3L36A

Pie12 d-peptide against hiv entry
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l36A00
1A02J 5AW3B 1FAVA 3P32A 1HWTC 1HUCA 2BASA 1G2CB 2R5DA 3V4WA 2ZFCA 4GT1A 2QM7A 2KP8A 1J2JB 5APYA 4RESB 2C9NY 4AUWA 3HE5B 3M0DA 5AVZB 3A5TA 3OAKA 3B8EB 3A3YB 2Z5IA 1FOSF 3NTNA 2Q5UA 1GK4A 1JNMA 1SLQA 5AVTB 5AW4B 2E42A 2Q7CA 3UIAA 1GU4A 5APVA 4KHXA 3NMDA 2WPQA 1T2KC 3VMZA 3VMXA 2W6AA 5AVVB 1MFZA 2R32A 4XE5B 2YO2A 5APQA 3V5BA 2E43A 3P7KA 1X8YA 4B86A 1GK6A 1H8AA 4LC1A 3VTPC 3M06A 3TYYA 3M9BA 1KQLA 3TNUB 1YYCA 4JYCA 3KQGA 4C46A 5AW1B 1FOSE 5AVSB 1H88A 1CSBA 3VYIA 1NWQA 2XV5A 1H89A 2YO3A 1MV8A 1GU5A 2C9LY 5APSA 5AW6B 2R5BA 2Z5HA 3LIEA 2WT7B 5AVYB 1GD2E 2Q3IA 5APTA 3TNUA 5AVRB 1OXZA 3HE4B 3NXSA 5AVUB 3HE5A 1OWAA 2WWWA 4I6MC 2P7JA 4JYBA 2XZRA 1SP4A 1DH3A 3M91A 3A2AA 5AW9B 1CI6B 4C7NB 2H7HA 5AVWB 3P8MC 3MD0A 3V4QA 2ZXEB 5CMZA 4M3LA 5APXA 5AW8B 3VMYA 1S9KE 1HBWA 1HJBA 3O8ZA 3HE4A 4I2LC 1GZLA 5AVQB 5AW7B 1CZQA 1IO4A 4EOTA 2IPPA 1CI6A 2R3CA 1JUNA 3M0AA 3TK1A 4HYTB 5AW5B 1NAFA 2QM8A 3HTKA 5APUA 5AVXB 2YNYA 3KDPB 2WTYA 5AW0B 4AYCA 4DZOA 4AQRD 3MGNA 2N9BA 2VRSA 2W27A 2WPRA 4GKGA 3LIDA 3T97A 1T2KD 3I5CA 2WT7A 5APWA 3L36A 1A02F 3SWFA 5AW2B 3L35A 2P2UA 2XU6A 1GTWA 1MUUA 3A7OA 3M9HA 1S9KD 2JJLA 3NFQA 3VN0A 2WPSA 3IR9A 2P67A 4C7NA 3L37A
chains in the Genus database with same CATH superfamily
4H0LD 4U3FG 4ZKPA 1LT9B 2B9BA 1NO4A 1AV1A 1N73B 1J2JB 1MKMA 2L5GB 1NTZD 3AE5C 1M1KQ 1SQBE 4L75A 4YPCA 2Q7CA 4OGQC 1L2PA 3L74J 1S72P 3B5ND 3TGUE 2XDJA 1M90Q 1P84I 3HUSC 3L73J 3I55P 3O6QB 3F5HA 2OGUA 1L0NE 4DJGA 1DD3A 1SQXE 3L72D 2WSEJ 2XV5A 3OJAB 1H89A 2YIUB 2KSJA 2W8ZA 1DD4A 1EXIA 5AVRB 3C1LA 3GMAA 2N1TD 2IFMA 2OTJP 1DH3A 1PP9J 3MHVA 2ZJSE 3A0BH 2KZJA 1Z56A 1T3JA 4PV1C 1GZLA 5AVQB 4EOTA 1SQVD 2KSEA 2QM8A 1YJ9P 4W7ZA 3H1KG 2O01N 3HTKA 5AVXB 1L0LK 1SQPG 3IF4A 1ZR4A 5CBOA 1K04A 1NTZE 2E75C 2QIWA 2WQYC 2I1KA 3CD6P 1YJNP 1JY2N 3SWFA 3GHGA 3HRNA 3L35A 4BXLA 2XU6A 4WVZA 3OA7A 3CX5D 1XTCC 2OARA 3NFQA 1MFTA 1SFCD 1YI2P 5AW3B 3SWKA 3GHGC 3CWBD 3RL0D 2FYNC 2QM7A 1SQBJ 4OGQD 2P10A 1BCCG 3OAKA 1FDIA 2Y0DA 3H1IE 3S9OA 4RKUJ 3NMDA 2M3EA 1T2KC 3ABVC 3VMXA 1L0NJ 1YIJP 1SQXJ 5BU5A 5EFWB 4WBAA 3TYYA 3HTKB 1EZVI 2FKWB 5AVSB 1CSBA 1NWQA 2ZAEB 2WSSH 1GU5A 5APSA 3GG2A 1FZGA 3NXSA 4PV1D 4ZKUA 1GW4A 3HD7B 3VMYA 1PPJD 3PJSK 2E74C 4MN4C 4GOFA 2E75D 3CWBE 2UWJE 2XNDH 3AEAC 5K5GB 2ITAA 2KYVA 3BASA 1A02F 1KYOD 4I1LA 5KLVD 1JMBA 4GODA 1HUCA 1NTKK 2YMKA 3H1IJ 1URQA 1W2BO 2KLUA 1LTGC 2P1JA 5APYA 1DEBA 2WZ7A 2ZXXA 3RK3C 1URQC 1NU1E 1M57D 1NKZB 3VMZA 1KILA 4ASWA 1PPJE 5AVVB 5KAIE 2JEEA 1GL2A 3V5BA 1EXJA 1FJKA 4WY4A 3N7NA 1GK6A 1R5SA 2KB7P 4NPFX 3ZDMA 1ZR2A 1KILC 1GL2C 2V7QJ 4WY4C 1ZRTD 2IBZG 3WU2E 2QJPC 5AVUB 1VPCA 2P7JA 3L75J 1ZOYC 2XZRA 4R4MA 5KJ7A 3TF5A 1LP1B 1HJBA 1HGZA 2BCCG 3B4SA 3WMM0 2K9JA 3VOPA 5KJ7C 1NGMB 1BSHA 3L71G 2O3JA 1QX8A 4NPEA 3G3ZA 2WT7A 2QJKB 1TU3F 1KILB 1Q86Q 2A06E 1VF5C 2PAJA 5B5EE 1T3UA 4D6TD 3IR9A 1BE3D 2NPSA 2QJPB 3S1KA 1LJ2A 2O01H 1NTME 2QJYB 3PP5A 1N86A 3RK3D 2NPSC 3FX0A 1VQNP 1NU1J 1VQKP 2JWAA 1FZCB 1SQQG 2A45G 1QLED 5BU8B 4R4LA 2AEFA 4XE5B 1GL2D 4B86A 3AE9C 4WY4D 1K8AQ 1S5LH 4OH8B 3E1IA 1YTZT 5KLIB 1G2CA 4U3FD 4Y99B 1SQVK 1OW8A 2R5BA 2WT7B 2ZT9B 3GW6A 3SWYA 3E7KA 3CPWO 5E79E 3GF7A 2HPCB 4HKZH 5KJ7D 4H13B 3H1JG 4XFJA 5CCGA 2H88C 2IPPA 4JF7A 3KYQA 4HYTB 1NAFA 3T97B 3CXHD 1Y8AA 1VF5D 3RK3E 3KDPB 2O01J 4GIFA 5AW0B 1JM0A 1FU1A 1RQUA 2W27A 1P84H 4KT0J 3I5CA 1FZEA 1NVOA 3AE2C 1NTMJ 1LTTC 1IK9A 1NH4A 1RQVA 1PFIA 1S9KD 1L0LE 1KILE 2NPSD 3KZIE 3W67A 1AVOA 1G2CB 2ZFCA 5B66E 2KP8A 4U3FE 1AFOA 1OZHA 1SQQK 1JY2P 1DIPA 3H1KD 3A5TA 3EQ2A 2AEJA 3EFFK 2Q6QA 4EI2A 5AVTB 1SQPD 3FWLA 1MFZA 2JDIH 2YO2A 4IL6E 2E43A 5BVZA 4WB4A 1VQ6P 3CCLP 3H1LG 5KKZB 2ZVNB 4H0LC 2WPVB 1MV8A 2FYUG 2HODB 2Y0CA 3TNUA 1EQ7A 3B5NA 3MIWA 3A2AA 1BCCD 1S9KE 1Q82Q 3B5NC 3SFDC 2M3BA 5KLVK 5GTIH 1JUNA 2RKLA 2WITA 1JY2O 1L4AB 3D6ZA 5C39A 3L70G 2AXCA 3H1KE 2AXTE 1L0LJ 1DEEG 4L74A 3CCMP 2WSEH 1J1DB 4WWIA 1KFNA 3RBXA 1A02J 1BGYJ 1E79H 2Y9YA 3CCJP 5GTHE 1IFMA 4UB8H 2E76D 3IFMA 1K73Q 1RHZB 3CC2P 3AEDC 1SLQA 1NTKE 5AW4B 1SFCA 4N6JA 