2CPBA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in dodecylphosphocholine micelles, 25 lowest energy structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
molecule keywords M13 MAJOR COAT PROTEIN
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpbA00
2MJZA 1NH4A 2C0XA 2CPBA 1IFIA 1HH0A 2CPSA 1FDMA 2C0WA 1HGZA 1IFDA 1IFJA 1HGVA
chains in the Genus database with same CATH superfamily
2JDIH 1VQ5P 4OVNF 4RESB 2QE7H 1LTAC 1JOCA 2KK7A 5APYA 1NGMB 2GUVA 2GA1A 2J58A 1KFNA 1R5LA 1UIIA 2WSEH 2A06G 2E76B 2WSFH 3G6EP 1IO4A 3SWFA 5AW1B 1RF1A 4WB4A 3A0HH 2A45I 1EXJA 4UB8H 1L0LE 1FJKA 3BCCG 3VMAA 1BCCG 1U7MA 3V2NA 1FS0E 3A0HE 3JSVC 4BXLA 1JY3P 1GTWA 4H0LB 1K73Q 4NPFX 1R5SA 1JMMA 5APWA 3TGUD 1IFNA 3L70J 1AA0A 3KZIH 2JWDA 3TDKA 2YO2A 2PP6A 2P67A 2V7QJ 1SQPE 2KSEA 2P58A 2FFDC 1KYOE 2SPZA 1FZCA 1RQVA 2E74D 2PGDA 2OGUA 4H0LD 1P84D 4ASVA 4BRYB 1JTHA 1M56D 3NMDA 4MN4C 2WT7A 1PV3A 4JYCA 4NPDA 3I5CA 1USDA 4W80A 3CCMP 3B5NC 5AVRB 5APVA 1SQVD 2Q5UA 1KYOI 2ZXXA 2YNYA 2W83C 2POHA 1HGVA 1LTJB 1SVFA 3L74E 4W7ZA 1NO4A 1LT9A 5TJHA 1EQ7A 5KKZC 1HBWA 2A45H 2JEEA 5KJ7C 3VMYA 2YKOA 4L75A 2IYOA 1RE4C 1X79B 2WSEJ 2Y0CA 2FKWB 2IFNA 2JKVA 2OQQA 3B8EB 3GLMA 2QEXP 4AUWA 1N7SC 4R4MA 4N3YB 3H32A 3SSUA 3M9QA 1GL2B 1NTKG 2WPSA 1NKNA 2RH0A 2N9YB 2FYUJ 1EZVG 1NTZD 2IZ1A 3AE1C 1NTKJ 2KI7B 1LWUB 3BCCE 3BRVB 3M91A 1GU4A 1H88A 3G71P 1OW8A 4GDOA 2WITA 1PPJD 5AVZB 1OVVA 5KAFE 1KILE 1QLED 4ASWA 2GUSA 1L2PA 2R44A 2IPPA 3A2AA 1JY2O 1OXZA 1PL5A 3KZIE 3CX5I 1L4AB 4IOIH 4XE5B 4DT0A 1JNMA 1DX7A 4LC1A 2OYHC 1G1JA 1JY2P 2HR3A 2KS1B 3H1ID 3O6QA 4JPZB 4M3LA 4O9BA 3WUTA 2K9YA 2PAJA 3CLQA 5AW4B 4IFMA 1SQXE 3PLNA 4WBAA 2OTJP 1FDIA 3L75E 1SQPG 1NU1E 4PV1D 1BDDA 1A02J 2ZFCA 1T3UA 3RK3C 1Q82Q 3H1JJ 4UB8E 2WVRA 1SQQK 1KILA 1RQUA 3CL3D 3H1JD 2N1TD 5KLIC 1Q2NA 5CCGA 4UB6E 1VL2A 1XTGB 1KMIZ 2AXTE 2IFMA 4C7RA 4D6TJ 2XNDH 1T6AA 1FDOA 3RL0C 1N73C 2WSSH 2KNCA 1RF0C 2BCCG 3U1AA 2AXTH 2K1AA 3OA7A 2HODA 1H8AA 1N7SD 2FY8A 1KD1Q 4JBZA 1NU1D 3CCJP 2OARA 1LJ2A 1KQFB 5GTHE 3KDPB 1W2EA 1QL1A 3M9HA 3RBZA 5CCHA 1FZCC 1KV4A 3EFGA 2W6JH 3L72E 1N7SB 1L0NK 3IR9A 2BCCE 3PH0A 2O1JA 2Q3EA 3V2PA 2RMZA 1VQLP 2AEFA 2VRSA 4W7YA 1FE6A 1GU5A 3KQGA 1L0LK 3HD7D 2L5GB 2G8YA 3N4XA 3B5ND 1A02F 3CC4P 2IDBA 2KLUA 2LR2A 2NPSC 1NVOA 3CWBG 3CI9A 3HRNA 2FYNB 2KZIA 2QJKB 2RN0A 4KHXA 3VP8A 4DJGA 1PPJG 2QIWA 1SQQG 2HPCB 3R4YA 1Y9BA 1EDKA 3USSA 1H0TA 1DEEG 1IK7A 3AE9C 3B5NB 1SQXG 1FZAA 1OW6A 3A3YB 1FC2C 1Z56A 2M5AB 3L75J 3U1CA 5AW5B 4I7ZB 3F89A 2V4HA 1X8YA 4YXWH 1N8RQ 2P1JA 2I8DA 3UIAA 3MTUE 2E74B 1GD2E 1N2DC 5E79H 5AW2B 1BE3G 1BGYD 4H44C 3RK2C 2FYNC 2QJKC 4RJTA 4PV1C 1HWTC 2NPSB 3KHUA 4U3FJ 3VN0A 1IFPA 2KNCB 1E5WA 2Y0EA 1VQ4P 3B71A 1EZVE 4H13C 2PFXA 4ZMDA 3ZDMA 3I55P 1HJBA 2HLOA 4GKGA 2WWWA 1NTKE 4WWIA 1N7LA 2FYUE 3L72J 5AVTB 2NPSD 2O01H 4LLHA 3V6IA 1EZVI 3CX5H 1S5LH 1UIXA 2IX7C 1RH5B 3L71E 1U57A 4HH2A 4DCKA 3D71A 4C7NB 2H88C 1NWQA 4KJMA 4YTPC 3B5NA 4OGQD 2QRXA 1EDLA 3HD7A 1RY3A 2KB7P 3L74G 2WMMA 3P32A 2R32A 1GL2D 1G2CA 3OJAB 5KLVD 3RL0B 1S9KD 1CI6B 2OTKE 2B9BA 5H2FH 4RO0A 3F5HA 4A7PA 3NTNA 4D6TE 1J1DC 1GW4A 1BGYG 5KLIB 1LT9C 2CPBA 1OX3A 2IBZD 1G2CB 3Q2YA 2WQYC 3JC22 1BDCA 3BCCD 2D2CD 3RK3B 3RL0D 4PD4I 3A0BH 2P2UA 4EI2A 1Q7YQ 1NTKD 1VDFA 1SQBE 2ZYGA 3L75D 1KYOD 1SQXJ 3OW2O 3CXHD 5E79E 1YI2P 1SQXD 2B87B 5L8RJ 1HVVA 1SQPJ 3FWNA 2P7JA 2D2CB 2WPRA 3RK3D 1LTGC 1DIPA 1DD4A 2WPVB 1S3JA 1VF5C 2JR8A 3ITKA 3V4WA 1L4AC 3ABVC 3AE4C 4YXDC 2K9JB 5AVVB 4PV1B 3CX5E 1BCCE 1KORA 1ZOYC 3LW5H 3RGUA 1L0LG 2Q3IA 1K8AQ 3L74D 3WUUA 2NPSA 2HYNA 1M90Q 2K9JA 3E7KA 2FXOA 2KP8A 2A06E 4K3AA 1M8OB 1VQ8P 3D70A 1AVYA 1JCDA 1BSNA 1CI6A 1T8ZA 1YTZT 5CJ0A 3AEGC 3V2QA 1RE4A 3V5BA 4C7NA 1AFOA 1JTHB 4U7JA 1FZFA 3HE4A 2WZ7A 1N7SA 3PTZA 1Y47A 2E75C 2KOGA 3FX0A 3T97B 