NAF A;  5AVS B;  1JNM A;  1SLQ A;  1A02 F;  4DZO A;  2XU6 A;  2VRS A;  1G2C B;  2P67 A;  1CI6 B;  1H88 A;  1GU5 A;  1MFZ A;  1T2K C;  2KP8 A;  1J2J B;  2XZR A;  2Q7C A;  2QM8 A;  3TYY A;  3VN0 A;  3V5B A;  2H7H A;  1HBW A;  4JYB A;  2YO2 A;  3HE4 B;  3TNU B;  1CZQ A;  3P7K A;  2WT7 A;  1CSB A;  5AW8 B;  5AVZ B;  1T2K D;  3SWF A;  5AW2 B;  3HTK A;  3TK1 A;  4JYC A;  3B8E B;  3LIE A;  4AQR D;  5APY A;  3VMY A;  3VYI A;  3NMD A;  2XV5 A;  2YNY A;  3M0A A;  3NTN A;  4RES B;  5APW A;  5AVX B;  1NWQ A;  1HWT C;  2WPQ A;  2P2U A;  2C9L Y;  3UIA A;  2Z5I A;  1CI6 A;  3L36 A;  2C9N Y;  1S9K E;  1FOS F; 
#chains in the Genus database with same CATH topology
 2ITA A;  1OMI A;  2ZYG A;  1N7S B;  3O8Z A;  1IC2 A;  2HR3 A;  4XE5 B;  2KZJ A;  4HJG H;  3CXH H;  3L72 G;  4WB4 A;  1NTM G;  3IFM A;  3JC2 2;  5AVW B;  4N78 E;  2E76 C;  5KLV E;  2NRG A;  1SQP J;  2E43 A;  1GU4 A;  1OW8 A;  4XFJ A;  1OWA A;  1D7M A;  3Q5R A;  2AXT E;  1LT9 A;  1FZE A;  3BAS A;  3TGU D;  2M3E A;  1GW3 A;  5AVQ B;  3G6E P;  1KZU B;  1QGK B;  3MUD C;  1PFI A;  1JEK A;  2ZT9 C;  3RK2 D;  1FZF A;  2OGU A;  1H89 A;  2ZXX A;  1SP4 A;  5M1B A;  5AW5 B;  2YXR B;  1RF0 A;  3H1K D;  3B5N B;  1SQP E;  1H88 A;  2NPS B;  4L74 A;  1KC8 Q;  2QM8 A;  2Y9Z A;  3PLN A;  3CXH E;  1S72 P;  3P7K A;  2RKL A;  2FYN C;  1KIL E;  4JYC A;  1R5L A;  3B8E B;  3GMA A;  1LT9 B;  1RE4 C;  4RKU J;  1JCC A;  3FWL A;  3TDK A;  2C9N Y;  1NU1 G;  1L2P A;  2R5D A;  4D6T D;  1L0L G;  1JY3 O;  3P8M C;  3CLQ A;  2Z4E A;  5APQ A;  3P32 A;  4NPD A;  2YO3 A;  1N7S C;  3I56 P;  2D2C D;  5KLI B;  1JCD A;  4EOT A;  2N9B A;  3PH0 A;  2RH0 A;  1N73 B;  1EDI A;  2E5T A;  2KSE A;  3AE4 C;  2QE7 H;  1MFT A;  2ZAE B;  1FC2 C;  1NTM K;  3M06 A;  5APX A;  1S4X A;  2ZXE B;  4NPE A;  1KYO D;  1VDF A;  3HE5 A;  4JBZ A;  3L71 D;  3H1I G;  5KAF E;  5AW3 B;  1IFP A;  1PGQ A;  2OAR A;  2O1J A;  4ZMD A;  5DJU B;  1EDL A;  1SLQ A;  1PP9 D;  2VRS A;  1PV3 A;  1Y47 A;  1KYO I;  5CCH A;  1CW5 A;  5GTH H;  3B4S A;  3B5N C;  1LNQ A;  4JYB A;  4RJT A;  2NPS C;  1PIX A;  1NTM J;  3AE5 C;  1QVF O;  1T2K D;  3L75 D;  2XV5 A;  1LWU A;  3AE2 C;  4GDO A;  3L74 G;  1LT9 C;  2Q3E A;  1M7L A;  4HKZ H;  2HPC A;  3CWB J;  2QJY B;  4R4M A;  5B66 E;  2KZI A;  1OFC X;  1X79 B;  