1KZUB 2FXOA 1HGVA 2E5TA 2DW3A 2OYHA 1J1EB 1VDFA 1SFCC 3M9BA 4RJTA 1YYCA 2N1TB 3H1HE 2FYUK 3FXEA 3HUSA 2Q1KA 3VYIA 3RL0C 2Q3IA 4L76A 2OYHC 2O1JA 2YKOA 1CI6B 1YITP 5AVWB 4HH2A 3WUUA 3JSVC 1IC2A 3BCCG 3CCSP 2G8YA 4I7ZC 2PRRA 2J5UA 2WTYA 1NJIQ 1PGOA 2FFDC 1JEKA 1N7SA 1DX7A 1LTSC 4U7JA 2IBZD 1ZLLA 1QVGO 1YQ3C 2D2CC 2JKVA 4OGQB 1KD1Q 1FDMA 3L74G 1N7SC 3HUSB 3L73G 4GT1A 3AE1C 1NTKJ 2BCCD 3AEBC 2C9NY 5CJ4A 2HYNA 5AVZB 3A3YB 3V2QA 4DCKA 1EZVG 1KB9D 3NTNA 1M56D 2E42A 1QVFO 3L71D 2KLVA 3H1HJ 1PP9G 2R32A 2W83C 3P7KA 1FBMA 1H8AA 3L72E 2W6BA 4PV1B 4JYCA 1JTHA 2YKQA 3TGUJ 3LIEA 1BDCA 1M1JA 1OXZA 2HR3A 2PGDA 1U7JA 2E75B 3V6IA 3G4SP 4Y28J 2E5YA 2H7HA 1EDKA 2IBZE 3MD0A 1GDTA 4M3LA 1SQQD 1SQVE 1M1JC 4I2LC 1VQMP 1W5CE 1S2EA 3TK1A 3A0HE 4O9BA 4EDFA 1Q2NA 3RK2C 3GHGB 5APUA 2BCCE 2FYNB 2GM4A 3CCUP 2D2CD 4GKGA 1SQBG 3A0HH 3LIDA 4ZNCA 3CX5E 1KB9E 1NKNA 3L36A 1N7SD 1Q90D 1RF1A 2P2UA 3L71E 3CCVP 2V7QH 1XTGB 1SQPK 1NTZJ 1LTAC 4UB6E 1JTHB 1L0NG 2N9YB 1LWUA 1SQXG 1RF1C 3H1JD 1D7MA 3QH9A 4OVNF 3CCEP 4AUWA 3KPEA 1T8ZA 1LWUC 5H2FE 3EFGA 4PD4D 1NHLA 3L72J 2W6AA 4TLFA 1SQQE 5H2FH 3RBZA 2IYOA 2E74B 3AEGC 3MTUE 1CW5A 1GMJA 3USSA 3G6EP 3MP7B 1WRGA 1AQTA 3HD7D 4K3AA 5APTA 3R2PA 4TT3H 2QRXA 1SQVJ 3Q5RA 3WUVA 1USDA 4N78D 3RK2D 3HE4A 1LNQA 1LWUB 5KAIH 3BRTB 1AJYA 1FZFA 1K9MQ 3H1LD 1ZMEC 1KYOE 1JCDA 3H1IG 3EWKA 3WU2H 5KLVE 3CWBJ 2I8DA 2ZVOB 2FYUD 4PD4E 1RH5B 1KQFB 3VN0A 2H89C 3RK3B 2ZYGA 3L37A 1URQB 3AE4C 3AE6C 5L8RJ 2KK7A 1JY3P 1PL5A 1OVRA 2KZIA 1OIPA 1GL2B 3CI9A 1SQQJ 1RY3A 2QEXP 4W80A 3L70D 4WY4B 1W2EA 1LGHB 4XA4A 3JC22 1M8OB 2QG4A 1UIIA 2I1JA 3L75G 1MZ9A 4K35A 2KI7B 3F89A 5B5EH 3PTZA 4HB1A 2HLOA 3JCUE 3L4FA 3G9RA 1ZRTE 3D6YA 5CHXA 2CPSA 4YTPC 4ASVA 3CMAP 5DJTB 2LXBA 1P84D 1Q81Q 5CJ0A 1SP4A 2LR2A 2FYUE 4IFDK 2ZXEB 2K9JB 2CK3H 2V4HA 1VF5B 3TSIA 1S1CX 1JO5A 3V2PA 1OW6A 1JY3O 3CX5I 5KLVJ 3M9QA 3VP8A 2B87A 2RN0A 1USEA 1LTJA 4AYCA 2P58A 1JMMA 2NPSB 3BATA 4D6TE 1NU1G 1BE3E 3C9IA 1QL1A 5E79H 1LTJC 1RE3A 4GOEA 3IAOA 2PP6A 1FAVA 3P32A 2Q3EA 2K9YA 4BRYA 4EYYQ 2RMZA 3BCCD 1RE3C 1G1IA 1OMIA 2YXRB 1ZW0A 1R5LA 3AEFC 2XNXA 2WPQA 3KHUA 5TISE 1OX3A 2MKVA 3PH0A 1M7LA 1OVUA 3KZIH 1KQLA 3PHLA 3KQGA 1N7LA 3L74D 5B66H 1PGQA 3L73D 2FBWC 4H13D 2E76C 2QVAA 2A06G 5CCHA 4JYBA 2R3SA 3H25A 4A7PA 3QWOC 1EZVD 1NTMG 1KYOI 3U59A 3LW5H 3CXHE 4IL6H 5CCHC 2M5AA 2R44A 4DT0A 1PP9D 4PD4I 4IL6X 3II6A 4D6TJ 3H6PA 1BE3J 2JR8A 1OW7A 2AEMA 2SPZA 4H44C 5AW2B 3K5BA 2B88A 2JJLA 1H0TA 4LLHA 2WPSA 4C7NA 2FXMA 1N2DC 1E5WA 2K37A 2RH0A 3FGAD 2M0BA 2FY8A 4H0LB 1SQPE 2IDBA 3AE3C 2AXTH 1GU4A 1N73A 1SQBD 4U3FJ 1EZVE 2CPBA 1LT9C 1WT6A 3TNUB 1PIXA 1N73C 2QSIA 3B5NB 2NZ2A 1LT1A 1H88A 1KORA 1L0ND 5GTHH 4JPZB 3LW5J 1X0TA 3O6QA 1SQXD 2MJZA 1BCCE 5CCHD 2W6JH 3M91A 5AW9B 4C7NB 1L0LG 3V4QA 4CPGA 2K3RA 1HBWA 1L4AD 2BEQD 3G71P 3VP9A 2IZ1A 2Y0EA 2XKMA 1YJWP 4H44D 1BGYG 2YIUC 1YHQP 1VQ9P 1VQ5P 1FZAA 4DZOA 1HH0A 1RE4A 1KQSO 2FFDA 2P67A 1BDDA 3FWNA 3H1KJ 2W90A 2NRGA 1SQPJ 1QL2A 1EDLA 1RE4C 3OW2O 4BWNA 1SFCB 1AQ5A 2LKMA 3RL0B 1FZBA 2Q5UA 1GK4A 3A0BE 3UIAA 2OYHB 1FS0E 3H1ID 3RGUA 4IFMA 4DOJA 1X8YA 4LC1A 2GUVA 3VMAA 4QMAA 2O1KA 4C46A 1ZN5A 1BCCJ 5KTBA 1HJ0A 3P8CD 4I7ZB 2C9LY 5AW6B 4Z1MH 5AVYB 3CXHI 1UIXA 3V2NA 1OWAA 3CCRP 1JB0J 1VL2A 2HG5D 2FFDB 2FXPA 1IO4A 2D2CB 1N8RQ 3L75D 3HD7A 1N7SB 2J59M 2K88A 4LGDE 1AVYA 3D71A 2B89A 1YTZI 3FXDA 1ZXGA 1NTKG 1NOHA 3AE7C 3MUDA 1KV4A 3S4RA 3HD7C 2OTKE 3MZWB 1SS1A 1SVFA 1MUUA 1GW3A 3C8VA 1FJPA 2LXCB 3Q5PA 3MUDC 4C7RA 1QEXA 3H1HG 2R5DA 2KS1A 4IOIH 1U7MA 1VQ8P 3P8CE 3SSUA 4EIJA 3B8EB 1KC8Q 3TGUG 1IK7A 2IX7C 5APVA 3CX5H 2L91A 1KB9H 4JBZA 1VQOP 4N3YB 2JWDA 3CC7P 2FYZA 1X9VA 1NU1D 1M1JB 3M06A 4UB6H 3L75E 4YXWH 3I56P 3IN6A 5KAFE 2J58A 1OFCX 1PGJA 1GD2E 3RK2B 2WSFH 2OQQA 5KAFH 2WWWA 5M1BA 3N4XA 1HTLC 5TJHA 2WSCH 1YQ4C 2KS1B 5AW7B 1CZQA 2A45H 4W7YA 1NTZG 1LP1A 2POHA 1RF1B 4PJ0E 2GA1A 1QGKB 2VRSA 2WPRA 1WMKA 1T2KD 2Z4EA 1PGPA 4PJ0H 3R4YA 2M8RA 1GTWA 2C0WA 1Q7YQ 1Y47A 3M9HA 3BVHA 2BCCJ 3AECC 2A06D 1KQGB 1LTBC 3L72G 3H1JE 2ZYDA 1SQBK 2KNCA 1NTMD 3L71J 3CL3D 4YXDC 2WVRA 1NAYA 2QJKC 1OVVA 3M0DA 3CMEP 1KYOH 1IFDA 1JCCA 1FOSF 