2CPBA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in dodecylphosphocholine micelles, 25 lowest energy structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords M13 MAJOR COAT PROTEIN
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpbA00
1IFDA 1HGVA 2C0WA 2CPSA 1FDMA 1IFJA 1HH0A 1HGZA 2CPBA 2MJZA 2C0XA 1NH4A 1IFIA
chains in the Genus database with same CATH superfamily
1WRGA 2O1KA 3RK3C 1NYHA 3AE2C 1CI6B 3CCJP 2QJPB 1SQQG 2FXPA 3CMAP 3TK1A 2KB7P 2E76B 1A02J 1GD2E 1KTMA 1FJKA 5CCHD 1PP9E 3D71A 2N1TD 1IFMA 1SQXD 4N3YB 4UB8H 1ZRTD 4Z1MH 2NPSC 1BDDA 2XNXA 1AQ5A 4ZKUA 3E7KA 4C7NA 5KLVE 2FYUG 2HR3A 3L74D 1RQVA 3FWNA 2E5TA 3C8VA 2IFNA 1NH4A 3F89A 2KLVA 2UWJE 3TYYA 2YIUB 1RHZB 5CHXA 2FFDB 3OAKA 2KZIA 1GL2C 1EZVE 4CPGA 1KILA 2B9BA 2POHA 3B4SA 1J2JB 2QRXA 2Y9ZA 3CC4P 3JSVC 5DJTB 2OYHC 1YJWP 4L73A 1SQBD 1GZLA 2IDBA 3AE3C 1URQA 3CLQA 3NMDA 4BRYA 1IFNA 2YXQB 4H13B 2WSSH 1FU1A 1SLQA 4N78E 5KLVD 1LWUB 1L0NK 1OW8A 3GHGA 1U57A 4Y99C 1VQ7P 3CWBG 4GOEA 1EZVD 3EQ2A 4WVZA 5AW9B 3TGUG 1FJPA 1X79B 3RK2C 1MKMA 1JTHA 2SPZA 3UIAA 2XZRA 3D70A 3H1IE 3PRJA 1HVVA 3AECC 3I5CA 5APTA 1D7MA 4PJ0E 5GTHH 3ZDMA 2K37A 2WPQA 2DW3A 3V4WA 4R4LA 1N86A 2FYUJ 2V7QJ 1K8AQ 4I1LA 1NJIQ 3L71G 5M1BA 1FZCB 3L35A 4RJTA 2HYNA 4EIJA 3H1HD 1J1EC 3Q5RA 4H0LD 5CBOA 3L72E 4H13D 3WUTA 3CCMP 3R2PA 3RL0C 1GK6A 1KYOH 2R32A 3H1ID 5B66H 5KTBA 2WSCJ 3BASA 1VF5D 2AEFA 2QVAA 2QEXP 1YYCA 1S9KE 2WTYA 4H44D 1IK9A 3JC22 1SP4A 1CW5A 4JQ0D 2WSFJ 2W6BA 1NTMK 3M9BA 1WMKA 2Q1KA 2W6AA 4GODA 3PTZA 2P10A 1Q81Q 1AJYA 1QEXA 1Q86Q 1FE6A 4GOFA 1OW7A 2ZT9B 3GG2A 1QVFO 1KILE 1QL1A 3CCVP 1EDIA 1Y9BA 3CX5E 3JCUE 4I6MC 1T8ZA 2Q3EA 2E5YA 3L75E 1QX8A 2OTKE 2K9JB 3A0BH 2O01H 2GUVA 2HODA 1RY3A 1BE3G 1RE3C 1ZR2A 2A45I 3EFGA 2IFMA 1Q2NA 2A45G 1GU4A 1SQXJ 1SQXK 1NO4A 2K9YA 1S9KD 1U7MA 2WPRA 1JY3N 3W67A 1KYOI 4RKUJ 5AVVB 3SWKA 1L0LD 1NU1G 3HD7B 4WY4D 1LT9A 3L74J 1OFCX 2LXCB 1PZQA 1SQPG 5AVRB 2LR2A 1RF0A 3IR9A 1L4AA 1T3JA 1KILD 3H1KG 1VQ4P 3V2PA 3CX5D 5CBNA 1VQLP 3L75D 5TJHA 1W2BO 2BEQD 2IBZD 1ZV8A 1MUUA 1Y8AA 5L8RJ 2KSJA 3H32B 1DEBA 1N73B 1KB9E 1Y47A 1KQLA 1K05A 1URQD 1SQBJ 2Z5HA 5KAFE 3MP7B 2D2CB 4UB6H 2H88C 1HGZA 3VMZA 2V4HA 2YO3A 2G8YA 5KLVJ 1M1JB 2QJKC 3G6EP 2AXTH 2GM4A 1YQ3C 1USDA 3HE4B 2QJPC 3PJSK 4AUWA 1FDIA 1DD4A 3NXSA 2W6JH 5AW0B 1J1EB 3IN6A 1SQQE 1OMIA 3H6PA 1OX3A 1IC2A 3SSUA 3MUDC 3RL0B 2LKMA 1VQOP 1GU5A 3GW6A 1VQ9P 1GDTA 3VP9A 5GTIE 4B86A 1E79H 2FBWC 2J5UA 1SQVE 1SFCA 3NFQA 4U3FE 3RL0g 1KB9H 3TNUB 2G3AA 2WVRA 4EYYQ 2N9BA 4D6TD 5AVYB 1L0LG 3P32A 1M7LA 1VQ5P 1L0ND 5KAFH 1PIXA 2KNCA 1FZFA 1Q7YQ 3MIWA 1AVOA 3H1HJ 1YBKA 1CI6A 1VL2A 3H1JD 2B87B 3H1IJ 3V6IA 1FZGA 1S5LX 2IBZG 3WMM0 1EDJA 1S72P 3WU2E 4H0LC 4H13C 3B5ND 1AFOA 2M3BA 3MTUE 1NAFA 1LWUC 3HRNA 5DJUB 3GMAA 1VF5C 2PP6A 1E5WA 2N1TB 4U3FD 4RESB 1N7SA 4H44C 3M0AA 2Q6QA 1T2KD 3CCRP 4PV1B 4UB8E 1S2EA 2FFDA 1KN7A 2ZJSE 1G2CA 1PGOA 3TGUE 1P84D 3OJAB 4LGDE 2IYOA 2YMYA 2FYNC 4ZMDA 1NTMD 5KJ7A 1OVUA 1W2EA 1YJNP 2QJKB 1PFIA 1EDLA 1LTTC 3CCQP 4WY4C 4ZNCA 1OVRA 3L75J 3TDKA 2E75D 3VN0A 1PPJG 3NTNA 5AVUB 2WQYC 4N6JA 1FC2C 2WT7A 4YXWH 2RKLA 2RMZA 1ZR4A 1LT1A 4RO0A 3B8EB 4TT3H 2XNDH 3HUSC 3M9HA 1ZW0A 2H43A 2M8RA 1URQC 4PV1D 3V2NA 4HJGH 3AE4C 