1KTM A;  2LXB A;  2IBZ D;  1NU1 K;  2YIU B;  1NTM E;  1RF0 C;  1NH4 A;  1L0L K;  1LJ2 A;  4AUW A;  3L70 D;  3A3Y B;  2E5Y A;  3PRJ A;  4IL6 H;  3E1I A;  5KLI C;  1KMI Z;  5GTH E;  5APU A;  3L37 A;  1EZV G;  1N73 C;  3VMA A;  1Q82 Q;  3SFD C;  1BE3 D;  2IBZ I;  3CWB E;  5KJ7 D;  1OXZ A;  1NTZ G;  1M1J A;  2WSC H;  1AVY A;  1HH0 A;  2E75 D;  1SQQ J;  2E42 A;  4L73 A;  2QG4 A;  5KLV D;  3E7K A;  3CD6 P;  5BU8 B;  1K04 A;  1L0L J;  5B5E H;  1N86 A;  3KXD A;  1U7M A;  4EI2 A;  2K37 A;  4PD4 I;  4CPG A;  2KLV A;  3CCS P;  2IX7 C;  3P8C E;  1L4A B;  1U7J A;  2FKW B;  3LIE A;  2FXM A;  1JY2 P;  2A45 H;  5AVX B;  1RY3 A;  1L0L E;  2V7Q J;  2HG5 D;  3ABV C;  1LTB C;  3K5B A;  3U59 A;  4H0L B;  4W7Z A;  3HD7 D;  4GKG A;  1KIL D;  3HE4 A;  3W68 A;  2QJY C;  4C7N A;  2YIU C;  2K9Y A;  5CCH C;  2K3R A;  1N7L A;  3WUU A;  4H13 B;  3CXH I;  3D71 A;  1GK4 A;  2W6B A;  4UB8 E;  1Y8A A;  2WIT A;  4OGQ B;  3C8V A;  1VQN P;  2KUB A;  3H1I E;  1GL2 D;  3KZI H;  5KJ7 A;  1N2D C;  2K88 A;  2W27 A;  2M5A A;  3L74 J;  2WPR A;  5AVU B;  3OAK A;  3RBZ A;  1NTZ K;  2FFD A;  4C7N B;  2RN0 A;  4A7P A;  2GA1 A;  4RO0 A;  1QL1 A;  2KLU A;  1CI6 B;  2KXP B;  1T8Z A;  3IN6 A;  1GU5 A;  2IFM A;  1BCC G;  2KP8 A;  3LW5 H;  4OWF A;  4YXD C;  1M8O B;  4ZNC A;  1USE A;  3E1R A;  5AW8 B;  4WY4 B;  3L74 E;  3SSU A;  2JP3 A;  5TIS E;  1L4A C;  3CPW O;  3NTN A;  3CCL P;  1R5S A;  1FOS F;  2MKV A;  3RL0 D;  3B71 A;  1NTZ J;  3V6I A;  3KZI E;  2R44 A;  4I2L C;  2B87 B;  2A06 E;  1HJB A;  1K73 Q;  1FDI A;  4H0L C;  2KOG A;  4BRY B;  2UWJ E;  1S2E A;  1SQB J;  2OTK E;  1JB0 J;  3M0D A;  2LKM A;  3M9H A;  3AED C;  1GZL A;  3H1H D;  2G3A A;  3CX5 H;  4H13 C;  1NTZ E;  3H1J G;  1VQ5 P;  1ZR2 A;  1RF1 A;  1G1I A;  4OGQ C;  1IJD B;  2JWA A;  4HH2 A;  1MUU A;  5CCG C;  2N9Y B;  1FAV A;  1GL2 A;  4U3F J;  2IYP A;  3N4X A;  1HTL C;  3CC4 P;  2HOD A;  3A0H H;  1VF5 B;  3MGN A;  2N1T B;  3BAT A;  3A7O A;  2I8D A;  3CWB D;  3AEE C;  2IDB A;  3H32 B;  1A02 F;  4DZO A;  2P67 A;  1MFZ A;  3PHL A;  1J2J B;  2Q7C A;  1FZC B;  2XKM A;  1LTT C;  1CSB A;  2J58 A;  1BGY J;  1VQ4 P;  1SQX G;  1MKM A;  5AW2 B;  1RF1 B;  1VQ6 P;  3WUV A;  3VYI A;  1PPJ E;  3CX5 E;  4WY4 C;  2P2U A;  1ZRT E;  1G2C A;  1OW6 A;  3CL3 D;  3P8C D;  