1H0TB 1VQPP 2XDJA 5M1BA 1HTLC 5KLVE 1S9KE 3TGUG 2KS1A 2ZVNB 3O6QB 3CCRP 1LTJC 3H1KE 3H1LG 1K9MQ 1WRGA 3H1HE 5APUA 2QM7A 2ZYAA 1IFDA 1LNQA 3H1JG 5KAFH 1Q86Q 2M0BA 1IK9A 2QM8A 1NTMJ 3HD7B 1QVGO 1MZ9A 1NTMD 3WU2H 3H6PA 5TISE 1T2KD 1KN7A 3G4SP 1LTSC 4Y28J 1MUUA 1PGJA 1S5LE 1ZV8A 1TU3F 1SQVG 4JYBA 1P84E 1QX8A 3HUSC 5TISH 5KLVJ 2IBZE 3HE5A 1X0TA 3HE5B 3P8CD 3QWOC 3L70D 1H89A 1SQPD 2CK3H 3H1IG 3L70E 4GT1A 2C0WA 3V2RA 3WMM0 5BVZA 3IAOA 4ZKPA 2AXCA 2H7HA 1KZUB 2LXCB 2KZJA 4N6JA 5CHXA 1KTMA 1OZHA 4H0LC 1PZQA 3AE6C 1HH0A 2WPQA 1YJWP 5B5EH 2WSFJ 2C9NY 1MKMA 1MV8A 1KILB 2FXMA 2Z5IA 4GODA 4L73A 4N78E 4ZNCA 1VQ6P 1AJYA 1KQLA 2R3CA 3H1LD 4XA4A 3RBXA 1BCCD 1FDMA 3AEFC 3T97A 3TF5A 1NTZG 2WT7B 3HE4B 4KT0J 3CCLP 1YIJP 3M0DA 1KILD 2W27A 1MFZA 2N9BA 5AW9B 3PRJA 2O01J 1KQSO 4HJGH 5K5GB 3V4QA 3P8CE 1SQVK 1ZLLA 1QVFO 2ITAA 1S4XA 3CXHH 1L4AA 2IBZG 1D7MA 1SQBJ 3VMXA 1YBKA 1YYCA 1CZQA 1JM0A 1LT1A 1IFJA 3AEEC 1P84I 3CWBJ 3GG2A 3CWBD 3M0AA 1K04A 4OGQB 1WMKA 1AV1A 1KQGB 1NTME 3BASA 3C1LA 2NRGA 3GF7A 4OGQC 3GHGC 4IFFA 3TK1A 2E5TA 1KC8Q 1LT9B 1VQKP 3AEAC 4R4LA 4U3FG 3H1HJ 1NYHA 1HUCA 3H1KJ 2Q7CA 3H1HD 5AVXB 1PGOA 3K5BA 1SFCC 1FU1A 4JF7A 2B87A 3H32B 4GOFA 1YTZI 1DEBA 5CBOA 1FJPA 3L71D 3NFQA 2HODB 2M5AA 5AW3B 3VTPC 1OVRA 1NTZK 4CPGA 2OYIC 5AVWB 5H2FE 4H13D 1OFCX 5CCHD 5BU8B 1R8EA 2O01N 3EWKA 2O3JA 2LXBA 2Q6QA 2HPCA 1KILC 4DOJA 1JMBA 3M06A 4H44D 5CBNA 3SWKA 1QL2A 1BE3D 2B89A 3L37A 4H13B 1NOHA 5GTIE 1ZMEC 1OW7A 1FAVA 1BCCJ 2MJZA 2OYOA 2HG5D 1JUNA 1LWUA 2E5YA 3SWYA 1FOSF 2N1TA 3A7OA 2JP3A 5CCGD 2V7QH 2DW3A 1GW3A 4WY4C 1KFMA 2W6BA 1QEXA 2QJYB 3HUSA 3AEBC 3PHLA 1GL2A 1RE3A 3L4FA 1JCCA 1RHZB 4PJ0H 5APTA 4Y99B 1E79H 3RK3E 4EDFA 4EIJA 2Q1KA 1NU1K 2KYVA 1ZXGA 2A45G 1FZEA 1SQQD 1K05A 1P84H 2W90A 2YIUB 3AE5C 3EFFK 4I7ZC 4IL6E 5KLVK 2AEJA 3WUVA 1ZR4A 3GF3A 1CSBA 2KSJA 1LGHB 1M1JB 3HD7C 1L0ND 1JY3O 3QH9A 1USEA 4HKZH 4IL6H 1NTMG 3MP7B 3L73G 2JO1A 1T2KC 3CPWO 1BGYE 1SP4A 3Q5RA 3MD0A 1N86A 3E1RA 1PGQA 3EQ2A 5AVYB 2WSCH 4D6TG 1HGZA 2XV5A 4L76A 1S2EA 1KB9I 2QJPB 1IC2A 2XU6A 4RKUJ 2ZYDA 5CJ4A 1J1EB 3CCQP 1VQOP 1URQC 1FBMA 3L71J 2QSIA 2J5UA 2R3SA 2P10A 3CXHE 5B66E 1U7JA 3BRTB 1L0NE 2M3BA 3L71G 1NTZE 2WTYA 3MHVA 4L74A 1JO5A 2BASA 3KYQA 3TSIA 1IJDB 2K3RA 4EOTA 4XFJA 3CCVP 1NHLA 2QJPC 1PP9E 1AVOA 1MFTA 5AVSB 3TGUJ 1AQTA 5KAIH 4K35A 1EXIA 4U3FD 4U3FE 1YJ9P 2C0XA 2ZAEB 1S5LX 1KB9D 3AEDC 1VF5B 2YMKA 1FZGA 3FXDA 1SFCA 2KLVA 1M1JC 3MUDC 5KJ7A 2IZ0A 3LIEA 1OMIA 1NU1J 2Z5HA 3HTKA 1GZLA 1SQPK 4I6MC 4B86A 3LIDA 3CCEP 1BSHA 1S1CX 1SQVE 3JCUH 1VF5D 2YIUC 3H1LJ 1SQXK 1KB9H 2W8ZA 4Y99C 3CCSP 3W68A 4C46A 4YPCA 2UWJE 2IBZI 2QJYC 1YQ4C 1RF1C 2OYHB 1KB9E 1VQNP 4HB1A 1LTJA 3A5TA 2LKMA 3AECC 1LTTC 1EZVD 2I1JA 5KTBA 3D6YA 2C9LY 1PPJE 2XNXA 3RL0g 2IYPA 5BU5A 3A0BE 1PP9G 1OWAA 1ZN5A 3FXEA 3H1KG 3L36A 3L73J 3WU2E 3Q1MA 3L73D 3AE3C 3TGUE 3TYYA 3CD6P 1LWUC 1PP9J 2XZRA 4TLFA 1IZNB 3II6A 2BCCJ 3H1IJ 1L0NG 2RKLA 1XTCC 2R5BA 3M0DC 4BRYA 1ZR2A 2OTLP 2FFDA 2A06D 1GL2C 1NTZJ 3AE8C 4PD4H 3VYIA 1M7LA 3FWLA 2YKQA 2JWAA 2ZJSE 3L72G 4N78D 3L35A 2KXPB 3CMEP 5KAIE 3H1IE 3L70G 5AW7B 3W67A 4EYYQ 3OAKA 2YXRB 2FYZA 1NKZB 1PIXA 3CMAP 1JB0J 3O8ZA 4DZOA 3L73E 5B5EE 1SFCB 3VMZA 3SFEC 1Y8AA 3S1KA 5KKZB 2WSCJ 1HF9A 3L74J 2PRRA 3RK2B 3KXDA 4H44B 2H43A 3H25A 1RF1B 1FOSE 2E74C 3IFMA 3GHGB 3H1JE 2W6AA 3BATA 4HYTB 1NAYA 1SQBK 3H1LE 2YMYA 1SQVJ 2FBWC 3KPEA 3R2PA 4WVZA 3RK2D 1NU1G 3GMAA 3MIWA 5AVUB 3SFDC 3L75G 1SQBG 2Q9IA 3MZWB 3CC2P 2K37A 1M1KQ 1GMJA 3IN6A 1YJNP 2JJLA 1DH3A 1LP1B 3C8VA 4PD4E 5CMZA 5DJTB 4IL6X 3Q5PA 3P8MC 5AVQB 1JEKA 1Q81Q 3Q5SA 3GHGA 1LP1A 2KUBA 2Y0DA 3BCCJ 1L0LJ 1S72P 4PJ0E 4I1LA 3TNUA 1IFIA 2QVAA 2FYUD 5C39A 1FZCB 4TT3H 1ZRTD 1EC5A 1L0NJ 2E76C 3N7NA 1OIPA 3JCUE 3D6ZA 1URQB 3MGNA 3FGAD 1J1EC 2XKMA 1OVUA 3U59A 2BEQD 1YQ3C 1N73B 