2ZT9C 5AVWB 5APVA 1UIXA 3KQGA 1X9VA 5GTHE 3AE1C 3I55P 1FZCA 4ZKPA 1G1JA 3MGNA 1BSNA 4IFMA 3HTKB 5BU8B 2ZXXA 1PP9D 2OTJP 1EXIA 2OYIC 3C1LA 1M56D 1VQ8P 2IZ0A 3AEFC 1M1KQ 1QVGO 4H0LB 4HB1A 3HD7C 1PGQA 1IFIA 1JM0A 2QG4A 1ZN5A 1VF5B 2NPSA 4OGQD 4D6TJ 1KYOE 1L0NJ 5B66E 2H7HA 1KZUB 1OVVA 4H44B 1FOSE 3L70E 1BCCE 3HE5A 1SQPE 4WBAA 4WB4A 2KUBA 1CSBA 3H1JJ 2M0BA 2QM8A 5AW2B 5CCGD 3H1KE 1N73C 1SQQK 3S4RA 1FDMA 1IJDB 3CXHH 2K9JA 1GL2A 2D2CC 4JYBA 4O9BA 2JP3A 2P1JA 4YPCA 3U1AA 2W8ZA 2OYHA 1M1JC 1SQXG 1N7SD 1SQVK 2L91A 4N78D 5KAIH 1HTLC 2OTLP 4U3FJ 2CK3H 1KQGB 2FYNB 3FXDA 3B5NC 3A0BE 2C0XA 1KQSO 1BGYE 2WSEH 1KYOD 1RE4C 3BCCE 3P7KA 5AW3B 2KI7B 3CMEP 3L70D 3WUUA 3L74G 1BCCD 3M06A 2A45H 2JJLA 1IFDA 3LIDA 1DIPA 4WY4B 1JY3O 1NTKE 2BCCE 3AE9C 3LW5H 3E1RA 3CC2P 1QL2A 3SWFA 2YXRB 2CPSA 3U59A 1T2KC 2Q3IA 1FZEA 1KILB 4DT0A 4I7ZC 5AW7B 4YTPC 3KYQA 1JY2N 2ZYDA 2GA1A 2KLUA 3CXHI 1SQBG 2YO2A 5KJ7D 2H89C 2R5DA 2HPCB 3HUSB 1NTMJ 1VQNP 3H1LE 1URQB 1BGYD 1NAYA 3BCCD 3G3ZA 3D6YA 5KLVG 2P2UA 1LTJC 3RK3E 5APYA 1W5CE 1NVOA 4UB6E 4EOTA 4IL6X 3KZIE 1NTKD 2BCCD 3L72D 1VPCA 3BRVB 4KT0J 3KPEA 1EZVG 5H2FH 2AXTE 2NRGA 3U1CA 1RF1C 2OYIB 4C7RA 3FGAD 2W27A 1HJBA 2YNYA 2YKQA 1JTHB 2E42A 5CCHC 2AXCA 1XTCC 5AW5B 1FOSF 2N1TC 3V2RA 1NTZE 2JO1A 3H1LD 3CL3D 4W7YA 4GDOA 3ITKA 1RH5B 2M3EA 1T3UA 3A3YB 5AVQB 3IFMA 4PV1C 4DOJA 1M90Q 4BWNA 2I1KA 2L5GB 3H1HG 1PP9J 2E74D 1ZXGA 2P7JA 2JWAA 1DD3A 1IFPA 2QA4P 1NWQA 2MKVA 1HBWA 2YKOA 3H1IG 1NGMB 3CCUP 4NPFX 1DEEG 2HG5D 1RE3A 3KHUA 3KZIH 3MD0A 1LP1A 1NTZD 2NZ2A 1Q82Q 2W90A 2XU6A 2NPSD 2IZ1A 4W7ZA 1PL5A 3P8MC 2R44A 2KOGA 1IFJA 3V4QA 1VQPP 1JUNA 3B5NB 3ABVC 3P8CE 2Z5IA 2A06E 4DCKA 3L73E 1S4XA 2KK7A 1MFTA 1T6AA 1KFMA 2K1AA 4OGQC 5AW6B 4BXLA 3AE6C 5TISE 3FWLA 3PLNA 4K35A 1KB9D 1GK4A 2PRRA 4W80A 5CCGC 1H8AA 2KIKA 5BU5A 3Q5SA 3AEAC 4EDFA 4I7ZB 2KP8A 4L74A 3H25A 4IOIH 2ZVOB 2PAJA 4DJGA 5E79E 4WWIA 1LNQA 1PV3A 5AW8B 4TLFA 1N7SC 2A06D 3L70J 4L75A 1BCCJ 2FYUE 2R3CA 3A7OA 2O3JA 5B5EE 2OYOA 3L73D 4HYTB 1GW4A 1SQPK 3M0DC 1DH3A 3G71P 1LTJB 1JCDA 1OW6A 1A02F 1SQQD 2IBZI 3L75G 2VRSA 3O8ZA 3RK2D 3T97B 3USSA 2C9LY 4NPDA 5AW1B 1OZHA 1RF1B 1YHQP 3RGUA 1H0TB 2E75B 1GW3A 3MUDA 2O01N 3CC7P 4JBZA 2B89A 1SQVD 5TISH 3VTPC 4PD4H 3GF3A 4IL6H 2O01J 1BGYJ 1NOHA 1NHLA 3V5BA 2FYZA 2J59M 3BCCJ 2BASA 3E1IA 4U7JA 2JR8A 2H8PD 2Y0DA 3OA7A 2WITA 1JCCA 2B88A 4C46A 2YMKA 3AE8C 3QH9A 1NTKK 1NTKJ 2BCCJ 3SFDC 3L72J 5E79H 3CWBE 1PGPA 3RBZA 4NPEA 2C0WA 3KDPB 3D6ZA 4DZOA 2M5AB 3AEDC 2V7QH 2XKMA 5B5EH 3L4FA 1AQTA 5APQA 2XDJA 3O6QB 1UIIA 1LTGC 1KQFB 3MHVA 1KMIZ 2E43A 4LLHA 1LTSC 3CCSP 2WMMA 1IK7A 2KS1B 1XTGB 2Q9IA 4ASVA 3H1LJ 1R5SA 3GLMA 1LWUA 1L4AD 4OVNF 2O1JA 3L71E 3SFEC 1SFCB 4JPZB 4D6TG 3EWKA 4PD4I 1JMMA 1L0NG 1YI2P 4XFJA 1JO5A 1U7JA 1JOCA 3AE5C 1FDOA 2WSCH 2KNCB 4OGQB 3CWBD 2K3RA 1AA0A 2C9NY 1KILC 3H1JG 5KKZB 5CJ0A 2ZYGA 3TGUD 1J1DC 3FX0A 1KV4A 3S9OA 1QLED 2WSFH 1HJ0A 2E74C 1LTAC 1S5LE 1KORA 2KXPB 1NTZJ 1NTZK 2ZYAA 1EC5A 1H88A 1SQBE 2P67A 3M9QA 3CXHE 3CCLP 1SQVG 2I1JA 4U3FG 3OW2O 4EI2A 3L71D 1KC8Q 3PHLA 1HWTC 1KFNA 1N7SB 3SWYA 3GHGC 4A7PA 1AV1A 5KLIB 5AVTB 3AEBC 2Z4EA 4WY4A 5KAIE 1K9MQ 1JNMA 2IPPA 1M57D 5AVZB 2JDIH 1G2CB 1P84I 5CMZA 1BE3E 2ITAA 2FXMA 4KJMA 3BVHA 