4EIJ A;  2H43 A;  4GOF A;  1KQL A;  1YQ4 C;  1SQQ D;  2PFX A;  1S5L H;  1X22 A;  2OTJ P;  1ZXG A;  2YKO A;  2XND H;  1NGM B;  1L0L D;  5DJT B;  3RK3 B;  4K35 A;  3CCE P;  3V2P A;  3CC7 P;  2FYZ A;  2PP6 A;  1ZW0 A;  1OZH A;  3L4F A;  1BCC J;  5C39 A;  2WPS A;  1H8A A;  3TNU A;  2KNC A;  5AVV B;  1RH5 B;  1NKZ B;  2Q3I A;  4PD4 E;  1AJY A;  1NTK G;  1LTI C;  1KOR A;  2WT7 B;  2C0W A;  2B9B A;  3HTK B;  1YYC A;  3OJA B;  1LT1 A;  3OW2 O;  1QX8 A;  1EQ7 A;  3QWO C;  2P58 A;  4DT0 A;  2AEJ A;  5AVS B;  1BCC E;  1VF5 C;  1S5L E;  1J1D B;  2N1T C;  3GHG A;  3KHU A;  4GIF A;  3M9Q A;  3A0B E;  2OYO A;  1HBW A;  3G4S P;  1LTS C;  3TNU B;  4TLF A;  2JEE A;  1FZC C;  1YJN P;  5AVZ B;  2YMY A;  1EXJ A;  3U1C A;  2YMK A;  1RF1 C;  3H1J J;  2O01 H;  4N3Y B;  1YHQ P;  2K9J A;  4ZKU A;  2FXP A;  2WSS H;  3V4W A;  1KN7 A;  3L74 D;  3H1L G;  2Y0E A;  2W6A A;  3L73 J;  1FS0 E;  2O01 J;  4N6J A;  1PZQ A;  1BSN A;  1SVF A;  3BCC J;  3KYQ A;  1X9V A;  1SFC D;  1VQK P;  2XDJ A;  5CMZ A;  3RK3 C;  3H1J E;  5K5G B;  2A06 D;  2WWW A;  2QSI A;  3ZDM A;  1IK7 A;  1IZN B;  4OVN F;  1IFM A;  2PGD A;  2OYH A;  2DW3 A;  1YJ9 P;  3S1K A;  2K1A A;  3BVH A;  2H8P D;  2V4H A;  3EWK A;  4H44 B;  5KAI H;  5APV A;  3L73 E;  1FE6 A;  1OW7 A;  3VMZ A;  1SQV D;  3Q2Y A;  1AQT A;  1NTZ D;  3BCC E;  3V2R A;  1NTK K;  1ZLL A;  2QJK B;  1Z56 A;  4Y28 J;  1EZV I;  3GW6 A;  1YQ3 C;  1J1D C;  1SQB D;  2RMZ A;  2WZ7 A;  2YO2 A;  1S3J A;  2OYH B;  1E5W A;  2A45 G;  2P1J A;  1ZR4 A;  2JO1 A;  2HLO A;  1RE3 A;  5CBN A;  2WQY C;  4LGD E;  1JY2 O;  3HRN A;  1LP1 A;  2BEZ F;  2QM7 A;  1YIT P;  2QIW A;  1PGO A;  5L8R J;  3CCR P;  3CI9 A;  3AE6 C;  3L72 J;  1NTK J;  4AYC A;  4U3F D;  3WU2 H;  3CC2 P;  4Z1M H;  1P84 H;  1PPJ D;  2IYO A;  3IR9 A;  2BEQ D;  1NYH A;  3AE9 C;  4W7Y A;  4EYY Q;  1ZRT D;  3HE5 B;  3H1K G;  1ZME C;  5CHX A;  3Q1M A;  3JCU H;  1MV8 A;  5CJ0 A;  4PJ0 H;  3LID A;  2R32 A;  2W6J H;  3RK2 B;  1SFC A;  4C46 A;  4WBA A;  3L72 E;  1K9M Q;  1KFN A;  1KB9 H;  3CX5 I;  1BGY D;  1NTK E;  2KS1 A;  1FOS E;  1JM0 A;  2G8Y A;  3WMM 0;  3AE8 C;  2CK3 H;  3G71 P;  1W5C E;  4B86 A;  4PV1 D;  4H44 C;  2WPV B;  3RL0 g;  1LWU B;  2M8R A;  4UB6 H;  2B88 A;  4YXW H;  3R4Y A;  1W2B O;  1M1K Q;  3F5H A;  3WU2 E;  