1HVVA 1JNMA 1L0NK 1T6AA 1KFMA 2E74D 1SQXK 3SFEC 1SQVG 4PD4H 2QJYC 2WSFJ 3M0DC 1FZCA 3VTPC 2Q9IA 4NPDA 2IFNA 5AW1B 2WSCJ 1FZCC 2Y9ZA 2ZYAA 3HE4B 3HE5A 1RF0A 4I6MC 3TDKA 4N78E 1IFNA 4RO0A 3CWBG 3O8ZA 1VQ7P 3WUTA 1NTZK 3RL0g 1EC5A 2KNCB 5KLIC 2IBZI 1EDIA 1RF0C 2JO1A 2WMMA 3AEEC 3AE8C 3M0AA 2HPCA 5AW5B 4Y99C 3H1LE 3JCUH 3B71A 2ZT9C 2YNYA 1ZP0C 3MGNA 3T97A 1URQD 3PLNA 4H13C 3H1JJ 4L73A 2IZ0A 1KB9I 2IYPA 1S5LE 2KXPB 1L0LD 3U1CA 1KILD 2BASA 4KJMA 3V4WA 3H32A 1VQPP 3L70E 2QE7H 4RESB 1U57A 3HE5B 5CBNA 1PPJG 1BGYD 1IFIA 1S5LX 2Z5IA 2JP3A 4IFFA 1S3JA 1PZQA 1S4XA 2OYOA 3BRVB 2C0XA 3Q5SA 1X79B 2K1AA 1IFJA 2BEZF 2OYIA 1FC2C 2A45I 3Q2YA 3Q1MA 2YO3A 1P84E 2Z5HA 5KLVG 1IJDB 2OYIC 1FDOA 3CC4P 1G1JA 2YXQB 1KTMA 5CCGC 3CLQA 3P8MC 5CMZA 5APXA 1ZV8A 2HODA 3H1LJ 2ZT9D 5KKZC 2B87B 1LTJB 2YMYA 5TISH 3H32B 3Q3DA 2FYUJ 2HFED 3W68A 2N9BA 1BGYE 1L4AA 1Y9BA 3U1AA 5APWA 1HF9A 1EDJA 1K05A 4BRYB 5DJUB 2OYIB 2KOGA 1L4AC 1HWTC 3BCCE 3L70J 1R8EA 3CXHH 1LTIC 2QA4P 1NU1K 4HJGH 2PFXA 3ITKA 1KN7A 3D70A 1J1DC 1X22A 1IFPA 4ZMDA 4KHXA 2E76B 1NTKD 1YBKA 5APQA 5GTIE 1IZNB 1VQLP 3L74E 3L73E 1FOSE 1PV3A 1LT9A 1JOCA 5CCGD 3H1HD 1BSNA 3CCQP 2N1TA 3PRJA 1KMIZ 4D6TG 2H8PD 1BE3G 1VQ4P 1JY3N 2GUSA 2M5AB 3KXDA 5AW8B 4H44B 4JQ0D 1NYHA 3TGUD 2KIKA 1J1EC 2H43A 1PP9E 2N1TC 1CI6A 2R3CA 4UB8E 4OWFA 1FE6A 2KUBA 2G3AA 1H0TB 4AQRD 3GF3A 1NTMK 2YKPA 3GLMA 4GDOA 1AA0A 3BCCJ 3A7OA 3V2RA 2OTLP 3E1RA
chains in the Genus database with same CATH topology
2NPSD 4ZKPA 4C7RA 1LT9B 1G2CB 2R5DA 1NO4A 1JY3P 2ZFCA 2KP8A 1N73B 1AFOA 1J2JB 1SQQK 1JY2P 3P8CE 2L5GB 4EIJA 3A5TA 3EQ2A 3B8EB 1GL2B 3CI9A 1RY3A 4W80A 4WY4B 5AVTB 2Q7CA 2IX7C 5APVA 1W2EA 1LGHB 4XA4A 3B5ND 2I1JA 2XDJA 1MZ9A 1MFZA 3HUSC 4N3YB 2YO2A 2E43A 2FYZA 1X9VA 1FJPA 2HLOA 5BVZA 4WB4A 1M1JB 3M06A 3L4FA 2J58A 5CHXA 2XV5A 3OJAB 1H89A 1MV8A 2CPSA 2KSJA 3RK2B 1GD2E 2HODB 2WSFH 3TNUA 1EQ7A 5AVRB 3B5NA 2N1TD 2WWWA 2IFMA 5CJ0A 3MIWA 1SP4A 1DH3A 3A2AA 4IFDK 2ZXEB 1S9KE 3N4XA 1Z56A 1HTLC 1T3JA 3TSIA 2WSCH 1GZLA 1JO5A 3B5NC 5AVQB 5AW7B 1CZQA 2M3BA 3V2PA 1JY3O 2A45H 4W7YA 5KLVK 4EOTA 1JUNA 2WITA 3L37A 2QM8A 4W7ZA 1JY2O 1L4AB 3HTKA 2POHA 3M9QA 3VP8A 5AVXB 1RF1B 1L0LK 1ZR4A 1LTJA 4AYCA 2I1KA 1JMMA 2VRSA 2WPRA 2NPSB 1T2KD 2Z4EA 3BATA 1JY2N 3SWFA 3GHGA 3C9IA 3HRNA 3L35A 2M8RA 2WSEH 1J1DB 2XU6A 1GTWA 1KFNA 2C0WA 1QL1A 3OA7A 3BVHA 3M9HA 1XTCC 2OARA 3NFQA 1LTJC 1RE3A 1SFCD 1LTBC 2PP6A 1A02J 5AW3B 1FAVA 3P32A 1SQBK 3GHGC 3RL0D 1IFMA 2QM7A 1RE3C 1G1IA 3CL3D 3IFMA 3M0DA 3OAKA 1IFDA 1JCCA 1FOSF 1HVVA 1JNMA 1L0NK 1SLQA 5AW4B 1SFCA 1KFMA 2XNXA 3NMDA 1SQXK 4N6JA 2WPQA 1T2KC 1KZUB 3VMXA 1HGVA 3M0DC 1FZCA 5BU5A 4WBAA 1M7LA 2OYHA 1J1EB 3VTPC 2Q9IA 1VDFA 3TYYA 3HTKB 1SFCC 3M9BA 1KQLA 2IFNA 1YYCA 2N1TB 2FYUK 2FKWB 3KQGA 3HUSA 5AW1B 1N7LA 5AVSB 1CSBA 3VYIA 1NWQA 3RL0C 1GU5A 1FZCC 5APSA 2Q3IA 2OYHC 1FZGA 2O1JA 3HE4B 3NXSA 3HE5A 1RF0A 2YKOA 4I6MC 5CCHA 4N78E 4JYBA 4ZKUA 1CI6B 5AVWB 1GW4A 4HH2A 1IFNA 3HD7B 3VMYA 3O8ZA 1IC2A 1NTZK 3U59A 3LW5H 1RF0C 5CCHC 3M0AA 2HPCA 5AW5B 4Y99C 3II6A 2YNYA 2WTYA 3H6PA 3MGNA 2KYVA 3T97A 3BASA 2FFDC 1URQD 1N7SA 1A02F 1DX7A 1LTSC 4I1LA 5AW2B 1ZLLA 2JJLA 4LLHA 2WPSA 4C7NA 2FXMA 1N2DC 1E5WA 1FDMA 1N7SC 3U1CA 1KILD 3HUSB 1HUCA 2BASA 1NTKK 3V4WA 4GT1A 1URQA 3H32A 1LTGC 2P1JA 5APYA 1DEBA 4RESB 2C9NY 3HE5B 5CJ4A 2HYNA 5AVZB 1IFIA 2WZ7A 3A3YB 3V2QA 2Z5IA 3NTNA 2E42A 4IFFA 1GU4A 1N73A 3RK3C 1URQC 1NKZB 3VMZA 1KILA 2KLVA 3BRVB 2C0XA 5AVVB 2R32A 2JEEA 1GL2A 2CPBA 1X79B 3V5BA 1LT9C 1WT6A 3P7KA 1FJKA 4WY4A 1IFJA 3N7NA 1FBMA 1GK6A 1H8AA 2OYIA 2KB7P 2W6BA 1ZR2A 3TNUB 1N73C 4JYCA 3B5NB 1JTHA 2A45I 1H88A 1KILC 2YKQA 1GL2C 2YO3A 2Z5HA 3LIEA 1M1JA 4WY4C 2MJZA 1IJDB 2OYIC 1OXZA 5AVUB 1VPCA 1G1JA 2P7JA 5CCHD 2XZRA 3M91A 5AW9B 5CCGC 4C7NB 3CLQA 2H7HA 3P8MC 3MD0A 3V4QA 1GDTA 5KJ7A 5CMZA 4M3LA 5APXA 1HBWA 1L4AD 1ZV8A 1HJBA 2HODA 1HGZA 1M1JC 4I2LC 3VP9A 1LTJB 2YMYA 2XKMA 3TK1A 3H32B 3WMM0 2HFED 3VOPA 5KJ7C 4O9BA 3RK2C 3GHGB 5APUA 1FZAA 2GM4A 4DZOA 2N9BA 4GKGA 3LIDA 3G3ZA 1L4AA 3U1AA 2WT7A 5APWA 1NKNA 3L36A 1N7SD 1KILB 1RF1A 1HH0A 2P2UA 1RE4A 2PAJA 1T3UA 1XTGB 3IR9A 2FFDA 2P67A 2OYIB 