2QJYB 1USEA 2N9YB 1SFCD 3G9RA 3TSIA 1KD1Q 1FBMA 3IAOA 4JF7A 2HPCA 1IO4A 1R5LA 1X0TA 3HUSA 3CXHD 3VMYA 3TF5A 1NTMG 1NU1E 2AEMA 2JKVA 4K3AA 3B71A 3L73J 1S5LH 2ZAEB 1HUCA 2E76D 1JY2P 1JY2O 1TU3F 1VQKP 3PH0A 4OWFA 1SQQJ 3M91A 3BRTB 3H1HE 3N4XA 3CI9A 2OYIA 1BE3D 4Y28J 2WT7B 2RH0A 3GF7A 1SQVJ 5C39A 3F5HA 3HD7A 2JEEA 5H2FE 2K88A 1LTIC 1G1IA 1OWAA 1NU1D 2GUSA 2FYUK 3L37A 4C7NB 1ZOYC 1LTBC 1SQPD 1GTWA 1JY3P 3H1KD 2FXOA 2WPVB 2MJZA 3H32A 3RK3B 1ZP0C 1N73A 1PP9G 2QM7A 4M3LA 1J1DB 2LXBA 3Q3DA 2E74B 4XE5B 3CD6P 1MZ9A 4BRYB 1M1JA 2J58A 2HLOA 1LT9C 1YITP 4GT1A 3HE4A 3B5NA 1L0LE 3AEEC 3RBXA 1ZMEC 2NPSB 1RE4A 1RF0C 1FZAA 1L4AC 2OQQA 1EZVI 1GMJA 3GHGB 4PJ0H 1VQMP 3CWBJ 2W83C 1H89A 1YTZI 3HE5B 4IFFA 1HGVA 3TGUJ 1PGJA 4QMAA 1L2PA 2E75C 2CPBA 2IBZE 1GL2B 1OXZA 1CZQA 1NKZB 2I8DA 4XA4A 1N7LA 1Q90D 2AEJA 5EFWB 2ZVNB 5APUA 2OYHB 3TNUA 1AVYA 3L71J 3V2QA 3G4SP 3RK3D 2PGDA 1QGKB 2Y9YA 3VMAA 1Z56A 3L70G 1BCCG 1LTJA 1HF9A 1BSHA 2WPSA 2B87A 2KYVA 1IZNB 2KZJA 1LGHB 3T97A 1RQUA 1K04A 4Y99B 4L76A 2OARA 3VMXA 1S3JA 5K5GB 1LJ2A 1RF1A 1S1CX 2QIWA 1H0TA 3Q1MA 3RK2B 2P58A 5AVSB 5CCHA 1SQBK 3EFFK 2N1TA 2XV5A 3MZWB 1SFCC 3CX5H 3JCUH 1WT6A 3A0HE 2ZT9D 4MN4C 1YQ4C 3R4YA 2FY8A 4OH8B 1BGYG 3Q2YA 2HFED 3BCCG 5KLVK 1N8RQ 1M8OB 1GL2D 2R3SA 3IF4A 2BEZF 2RN0A 5APXA 5KKZC 4D6TE 1L0NE 3S1KA 1DX7A 2QSIA 4PD4E 1NTKG 2BCCG 4IL6E 2R5BA 1PPJE 1JEKA 2E76C 3L72G 3AE7C 2WSEJ 3N7NA 2M5AA 1BE3J 3H1JE 4I2LC 2HODB 2IYPA 3LIEA 1X8YA 3O6QA 3A5TA 1EDKA 1VDFA 3HD7D 3LW5J 4KHXA 2KS1A 2JWDA 2WWWA 1YIJP 1NKNA 3I56P 1NU1K 1NU1J 3P8CD 3H1LG 1HH0A 2Q5UA 1EQ7A 2WZ7A 1EXJA 1LT9B 5KLIC 5AW4B 1SQPJ 1FS0E 4HKZH 5CJ4A 3CPWO 3CX5I 1X22A 3H1KJ 4AQRD 2YIUC 3AEGC 1L4AB 2FFDC 3VYIA 4PD4D 1JB0J 1PPJD 3A0HH 4JYCA 2QJYC 2ZFCA 2D2CD 2IX7C 4GIFA 2Q7CA 1ZLLA 1R8EA 3PP5A 4HH2A 2Y0CA 5CCGA 4ASWA 4LC1A 1FZBA 1P84E 4GKGA 1NTZG 3K5BA 2OGUA 1LP1B 5KJ7C 1YTZT 2FYUD 1K73Q 2KSEA 3FXEA 1SS1A 1BDCA 1NTME 3CCEP 3W68A 1N2DC 4R4MA 3BATA 3C9IA 2Y0EA 4AYCA 3M0DA 3VOPA 3KXDA 1OIPA 1MV8A 3HTKA 5APSA 3RL0D 1SVFA 2QE7H 1KB9I 5GTIH 2PFXA 1JMBA 3WUVA 3A2AA 5APWA 3VP8A 1YJ9P 3L36A 4IFDK 2YKPA 1SQXE 3II6A 2ZXEB 2FKWB 4YXDC 1ZRTE 1MFZA 1VQ6P 1L0LK 1L0LJ 5BVZA 3QWOC 1FAVA 2A06G 3L74E 5AVXB 3WU2H 1FZCC 1P84H 3L73G 3Q5PA
chains in the Genus database with same CATH topology
1SFCA 1XTCC 3NFQA 5AW5B 1WRGA 1FOSF 2O1KA 2N1TC 3N4XA 3V2RA 3RK3C 3TNUB 3CI9A 2OYIA 1CI6B 2N9BA 2WT7B 5AVYB 3P32A 1M7LA 3CL3D 4W7YA 1FZFA 3TK1A 2KB7P 3MIWA 1A02J 1GD2E 1T3UA 3A3YB 5AVQB 1CI6A 1FJKA 3IFMA 5CCHD 3HD7A 2JEEA 2N1TD 1IFMA 1G1IA 1LTIC 1OWAA 2GUSA 4DOJA 2FYUK 3L37A 4C7NB 4N3YB 1FZGA 2I1KA 3WMM0 1LTBC 2L5GB 2NPSC 2P7JA 1GTWA 1JY3P 2XNXA 1AQ5A 3B5ND 4ZKUA 1AFOA 4C7NA 2M3BA 1NWQA 1HBWA 3MTUE 1NAFA 1LWUC 3HRNA 2MJZA 2YKOA 3H32A 2PP6A 2HG5D 1E5WA 1RE3A 2IFNA 2N1TB 3MD0A 3RK3B 1N73A 2QM7A 1NH4A 4RESB 2KLVA 1N7SA 3TYYA 4M3LA 5CHXA 1J1DB 2XU6A 2NPSD 2FFDB 3OAKA 4W7ZA 1GL2C 3P8MC 1KILA 3M0AA 2POHA 2KOGA 1J2JB 4XE5B 1IFJA 1T2KD 3V4QA 1JUNA 3B5NB 3P8CE 2Z5IA 2FFDA 1MZ9A 1M1JA 2J58A 2HLOA 2OYHC 1G2CA 1LT9C 4GT1A 1KFMA 1GZLA 3HE4A 5AW6B 3B5NA 1URQA 3CLQA 3NMDA 3OJAB 4LGDE 2NPSB 1IFNA 1RE4A 1RF0C 1FZAA 1L4AC 1FU1A 1SLQA 1GK4A 3GHGB 4N78E 1H89A 1LWUB 4W80A 5CCGC 