1VQ8 P;  4PD4 D;  1P84 E;  2HPC B;  2QJK C;  2B89 A;  5CJ4 A;  2ZVO B;  4N78 D;  3QH9 A;  1NU1 J;  3TK1 A;  1T3J A;  1UIX A;  3EQ2 A;  5E79 H;  4IFD K;  2OYH C;  5APW A;  3O6Q A;  1NAY A;  3GF7 A;  3C9I A;  2D2C B;  2WSC J;  1URQ D;  3MTU E;  3L71 G;  2I1J A;  4IL6 E;  1NU1 E;  1M1J B;  1SQP D;  2OYI A;  4HB1 A;  1PP9 G;  3AEA C;  5AW6 B;  4EDF A;  2JR8 A;  3CXH D;  1GD2 E;  1NJI Q;  1KV4 A;  3W67 A;  3H1I J;  1AVO A;  3O6Q B;  3RK2 C;  1S5L X;  4M3L A;  1HJ0 A;  3L75 G;  3CCU P;  2E76 D;  4NPF X;  2GUS A;  5B5E E;  1AQ5 A;  5GTI H;  5E79 E;  1JY3 N;  3H1J D;  3T97 A;  2JWD A;  1KQS O;  2ZVN B;  4I1L A;  4K3A A;  2ZT9 D;  1S1C X;  1YTZ I;  1LWU C;  2KI7 B;  4C7R A;  2H89 C;  1NOH A;  1QL2 A;  3L73 D;  3L70 G;  3H1K J;  3HE4 B;  1KD1 Q;  1PGJ A;  3BCC D;  3CCQ P;  4U7J A;  1N8R Q;  4YTP C;  1BE3 G;  2Y0D A;  4JQ0 D;  2Z5I A;  3MHV A;  1NKN A;  2M3B A;  2XNX A;  1RQV A;  2P10 A;  3T97 B;  3PTZ A;  1LTJ A;  2D2C C;  1DIP A;  5GTI E;  3TF5 A;  1URQ A;  4I6M C;  4IOI H;  3H1K E;  2Q5U A;  3HUS A;  4QMA A;  3CCM P;  3A2A A;  2M5A B;  3LW5 J;  2FYU G;  4HYT B;  5AW9 B;  2P7J A;  2FY8 A;  1M1J C;  1X0T A;  1N7S D;  2E75 B;  1KQF B;  2FFD B;  3A5T A;  1ZN5 A;  1YBK A;  1K05 A;  1KYO H;  4GT1 A;  3OA7 A;  1Q81 Q;  3F89 A;  1FBM A;  3HD7 A;  1KIL A;  4IFF A;  2ZFC A;  1DH3 A;  4W80 A;  2NZ2 A;  1LTJ B;  5BU5 A;  3VP8 A;  2GUV A;  1EZV E;  1TU3 F;  5AW7 B;  1EXI A;  2W8Z A;  2OQQ A;  1DEE G;  5AVY B;  3KQG A;  3HUS B;  2Y9Y A;  3EFG A;  3JSV C;  3V4Q A;  1XTG B;  1QVG O;  3L72 D;  1IFJ A;  5EFW B;  1NTM D;  1NTK D;  1JTH A;  2FBW C;  1T2K C;  2KB7 P;  3MUD A;  1OIP A;  1GW4 A;  3S4R A;  1GDT A;  4L75 A;  3CCV P;  3VP9 A;  1L0N G;  2H7H A;  4LLH A;  3FGA D;  1PP9 J;  3HD7 B;  1KIL B;  3B5N D;  1QLE D;  2NPS D;  3UIA A;  3BRV B;  3AEF C;  3H6P A;  2BAS A;  1RE4 A;  3VTP C;  1PP9 E;  1IFD A;  1NHL A;  2O1K A;  1GL2 B;  1P84 I;  5KJ7 C;  2HOD B;  2J59 M;  3SFE C;  5KKZ B;  1N7S A;  2E75 C;  3L70 J;  2FYU K;  2FFD C;  3A0H E;  3Q3D A;  1NU1 D;  3RGU A;  5KTB A;  1KB9 I;  2R3S A;  1BE3 J;  4L76 A;  2SPZ A;  1LTJ C;  2WTY A;  1EC5 A;  2C0X A;  2AXT H;  3N7N A;  1URQ C;  2FXO A;  1G2C B;  3HUS C;  1Q86 Q;  4BWN A;  4DCK A;  3L70 E;  4ASV A;  2KK7 A;  1OVV A;  1KFM A;  3RL0 B;  