2QG4A 5APSA 2NZ2A 1BGYJ 1VPCA 3HUSB 1VQ9P 1URQD 2BCCD 4OH8B 2O1KA 3GW6A 2K88A 1NTMK 1T3JA 5AW6B 2E43A 1SS1A 1X22A 1QGKB 3S9OA 1BE3E 5APXA 4I2LC 1RF0A 2H8PD 3PP5A 1SQQJ 2E75D 2L91A 1SQBD 5AW8B 3VOPA 3IF4A 2YKPA 3PJSK 1CW5A 4LGDE 1YITP 3LW5J 3G9RA 2N1TC 1EDJA 4WY4A 2GM4A 1HJ0A 1IFMA 1X9VA 5EFWB 4BWNA 1GK6A 3NXSA 1VQMP 1YHQP 1RE3C 1JY3N 3S4RA 5GTHH 1LTBC 2E75B 3C9IA 2QA4P 4WY4B 1GDTA 1FZBA 3E1IA 3CX5D 3CCUP 1W2BO 4PD4D 2ZT9D 3P7KA 1JY2N 1Q90D 1ZP0C 3HTKB 4NPEA 2Z4EA 3L72D 4QMAA 2FYUG 3AE2C 3CXHI 2BEZF 2ZT9C 3AE7C 4WY4D 5CCGC 1L4AD 1L0LD 4OWFA 1WT6A 2FXPA 1NTKK 2ZT9B 1ZRTE 4IFDK 4AYCA 2FYUK 1G1IA 2KIKA 3H1KD 4UB6H 1N73A 1SLQA 2OYIB 4ZKUA 2M8RA 2J59M 2B88A 1GK4A 1DD3A 4GIFA 5B66H 1M57D 1EDIA 1URQA 2OYIA 4D6TD 2D2CC 3M9BA 1PP9D 5APQA 5CCHC 4JQ0D 1AQ5A 3BVHA 3TNUB 2CPSA 2E42A 2N1TB 2G3AA 2MKVA 3G3ZA 5GTIH 2I1KA 2Y9YA 2Y9ZA 5DJUB 4GOEA 1SQQE 5KJ7D 3Q3DA 1NH4A 1BE3J 1SFCD 2R5DA 3H1HG 2ZVOB 2HFED 3CWBE 1NJIQ 1VQ7P 1KYOH 1W5CE 1J1DB 1ZW0A 5KLVG 1J2JB 4Z1MH 3I56P 4AQRD 5AW0B 2OYHA 1NAFA 3CC7P 2ZXEB 1LTIC 1M1JA 3MUDA 2E76D 2FFDB 1PFIA 2YXQB 3VP9A 2M3EA 3B4SA 2YO3A 2AEMA 1PGPA 2H89C
chains in the Genus database with same CATH topology
4RESB 1LTAC 1JOCA 5APYA 2GUVA 2J58A 2WSEH 1KFNA 2WSFH 1IO4A 3SWFA 5AW1B 1RF1A 4WB4A 2A45I 1FJKA 3V2NA 1GTWA 1JY3P 1JMMA 5APWA 1IFNA 2FFDC 2YO2A 2PP6A 2P67A 1FZCA 1JTHA 2WT7A 3NMDA 4JYCA 3I5CA 4W80A 3B5NC 5AVRB 5APVA 2Q5UA 2YNYA 2POHA 1HGVA 1LTJB 1SVFA 4W7ZA 1A02J 1NO4A 1LT9A 1EQ7A 1HBWA 2A45H 2JEEA 5KJ7C 3VMYA 2YKOA 1RE4C 1X79B 2FKWB 2IFNA 3B8EB 4AUWA 1N7SC 4N3YB 3H32A 3M9QA 1GL2B 2WPSA 1NKNA 1H88A 3BRVB 1GU4A 3M91A 1LWUB 2WITA 5AVZB 2GUSA 3A2AA 2IPPA 1JY2O 1OXZA 1JNMA 4XE5B 1L4AB 1DX7A 4LC1A 2OYHC 1G1JA 1JY2P 4O9BA 4M3LA 2PAJA 3CLQA 5AW4B 4IFMA 4WBAA 2ZFCA 1T3UA 3RK3C 1SQQK 1KILA 3CL3D 2N1TD 5CCGA 4C7RA 1XTGB 2IFMA 3RL0C 1N73C 1RF0C 3U1AA 3OA7A 2HODA 1H8AA 1N7SD 2OARA 3KDPB 1W2EA 1QL1A 3M9HA 5CCHA 1FZCC 3EFGA 1N7SB 1L0NK 3IR9A 2O1JA 3V2PA 2VRSA 4W7YA 1GU5A 3KQGA 1L0LK 3HD7D 2L5GB 3N4XA 3B5ND 1A02F 2NPSC 4KHXA 3HRNA 3CI9A 3VP8A 2HPCB 3B5NB 1FZAA 3A3YB 1Z56A 3U1CA 5AW5B 1X8YA 2P1JA 3UIAA 3MTUE 1GD2E 1N2DC 5AW2B 3RK2C 1HWTC 2NPSB 3VN0A 1E5WA 1HJBA 2HLOA 4GKGA 2WWWA 1N7LA 5AVTB 2NPSD 2O01H 4LLHA 2IX7C 4HH2A 4C7NB 1NWQA 3B5NA 3HD7A 1RY3A 2KB7P 3P32A 3RL0B 2R32A 1GL2D 1G2CA 3OJAB 1S9KD 1CI6B 3NTNA 1J1DC 1GW4A 1LT9C 2CPBA 1G2CB 3RL0D 3RK3B 2P2UA 1VDFA 1HVVA 2P7JA 2WPRA 3RK3D 1LTGC 3V4WA 1L4AC 5AVVB 3LW5H 2Q3IA 2NPSA 2HYNA 2KP8A 1JCDA 1CI6A 1T8ZA 1YTZT 5CJ0A 3V2QA 1RE4A 3V5BA 4C7NA 1AFOA 1JTHB 1FZFA 3HE4A 2WZ7A 1N7SA 2KOGA 2XDJA 1HTLC 1S9KE 1LTJC 1WRGA 5APUA 2QM7A 1IFDA 1IK9A 2QM8A 3HD7B 1MZ9A 3H6PA 1T2KD 1LTSC 1MUUA 1ZV8A 4JYBA 3HUSC 3HE5A 3P8CD 3HE5B 1H89A 5BVZA 4GT1A 3V2RA 3WMM0 2C0WA 2H7HA 4ZKPA 1KZUB 4N6JA 5CHXA 1HH0A 2WPQA 2C9NY 1MV8A 1KILB 2FXMA 2Z5IA 4N78E 1KQLA 2R3CA 4XA4A 3T97A 2WT7B 3HE4B 3M0DA 1KILD 2W27A 1MFZA 2N9BA 5AW9B 3V4QA 3P8CE 1SQVK 1ZLLA 1L4AA 3VMXA 1YYCA 1CZQA 1IFJA 3M0AA 3BASA 3TK1A 3GHGC 4IFFA 1LT9B 1HUCA 2Q7CA 5AVXB 1SFCC 1FU1A 4JF7A 3H32B 1YTZI 1DEBA 1FJPA 3NFQA 2HODB 5AW3B 3VTPC 1NTZK 2OYIC 5AVWB 5CCHD 5BU8B 2HPCA 1KILC 4DOJA 3M06A 1QL2A 3L37A 1NOHA 1FAVA 2MJZA 2HG5D 1JUNA 1LWUA 3SWYA 1FOSF 2N1TA 3A7OA 5CCGD 4WY4C 1GW3A 1KFMA 2W6BA 3HUSA 5APTA 1GL2A 1RE3A 3L4FA 1JCCA 4Y99B 4EIJA 1NU1K 2KYVA 2A45G 1FZEA 5KLVK 1ZR4A 3HD7C 1CSBA 2KSJA 1LGHB 1M1JB 1JY3O 1T2KC 1SP4A 3MD0A 1N86A 3EQ2A 5AVYB 2WSCH 1HGZA 2XV5A 1IC2A 2XU6A 5CJ4A 1J1EB 1URQC 1FBMA 1FDMA 3BRTB 2M3BA 1JO5A 2WTYA 2BASA 3KYQA 3TSIA 1IJDB 4EOTA 1NHLA 5AVSB 2C0XA 1FZGA 1SFCA 2KLVA 1M1JC 5KJ7A 3LIEA 2Z5HA 3HTKA 1GZLA 1SQPK 4I6MC 4B86A 3LIDA 1SQXK 4Y99C 4C46A 1RF1C 2OYHB 1LTJA 3A5TA 2LKMA 5KTBA 1LTTC 2I1JA 2C9LY 2XNXA 5BU5A 1ZN5A 1OWAA 3L36A 3TYYA 