1YTZI 3HE5B 1H8AA 2YMYA 5BU5A 4IFFA 1HGVA 1L0NK 5KJ7A 2KP8A 3GHGA 4Y99C 2CPBA 1W2EA 1GL2B 2PAJA 1PFIA 3EQ2A 1OXZA 5AW9B 1LTTC 1CZQA 1NKZB 4WY4C 1FJPA 4XA4A 1X79B 1N7LA 3RK2C 5AW8B 1JTHA 1N7SC 5APUA 3UIAA 2XZRA 2R3CA 3A7OA 3VN0A 2OYHB 1HVVA 3NTNA 5AVUB 3I5CA 3TNUA 4HYTB 4N6JA 5APTA 1GW4A 1SQPK 3M0DC 1DH3A 1LTJB 2WT7A 3V2QA 1JCDA 1A02F 3RK3D 1ZR4A 2WPQA 3V4WA 1Z56A 1N86A 2VRSA 3O8ZA 3RK2D 3B8EB 4I1LA 2C9LY 1LTJA 2WPSA 3HUSC 3M9HA 2KYVA 2H43A 2M8RA 5AW1B 1URQC 1RF1B 1LGHB 3V2NA 3T97A 1GW3A 4Y99B 3MUDA 1FZCB 3L35A 2OARA 2HYNA 3VTPC 3VMXA 4EIJA 5AVWB 5APVA 1J1EC 1RF1A 3KQGA 1X9VA 1NOHA 1NHLA 3V5BA 2FYZA 3RK2B 2J59M 1FZCA 5AVSB 4ZKPA 5CCHA 1SQBK 2BASA 3E1IA 1G1JA 3R2PA 3RL0C 2N1TA 2XV5A 1GK6A 2R32A 3MGNA 5KTBA 2H8PD 4IFMA 1SFCC 1WT6A 3OA7A 2WITA 1JCCA 3HTKB 3BASA 5BU8B 4C46A 2OYIC 1NTKK 4OH8B 1YYCA 2HFED 1S9KE 2WTYA 1IK9A 5KLVK 1SP4A 1GL2D 1CW5A 2C0WA 5APXA 3KDPB 4DZOA 2W6BA 1NTMK 3M9BA 3HD7C 2XKMA 1DX7A 2W6AA 3L4FA 1IFIA 5APQA 2XDJA 2R5BA 1LTGC 2E43A 4LLHA 1LTSC 1ZN5A 3N7NA 2NPSA 4I2LC 1QL1A 1XTGB 2HODB 2Q9IA 2H7HA 1KZUB 3LIEA 1X8YA 4I6MC 1T8ZA 1FOSE 3A5TA 1LWUA 1L4AD 3HD7D 1VDFA 3HE5A 2O1JA 4WBAA 2O01H 4WB4A 2GUVA 4KHXA 1CSBA 2HODA 1SFCB 1RY3A 2QM8A 5AW2B 2WWWA 5CCGD 1RE3C 1ZR2A 1NKNA 2A45I 3EFGA 1N73C 1SQQK 2IFMA 1JMMA 1NU1K 1FDMA 1IJDB 3P8CD 1HH0A 2Q5UA 1EQ7A 1GL2A 2A45G 1SQXK 1GU4A 1NO4A 2WZ7A 1JO5A 1JOCA 1LT9B 2WSCH 5AW4B 1S9KD 2WPRA 1JY3N 4JYBA 4O9BA 5CJ4A 2C9NY 1KILC 2P1JA 5CJ0A 5AVVB 4AQRD 3U1AA 1J1DC 1L4AB 2OYHA 3HD7B 4WY4D 2FFDC 1LT9A 3VYIA 1M1JC 2WSFH 1N7SD 1SQVK 4N78D 4JYCA 1LTAC 1HTLC 5AVRB 2ZFCA 1NTZK 3IR9A 1RF0A 2IX7C 3B5NC 2C0XA 1L4AA 1T3JA 4GIFA 1KILD 2Q7CA 2WSEH 1ZLLA 3V2PA 1RE4C 3PP5A 3P7KA 1H88A 4HH2A 5AW3B 2P67A 3M9QA 5CCGA 1ZV8A 1MUUA 2I1JA 2KSJA 3M06A 2A45H 4LC1A 2JJLA 1FZBA 1IFDA 3H32B 3LIDA 4GKGA 1DEBA 4WY4B 1JY3O 3LW5H 1N73B 1KQLA 1HWTC 1KFNA 5KJ7C 1N7SB 1URQD 3GHGC 3SWYA 2Z5HA 1YTZT 1QL2A 3SWFA 2CPSA 3U59A 1T2KC 5AVTB 2Q3IA 1FZEA 2Z4EA 4WY4A 1KILB 1HGZA 5AW7B 1JNMA 3VMZA 2IPPA 3KYQA 5AVZB 1JY2N 2YO3A 1N2DC 3BATA 3C9IA 1M1JB 4AYCA 3M0DA 3VOPA 2YO2A 5KJ7D 1MV8A 1G2CB 3HTKA 5CMZA 2R5DA 5APSA 2GM4A 3RL0D 1SVFA 2HPCB 3HUSB 2FXMA 3HE4B 3BVHA 1SFCD 1URQB 4AUWA 3TSIA 1FBMA 3G3ZA 3A2AA 4JF7A 2HPCA 3NXSA 2P2UA 1IO4A 3HUSA 5APWA 1LTJC 5AW0B 3VP8A 3VMYA 3L36A 4IFDK 5APYA 2YKPA 1J1EB 4EOTA 3H6PA 3II6A 1IC2A 2ZXEB 2FKWB 1VPCA 3BRVB 3RL0B 2LKMA 1HUCA 3KPEA 1JY2P 1JY2O 1MFZA 1GU5A 1L0LK 3U1CA 3M91A 5BVZA 1RF1C 1FAVA 2OYIB 1GDTA 4C7RA 3BRTB 3VP9A 2W27A 1HJBA 4B86A 2YNYA 5AVXB 1FZCC 2YKQA 1JTHB 2E42A 5CCHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFD A;  1HGV A;  2C0W A;  2CPS A;  1FDM A;  1IFJ A;  1HH0 A;  1HGZ A;  2CPB A;  2MJZ A;  2C0X A;  1NH4 A;  1IFI A; 
#chains in the Genus database with same CATH topology