2QJP B;  3MZW B;  1VQL P;  1CZQ A;  2FYU J;  4IL6 X;  1EDJ A;  1BE3 E;  3H1H G;  1L0N K;  2C9L Y;  3H1I D;  4WVZ A;  3HD7 C;  1KIL C;  1VQ7 P;  2CPS A;  3B5N A;  3CME P;  3MP7 B;  2NPS A;  1VL2 A;  3M0D C;  3M9B A;  2KNC B;  3SWY A;  4TT3 H;  2FYU E;  1G1J A;  1VPC A;  2Z5H A;  2YXQ B;  3CWB G;  2BCC G;  4ZKP A;  1SQX K;  1SS1 A;  1ZV8 A;  2IZ0 A;  2A45 I;  5APS A;  1NO4 A;  3EFF K;  1GL2 C;  3L35 A;  2L5G B;  1JUN A;  1H0T A;  4DOJ A;  1L0N J;  5CCH D;  1RHZ B;  3MD0 A;  3FXD A;  5KKZ C;  3GHG B;  3KPE A;  1GTW A;  2M0B A;  3AEB C;  3V2N A;  1LGH B;  1N73 A;  5AW0 B;  5AVT B;  1JO5 A;  3VOP A;  1NAF A;  1E79 H;  1SQQ G;  3USS A;  2XU6 A;  2PAJ A;  5KAF H;  1SQX J;  1L0N E;  1DX7 A;  1BDD A;  2K9J B;  1EZV D;  1YIJ P;  1H0T B;  2E74 D;  1XTC C;  1IFN A;  1EDK A;  4OH8 B;  2Q9I A;  2IZ1 A;  3RL0 C;  2QJP C;  3FWN A;  3VMY A;  2O3J A;  2YNY A;  2KIK A;  2WPQ A;  1J1E B;  1YTZ T;  1W2E A;  2O01 N;  1L4A D;  1SQX E;  3AEG C;  2QA4 P;  1YJW P;  1VQO P;  1WT6 A;  2R5B A;  1USD A;  2OTL P;  3RK3 E;  1PL5 A;  3M91 A;  5B66 H;  1FJP A;  1GMJ A;  4DJG A;  4H0L D;  1AV1 A;  3TGU G;  2KSJ A;  4XA4 A;  5KAI E;  2PRR A;  3CX5 D;  2LXC B;  4ASW A;  1FJK A;  3H1H J;  4H13 D;  3MIW A;  3GHG C;  4WWI A;  3AE1 C;  1MZ9 A;  1IFI A;  2HFE D;  4OGQ D;  2AEM A;  1Q7Y Q;  5CCG D;  4JF7 A;  1LP1 B;  2H88 C;  2YKQ A;  4GOE A;  2XZR A;  1R8E A;  1Q2N A;  2I1K A;  2HYN A;  3VN0 A;  2BCC J;  3FXE A;  1SQQ K;  1FU1 A;  3GLM A;  3H1H E;  1DD3 A;  1RQU A;  4D6T G;  1T3U A;  1FZG A;  2A06 G;  5CBO A;  3M0A A;  1NWQ A;  3BRT B;  4JPZ B;  1S9K E;  3R2P A;  1JY3 P;  3H1L J;  3Q5P A;  1T6A A;  2WSE H;  1J1E C;  1A02 J;  3IF4 A;  4GOD A;  4WY4 D;  1BSH A;  1SFC B;  3GF3 A;  1L4A A;  1SQV G;  2BCC E;  3JCU E;  4PJ0 E;  1BCC D;  2KS1 B;  3AEC C;  2AEF A;  5APT A;  3NFQ A;  2JKV A;  4KHX A;  1HGV A;  5AW1 B;  2ZJS E;  1UII A;  1KB9 E;  1ZP0 C;  1YI2 P;  2WSE J;  1IO4 A;  1HUC A;  1PGP A;  2E74 B;  3PJS K;  4R4L A;  3U1A A;  2W90 A;  3H1L E;  5BVZ A;  1SQB G;  2FYU D;  1M56 D;  1M90 Q;  2JJL A;  2V7Q H;  2R3C A;  4UB6 E;  4UB8 H;  1M57 D;  3I5C A;  1FZA A;  5AW4 B;  1SQQ E;  1HF9 A;  4BXL A;  3PP5 A;  3C1L A;  4U3F G;  1JOC A;  3CMA P;  4KJM A;  5CCG A;  1RE3 C;  3S9O A;  1PPJ G;  3TSI A;  3TYY A;  