1LWUC 2XZRA 3II6A 3M0DC 1XTCC 2R5BA 1ZR2A 2FFDA 1GL2C 3VYIA 1M7LA 4N78D 2YKQA 3L35A 5AW7B 3OAKA 2FYZA 1NKZB 3O8ZA 4DZOA 1SFCB 3VMZA 3RK2B 2H43A 1RF1B 1FOSE 3IFMA 3GHGB 2W6AA 3BATA 4HYTB 1SQBK 2YMYA 3KPEA 3R2PA 3RK2D 5AVUB 3MIWA 2Q9IA 2JJLA 1DH3A 5CMZA 3P8MC 5AVQB 3GHGA 4I1LA 3TNUA 1IFIA 1FZCB 3N7NA 1URQB 3MGNA 1J1EC 2XKMA 3U59A 1N73B 5APSA 1VPCA 3HUSB 1URQD 4OH8B 2O1KA 1NTMK 1T3JA 5AW6B 2E43A 5APXA 4I2LC 1RF0A 2H8PD 3PP5A 5AW8B 3VOPA 2YKPA 1CW5A 4LGDE 2N1TC 4WY4A 2GM4A 1IFMA 1X9VA 1GK6A 3NXSA 1RE3C 1JY3N 1LTBC 3C9IA 4WY4B 1GDTA 1FZBA 3E1IA 3P7KA 2Z4EA 1JY2N 3HTKB 4WY4D 5CCGC 1L4AD 1WT6A 1NTKK 4IFDK 4AYCA 2FYUK 1G1IA 1N73A 1SLQA 2OYIB 4ZKUA 2M8RA 2J59M 1GK4A 4GIFA 1URQA 2OYIA 3M9BA 5APQA 5CCHC 1AQ5A 3BVHA 3TNUB 2CPSA 2E42A 2N1TB 3G3ZA 2I1KA 5KJ7D 1NH4A 1SFCD 2R5DA 2HFED 1J1DB 1J2JB 4AQRD 5AW0B 2OYHA 1NAFA 2ZXEB 3MUDA 1LTIC 1M1JA 2FFDB 1PFIA 3VP9A 2YO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  1NH4 A;  2C0X A;  2CPB A;  1IFI A;  1HH0 A;  2CPS A;  1FDM A;  2C0W A;  1HGZ A;  1IFD A;  1IFJ A;  1HGV A; 
#chains in the Genus database with same CATH topology
 2JDI H;  1VQ5 P;  4OVN F;  4RES B;  2QE7 H;  1LTA C;  1JOC A;  2KK7 A;  5APY A;  1NGM B;  2GUV A;  2GA1 A;  2J58 A;  1KFN A;  1R5L A;  1UII A;  2WSE H;  2A06 G;  2E76 B;  2WSF H;  3G6E P;  1IO4 A;  3SWF A;  5AW1 B;  1RF1 A;  4WB4 A;  3A0H H;  2A45 I;  1EXJ A;  4UB8 H;  1L0L E;  1FJK A;  3BCC G;  3VMA A;  1BCC G;  1U7M A;  3V2N A;  1FS0 E;  3A0H E;  3JSV C;  4BXL A;  1JY3 P;  1GTW A;  4H0L B;  1K73 Q;  4NPF X;  1R5S A;  1JMM A;  5APW A;  3TGU D;  1IFN A;  3L70 J;  1AA0 A;  3KZI H;  2JWD A;  3TDK A;  2YO2 A;  2PP6 A;  2P67 A;  2V7Q J;  1SQP E;  2KSE A;  2P58 A;  2FFD C;  1KYO E;  2SPZ A;  1FZC A;  1RQV A;  2E74 D;  2PGD A;  2OGU A;  4H0L D;  1P84 D;  4ASV A;  4BRY B;  1JTH A;  1M56 D;  3NMD A;  4MN4 C;  2WT7 A;  1PV3 A;  4JYC A;  4NPD A;  3I5C A;  1USD A;  4W80 A;  3CCM P;  3B5N C;  5AVR B;  5APV A;  1SQV D;  2Q5U A;  1KYO I;  2ZXX A;  2YNY A;  2W83 C;  2POH A;  1HGV A;  1LTJ B;  1SVF A;  3L74 E;  4W7Z A;  1NO4 A;  1LT9 A;  5TJH A;  1EQ7 A;  5KKZ C;  1HBW A;  2A45 H;  2JEE A;  5KJ7 C;  3VMY A;  2YKO A;  4L75 A;  2IYO A;  1RE4 C;  1X79 B;  2WSE J;  2Y0C A;  2FKW B;  2IFN A;  2JKV A;  2OQQ A;  3B8E B;  3GLM A;  2QEX P;  4AUW A;  1N7S C;  4R4M A;  4N3Y B;  3H32 A;  3SSU A;  3M9Q A;  1GL2 B;  1NTK G;  2WPS A;  1NKN A;  2RH0 A;  2N9Y B;  2FYU J;  1EZV G;  1NTZ D;  2IZ1 A;  3AE1 C;  1NTK J;  2KI7 B;  1LWU B;  3BCC E;  3BRV B;  3M91 A;  1GU4 A;  1H88 A;  3G71 P;  1OW8 A;  4GDO A;  2WIT A;  1PPJ D;  5AVZ B;  1OVV A;  5KAF E;  1KIL E;  1QLE D;  4ASW A;  2GUS A;  1L2P A;  2R44 A;  2IPP A;  3A2A A;  1JY2 O;  1OXZ A;  1PL5 A;  3KZI E;  3CX5 I;  1L4A B;  4IOI H;  4XE5 B;  4DT0 A;  1JNM A;  1DX7 A;  4LC1 A;  2OYH C;  1G1J A;  1JY2 P;  2HR3 A;  2KS1 B;  3H1I D;  3O6Q A;  4JPZ B;  4M3L A;  4O9B A;  3WUT A;  2K9Y A;  2PAJ A;  3CLQ A;  5AW4 B;  4IFM A;  1SQX E;  3PLN A;  4WBA A;  2OTJ P;  1FDI A;  3L75 E;  1SQP G;  1NU1 E;  4PV1 D;  1BDD A;  1A02 J;  2ZFC A;  1T3U A;  3RK3 C;  1Q82 Q;  3H1J J;  4UB8 E;  2WVR A;  1SQQ K;  1KIL A;  1RQU A;  3CL3 D;  3H1J D;  2N1T D;  5KLI C;  1Q2N A;  5CCG A;  4UB6 E;  1VL2 A;  1XTG B;  1KMI Z;  2AXT E;  2IFM A;  4C7R A;  4D6T J;  2XND H;  1T6A A;  1FDO A;  3RL0 C;  1N73 C;  2WSS H;  2KNC A;  1RF0 C;  2BCC G;  3U1A A;  2AXT H;  2K1A A;  3OA7 A;  2HOD A;  1H8A A;  1N7S D;  2FY8 A;  1KD1 Q;  4JBZ A;  1NU1 D;  3CCJ P;  2OAR A;  1LJ2 A;  1KQF B;  5GTH E;  3KDP B;  1W2E A;  1QL1 A;  3M9H A;  3RBZ A;  5CCH A;  1FZC C;  1KV4 A;  3EFG A;  2W6J H;  3L72 E;  1N7S B;  1L0N K;  3IR9 A;  2BCC E;  3PH0 A;  2O1J A;  2Q3E A;  3V2P A;  2RMZ A;  1VQL P;  2AEF A;  2VRS A;  4W7Y