 1WRG A;  2O1K A;  3RK3 C;  1NYH A;  3AE2 C;  1CI6 B;  3CCJ P;  2QJP B;  1SQQ G;  2FXP A;  3CMA P;  3TK1 A;  2KB7 P;  2E76 B;  1A02 J;  1GD2 E;  1KTM A;  1FJK A;  5CCH D;  1PP9 E;  3D71 A;  2N1T D;  1IFM A;  1SQX D;  4N3Y B;  4UB8 H;  1ZRT D;  4Z1M H;  2NPS C;  1BDD A;  2XNX A;  1AQ5 A;  4ZKU A;  3E7K A;  4C7N A;  5KLV E;  2FYU G;  2HR3 A;  3L74 D;  1RQV A;  3FWN A;  2E5T A;  3C8V A;  2IFN A;  1NH4 A;  3F89 A;  2KLV A;  2UWJ E;  3TYY A;  2YIU B;  1RHZ B;  5CHX A;  2FFD B;  3OAK A;  2KZI A;  1GL2 C;  1EZV E;  4CPG A;  1KIL A;  2B9B A;  2POH A;  3B4S A;  1J2J B;  2QRX A;  2Y9Z A;  3CC4 P;  3JSV C;  5DJT B;  2OYH C;  1YJW P;  4L73 A;  1SQB D;  1GZL A;  2IDB A;  3AE3 C;  1URQ A;  3CLQ A;  3NMD A;  4BRY A;  1IFN A;  2YXQ B;  4H13 B;  2WSS H;  1FU1 A;  1SLQ A;  4N78 E;  5KLV D;  1LWU B;  1L0N K;  1OW8 A;  3GHG A;  1U57 A;  4Y99 C;  1VQ7 P;  3CWB G;  4GOE A;  1EZV D;  3EQ2 A;  4WVZ A;  5AW9 B;  3TGU G;  1FJP A;  1X79 B;  3RK2 C;  1MKM A;  1JTH A;  2SPZ A;  3UIA A;  2XZR A;  3D70 A;  3H1I E;  3PRJ A;  1HVV A;  3AEC C;  3I5C A;  5APT A;  1D7M A;  4PJ0 E;  5GTH H;  3ZDM A;  2K37 A;  2WPQ A;  2DW3 A;  3V4W A;  4R4L A;  1N86 A;  2FYU J;  2V7Q J;  1K8A Q;  4I1L A;  1NJI Q;  3L71 G;  5M1B A;  1FZC B;  3L35 A;  4RJT A;  2HYN A;  4EIJ A;  3H1H D;  1J1E C;  3Q5R A;  4H0L D;  5CBO A;  3L72 E;  4H13 D;  3WUT A;  3CCM P;  3R2P A;  3RL0 C;  1GK6 A;  1KYO H;  2R32 A;  3H1I D;  5B66 H;  5KTB A;  2WSC J;  3BAS A;  1VF5 D;  2AEF A;  2QVA A;  2QEX P;  1YYC A;  1S9K E;  2WTY A;  4H44 D;  1IK9 A;  3JC2 2;  1SP4 A;  1CW5 A;  4JQ0 D;  2WSF J;  2W6B A;  1NTM K;  3M9B A;  1WMK A;  2Q1K A;  2W6A A;  4GOD A;  3PTZ A;  2P10 A;  1Q81 Q;  1AJY A;  1QEX A;  1Q86 Q;  1FE6 A;  4GOF A;  1OW7 A;  2ZT9 B;  3GG2 A;  1QVF O;  1KIL E;  1QL1 A;  3CCV P;  1EDI A;  1Y9B A;  3CX5 E;  3JCU E;  4I6M C;  1T8Z A;  2Q3E A;  2E5Y A;  3L75 E;  1QX8 A;  2OTK E;  2K9J B;  3A0B H;  2O01 H;  2GUV A;  2HOD A;  1RY3 A;  1BE3 G;  1RE3 C;  1ZR2 A;  2A45 I;  3EFG A;  2IFM A;  1Q2N A;  2A45 G;  1GU4 A;  1SQX J;  1SQX K;  1NO4 A;  2K9Y A;  1S9K D;  1U7M A;  2WPR A;  1JY3 N;  3W67 A;  1KYO I;  4RKU J;  5AVV B;  3SWK A;  1L0L D;  1NU1 G;  3HD7 B;  4WY4 D;  1LT9 A;  3L74 J;  1OFC X;  2LXC B;  1PZQ A;  1SQP G;  5AVR B;  2LR2 A;  1RF0 A;  3IR9 A;  1L4A A;  1T3J A;  1KIL D;  3H1K G;  1VQ4 P;  3V2P A;  3CX5 D;  5CBN A;  1VQL P;  3L75 D;  5TJH A;  1W2B O;  2BEQ D;  2IBZ D;  1ZV8 A;  1MUU A;  1Y8A A;  5L8R J;  2KSJ A;  3H32 B;  1DEB A;  1N73 B;  1KB9 E;  1Y47 A;  1KQL A;  1K05 A;  1URQ D;  1SQB J;  2Z5H A;  5KAF E;  3MP7 B;  2D2C B;  4UB6 H;  2H88 C;  1HGZ A;  3VMZ A;  2V4H A;  2YO3 A;  2G8Y A;  5KLV J;  1M1J B;  2QJK C;  3G6E P;  2AXT H;  2GM4 A;  1YQ3 C;  1USD A;  3HE4 B;  2QJP C;  3PJS K;  4AUW A;  1FDI A;  1DD4 A;  3NXS A;  2W6J H;  5AW0 B;  1J1E B;  3IN6 A;  1SQQ E;  1OMI A;  3H6P A;  1OX3 A;  1IC2 A;  3SSU A;  3MUD C;  3RL0 B;  2LKM A;  1VQO P;  1GU5 A;  3GW6 A;  1VQ9 P;  1GDT A;  3VP9 A;  5GTI E;  4B86 A;  1E79 H;  2FBW C;  2J5U A;  1SQV E;  1SFC A;  3NFQ A;  4U3F E;  3RL0 g;  1KB9 H;  3TNU B;  2G3A A;  2WVR A;  4EYY Q;  2N9B A;  4D6T D;  5AVY B;  1L0L G;  3P32 A;  1M7L A;  1VQ5 P;  1L0N D;  5KAF H;  1PIX A;  2KNC A;  1FZF A;  1Q7Y Q;  3MIW A;  1AVO A;  3H1H J;  1YBK A;  1CI6 A;  1VL2 A;  3H1J D;  2B87 B;  3H1I J;  3V6I A;  1FZG A;  1S5L X;  2IBZ G;  3WMM 0;  1EDJ A;  1S72 P;  3WU2 E;  4H0L C;  4H13 C;  3B5N D;  1AFO A;  2M3B A;  3MTU E;  1NAF A;  1LWU C;  3HRN A;  5DJU B;  3GMA A;  1VF5 C;  2PP6 A;  1E5W A;  2N1T B;  4U3F D;  4RES B;  1N7S A;  4H44 C;  3M0A A;  2Q6Q A;  1T2K D;  3CCR P;  4PV1 B;  4UB8 E;  1S2E A;  2FFD A;  1KN7 A;  2ZJS E;  1G2C A;  1PGO A;  3TGU E;  1P84 D;  3OJA B;  4LGD E;  2IYO A;  2YMY A;  2FYN C;  4ZMD A;  1NTM D;  5KJ7 A;  1OVU A;  1W2E A;  1YJN P;  2QJK B;  1PFI A;  1EDL A;  1LTT C;  3CCQ P;  4WY4 C;  4ZNC A;  1OVR A;  3L75 J;  3TDK A;  2E75 D;  3VN0 A;  1PPJ G;  3NTN A;  5AVU B;  2WQY C;  4N6J A;  1FC2 C;  2WT7 A;  4YXW H;  2RKL A;  2RMZ A;  1ZR4 A;  1LT1 A;  4RO0 A;  3B8E B;  4TT3 H;  2XND H;  3HUS C;  3M9H A;  1ZW0 A;  2H43 A;  2M8R A;  1URQ C;  4PV1 D;  3V2N A;  4HJG H;  3AE4 C;  2ZT9 C;  5AVW B;  5APV A;  1UIX A;  3KQG A;  1X9V A;  5GTH E;  3AE1 C;  3I55 P;  1FZC A;  4ZKP A;  1G1J A;  3MGN A;  1BSN A;  4IFM A;  3HTK B;  5BU8 B;  2ZXX A;  1PP9 D;  2OTJ P;  1EXI A;  2OYI C;  3C1L A;  1M56 D;  1VQ8 P;  2IZ0 A;  3AEF C;  1M1K Q;  1QVG O;  4H0L B;  4HB1 A;  3HD7 C;  1PGQ A;  1IFI A;  1JM0 A;  2QG4 A;  1ZN5 A;  1VF5 B;  2NPS A;  4OGQ D;  4D6T J;  1KYO E;  1L0N J;  5B66 E;  2H7H A;  1KZU B;  1OVV A;  4H44 B;  1FOS E;  3L70 E;  1BCC E;  3HE5 A;  1SQP E;  4WBA A;  4WB4 A;  2KUB A;  1CSB A;  3H1J J;  2M0B A;  2QM8 A;  5AW2 B;  5CCG D;  3H1K E;  1N73 C;  1SQQ K;  3S4R A;  1FDM A;  1IJD B;  3CXH H;  2K9J A;  1GL2 A;  2D2C C;  4JYB A;  4O9B A;  2JP3 A;  2P1J A;  4YPC A;  3U1A A;  2W8Z A;  2OYH A;  1M1J C;  1SQX G;  1N7S D;  1SQV K;  2L91 A;  4N78 D;  5KAI H;  1HTL C;  2OTL P;  4U3F J;  2CK3 H;  1KQG B;  2FYN B;  3FXD A;  3B5N C;  3A0B E;  2C0X A;  1KQS O;  1BGY E;  2WSE H;  1KYO D;  1RE4 C;  3BCC E;  3P7K A;  5AW3 B;  2KI7 B;  3CME P;  3L70 D;  3WUU A;  3L74 G;  1BCC D;  3M06 A;  2A45 H;  2JJL A;  1IFD A;  3LID A;  1DIP A;  4WY4 B;  1JY3 O;  1NTK E;  2BCC E;  3AE9 C;  3LW5 H;  3E1R A;  3CC2 P;  1QL2 A;  3SWF A;  2YXR B;  2CPS A;  3U59 A;  1T2K C;  2Q3I A;  1FZE A;  1KIL B;  4DT0 A;  4I7Z C;  5AW7 B;  4YTP C;  3KYQ A;  1JY2 N;  2ZYD A;  2GA1 A;  2KLU A;  3CXH I;  1SQB G;  2YO2 A;  5KJ7 D;  2H89 C;  2R5D A;  2HPC B;  3HUS B;  1NTM J;  1VQN P;  3H1L E;  1URQ B;  1BGY D;  1NAY A;  3BCC D;  3G3Z A;  3D6Y A;  5KLV G;  2P2U A;  1LTJ C;  3RK3 E;  5APY A;  1W5C E;  1NVO A;  4UB6 E;  4EOT A;  4IL6 X;  3KZI E;  1NTK D;  2BCC D;  3L72 D;  1VPC A;  3BRV B;  4KT0 J;  3KPE A;  1EZV G;  5H2F H;  2AXT E;  2NRG A;  3U1C A;  1RF1 C;  2OYI B;  4C7R A;  3FGA D;  2W27 A;  1HJB A;  2YNY A;  2YKQ A;  1JTH B;  2E42 A;  5CCH C;  2AXC A;  1XTC C;  5AW5 B;  1FOS F;  2N1T C;  3V2R A;  1NTZ E;  2JO1 A;  3H1L D;  3CL3 D;  4W7Y A;  4GDO A;  3ITK A;  1RH5 B;  2M3E A;  1T3U A;  3A3Y B;  5AVQ B;  3IFM A;  4PV1 C;  4DOJ A;  1M90 Q;  4BWN A;  2I1K A;  2L5G B;  3H1H G;  1PP9 J;  2E74 D;  1ZXG A;  2P7J A;  2JWA A;  1DD3 A;  1IFP A;  2QA4 P;  1NWQ A;  2MKV A;  1HBW A;  2YKO A;  3H1I G;  1NGM B;  3CCU P;  4NPF X;  1DEE G;  2HG5 D;  1RE3 A;  3KHU A;  3KZI H;  3MD0 A;  1LP1 A;  1NTZ D;  2NZ2 A;  1Q82 Q;  2W90 A;  2XU6 A;  2NPS D;  2IZ1 A;  4W7Z A;  1PL5 A;  3P8M C;  2R44 A;  2KOG A;  1IFJ A;  3V4Q A;  1VQP P;  1JUN A;  3B5N B;  3ABV C;  3P8C E;  2Z5I A;  2A06 E;  4DCK A;  3L73 E;  1S4X A;  2KK7 A;  1MFT A;  1T6A A;  1KFM A;  2K1A A;  4OGQ C;  5AW6 B;  4BXL A;  3AE6 C;  5TIS E;  3FWL A;  