2NPSA 1SQPK 1LTAC 2O01H 2KOGA 1JTHB 1L4AC 1HWTC 1LWUA 1RF1C 3PP5A 1QL2A 1RE4C 1N86A 1LTIC 1NU1K 1SFCB 1AQ5A 2LKMA 3RK3D 2NPSC 4AUWA 3KPEA 3RL0B 1T8ZA 1LWUC 1FZCB 1J1DC 1FZBA 2Q5UA 1GK4A 2A45G 3UIAA 3EFGA 2OYHB 4KHXA 1NHLA 5BU8B 2W6AA 4IFMA 4XE5B 5APQA 1GL2D 4DOJA 1X8YA 4B86A 4WY4D 4LC1A 4OH8B 2GUVA 3E1IA 3MTUE 1YTZT 2O1KA 4C46A 1FOSE 1CW5A 1ZN5A 1LT9A 1JOCA 1G2CA 5CCGD 5KTBA 4Y99B 3P8CD 2C9LY 1SQVK 5AW6B 1WRGA 2R5BA 2WT7B 3HD7D 5AVYB 5APTA 2N1TA 3R2PA 3V2NA 2H8PD 1OWAA 3SWYA 2HG5D 1JY3N 2GUSA 2FFDB 2HPCB 5AW8B 5KJ7D 4N78D 3RK2D 1J1EC 3HE4A 1LWUB 2H43A 2N1TC 3BRTB 1IO4A 5CCGA 2IPPA 1CI6A 2R3CA 4JF7A 1FZFA 3KYQA 4HYTB 1NAFA 3HD7A 1N7SB 2J59M 4LGDE 3KDPB 1YTZI 4GIFA 5AW0B 1FU1A 4AQRD 1JCDA 1NTMK 2W27A 2YKPA 1NOHA 3I5CA 3MUDA 3HD7C 1FZEA 1LTTC 1IK9A 1NH4A 1SVFA 1PFIA 1MUUA 3A7OA 1GW3A 1S9KD 3V2RA 3VN0A 3RK3B 1URQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A02 J;  5AW3 B;  1FAV A;  3P32 A;  1HWT C;  1HUC A;  2BAS A;  1G2C B;  2R5D A;  3V4W A;  2ZFC A;  4GT1 A;  2QM7 A;  2KP8 A;  1J2J B;  5APY A;  4RES B;  2C9N Y;  4AUW A;  3HE5 B;  3M0D A;  5AVZ B;  3A5T A;  3OAK A;  3B8E B;  3A3Y B;  2Z5I A;  1FOS F;  3NTN A;  2Q5U A;  1GK4 A;  1JNM A;  1SLQ A;  5AVT B;  5AW4 B;  2E42 A;  2Q7C A;  3UIA A;  1GU4 A;  5APV A;  4KHX A;  3NMD A;  2WPQ A;  1T2K C;  3VMZ A;  3VMX A;  2W6A A;  5AVV B;  1MFZ A;  2R32 A;  4XE5 B;  2YO2 A;  5APQ A;  3V5B A;  2E43 A;  3P7K A;  1X8Y A;  4B86 A;  1GK6 A;  1H8A A;  4LC1 A;  3VTP C;  3M06 A;  3TYY A;  3M9B A;  1KQL A;  3TNU B;  1YYC A;  4JYC A;  3KQG A;  4C46 A;  5AW1 B;  1FOS E;  5AVS B;  1H88 A;  1CSB A;  3VYI A;  1NWQ A;  2XV5 A;  1H89 A;  2YO3 A;  1MV8 A;  1GU5 A;  2C9L Y;  5APS A;  5AW6 B;  2R5B A;  2Z5H A;  3LIE A;  2WT7 B;  5AVY B;  1GD2 E;  2Q3I A;  5APT A;  3TNU A;  5AVR B;  1OXZ A;  3HE4 B;  3NXS A;  5AVU B;  3HE5 A;  1OWA A;  2WWW A;  4I6M C;  2P7J A;  4JYB A;  2XZR A;  1SP4 A;  1DH3 A;  3M91 A;  3A2A A;  5AW9 B;  1CI6 B;  4C7N B;  2H7H A;  5AVW B;  3P8M C;  3MD0 A;  3V4Q A;  2ZXE B;  5CMZ A;  4M3L A;  5APX A;  5AW8 B;  3VMY A;  1S9K E;  1HBW A;  1HJB A;  3O8Z A;  3HE4 A;  4I2L C;  1GZL A;  5AVQ B;  5AW7 B;  1CZQ A;  1IO4 A;  4EOT A;  2IPP A;  1CI6 A;  2R3C A;  1JUN A;  3M0A A;  3TK1 A;  4HYT B;  5AW5 B;  1NAF A;  2QM8 A;  3HTK A;  5APU A;  5AVX B;  2YNY A;  3KDP B;  2WTY A;  5AW0 B;  4AYC A;  4DZO A;  4AQR D;  3MGN A;  2N9B A;  2VRS A;  2W27 A;  2WPR A;  4GKG A;  3LID A;  3T97 A;  1T2K D;  3I5C A;  2WT7 A;  5APW A;  3L36 A;  1A02 F;  3SWF A;  5AW2 B;  3L35 A;  2P2U A;  2XU6 A;  1GTW A;  1MUU A;  3A7O A;  3M9H A;  1S9K D;  2JJL A;  3NFQ A;  3VN0 A;  2WPS A;  3IR9 A;  2P67 A;  4C7N A;  3L37 A; 
#chains in the Genus database with same CATH topology
 4H0L D;  4U3F G;  4ZKP A;  1LT9 B;  2B9B A;  1NO4 A;  1AV1 A;  1N73 B;  1J2J B;  1MKM A;  2L5G B;  1NTZ D;  3AE5 C;  1M1K Q;  1SQB E;  4L75 A;  4YPC A;  2Q7C A;  4OGQ C;  1L2P A;  3L74 J;  1S72 P;  3B5N D;  3TGU E;  2XDJ A;  1M90 Q;  1P84 I;  3HUS C;  3L73 J;  3I55 P;  3O6Q B;  3F5H A;  2OGU A;  1L0N E;  4DJG A;  1DD3 A;  1SQX E;  3L72 D;  2WSE J;  2XV5 A;  3OJA B;  1H89 A;  2YIU B;  2KSJ A;  2W8Z A;  1DD4 A;  1EXI A;  5AVR B;  3C1L A;  3GMA A;  2N1T D;  2IFM A;  2OTJ P;  1DH3 A;  1PP9 J;  3MHV A;  2ZJS E;  3A0B H;  2KZJ A;  1Z56 A;  1T3J A;  4PV1 C;  1GZL A;  5AVQ B;  4EOT A;  1SQV D;  2KSE A;  2QM8 A;  1YJ9 P;  4W7Z A;  3H1K G;  2O01 N;  3HTK A;  5AVX B;  1L0L K;  1SQP G;  3IF4 A;  1ZR4 A;  5CBO A;  1K04 A;  1NTZ E;  2E75 C;  2QIW A;  2WQY C;  2I1K A;  3CD6 P;  1YJN P;  1JY2 N;  3SWF A;  3GHG A;  3HRN A;  3L35 A;  4BXL A;  2XU6 A;  4WVZ A;  3OA7 A;  3CX5 D;  1XTC C;  2OAR A;  3NFQ A;  1MFT A;  1SFC D;  1YI2 P;  5AW3 B;  3SWK A;  3GHG C;  3CWB D;  3RL0 D;  2FYN C;  2QM7 A;  1SQB J;  4OGQ D;  2P10 A;  1BCC G;  3OAK A;  1FDI A;  2Y0D A;  3H1I E;  3S9O A;  4RKU J;  3NMD A;  2M3E A;  1T2K C;  3ABV C;  3VMX A;  1L0N J;  1YIJ P;  1SQX J;  5BU5 A;  5EFW B;  4WBA A;  3TYY A;  3HTK B;  1EZV I;  2FKW B;  5AVS B;  1CSB A;  1NWQ A;  2ZAE B;  2WSS H;  1GU5 A;  5APS A;  