A;  1FE6 A;  1GU5 A;  3KQG A;  1L0L K;  3HD7 D;  2L5G B;  2G8Y A;  3N4X A;  3B5N D;  1A02 F;  3CC4 P;  2IDB A;  2KLU A;  2LR2 A;  2NPS C;  1NVO A;  3CWB G;  3CI9 A;  3HRN A;  2FYN B;  2KZI A;  2QJK B;  2RN0 A;  4KHX A;  3VP8 A;  4DJG A;  1PPJ G;  2QIW A;  1SQQ G;  2HPC B;  3R4Y A;  1Y9B A;  1EDK A;  3USS A;  1H0T A;  1DEE G;  1IK7 A;  3AE9 C;  3B5N B;  1SQX G;  1FZA A;  1OW6 A;  3A3Y B;  1FC2 C;  1Z56 A;  2M5A B;  3L75 J;  3U1C A;  5AW5 B;  4I7Z B;  3F89 A;  2V4H A;  1X8Y A;  4YXW H;  1N8R Q;  2P1J A;  2I8D A;  3UIA A;  3MTU E;  2E74 B;  1GD2 E;  1N2D C;  5E79 H;  5AW2 B;  1BE3 G;  1BGY D;  4H44 C;  3RK2 C;  2FYN C;  2QJK C;  4RJT A;  4PV1 C;  1HWT C;  2NPS B;  3KHU A;  4U3F J;  3VN0 A;  1IFP A;  2KNC B;  1E5W A;  2Y0E A;  1VQ4 P;  3B71 A;  1EZV E;  4H13 C;  2PFX A;  4ZMD A;  3ZDM A;  3I55 P;  1HJB A;  2HLO A;  4GKG A;  2WWW A;  1NTK E;  4WWI A;  1N7L A;  2FYU E;  3L72 J;  5AVT B;  2NPS D;  2O01 H;  4LLH A;  3V6I A;  1EZV I;  3CX5 H;  1S5L H;  1UIX A;  2IX7 C;  1RH5 B;  3L71 E;  1U57 A;  4HH2 A;  4DCK A;  3D71 A;  4C7N B;  2H88 C;  1NWQ A;  4KJM A;  4YTP C;  3B5N A;  4OGQ D;  2QRX A;  1EDL A;  3HD7 A;  1RY3 A;  2KB7 P;  3L74 G;  2WMM A;  3P32 A;  2R32 A;  1GL2 D;  1G2C A;  3OJA B;  5KLV D;  3RL0 B;  1S9K D;  1CI6 B;  2OTK E;  2B9B A;  5H2F H;  4RO0 A;  3F5H A;  4A7P A;  3NTN A;  4D6T E;  1J1D C;  1GW4 A;  1BGY G;  5KLI B;  1LT9 C;  2CPB A;  1OX3 A;  2IBZ D;  1G2C B;  3Q2Y A;  2WQY C;  3JC2 2;  1BDC A;  3BCC D;  2D2C D;  3RK3 B;  3RL0 D;  4PD4 I;  3A0B H;  2P2U A;  4EI2 A;  1Q7Y Q;  1NTK D;  1VDF A;  1SQB E;  2ZYG A;  3L75 D;  1KYO D;  1SQX J;  3OW2 O;  3CXH D;  5E79 E;  1YI2 P;  1SQX D;  2B87 B;  5L8R J;  1HVV A;  1SQP J;  3FWN A;  2P7J A;  2D2C B;  2WPR A;  3RK3 D;  1LTG C;  1DIP A;  1DD4 A;  2WPV B;  1S3J A;  1VF5 C;  2JR8 A;  3ITK A;  3V4W A;  1L4A C;  3ABV C;  3AE4 C;  4YXD C;  2K9J B;  5AVV B;  4PV1 B;  3CX5 E;  1BCC E;  1KOR A;  1ZOY C;  3LW5 H;  3RGU A;  1L0L G;  2Q3I A;  1K8A Q;  3L74 D;  3WUU A;  2NPS A;  2HYN A;  1M90 Q;  2K9J A;  3E7K A;  2FXO A;  2KP8 A;  2A06 E;  4K3A A;  1M8O B;  1VQ8 P;  3D70 A;  1AVY A;  1JCD A;  1BSN A;  1CI6 A;  1T8Z A;  1YTZ T;  5CJ0 A;  3AEG C;  3V2Q A;  1RE4 A;  3V5B A;  4C7N A;  1AFO A;  1JTH B;  4U7J A;  1FZF A;  3HE4 A;  2WZ7 A;  1N7S A;  3PTZ A;  1Y47 A;  2E75 C;  2KOG A;  3FX0 A;  3T97 B;  1H0T B;  1VQP P;  2XDJ A;  5M1B A;  1HTL C;  5KLV E;  1S9K E;  3TGU G;  2KS1 A;  2ZVN B;  3O6Q B;  3CCR P;  1LTJ C;  3H1K E;  3H1L G;  1K9M Q;  1WRG A;  3H1H E;  5APU A;  2QM7 A;  2ZYA A;  1IFD A;  1LNQ A;  3H1J G;  5KAF H;  1Q86 Q;  2M0B A;  1IK9 A;  2QM8 A;  1NTM J;  3HD7 B;  1QVG O;  1MZ9 A;  1NTM D;  3WU2 H;  3H6P A;  5TIS E;  1T2K D;  1KN7 A;  3G4S P;  1LTS C;  4Y28 J;  1MUU A;  1PGJ A;  1S5L E;  1ZV8 A;  1TU3 F;  1SQV G;  4JYB A;  1P84 E;  1QX8 A;  3HUS C;  5TIS H;  5KLV J;  2IBZ E;  3HE5 A;  1X0T A;  3HE5 B;  3P8C D;  3QWO C;  3L70 D;  1H89 A;  1SQP D;  2CK3 H;  3H1I G;  3L70 E;  4GT1 A;  2C0W A;  3V2R A;  3WMM 0;  5BVZ A;  3IAO A;  4ZKP A;  2AXC A;  2H7H A;  1KZU B;  2LXC B;  2KZJ A;  4N6J A;  5CHX A;  1KTM A;  1OZH A;  4H0L C;  1PZQ A;  3AE6 C;  1HH0 A;  2WPQ A;  1YJW P;  5B5E H;  2WSF J;  2C9N Y;  1MKM A;  1MV8 A;  1KIL B;  2FXM A;  2Z5I A;  4GOD A;  4L73 A;  4N78 E;  4ZNC A;  1VQ6 P;  1AJY A;  1KQL A;  2R3C A;  3H1L D;  4XA4 A;  3RBX A;  1BCC D;  1FDM A;  3AEF C;  3T97 A;  3TF5 A;  1NTZ G;  2WT7 B;  3HE4 B;  4KT0 J;  3CCL P;  1YIJ P;  3M0D A;  1KIL D;  2W27 A;  1MFZ A;  2N9B A;  5AW9 B;  3PRJ A;  2O01 J;  1KQS O;  4HJG H;  5K5G B;  3V4Q A;  3P8C E;  1SQV K;  1ZLL A;  1QVF O;  2ITA A;  1S4X A;  3CXH H;  1L4A A;  2IBZ G;  1D7M A;  1SQB J;  3VMX A;  1YBK A;  1YYC A;  1CZQ A;  1JM0 A;  1LT1 A;  1IFJ A;  3AEE C;  1P84 I;  3CWB J;  3GG2 A;  3CWB D;  3M0A A;  1K04 A;  4OGQ B;  1WMK A;  1AV1 A;  1KQG B;  1NTM E;  3BAS A;  3C1L A;  2NRG A;  3GF7 A;  4OGQ C;  3GHG C;  4IFF A;  3TK1 A;  2E5T A;  1KC8 Q;  1LT9 B;  1VQK P;  3AEA C;  4R4L A;  4U3F G;  3H1H J;  1NYH A;  1HUC A;  3H1K J;  2Q7C A;  3H1H D;  5AVX B;  1PGO A;  3K5B A;  1SFC C;  1FU1 A;  4JF7 A;  2B87 A;  3H32 B;  4GOF A;  1YTZ I;  1DEB A;  5CBO A;  1FJP A;  3L71 D;  3NFQ A;  2HOD B;  2M5A A;  5AW3 B;  3VTP C;  1OVR A;  1NTZ K;  4CPG A;  2OYI C;  5AVW B;  5H2F E;  4H13 D;  1OFC X;  5CCH D;  5BU8 B;  1R8E A;  2O01 N;  3EWK A;  2O3J A;  2LXB A;  2Q6Q A;  2HPC A;  1KIL C;  4DOJ A;  1JMB A;  3M06 A;  4H44 D;  5CBN A;  3SWK A;  1QL2 A;  1BE3 D;  2B89 A;  3L37 A;  4H13 B;  1NOH A;  5GTI E;  1ZME C;  1OW7 A;  1FAV A;  1BCC J;  2MJZ A;  2OYO A;  2HG5 D;  1JUN A;  1LWU A;  2E5Y A;  3SWY A;  1FOS F;  2N1T A;  3A7O A;  2JP3 A;  5CCG D;  2V7Q H;  2DW3 A;  1GW3 A;  4WY4 C;  1KFM A;  2W6B A;  1QEX A;  2QJY B;  3HUS A;  3AEB C;  3PHL A;  1GL2 A;  1RE3 A;  3L4F A;  1JCC A;  1RHZ B;  4PJ0 H;  5APT A;  4Y99 B;  1E79 H;  3RK3 E;  4EDF A;  4EIJ A;  2Q1K A;  1NU1 K;  2KYV A;  1ZXG A;  2A45 G;  1FZE A;  1SQQ D;  1K05 A;  1P84 H;  2W90 A;  2YIU B;  3AE5 C;  3EFF K;  4I7Z C;  4IL6 E;  5KLV K;  2AEJ A;  3WUV A;  1ZR4 A;  3GF3 A;  1CSB A;  2KSJ A;  1LGH B;  1M1J B;  3HD7 C;  1L0N D;  1JY3 O;  3QH9 A;  1USE A;  4HKZ H;  4IL6 H;  1NTM G;  3MP7 B;  3L73 G;  2JO1 A;  1T2K C;  3CPW O;  1BGY E;  1SP4 A;  3Q5R A;  3MD0 A;  1N86 A;  3E1R A;  1PGQ A;  3EQ2 A;  5AVY B;  2WSC H;  4D6T G;  1HGZ A;  2XV5 A;  4L76 A;  1S2E A;  1KB9 I;  2QJP B;  1IC2 A;  2XU6 A;  4RKU J;  2ZYD A;  5CJ4 A;  1J1E B;  3CCQ P;  1VQO P;  1URQ C;  1FBM A;  3L71 J;  2QSI A;  2J5U A;  2R3S A;  2P10 A;  3CXH E;  5B66 E;  1U7J A;  3BRT B;  1L0N E;  2M3B A;  3L71 G;  1NTZ E;  2WTY A;  3MHV A;  4L74 A;  1JO5 A;  2BAS A;  3KYQ A;  3TSI A;  1IJD B;  2K3R A;  4EOT A;  4XFJ A;  3CCV P;  1NHL A;  2QJP C;  1PP9 E;  1AVO A;  1MFT A;  5AVS B;  3TGU J;  1AQT A;  5KAI H;  4K35 A;  1EXI A;  4U3F D;  4U3F E;  1YJ9 P;  2C0X A;  2ZAE B;  1S5L X;  1KB9 D;  3AED C;  1VF5 B;  2YMK A;  1FZG A;  3FXD A;  1SFC A;  2KLV A;  1M1J C;  3MUD C;  5KJ7 A;  2IZ0 A;  3LIE A;  1OMI A;  1NU1 J;  2Z5H A;  3HTK A;  1GZL A;  1SQP K;  4I6M C;  4B86 A;  3LID A;  3CCE P;  1BSH A;  1S1C X;  1SQV E;  3JCU H;  1VF5 D;  2YIU C;  3H1L J;  1SQX K;  1KB9 H;  2W8Z A;  4Y99 C;  3CCS P;  3W68 A;  4C46 A;  4YPC A;  2UWJ E;  2IBZ I;  2QJY C;  1YQ4 C;  1RF1 C;  2OYH B;  1KB9 E;  1VQN P;  4HB1 A;  1LTJ A;  3A5T A;  2LKM A;  3AEC C;  1LTT C;  1EZV D;  2I1J A;  5KTB A;  3D6Y A;  2C9L Y;  1PPJ E;  2XNX A;  3RL0 g;  2IYP A;  5BU5 A;  3A0B E;  1PP9 G;  1OWA A;  1ZN5 A;  3FXE A;  3H1K G;  3L36 A;  3L73 J;  3WU2 E;  3Q1M A;  3L73 D;  3AE3 C;  3TGU E;  3TYY A;  3CD6 P;  1LWU C;  1PP9 J;  2XZR A;  4TLF A;  1IZN B;  3II6 A;  2BCC J;  3H1I J;  1L0N G;  2RKL A;  1XTC C;  2R5B A;  3M0D C;  4BRY A;  1ZR2 A;  2OTL P;  2FFD A;  2A06 D;  1GL2 C;  1NTZ J;  3AE8 C;  4PD4 H;  3VYI A;  1M7L A;  3FWL A;  2YKQ A;  2JWA A;  2ZJS E;  3L72 G;  4N78 D;  3L35 A;  2KXP B;  3CME P;  5KAI E;  3H1I E;  3L70 G;  5AW7 B;  3W67 A;  4EYY Q;  3OAK A;  2YXR B;  2FYZ A;  1NKZ B;  1PIX A;  3CMA P;  1JB0 J;  3O8Z A;  4DZO A;  3L73 E;  5B5E E;  1SFC B;  3VMZ A;  3SFE C;  1Y8A A;  3S1K A;  5KKZ B;  2WSC J;  1HF9 A;  3L74 J;  2PRR A;  3RK2 B;  3KXD A;  4H44 B;  2H43 A;  3H25 A;  1RF1 B;  1FOS E;  2E74 C;  3IFM A;  3GHG B;  3H1J E;  2W6A A;  3BAT A;  4HYT B;  1NAY A;  1SQB K;  3H1L E;  2YMY A;  1SQV J;  2FBW C;  3KPE A;  3R2P A;  4WVZ A;  3RK2 D;  1NU1 G;  3GMA A;  3MIW A;  5AVU B;  3SFD C;  3L75 G;  1SQB G;  2Q9I A;  3MZW B;  3CC2 P;  