3PLN A;  4K35 A;  1KB9 D;  1GK4 A;  2PRR A;  4W80 A;  5CCG C;  1H8A A;  2KIK A;  5BU5 A;  3Q5S A;  3AEA C;  4EDF A;  4I7Z B;  2KP8 A;  4L74 A;  3H25 A;  4IOI H;  2ZVO B;  2PAJ A;  4DJG A;  5E79 E;  4WWI A;  1LNQ A;  1PV3 A;  5AW8 B;  4TLF A;  1N7S C;  2A06 D;  3L70 J;  4L75 A;  1BCC J;  2FYU E;  2R3C A;  3A7O A;  2O3J A;  5B5E E;  2OYO A;  3L73 D;  4HYT B;  1GW4 A;  1SQP K;  3M0D C;  1DH3 A;  3G71 P;  1LTJ B;  1JCD A;  1OW6 A;  1A02 F;  1SQQ D;  2IBZ I;  3L75 G;  2VRS A;  3O8Z A;  3RK2 D;  3T97 B;  3USS A;  2C9L Y;  4NPD A;  5AW1 B;  1OZH A;  1RF1 B;  1YHQ P;  3RGU A;  1H0T B;  2E75 B;  1GW3 A;  3MUD A;  2O01 N;  3CC7 P;  4JBZ A;  2B89 A;  1SQV D;  5TIS H;  3VTP C;  4PD4 H;  3GF3 A;  4IL6 H;  2O01 J;  1BGY J;  1NOH A;  1NHL A;  3V5B A;  2FYZ A;  2J59 M;  3BCC J;  2BAS A;  3E1I A;  4U7J A;  2JR8 A;  2H8P D;  2Y0D A;  3OA7 A;  2WIT A;  1JCC A;  2B88 A;  4C46 A;  2YMK A;  3AE8 C;  3QH9 A;  1NTK K;  1NTK J;  2BCC J;  3SFD C;  3L72 J;  5E79 H;  3CWB E;  1PGP A;  3RBZ A;  4NPE A;  2C0W A;  3KDP B;  3D6Z A;  4DZO A;  2M5A B;  3AED C;  2V7Q H;  2XKM A;  5B5E H;  3L4F A;  1AQT A;  5APQ A;  2XDJ A;  3O6Q B;  1UII A;  1LTG C;  1KQF B;  3MHV A;  1KMI Z;  2E43 A;  4LLH A;  1LTS C;  3CCS P;  2WMM A;  1IK7 A;  2KS1 B;  1XTG B;  2Q9I A;  4ASV A;  3H1L J;  1R5S A;  3GLM A;  1LWU A;  1L4A D;  4OVN F;  2O1J A;  3L71 E;  3SFE C;  1SFC B;  4JPZ B;  4D6T G;  3EWK A;  4PD4 I;  1JMM A;  1L0N G;  1YI2 P;  4XFJ A;  1JO5 A;  1U7J A;  1JOC A;  3AE5 C;  1FDO A;  2WSC H;  2KNC B;  4OGQ B;  3CWB D;  2K3R A;  1AA0 A;  2C9N Y;  1KIL C;  3H1J G;  5KKZ B;  5CJ0 A;  2ZYG A;  3TGU D;  1J1D C;  3FX0 A;  1KV4 A;  3S9O A;  1QLE D;  2WSF H;  1HJ0 A;  2E74 C;  1LTA C;  1S5L E;  1KOR A;  2KXP B;  1NTZ J;  1NTZ K;  2ZYA A;  1EC5 A;  1H88 A;  1SQB E;  2P67 A;  3M9Q A;  3CXH E;  3CCL P;  1SQV G;  2I1J A;  4U3F G;  3OW2 O;  4EI2 A;  3L71 D;  1KC8 Q;  3PHL A;  1HWT C;  1KFN A;  1N7S B;  3SWY A;  3GHG C;  4A7P A;  1AV1 A;  5KLI B;  5AVT B;  3AEB C;  2Z4E A;  4WY4 A;  5KAI E;  1K9M Q;  1JNM A;  2IPP A;  1M57 D;  5AVZ B;  2JDI H;  1G2C B;  1P84 I;  5CMZ A;  1BE3 E;  2ITA A;  2FXM A;  4KJM A;  3BVH A;  2QJY B;  1USE A;  2N9Y B;  1SFC D;  3G9R A;  3TSI A;  1KD1 Q;  1FBM A;  3IAO A;  4JF7 A;  2HPC A;  1IO4 A;  1R5L A;  1X0T A;  3HUS A;  3CXH D;  3VMY A;  3TF5 A;  1NTM G;  1NU1 E;  2AEM A;  2JKV A;  4K3A A;  3B71 A;  3L73 J;  1S5L H;  2ZAE B;  1HUC A;  2E76 D;  1JY2 P;  1JY2 O;  1TU3 F;  1VQK P;  3PH0 A;  4OWF A;  1SQQ J;  3M91 A;  3BRT B;  3H1H E;  3N4X A;  3CI9 A;  2OYI A;  1BE3 D;  4Y28 J;  2WT7 B;  2RH0 A;  3GF7 A;  1SQV J;  5C39 A;  3F5H A;  3HD7 A;  2JEE A;  5H2F E;  2K88 A;  1LTI C;  1G1I A;  1OWA A;  1NU1 D;  2GUS A;  2FYU K;  3L37 A;  4C7N B;  1ZOY C;  1LTB C;  1SQP D;  1GTW A;  1JY3 P;  3H1K D;  2FXO A;  2WPV B;  2MJZ A;  3H32 A;  3RK3 B;  1ZP0 C;  1N73 A;  1PP9 G;  2QM7 A;  4M3L A;  1J1D B;  2LXB A;  3Q3D A;  2E74 B;  4XE5 B;  3CD6 P;  1MZ9 A;  4BRY B;  1M1J A;  2J58 A;  2HLO A;  1LT9 C;  1YIT P;  4GT1 A;  3HE4 A;  3B5N A;  1L0L E;  3AEE C;  3RBX A;  1ZME C;  2NPS B;  1RE4 A;  1RF0 C;  1FZA A;  1L4A C;  2OQQ A;  1EZV I;  1GMJ A;  3GHG B;  4PJ0 H;  1VQM