3GG2 A;  1FZG A;  3NXS A;  4PV1 D;  4ZKU A;  1GW4 A;  3HD7 B;  3VMY A;  1PPJ D;  3PJS K;  2E74 C;  4MN4 C;  4GOF A;  2E75 D;  3CWB E;  2UWJ E;  2XND H;  3AEA C;  5K5G B;  2ITA A;  2KYV A;  3BAS A;  1A02 F;  1KYO D;  4I1L A;  5KLV D;  1JMB A;  4GOD A;  1HUC A;  1NTK K;  2YMK A;  3H1I J;  1URQ A;  1W2B O;  2KLU A;  1LTG C;  2P1J A;  5APY A;  1DEB A;  2WZ7 A;  2ZXX A;  3RK3 C;  1URQ C;  1NU1 E;  1M57 D;  1NKZ B;  3VMZ A;  1KIL A;  4ASW A;  1PPJ E;  5AVV B;  5KAI E;  2JEE A;  1GL2 A;  3V5B A;  1EXJ A;  1FJK A;  4WY4 A;  3N7N A;  1GK6 A;  1R5S A;  2KB7 P;  4NPF X;  3ZDM A;  1ZR2 A;  1KIL C;  1GL2 C;  2V7Q J;  4WY4 C;  1ZRT D;  2IBZ G;  3WU2 E;  2QJP C;  5AVU B;  1VPC A;  2P7J A;  3L75 J;  1ZOY C;  2XZR A;  4R4M A;  5KJ7 A;  3TF5 A;  1LP1 B;  1HJB A;  1HGZ A;  2BCC G;  3B4S A;  3WMM 0;  2K9J A;  3VOP A;  5KJ7 C;  1NGM B;  1BSH A;  3L71 G;  2O3J A;  1QX8 A;  4NPE A;  3G3Z A;  2WT7 A;  2QJK B;  1TU3 F;  1KIL B;  1Q86 Q;  2A06 E;  1VF5 C;  2PAJ A;  5B5E E;  1T3U A;  4D6T D;  3IR9 A;  1BE3 D;  2NPS A;  2QJP B;  3S1K A;  1LJ2 A;  2O01 H;  1NTM E;  2QJY B;  3PP5 A;  1N86 A;  3RK3 D;  2NPS C;  3FX0 A;  1VQN P;  1NU1 J;  1VQK P;  2JWA A;  1FZC B;  1SQQ G;  2A45 G;  1QLE D;  5BU8 B;  4R4L A;  2AEF A;  4XE5 B;  1GL2 D;  4B86 A;  3AE9 C;  4WY4 D;  1K8A Q;  1S5L H;  4OH8 B;  3E1I A;  1YTZ T;  5KLI B;  1G2C A;  4U3F D;  4Y99 B;  1SQV K;  1OW8 A;  2R5B A;  2WT7 B;  2ZT9 B;  3GW6 A;  3SWY A;  3E7K A;  3CPW O;  5E79 E;  3GF7 A;  2HPC B;  4HKZ H;  5KJ7 D;  4H13 B;  3H1J G;  4XFJ A;  5CCG A;  2H88 C;  2IPP A;  4JF7 A;  3KYQ A;  4HYT B;  1NAF A;  3T97 B;  3CXH D;  1Y8A A;  1VF5 D;  3RK3 E;  3KDP B;  2O01 J;  4GIF A;  5AW0 B;  1JM0 A;  1FU1 A;  1RQU A;  2W27 A;  1P84 H;  4KT0 J;  3I5C A;  1FZE A;  1NVO A;  3AE2 C;  1NTM J;  1LTT C;  1IK9 A;  1NH4 A;  1RQV A;  1PFI A;  1S9K D;  1L0L E;  1KIL E;  2NPS D;  3KZI E;  3W67 A;  1AVO A;  1G2C B;  2ZFC A;  5B66 E;  2KP8 A;  4U3F E;  1AFO A;  1OZH A;  1SQQ K;  1JY2 P;  1DIP A;  3H1K D;  3A5T A;  3EQ2 A;  2AEJ A;  3EFF K;  2Q6Q A;  4EI2 A;  5AVT B;  1SQP D;  3FWL A;  1MFZ A;  2JDI H;  2YO2 A;  4IL6 E;  2E43 A;  5BVZ A;  4WB4 A;  1VQ6 P;  3CCL P;  3H1L G;  5KKZ B;  2ZVN B;  4H0L C;  2WPV B;  1MV8 A;  2FYU G;  2HOD B;  2Y0C A;  3TNU A;  1EQ7 A;  3B5N A;  3MIW A;  3A2A A;  1BCC D;  1S9K E;  1Q82 Q;  3B5N C;  3SFD C;  2M3B A;  5KLV K;  5GTI H;  1JUN A;  2RKL A;  2WIT A;  1JY2 O;  1L4A B;  3D6Z A;  5C39 A;  3L70 G;  2AXC A;  3H1K E;  2AXT E;  1L0L J;  1DEE G;  4L74 A;  3CCM P;  2WSE H;  1J1D B;  4WWI A;  1KFN A;  3RBX A;  1A02 J;  1BGY J;  1E79 H;  2Y9Y A;  3CCJ P;  5GTH E;  1IFM A;  4UB8 H;  2E76 D;  3IFM A;  1K73 Q;  1RHZ B;  3CC2 P;  3AED C;  1SLQ A;  1NTK E;  5AW4 B;  1SFC A;  4N6J A;  1KZU B;  2FXO A;  1HGV A;  2E5T A;  2DW3 A;  2OYH A;  1J1E B;  1VDF A;  1SFC C;  3M9B A;  4RJT A;  1YYC A;  2N1T B;  3H1H E;  2FYU K;  3FXE A;  3HUS A;  2Q1K A;  3VYI A;  3RL0 C;  2Q3I A;  4L76 A;  2OYH C;  2O1J A;  2YKO A;  1CI6 B;  1YIT P;  5AVW B;  4HH2 A;  3WUU A;  3JSV C;  1IC2 A;  3BCC G;  3CCS P;  2G8Y A;  4I7Z C;  2PRR A;  2J5U A;  2WTY A;  1NJI Q;  1PGO A;  2FFD C;  1JEK A;  1N7S A;  1DX7 A;  1LTS C;  4U7J A;  2IBZ D;  1ZLL A;  1QVG O;  1YQ3 C;  2D2C C;  2JKV A;  4OGQ B;  1KD1 Q;  1FDM A;  3L74 G;  1N7S C;  3HUS B;  3L73 G;  4GT1 A;  3AE1 C;  1NTK J;  2BCC D;  3AEB C;  2C9N Y;  5CJ4 A;  2HYN A;  5AVZ B;  3A3Y B;  3V2Q A;  4DCK A;  1EZV G;  1KB9 D;  3NTN A;  1M56 D;  2E42 A;  1QVF O;  3L71 D;  2KLV A;  3H1H J;  1PP9 G;  2R32 A;  2W83 C;  3P7K A;  1FBM A;  1H8A A;  3L72 E;  2W6B A;  4PV1 B;  4JYC A;  1JTH A;  2YKQ A;  3TGU J;  3LIE A;  1BDC A;  1M1J A;  1OXZ A;  2HR3 A;  2PGD A;  1U7J A;  2E75 B;  3V6I A;  3G4S P;  4Y28 J;  2E5Y A;  2H7H A;  1EDK A;  2IBZ E;  3MD0 A;  1GDT A;  4M3L A;  1SQQ D;  1SQV E;  1M1J C;  4I2L C;  1VQM P;  1W5C E;  1S2E A;  3TK1 A;  3A0H E;  4O9B A;  4EDF A;  1Q2N A;  3RK2 C;  3GHG B;  5APU A;  2BCC E;  2FYN B;  2GM4 A;  3CCU P;  2D2C D;  4GKG A;  1SQB G;  3A0H H;  3LID A;  4ZNC A;  3CX5 E;  1KB9 E;  1NKN A;  