1U57 A;  3V5B A;  1VF5 D;  2N1T D;  2MJZ A;  1WRG A;  2GM4 A;  3SWF A;  4I7Z B;  3TGU J;  2OYI B;  3NMD A;  4RES B;  2KYV A;  1L0N D;  1KQG B;  2IBZ G;  1CI6 A;  1FZB A;  1BGY G;  3AE7 C;  1K8A Q;  2WMM A;  5TIS H;  1OVU A;  4Y99 B;  4WY4 A;  1SFC C;  1X8Y A;  1VQM P;  3D6Z A;  1DD4 A;  3IAO A;  2JDI H;  3TGU E;  2WSF H;  5TJH A;  1VQ9 P;  2QRX A;  1SQV K;  1SQX D;  3ITK A;  1JMM A;  2ZYD A;  5H2F H;  2Y0C A;  3Q5S A;  2POH A;  2B87 A;  4PV1 B;  2E74 C;  5KLV G;  3V2Q A;  3KDP B;  3VMX A;  4D6T J;  3RK3 D;  2Q1K A;  4BRY A;  1FDM A;  1JY2 N;  2WSF J;  1SQB K;  1BDC A;  2IFN A;  1VQP P;  1JMB A;  1JNM A;  1OX3 A;  1AA0 A;  1HVV A;  1WMK A;  1SQV J;  1AFO A;  1SQP G;  4D6T E;  3H25 A;  1URQ B;  2WVR A;  1HGZ A;  3WUT A;  3G3Z A;  5APY A;  2L91 A;  2N1T A;  3II6 A;  5H2F E;  3L71 J;  4KT0 J;  3H32 A;  4IFM A;  4I7Z C;  2OYI C;  1GK6 A;  1FZC A;  1SQV E;  3RBX A;  2IPP A;  3CCJ P;  3SWK A;  1Q90 D;  4MN4 C;  2ZYA A;  3NXS A;  4YPC A;  4Y99 C;  1KYO E;  2E76 B;  1S9K D;  1FDO A;  1P84 D;  3D6Y A;  1NVO A;  3L71 E;  5AVR B;  2LR2 A;  3I55 P;  3L75 J;  3FX0 A;  1SQB E;  2QVA A;  1IK9 A;  3L73 G;  2BCC D;  3D70 A;  4O9B A;  1JTH B;  2QEX P;  4LC1 A;  1QEX A;  3BCC G;  4PV1 C;  2ZT9 B;  1OVR A;  1KB9 D;  5KLV K;  1DEB A;  3H1L D;  4U3F E;  3L75 E;  4PD4 H;  1Y9B A;  1LTA C;  2Q6Q A;  2YKP A;  3AE3 C;  4H44 D;  2W83 C;  2FYN B;  2CPB A;  2AXC A;  2WT7 A;  2J5U A;  3GG2 A;  3HTK A;  2IBZ E;  4AQR D;  1LTG C;  1SQP K;  3A0B H;  1BGY E;  1HWT C;  5KLV J;  3L36 A;  1ZOY C;  3G9R A; 
#chains in the Genus database with same CATH homology
 3RL0 D;  1L4A D;  1URQ D;  1N7S B;  4I2L C;  3MTU E;  2I1J A;  1HJB A;  3O8Z A;  1IC2 A;  1WT6 A;  2R5B A;  2KOG A;  1M1J B;  4XE5 B;  2OYI A;  3M91 A;  1FJP A;  4WB4 A;  5AW6 B;  3IFM A;  3M0D A;  2LKM A;  5AVW B;  4N78 E;  3M9H A;  1GD2 E;  2KSJ A;  1GZL A;  4XA4 A;  2E43 A;  1GU4 A;  3RK2 C;  1OWA A;  1ZR2 A;  1RF1 A;  4M3L A;  1G1I A;  1LT9 A;  1IJD B;  1FZE A;  4HH2 A;  2GUS A;  3BAS A;  1MUU A;  1AQ5 A;  1FJK A;  1GW3 A;  5AVQ B;  5CCG C;  1KZU B;  3MIW A;  1FAV A;  3GHG C;  1GL2 A;  1PFI A;  1MZ9 A;  1IFI A;  3RK2 D;  3N4X A;  1JY3 N;  1HTL C;  2HFE D;  1FZF A;  3T97 A;  2HOD A;  3MGN A;  1H89 A;  2N1T B;  1SP4 A;  3BAT A;  3A7O