2K37 A;  1M1K Q;  1GMJ A;  3IN6 A;  1YJN P;  2JJL A;  1DH3 A;  1LP1 B;  3C8V A;  4PD4 E;  5CMZ A;  5DJT B;  4IL6 X;  3Q5P A;  3P8M C;  5AVQ B;  1JEK A;  1Q81 Q;  3Q5S A;  3GHG A;  1LP1 A;  2KUB A;  2Y0D A;  3BCC J;  1L0L J;  1S72 P;  4PJ0 E;  4I1L A;  3TNU A;  1IFI A;  2QVA A;  2FYU D;  5C39 A;  1FZC B;  4TT3 H;  1ZRT D;  1EC5 A;  1L0N J;  2E76 C;  3N7N A;  1OIP A;  3JCU E;  3D6Z A;  1URQ B;  3MGN A;  3FGA D;  1J1E C;  2XKM A;  1OVU A;  3U59 A;  2BEQ D;  1YQ3 C;  1N73 B;  2QG4 A;  5APS A;  2NZ2 A;  1BGY J;  1VPC A;  3HUS B;  1VQ9 P;  1URQ D;  2BCC D;  4OH8 B;  2O1K A;  3GW6 A;  2K88 A;  1NTM K;  1T3J A;  5AW6 B;  2E43 A;  1SS1 A;  1X22 A;  1QGK B;  3S9O A;  1BE3 E;  5APX A;  4I2L C;  1RF0 A;  2H8P D;  3PP5 A;  1SQQ J;  2E75 D;  2L91 A;  1SQB D;  5AW8 B;  3VOP A;  3IF4 A;  2YKP A;  3PJS K;  1CW5 A;  4LGD E;  1YIT P;  3LW5 J;  3G9R A;  2N1T C;  1EDJ A;  4WY4 A;  2GM4 A;  1HJ0 A;  1IFM A;  1X9V A;  5EFW B;  4BWN A;  1GK6 A;  3NXS A;  1VQM P;  1YHQ P;  1RE3 C;  1JY3 N;  3S4R A;  5GTH H;  1LTB C;  2E75 B;  3C9I A;  2QA4 P;  4WY4 B;  1GDT A;  1FZB A;  3E1I A;  3CX5 D;  3CCU P;  1W2B O;  4PD4 D;  2ZT9 D;  3P7K A;  1JY2 N;  1Q90 D;  1ZP0 C;  3HTK B;  4NPE A;  2Z4E A;  3L72 D;  4QMA A;  2FYU G;  3AE2 C;  3CXH I;  2BEZ F;  2ZT9 C;  3AE7 C;  4WY4 D;  5CCG C;  1L4A D;  1L0L D;  4OWF A;  1WT6 A;  2FXP A;  1NTK K;  2ZT9 B;  1ZRT E;  4IFD K;  4AYC A;  2FYU K;  1G1I A;  2KIK A;  3H1K D;  4UB6 H;  1N73 A;  1SLQ A;  2OYI B;  4ZKU A;  2M8R A;  2J59 M;  2B88 A;  1GK4 A;  1DD3 A;  4GIF A;  5B66 H;  1M57 D;  1EDI A;  1URQ A;  2OYI A;  4D6T D;  2D2C C;  3M9B A;  1PP9 D;  5APQ A;  5CCH C;  4JQ0 D;  1AQ5 A;  3BVH A;  3TNU B;  2CPS A;  2E42 A;  2N1T B;  2G3A A;  2MKV A;  3G3Z A;  5GTI H;  2I1K A;  2Y9Y A;  2Y9Z A;  5DJU B;  4GOE A;  1SQQ E;  5KJ7 D;  3Q3D A;  1NH4 A;  1BE3 J;  1SFC D;  2R5D A;  3H1H G;  2ZVO B;  2HFE D;  3CWB E;  1NJI Q;  1VQ7 P;  1KYO H;  1W5C E;  1J1D B;  1ZW0 A;  5KLV G;  1J2J B;  4Z1M H;  3I56 P;  4AQR D;  5AW0 B;  2OYH A;  1NAF A;  3CC7 P;  2ZXE B;  1LTI C;  1M1J A;  3MUD A;  2E76 D;  2FFD B;  1PFI A;  2YXQ B;  3VP9 A;  2M3E A;  3B4S A;  2YO3 A;  2AEM A;  1PGP A;  2H89 C; 
#chains in the Genus database with same CATH homology
 4RES B;  1LTA C;  1JOC A;  5APY A;  2GUV A;  2J58 A;  2WSE H;  1KFN A;  2WSF H;  1IO4 A;  3SWF A;  5AW1 B;  1RF1 A;  4WB4 A;  2A45 I;  1FJK A;  3V2N A;  1GTW A;  1JY3 P;  1JMM A;  5APW A;  1IFN A;  2FFD C;  2YO2 A;  2PP6 A;  2P67 A;  1FZC A;  1JTH A;  2WT7 A;  3NMD A;  4JYC A;  3I5C A;  4W80 A;  3B5N C;  5AVR B;  5APV A;  2Q5U A;  2YNY A;  2POH A;  1HGV A;  1LTJ B;  1SVF A;  4W7Z A;  1A02 J;  1NO4 A;  1LT9 A;  1EQ7 A;  1HBW A;  2A45 H;  2JEE A;  5KJ7 C;  3VMY A;  2YKO A;  1RE4 C;  1X79 B;  2FKW B;  2IFN A;  3B8E B;  4AUW A;  1N7S C;  4N3Y B;  3H32 A;  3M9Q A;  1GL2 B;  2WPS A;  1NKN A;  1H88 A;  3BRV B;  1GU4 A;  3M91 A;  1LWU B;  2WIT A;  5AVZ B;  2GUS A;  3A2A A;  2IPP A;  1JY2 O;  1OXZ A;  1JNM A;  4XE5 B;  1L4A B;  1DX7 A;  4LC1 A;  2OYH C;  1G1J A;  1JY2 P;  4O9B A;  4M3L A;  2PAJ A;  3CLQ A;  5AW4 B;  4IFM A;  4WBA A;  2ZFC A;  1T3U A;  3RK3 C;  1SQQ K;  1KIL A;  3CL3 D;  2N1T D;  5CCG A;  4C7R A;  1XTG B;  2IFM A;  3RL0 C;  1N73 C;  1RF0 C;  3U1A A;  3OA7 A;  2HOD A;  1H8A A;  1N7S D;  2OAR A;  3KDP B;  1W2E A;  1QL1 A;  3M9H A;  5CCH A;  1FZC C;  3EFG A;  1N7S B;  1L0N K;  3IR9 A;  2O1J A;  3V2P A;  2VRS A;  4W7Y A;  1GU5 A;  3KQG A;  1L0L K;  3HD7 D;  2L5G B;  3N4X A;  3B5N D;  1A02 F;  2NPS C;  4KHX A;  3HRN A;  3CI9 A;  3VP8 A;  2HPC B;  3B5N B;  1FZA A;  3A3Y B;  1Z56 A;  3U1C A;  5AW5 B;  1X8Y A;  2P1J A;  3UIA A;  3MTU E;  1GD2 E;  1N2D C;  5AW2 B;  3RK2 C;  1HWT C;  2NPS B;  3VN0 A;  1E5W A;  1HJB A;  