3L36 A;  1N7S D;  1Q90 D;  1RF1 A;  2P2U A;  3L71 E;  3CCV P;  2V7Q H;  1XTG B;  1SQP K;  1NTZ J;  1LTA C;  4UB6 E;  1JTH B;  1L0N G;  2N9Y B;  1LWU A;  1SQX G;  1RF1 C;  3H1J D;  1D7M A;  3QH9 A;  4OVN F;  3CCE P;  4AUW A;  3KPE A;  1T8Z A;  1LWU C;  5H2F E;  3EFG A;  4PD4 D;  1NHL A;  3L72 J;  2W6A A;  4TLF A;  1SQQ E;  5H2F H;  3RBZ A;  2IYO A;  2E74 B;  3AEG C;  3MTU E;  1CW5 A;  1GMJ A;  3USS A;  3G6E P;  3MP7 B;  1WRG A;  1AQT A;  3HD7 D;  4K3A A;  5APT A;  3R2P A;  4TT3 H;  2QRX A;  1SQV J;  3Q5R A;  3WUV A;  1USD A;  4N78 D;  3RK2 D;  3HE4 A;  1LNQ A;  1LWU B;  5KAI H;  3BRT B;  1AJY A;  1FZF A;  1K9M Q;  3H1L D;  1ZME C;  1KYO E;  1JCD A;  3H1I G;  3EWK A;  3WU2 H;  5KLV E;  3CWB J;  2I8D A;  2ZVO B;  2FYU D;  4PD4 E;  1RH5 B;  1KQF B;  3VN0 A;  2H89 C;  3RK3 B;  2ZYG A;  3L37 A;  1URQ B;  3AE4 C;  3AE6 C;  5L8R J;  2KK7 A;  1JY3 P;  1PL5 A;  1OVR A;  2KZI A;  1OIP A;  1GL2 B;  3CI9 A;  1SQQ J;  1RY3 A;  2QEX P;  4W80 A;  3L70 D;  4WY4 B;  1W2E A;  1LGH B;  4XA4 A;  3JC2 2;  1M8O B;  2QG4 A;  1UII A;  2I1J A;  3L75 G;  1MZ9 A;  4K35 A;  2KI7 B;  3F89 A;  5B5E H;  3PTZ A;  4HB1 A;  2HLO A;  3JCU E;  3L4F A;  3G9R A;  1ZRT E;  3D6Y A;  5CHX A;  2CPS A;  4YTP C;  4ASV A;  3CMA P;  5DJT B;  2LXB A;  1P84 D;  1Q81 Q;  5CJ0 A;  1SP4 A;  2LR2 A;  2FYU E;  4IFD K;  2ZXE B;  2K9J B;  2CK3 H;  2V4H A;  1VF5 B;  3TSI A;  1S1C X;  1JO5 A;  3V2P A;  1OW6 A;  1JY3 O;  3CX5 I;  5KLV J;  3M9Q A;  3VP8 A;  2B87 A;  2RN0 A;  1USE A;  1LTJ A;  4AYC A;  2P58 A;  1JMM A;  2NPS B;  3BAT A;  4D6T E;  1NU1 G;  1BE3 E;  3C9I A;  1QL1 A;  5E79 H;  1LTJ C;  1RE3 A;  4GOE A;  3IAO A;  2PP6 A;  1FAV A;  3P32 A;  2Q3E A;  2K9Y A;  4BRY A;  4EYY Q;  2RMZ A;  3BCC D;  1RE3 C;  1G1I A;  1OMI A;  2YXR B;  1ZW0 A;  1R5L A;  3AEF C;  2XNX A;  2WPQ A;  3KHU A;  5TIS E;  1OX3 A;  2MKV A;  3PH0 A;  1M7L A;  1OVU A;  3KZI H;  1KQL A;  3PHL A;  3KQG A;  1N7L A;  3L74 D;  5B66 H;  1PGQ A;  3L73 D;  2FBW C;  4H13 D;  2E76 C;  2QVA A;  2A06 G;  5CCH A;  4JYB A;  2R3S A;  3H25 A;  4A7P A;  3QWO C;  1EZV D;  1NTM G;  1KYO I;  3U59 A;  3LW5 H;  3CXH E;  4IL6 H;  5CCH C;  2M5A A;  2R44 A;  4DT0 A;  1PP9 D;  4PD4 I;  4IL6 X;  3II6 A;  4D6T J;  3H6P A;  1BE3 J;  2JR8 A;  1OW7 A;  2AEM A;  2SPZ A;  4H44 C;  5AW2 B;  3K5B A;  2B88 A;  2JJL A;  1H0T A;  4LLH A;  2WPS A;  4C7N A;  2FXM A;  1N2D C;  1E5W A;  2K37 A;  2RH0 A;  3FGA D;  2M0B A;  2FY8 A;  4H0L B;  1SQP E;  2IDB A;  3AE3 C;  2AXT H;  1GU4 A;  1N73 A;  1SQB D;  4U3F J;  1EZV E;  2CPB A;  1LT9 C;  1WT6 A;  3TNU B;  1PIX A;  1N73 C;  2QSI A;  3B5N B;  2NZ2 A;  1LT1 A;  1H88 A;  1KOR A;  1L0N D;  5GTH H;  4JPZ B;  3LW5 J;  1X0T A;  3O6Q A;  1SQX D;  2MJZ A;  1BCC E;  5CCH D;  2W6J H;  3M91 A;  5AW9 B;  4C7N B;  1L0L G;  3V4Q A;  4CPG A;  2K3R A;  1HBW A;  1L4A D;  2BEQ D;  3G71 P;  3VP9 A;  2IZ1 A;  2Y0E A;  2XKM A;  1YJW P;  4H44 D;  1BGY G;  2YIU C;  1YHQ P;  1VQ9 P;  1VQ5 P;  1FZA A;  4DZO A;  1HH0 A;  1RE4 A;  1KQS O;  2FFD A;  2P67 A;  1BDD A;  3FWN A;  3H1K J;  2W90 A;  2NRG A;  1SQP J;  1QL2 A;  1EDL A;  1RE4 C;  3OW2 O;  4BWN A;  1SFC B;  1AQ5 A;  2LKM A;  3RL0 B;  1FZB A;  2Q5U A;  1GK4 A;  3A0B E;  3UIA A;  2OYH B;  1FS0 E;  3H1I D;  3RGU A;  4IFM A;  4DOJ A;  1X8Y A;  4LC1 A;  2GUV A;  3VMA A;  4QMA A;  2O1K A;  4C46 A;  1ZN5 A;  1BCC J;  5KTB A;  1HJ0 A;  3P8C D;  4I7Z B;  2C9L Y;  5AW6 B;  4Z1M H;  5AVY B;  3CXH I;  1UIX A;  3V2N A;  1OWA A;  3CCR P;  1JB0 J;  1VL2 A;  2HG5 D;  2FFD B;  2FXP A;  1IO4 A;  2D2C B;  1N8R Q;  3L75 D;  3HD7 A;  1N7S B;  2J59 M;  2K88 A;  4LGD E;  1AVY A;  3D71 A;  2B89 A;  1YTZ I;  3FXD A;  1ZXG A;  1NTK G;  1NOH A;  3AE7 C;  3MUD A;  1KV4 A;  3S4R A;  3HD7 C;  2OTK E;  3MZW B;  1SS1 A;  1SVF A;  1MUU A;  1GW3 A;  3C8V A;  1FJP A;  2LXC B;  3Q5P A;  3MUD C;  4C7R A;  1QEX A;  3H1H G;  2R5D A;  2KS1 A;  4IOI H;  1U7M A;  1VQ8 P;  3P8C E;  3SSU A;  4EIJ A;  3B8E B;  1KC8 Q;  3TGU G;  1IK7 A;  2IX7 C;  5APV A;  3CX5 H;  2L91 A;  1KB9 H;  4JBZ A;  1VQO P;  4N3Y B;  2JWD A;  3CC7 P;  2FYZ A;  1X9V A;  1NU1 D;  1M1J B;  3M06 A;  4UB6 H;  3L75 E;  4YXW H;  3I56 P;  3IN6 A;  5KAF E;  2J58 A;  1OFC X;  1PGJ A;  1GD2 E;  3RK2 B;  2WSF H;  2OQQ A;  5KAF H;  2WWW A;  5M1B A;  3N4X A;  1HTL C;  5TJH A;  2WSC H;  1YQ4 C;  2KS1 B;  5AW7 B;  1CZQ A;  2A45 H;  4W7Y A;  1NTZ G;  1LP1 A;  2POH A;  1RF1 B;  4PJ0 E;  2GA1 A;  1QGK B;  2VRS A;  2WPR A;  1WMK A;  1T2K D;  2Z4E A;  1PGP A;  4PJ0 H;  3R4Y A;  2M8R A;  1GTW A;  2C0W A;  1Q7Y Q;  1Y47 A;  3M9H A;  3BVH A;  2BCC J;  3AEC C;  2A06 D;  1KQG B;  1LTB C;  3L72 G;  3H1J E;  2ZYD A;  1SQB K;  2KNC A;  1NTM D;  3L71 J;  3CL3 D;  4YXD C;  2WVR A;  1NAY A;  2QJK C;  1OVV A;  3M0D A;  3CME P;  1KYO H;  1IFD A;  1JCC A;  1FOS F;  1HVV A;  1JNM A;  1L0N K;  1T6A A;  1KFM A;  2E74 D;  1SQX K;  3SFE C;  1SQV G;  4PD4 H;  2QJY C;  2WSF J;  3M0D C;  1FZC A;  3VTP C;  2Q9I A;  4NPD A;  2IFN A;  5AW1 B;  2WSC J;  1FZC C;  2Y9Z A;  2ZYA A;  3HE4 B;  3HE5 A;  1RF0 A;  4I6M C;  3TDK A;  4N78 E;  1IFN A;  4RO0 A;  3CWB G;  3O8Z A;  1VQ7 P;  3WUT A;  1NTZ K;  3RL0 g;  1EC5 A;  2KNC B;  5KLI C;  2IBZ I;  1EDI A;  1RF0 C;  2JO1 A;  2WMM A;  3AEE C;  3AE8 C;  3M0A A;  2HPC A;  5AW5 B;  4Y99 C;  3H1L E;  3JCU H;  3B71 A;  2ZT9 C;  2YNY A;  1ZP0 C;  3MGN A;  3T97 A;  1URQ D;  3PLN A;  4H13 C;  3H1J J;  4L73 A;  2IZ0 A;  1KB9 I;  2IYP A;  1S5L E;  2KXP B;  1L0L D;  3U1C A;  1KIL D;  2BAS A;  4KJM A;  3V4W A;  3H32 A;  1VQP P;  3L70 E;  2QE7 H;  4RES B;  1U57 A;  3HE5 B;  5CBN A;  1PPJ G;  1BGY D;  1IFI A;  1S5L X;  2Z5I A;  2JP3 A;  4IFF A;  1S3J A;  1PZQ A;  1S4X A;  2OYO A;  3BRV B;  2C0X A;  3Q5S A;  1X79 B;  2K1A A;  1IFJ A;  2BEZ F;  2OYI A;  1FC2 C;  2A45 I;  3Q2Y A;  3Q1M A;  2YO3 A;  1P84 E;  2Z5H A;  5KLV G;  1IJD B;  2OYI C;  1FDO A;  3CC4 P;  1G1J A;  2YXQ B;  1KTM A;  5CCG C;  3CLQ A;  3P8M C;  5CMZ A;  5APX A;  1ZV8 A;  2HOD A;  3H1L J;  2ZT9 D;  5KKZ C;  2B87 B;  1LTJ B;  2YMY A;  5TIS H;  3H32 B;  3Q3D A;  2FYU J;  2HFE D;  3W68 A;  2N9B A;  1BGY E;  1L4A A;  1Y9B A;  3U1A A;  5APW A;  1HF9 A;  1EDJ A;  1K05 A;  4BRY B;  5DJU B;  2OYI B;  2KOG A;  1L4A C;  1HWT C;  3BCC E;  3L70 J;  1R8E A;  3CXH H;  1LTI C;  2QA4 P;  1NU1 K;  4HJG H;  2PFX A;  3ITK A;  1KN7 A;  3D70 A;  1J1D C;  1X22 A;  1IFP A;  4ZMD A;  4KHX A;  2E76 B;  1NTK D;  1YBK A;  5APQ A;  5GTI E;  1IZN B;  1VQL P;  3L74 E;  3L73 E;  1FOS E;  1PV3 A;  1LT9 A;  1JOC A;  5CCG D;  3H1H D;  1BSN A;  3CCQ P;  2N1T A;  3PRJ A;  1KMI Z;  4D6T G;  2H8P D;  1BE3 G;  1VQ4 P;  1JY3 N;  2GUS A;  2M5A B;  3KXD A;  5AW8 B;  4H44 B;  4JQ0 D;  1NYH A;  3TGU D;  2KIK A;  1J1E C;  2H43 A;  1PP9 E;  2N1T C;  1CI6 A;  2R3C A;  4UB8 E;  4OWF A;  1FE6 A;  2KUB A;  2G3A A;  1H0T B;  4AQR D;  3GF3 A;  1NTM K;  2YKP A;  3GLM A;  4GDO A;  1AA0 A;  3BCC J;  3A7O A;  3V2R A;  2OTL P;  3E1R A; 
#chains in the Genus database with same CATH homology
 2NPS D;  4ZKP A;  4C7R A;  1LT9 B;  1G2C B;  2R5D A;  1NO4 A;  1JY3 P;  2ZFC A;  2KP8 A;  1N73 B;  1AFO A;  1J2J B;  1SQQ K;  1JY2 P;  3P8C E;  2L5G B;  4EIJ A;  3A5T A;  3EQ2 A;  3B8E B;  1GL2 B;  3CI9 A;  1RY3 A;  4W80 A;  4WY4 B;  5AVT B;  2Q7C A;  2IX7 C;  5APV A;  1W2E A;  1LGH B;  4XA4 A;  3B5N D;  2I1J A;  2XDJ A;  1MZ9 A;  1MFZ A;  3HUS C;  4N3Y B;  2YO2 A;  2E43 A;  2FYZ A;  1X9V A;  1FJP A;  2HLO A;  5BVZ A;  4WB4 A;  1M1J B;  3M06 A;  3L4F A;  2J58 A;  5CHX A;  2XV5 A;  3OJA B;  1H89 A;  1MV8 A;  2CPS A;  2KSJ A;  3RK2 B;  1GD2 E;  2HOD B;  2WSF H;  3TNU A;  1EQ7 A;  5AVR B;  3B5N A;  2N1T D;  2WWW A;  2IFM A;  5CJ0 A;  3MIW A;  1SP4 A;  1DH3 A;  3A2A A;  4IFD K;  2ZXE B;  1S9K E;  3N4X A;  1Z56 A;  1HTL C;  1T3J A;  3TSI A;  2WSC H;  1GZL A;  1JO5 A;  3B5N C;  5AVQ B;  5AW7 B;  1CZQ A;  2M3B A;  3V2P A;  1JY3 O;  2A45 H;  4W7Y A;  5KLV K;  4EOT A;  1JUN A;  2WIT A;  3L37 A;  2QM8 A;  4W7Z A;  1JY2 O;  1L4A B;  3HTK A;  2POH A;  3M9Q A;  3VP8 A;  5AVX B;  1RF1 B;  1L0L K;  1ZR4 A;  1LTJ A;  4AYC A;  2I1K A;  1JMM A;  2VRS A;  2WPR A;  2NPS B;  1T2K D;  2Z4E A;  3BAT A;  1JY2 N;  3SWF A;  3GHG A;  3C9I