A;  4I1L A;  5AW5 B;  5CCG D;  1RF0 A;  3H32 B;  1A02 F;  4DZO A;  1YTZ I;  2P67 A;  3B5N B;  4JF7 A;  1H88 A;  1LWU C;  2YKQ A;  1MFZ A;  2NPS B;  1J2J B;  4C7R A;  2XZR A;  2Q7C A;  1FZC B;  1NOH A;  1QL2 A;  2QM8 A;  2XKM A;  2I1K A;  2HYN A;  3VN0 A;  1LTT C;  1SQQ K;  3HE4 B;  1FU1 A;  3P7K A;  1CSB A;  2J58 A;  5AW2 B;  1T3U A;  1RF1 B;  4JYC A;  3B8E B;  1FZG A;  1LT9 B;  1RE4 C;  3VYI A;  3M0A A;  4WY4 C;  1NWQ A;  1JCC A;  2P2U A;  3BRT B;  2Z5I A;  1G2C A;  1NKN A;  2M3B A;  2XNX A;  2C9N Y;  1S9K E;  3CL3 D;  3R2P A;  1JY3 P;  3P8C D;  4EIJ A;  2R5D A;  2WSE H;  1JY3 O;  1LTJ A;  3P8M C;  2H43 A;  1J1E C;  1A02 J;  1KQL A;  3CLQ A;  4WY4 D;  2Z4E A;  1SFC B;  5APQ A;  3P32 A;  1L4A A;  1URQ A;  4I6M C;  2YO3 A;  1N7S C;  2YKO A;  2Q5U A;  3HUS A;  5APT A;  3A2A A;  3NFQ A;  1JCD A;  4EOT A;  4KHX A;  1HGV A;  3RK3 B;  5AW1 B;  4HYT B;  2N9B A;  5AW9 B;  3V2P A;  2P7J A;  2FYZ A;  2PP6 A;  1M1J C;  1N73 B;  1N7S D;  1IO4 A;  3L4F A;  1HUC A;  2FFD B;  3A5T A;  3U1A A;  1ZN5 A;  2WPS A;  5BVZ A;  1H8A A;  3TNU A;  4GT1 A;  1NTM K;  3OA7 A;  3M06 A;  5AVV B;  1NKZ B;  2Q3I A;  1FBM A;  5APX A;  3HD7 A;  1KIL A;  4IFF A;  2ZXE B;  2ZFC A;  1DH3 A;  4W80 A;  2JJL A;  1LTJ B;  5BU5 A;  3VP8 A;  1VDF A;  2R3C A;  3HE5 A;  2GUV A;  1LTI C;  2WT7 B;  5AW7 B;  3I5C A;  1FZA A;  5AW3 B;  2C0W A;  5AW4 B;  3HTK B;  1YYC A;  3OJA B;  2OAR A;  5AVY B;  3KQG A;  2O1J A;  3HUS B;  1EQ7 A;  3EFG A;  3V4Q A;  1XTG B;  5AVS B;  1SLQ A;  3PP5 A;  1IFJ A;  2VRS A;  1JOC A;  1J1D B;  2N1T C;  1JTH A;  5CCG A;  5CCH A;  1CW5 A;  1RE3 C;  2KB7 P;  1T2K C;  3GHG A;  3MUD A;  1GW4 A;  1GDT A;  4GIF A;  3M9Q A;  3TSI A;  3B5N C;  3TYY A;  3V5B A;  3VP9 A;  2H7H A;  1HBW A;  1LTS C;  4JYB A;  4LLH A;  2NPS C;  3TNU B;  2JEE A;  1FZC C;  2N1T D;  2MJZ A;  1WRG A;  5AVZ B;  2GM4 A;  1T2K D;  3SWF A;  3HD7 B;  1KIL B;  2YMY A;  3B5N D;  2OYI B;  3NMD A;  2XV5 A;  3U1C A;  1LWU A;  4RES B;  2KYV A;  2NPS D;  1RF1 C;  3UIA A;  1LT9 C;  1CI6 A;  2O01 H;  1FZB A;  3BRV B;  1M7L A;  3H6P A;  4N3Y B;  2HPC A;  4ZKU A;  3V4W A;  2BAS A;  1RE4 A;  1X79 B;  4Y99 B;  1NU1 K;  3VTP C;  4WY4 A;  1SFC C;  1X8Y A;  1RF0 C;  1NH4 A;  1L0L K;  2W6A A;  1IFD A;  1NHL A;  2O1K A;  4AUW A;  3A3Y