2HLO A;  4GKG A;  2WWW A;  1N7L A;  5AVT B;  2NPS D;  2O01 H;  4LLH A;  2IX7 C;  4HH2 A;  4C7N B;  1NWQ A;  3B5N A;  3HD7 A;  1RY3 A;  2KB7 P;  3P32 A;  3RL0 B;  2R32 A;  1GL2 D;  1G2C A;  3OJA B;  1S9K D;  1CI6 B;  3NTN A;  1J1D C;  1GW4 A;  1LT9 C;  2CPB A;  1G2C B;  3RL0 D;  3RK3 B;  2P2U A;  1VDF A;  1HVV A;  2P7J A;  2WPR A;  3RK3 D;  1LTG C;  3V4W A;  1L4A C;  5AVV B;  3LW5 H;  2Q3I A;  2NPS A;  2HYN A;  2KP8 A;  1JCD A;  1CI6 A;  1T8Z A;  1YTZ T;  5CJ0 A;  3V2Q A;  1RE4 A;  3V5B A;  4C7N A;  1AFO A;  1JTH B;  1FZF A;  3HE4 A;  2WZ7 A;  1N7S A;  2KOG A;  2XDJ A;  1HTL C;  1S9K E;  1LTJ C;  1WRG A;  5APU A;  2QM7 A;  1IFD A;  1IK9 A;  2QM8 A;  3HD7 B;  1MZ9 A;  3H6P A;  1T2K D;  1LTS C;  1MUU A;  1ZV8 A;  4JYB A;  3HUS C;  3HE5 A;  3P8C D;  3HE5 B;  1H89 A;  5BVZ A;  4GT1 A;  3V2R A;  3WMM 0;  2C0W A;  2H7H A;  4ZKP A;  1KZU B;  4N6J A;  5CHX A;  1HH0 A;  2WPQ A;  2C9N Y;  1MV8 A;  1KIL B;  2FXM A;  2Z5I A;  4N78 E;  1KQL A;  2R3C A;  4XA4 A;  3T97 A;  2WT7 B;  3HE4 B;  3M0D A;  1KIL D;  2W27 A;  1MFZ A;  2N9B A;  5AW9 B;  3V4Q A;  3P8C E;  1SQV K;  1ZLL A;  1L4A A;  3VMX A;  1YYC A;  1CZQ A;  1IFJ A;  3M0A A;  3BAS A;  3TK1 A;  3GHG C;  4IFF A;  1LT9 B;  1HUC A;  2Q7C A;  5AVX B;  1SFC C;  1FU1 A;  4JF7 A;  3H32 B;  1YTZ I;  1DEB A;  1FJP A;  3NFQ A;  2HOD B;  5AW3 B;  3VTP C;  1NTZ K;  2OYI C;  5AVW B;  5CCH D;  5BU8 B;  2HPC A;  1KIL C;  4DOJ A;  3M06 A;  1QL2 A;  3L37 A;  1NOH A;  1FAV A;  2MJZ A;  2HG5 D;  1JUN A;  1LWU A;  3SWY A;  1FOS F;  2N1T A;  3A7O A;  5CCG D;  4WY4 C;  1GW3 A;  1KFM A;  2W6B A;  3HUS A;  5APT A;  1GL2 A;  1RE3 A;  3L4F A;  1JCC A;  4Y99 B;  4EIJ A;  1NU1 K;  2KYV A;  2A45 G;  1FZE A;  5KLV K;  1ZR4 A;  3HD7 C;  1CSB A;  2KSJ A;  1LGH B;  1M1J B;  1JY3 O;  1T2K C;  1SP4 A;  3MD0 A;  1N86 A;  3EQ2 A;  5AVY B;  2WSC H;  1HGZ A;  2XV5 A;  1IC2 A;  2XU6 A;  5CJ4 A;  1J1E B;  1URQ C;  1FBM A;  1FDM A;  3BRT B;  2M3B A;  1JO5 A;  2WTY A;  2BAS A;  3KYQ A;  3TSI A;  1IJD B;  4EOT A;  1NHL A;  5AVS B;  2C0X A;  1FZG A;  1SFC A;  2KLV A;  1M1J C;  5KJ7 A;  3LIE A;  2Z5H A;  3HTK A;  1GZL A;  1SQP K;  4I6M C;  4B86 A;  3LID A;  1SQX K;  4Y99 C;  4C46 A;  1RF1 C;  2OYH B;  1LTJ A;  3A5T A;  2LKM A;  5KTB A;  1LTT C;  2I1J A;  2C9L Y;  2XNX A;  5BU5 A;  1ZN5 A;  1OWA A;  3L36 A;  3TYY A;  1LWU C;  2XZR A;  3II6 A;  3M0D C;  1XTC C;  2R5B A;  1ZR2 A;  2FFD A;  1GL2 C;  3VYI A;  1M7L A;  4N78 D;  2YKQ A;  3L35 A;  5AW7 B;  3OAK A;  2FYZ A;  1NKZ B;  3O8Z A;  4DZO A;  1SFC B;  3VMZ A;  3RK2 B;  2H43 A;  1RF1 B;  1FOS E;  3IFM A;  3GHG B;  2W6A A;  3BAT A;  4HYT B;  1SQB K;  2YMY A;  3KPE A;  3R2P A;  3RK2 D;  5AVU B;  3MIW A;  2Q9I A;  2JJL A;  1DH3 A;  5CMZ A;  3P8M C;  5AVQ B;  3GHG A;  4I1L A;  3TNU A;  1IFI A;  1FZC B;  3N7N A;  1URQ B;  3MGN A;  1J1E C;  2XKM A;  3U59 A;  1N73 B;  5APS A;  1VPC A;  3HUS B;  1URQ D;  4OH8 B;  2O1K A;  1NTM K;  1T3J A;  5AW6 B;  2E43 A;  5APX A;  4I2L C;  1RF0 A;  2H8P D;  3PP5 A;  5AW8 B;  3VOP A;  2YKP A;  1CW5 A;  4LGD E;  2N1T C;  4WY4 A;  2GM4 A;  1IFM A;  1X9V A;  1GK6 A;  3NXS A;  1RE3 C;  1JY3 N;  1LTB C;  3C9I A;  4WY4 B;  1GDT A;  1FZB A;  3E1I A;  3P7K A;  2Z4E A;  1JY2 N;  3HTK B;  4WY4 D;  5CCG C;  1L4A D;  1WT6 A;  1NTK K;  4IFD K;  4AYC A;  2FYU K;  1G1I A;  1N73 A;  1SLQ A;  2OYI B;  4ZKU A;  2M8R A;  2J59 M;  1GK4 A;  4GIF A;  1URQ A;  2OYI A;  3M9B A;  5APQ A;  5CCH C;  1AQ5 A;  3BVH A;  3TNU B;  2CPS A;  2E42 A;  2N1T B;  3G3Z A;  2I1K A;  5KJ7 D;  1NH4 A;  1SFC D;  2R5D A;  2HFE D;  1J1D B;  1J2J B;  4AQR D;  5AW0 B;  2OYH A;  1NAF A;  2ZXE B;  3MUD A;  1LTI C;  1M1J A;  2FFD B;  1PFI A;  3VP9 A;  2YO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...