A;  3HRN A;  3L35 A;  2M8R A;  2WSE H;  1J1D B;  2XU6 A;  1GTW A;  1KFN A;  2C0W A;  1QL1 A;  3OA7 A;  3BVH A;  3M9H A;  1XTC C;  2OAR A;  3NFQ A;  1LTJ C;  1RE3 A;  1SFC D;  1LTB C;  2PP6 A;  1A02 J;  5AW3 B;  1FAV A;  3P32 A;  1SQB K;  3GHG C;  3RL0 D;  1IFM A;  2QM7 A;  1RE3 C;  1G1I A;  3CL3 D;  3IFM A;  3M0D A;  3OAK A;  1IFD A;  1JCC A;  1FOS F;  1HVV A;  1JNM A;  1L0N K;  1SLQ A;  5AW4 B;  1SFC A;  1KFM A;  2XNX A;  3NMD A;  1SQX K;  4N6J A;  2WPQ A;  1T2K C;  1KZU B;  3VMX A;  1HGV A;  3M0D C;  1FZC A;  5BU5 A;  4WBA A;  1M7L A;  2OYH A;  1J1E B;  3VTP C;  2Q9I A;  1VDF A;  3TYY A;  3HTK B;  1SFC C;  3M9B A;  1KQL A;  2IFN A;  1YYC A;  2N1T B;  2FYU K;  2FKW B;  3KQG A;  3HUS A;  5AW1 B;  1N7L A;  5AVS B;  1CSB A;  3VYI A;  1NWQ A;  3RL0 C;  1GU5 A;  1FZC C;  5APS A;  2Q3I A;  2OYH C;  1FZG A;  2O1J A;  3HE4 B;  3NXS A;  3HE5 A;  1RF0 A;  2YKO A;  4I6M C;  5CCH A;  4N78 E;  4JYB A;  4ZKU A;  1CI6 B;  5AVW B;  1GW4 A;  4HH2 A;  1IFN A;  3HD7 B;  3VMY A;  3O8Z A;  1IC2 A;  1NTZ K;  3U59 A;  3LW5 H;  1RF0 C;  5CCH C;  3M0A A;  2HPC A;  5AW5 B;  4Y99 C;  3II6 A;  2YNY A;  2WTY A;  3H6P A;  3MGN A;  2KYV A;  3T97 A;  3BAS A;  2FFD C;  1URQ D;  1N7S A;  1A02 F;  1DX7 A;  1LTS C;  4I1L A;  5AW2 B;  1ZLL A;  2JJL A;  4LLH A;  2WPS A;  4C7N A;  2FXM A;  1N2D C;  1E5W A;  1FDM A;  1N7S C;  3U1C A;  1KIL D;  3HUS B;  1HUC A;  2BAS A;  1NTK K;  3V4W A;  4GT1 A;  1URQ A;  3H32 A;  1LTG C;  2P1J A;  5APY A;  1DEB A;  4RES B;  2C9N Y;  3HE5 B;  5CJ4 A;  2HYN A;  5AVZ B;  1IFI A;  2WZ7 A;  3A3Y B;  3V2Q A;  2Z5I A;  3NTN A;  2E42 A;  4IFF A;  1GU4 A;  1N73 A;  3RK3 C;  1URQ C;  1NKZ B;  3VMZ A;  1KIL A;  2KLV A;  3BRV B;  2C0X A;  5AVV B;  2R32 A;  2JEE A;  1GL2 A;  2CPB A;  1X79 B;  3V5B A;  1LT9 C;  1WT6 A;  3P7K A;  1FJK A;  4WY4 A;  1IFJ A;  3N7N A;  1FBM A;  1GK6 A;  1H8A A;  2OYI A;  2KB7 P;  2W6B A;  1ZR2 A;  3TNU B;  1N73 C;  4JYC A;  3B5N B;  1JTH A;  2A45 I;  1H88 A;  1KIL C;  2YKQ A;  1GL2 C;  2YO3 A;  2Z5H A;  3LIE A;  1M1J A;  4WY4 C;  2MJZ A;  1IJD B;  2OYI C;  1OXZ A;  5AVU B;  1VPC A;  1G1J A;  2P7J A;  5CCH D;  2XZR A;  3M91 A;  5AW9 B;  5CCG C;  4C7N B;  3CLQ A;  2H7H A;  3P8M C;  3MD0 A;  3V4Q A;  1GDT A;  5KJ7 A;  5CMZ A;  4M3L A;  5APX A;  1HBW A;  1L4A D;  1ZV8 A;  1HJB A;  2HOD A;  1HGZ A;  1M1J C;  4I2L C;  3VP9 A;  1LTJ B;  2YMY A;  2XKM A;  3TK1 A;  3H32 B;  3WMM 0;  2HFE D;  3VOP A;  5KJ7 C;  4O9B A;  3RK2 C;  3GHG B;  5APU A;  1FZA A;  2GM4 A;  4DZO A;  2N9B A;  4GKG A;  3LID A;  3G3Z A;  1L4A A;  3U1A A;  2WT7 A;  5APW A;  1NKN A;  3L36 A;  1N7S D;  1KIL B;  1RF1 A;  1HH0 A;  2P2U A;  1RE4 A;  2PAJ A;  1T3U A;  1XTG B;  3IR9 A;  2FFD A;  2P67 A;  2OYI B;  2NPS A;  1SQP K;  1LTA C;  2O01 H;  2KOG A;  1JTH B;  1L4A C;  1HWT C;  1LWU A;  1RF1 C;  3PP5 A;  1QL2 A;  1RE4 C;  1N86 A;  1LTI C;  1NU1 K;  1SFC B;  1AQ5 A;  2LKM A;  3RK3 D;  2NPS C;  4AUW A;  3KPE A;  3RL0 B;  1T8Z A;  1LWU C;  1FZC B;  1J1D C;  1FZB A;  2Q5U A;  1GK4 A;  2A45 G;  3UIA A;  3EFG A;  2OYH B;  4KHX A;  1NHL A;  5BU8 B;  2W6A A;  4IFM A;  4XE5 B;  5APQ A;  1GL2 D;  4DOJ A;  1X8Y A;  4B86 A;  4WY4 D;  4LC1 A;  4OH8 B;  2GUV A;  3E1I A;  3MTU E;  1YTZ T;  2O1K A;  4C46 A;  1FOS E;  1CW5 A;  1ZN5 A;  1LT9 A;  1JOC A;  1G2C A;  5CCG D;  5KTB A;  4Y99 B;  3P8C D;  2C9L Y;  1SQV K;  5AW6 B;  1WRG A;  2R5B A;  2WT7 B;  3HD7 D;  5AVY B;  5APT A;  2N1T A;  3R2P A;  3V2N A;  2H8P D;  1OWA A;  3SWY A;  2HG5 D;  1JY3 N;  2GUS A;  2FFD B;  2HPC B;  5AW8 B;  5KJ7 D;  4N78 D;  3RK2 D;  1J1E C;  3HE4 A;  1LWU B;  2H43 A;  2N1T C;  3BRT B;  1IO4 A;  5CCG A;  2IPP A;  1CI6 A;  2R3C A;  4JF7 A;  1FZF A;  3KYQ A;  4HYT B;  1NAF A;  3HD7 A;  1N7S B;  2J59 M;  4LGD E;  3KDP B;  1YTZ I;  4GIF A;  5AW0 B;  1FU1 A;  4AQR D;  1JCD A;  1NTM K;  2W27 A;  2YKP A;  1NOH A;  3I5C A;  3MUD A;  3HD7 C;  1FZE A;  1LTT C;  1IK9 A;  1NH4 A;  1SVF A;  1PFI A;  1MUU A;  3A7O A;  1GW3 A;  1S9K D;  3V2R A;  3VN0 A;  3RK3 B;  1URQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...