B;  1GL2 B;  4N6J A;  2WSF H;  5KJ7 C;  1SQV K;  1SVF A;  3E1I A;  2HOD B;  2J59 M;  3KYQ A;  1X9V A;  1SFC D;  1JMM A;  2XDJ A;  5CMZ A;  3RK3 C;  5APU A;  2WWW A;  3L37 A;  1N73 C;  1N7S A;  2POH A;  2FYU K;  1IFM A;  5KJ7 D;  2FFD C;  2OYH A;  1OXZ A;  3V2Q A;  3KDP B;  3VMX A;  3RK3 D;  1FDM A;  3BVH A;  1JY2 N;  1M1J A;  5KTB A;  2WSC H;  2H8P D;  1HH0 A;  1SQB K;  2E42 A;  5APV A;  3VMZ A;  1LTJ C;  2IFN A;  2WTY A;  2C0X A;  5BU8 B;  3N7N A;  1URQ C;  3V2R A;  1JNM A;  1NTK K;  1ZLL A;  1N86 A;  1HVV A;  3HUS C;  1G2C B;  1Z56 A;  1AFO A;  2KLV A;  2IX7 C;  3P8C E;  1J1D C;  1KFM A;  2YO2 A;  2WZ7 A;  3RL0 B;  1L4A B;  1URQ B;  1CZQ A;  2OYH B;  1E5W A;  2A45 G;  2FKW B;  2P1J A;  1HGZ A;  1ZR4 A;  3G3Z A;  3LIE A;  2FXM A;  5APY A;  2HLO A;  2N1T A;  3II6 A;  1L0N K;  1JY2 P;  1RE3 A;  2A45 H;  5AVX B;  1RY3 A;  3H32 A;  2C9L Y;  3HD7 C;  4LGD E;  1KIL C;  1JY2 O;  3HRN A;  2CPS A;  4IFM A;  3B5N A;  2OYI C;  1GK6 A;  2HG5 D;  2QM7 A;  2NPS A;  1LTB C;  1FZC A;  3U59 A;  3M0D C;  2IPP A;  3CI9 A;  4W7Z A;  3M9B A;  3HD7 D;  4GKG A;  3SWY A;  1KIL D;  4AYC A;  3HE4 A;  3NXS A;  1G1J A;  4C7N A;  1VPC A;  2Z5H A;  3IR9 A;  4W7Y A;  4Y99 C;  3HE5 B;  4ZKP A;  1S9K D;  5CCH C;  1SQX K;  1ZV8 A;  1N7L A;  5AVR B;  5CHX A;  2A45 I;  5APS A;  1MV8 A;  5CJ0 A;  1NO4 A;  1GL2 C;  3L35 A;  2L5G B;  1GK4 A;  2R32 A;  3LID A;  3RK2 B;  1IK9 A;  2W6B A;  1JUN A;  4DOJ A;  1SFC A;  4C46 A;  2WIT A;  5CCH D;  4WBA A;  3MD0 A;  4O9B A;  1JTH B;  1KFN A;  4LC1 A;  3GHG B;  1GL2 D;  1FOS E;  5KJ7 A;  3KPE A;  1GTW A;  1N2D C;  3WMM 0;  2W27 A;  3V2N A;  1LGH B;  5KLV K;  1DEB A;  2WPR A;  1N73 A;  5AVU B;  4B86 A;  3OAK A;  5AW0 B;  1NTZ K;  5AVT B;  2FFD A;  1JO5 A;  4C7N B;  3VOP A;  1LWU B;  2M8R A;  1NAF A;  1QL1 A;  2XU6 A;  2PAJ A;  1CI6 B;  1LTA C;  2YKP A;  1T8Z A;  1GU5 A;  1DX7 A;  2IFM A;  2KP8 A;  3LW5 H;  2HPC B;  5CJ4 A;  2CPB A;  1XTC C;  4N78 D;  1IFN A;  2WT7 A;  5AW8 B;  4WY4 B;  4OH8 B;  3HTK A;  2Q9I A;  3TK1 A;  3RL0 C;  1T3J A;  3EQ2 A;  1L4A C;  4AQR D;  1LTG C;  1SQP K;  3VMY A;  2YNY A;  3NTN A;  2OYH C;  5APW A;  4IFD K;  1HWT C;  2WPQ A;  1J1E B;  1YTZ T;  3C9I A;  1W2E A;  3L36 A;  1FOS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...