P;  3CWB J;  2W83 C;  1H89 A;  1YTZ I;  3HE5 B;  4IFF A;  1HGV A;  3TGU J;  1PGJ A;  4QMA A;  1L2P A;  2E75 C;  2CPB A;  2IBZ E;  1GL2 B;  1OXZ A;  1CZQ A;  1NKZ B;  2I8D A;  4XA4 A;  1N7L A;  1Q90 D;  2AEJ A;  5EFW B;  2ZVN B;  5APU A;  2OYH B;  3TNU A;  1AVY A;  3L71 J;  3V2Q A;  3G4S P;  3RK3 D;  2PGD A;  1QGK B;  2Y9Y A;  3VMA A;  1Z56 A;  3L70 G;  1BCC G;  1LTJ A;  1HF9 A;  1BSH A;  2WPS A;  2B87 A;  2KYV A;  1IZN B;  2KZJ A;  1LGH B;  3T97 A;  1RQU A;  1K04 A;  4Y99 B;  4L76 A;  2OAR A;  3VMX A;  1S3J A;  5K5G B;  1LJ2 A;  1RF1 A;  1S1C X;  2QIW A;  1H0T A;  3Q1M A;  3RK2 B;  2P58 A;  5AVS B;  5CCH A;  1SQB K;  3EFF K;  2N1T A;  2XV5 A;  3MZW B;  1SFC C;  3CX5 H;  3JCU H;  1WT6 A;  3A0H E;  2ZT9 D;  4MN4 C;  1YQ4 C;  3R4Y A;  2FY8 A;  4OH8 B;  1BGY G;  3Q2Y A;  2HFE D;  3BCC G;  5KLV K;  1N8R Q;  1M8O B;  1GL2 D;  2R3S A;  3IF4 A;  2BEZ F;  2RN0 A;  5APX A;  5KKZ C;  4D6T E;  1L0N E;  3S1K A;  1DX7 A;  2QSI A;  4PD4 E;  1NTK G;  2BCC G;  4IL6 E;  2R5B A;  1PPJ E;  1JEK A;  2E76 C;  3L72 G;  3AE7 C;  2WSE J;  3N7N A;  2M5A A;  1BE3 J;  3H1J E;  4I2L C;  2HOD B;  2IYP A;  3LIE A;  1X8Y A;  3O6Q A;  3A5T A;  1EDK A;  1VDF A;  3HD7 D;  3LW5 J;  4KHX A;  2KS1 A;  2JWD A;  2WWW A;  1YIJ P;  1NKN A;  3I56 P;  1NU1 K;  1NU1 J;  3P8C D;  3H1L G;  1HH0 A;  2Q5U A;  1EQ7 A;  2WZ7 A;  1EXJ A;  1LT9 B;  5KLI C;  5AW4 B;  1SQP J;  1FS0 E;  4HKZ H;  5CJ4 A;  3CPW O;  3CX5 I;  1X22 A;  3H1K J;  4AQR D;  2YIU C;  3AEG C;  1L4A B;  2FFD C;  3VYI A;  4PD4 D;  1JB0 J;  1PPJ D;  3A0H H;  4JYC A;  2QJY C;  2ZFC A;  2D2C D;  2IX7 C;  4GIF A;  2Q7C A;  1ZLL A;  1R8E A;  3PP5 A;  4HH2 A;  2Y0C A;  5CCG A;  4ASW A;  4LC1 A;  1FZB A;  1P84 E;  4GKG A;  1NTZ G;  3K5B A;  2OGU A;  1LP1 B;  5KJ7 C;  1YTZ T;  2FYU D;  1K73 Q;  2KSE A;  3FXE A;  1SS1 A;  1BDC A;  1NTM E;  3CCE P;  3W68 A;  1N2D C;  4R4M A;  3BAT A;  3C9I A;  2Y0E A;  4AYC A;  3M0D A;  3VOP A;  3KXD A;  1OIP A;  1MV8 A;  3HTK A;  5APS A;  3RL0 D;  1SVF A;  2QE7 H;  1KB9 I;  5GTI H;  2PFX A;  1JMB A;  3WUV A;  3A2A A;  5APW A;  3VP8 A;  1YJ9 P;  3L36 A;  4IFD K;  2YKP A;  1SQX E;  3II6 A;  2ZXE B;  2FKW B;  4YXD C;  1ZRT E;  1MFZ A;  1VQ6 P;  1L0L K;  1L0L J;  5BVZ A;  3QWO C;  1FAV A;  2A06 G;  3L74 E;  5AVX B;  3WU2 H;  1FZC C;  1P84 H;  3L73 G;  3Q5P A; 
#chains in the Genus database with same CATH homology
 1SFC A;  1XTC C;  3NFQ A;  5AW5 B;  1WRG A;  1FOS F;  2O1K A;  2N1T C;  3N4X A;  3V2R A;  3RK3 C;  3TNU B;  3CI9 A;  2OYI A;  1CI6 B;  2N9B A;  2WT7 B;  5AVY B;  3P32 A;  1M7L A;  3CL3 D;  4W7Y A;  1FZF A;  3TK1 A;  2KB7 P;  3MIW A;  1A02 J;  1GD2 E;  1T3U A;  3A3Y B;  5AVQ B;  1CI6 A;  1FJK A;  3IFM A;  5CCH D;  3HD7 A;  2JEE A;  2N1T D;  1IFM A;  1G1I A;  1LTI C;  1OWA A;  2GUS A;  4DOJ A;  2FYU K;  3L37 A;  4C7N B;  4N3Y B;  1FZG A;  2I1K A;  3WMM 0;  1LTB C;  2L5G B;  2NPS C;  2P7J A;  1GTW A;  1JY3 P;  2XNX A;  1AQ5 A;  3B5N D;  4ZKU A;  1AFO A;  4C7N A;  2M3B A;  1NWQ A;  1HBW A;  3MTU E;  1NAF A;  1LWU C;  3HRN A;  2MJZ A;  2YKO A;  3H32 A;  2PP6 A;  2HG5 D;  1E5W A;  1RE3 A;  2IFN A;  2N1T B;  3MD0 A;  3RK3 B;  1N73 A;  2QM7 A;  1NH4 A;  4RES B;  2KLV A;  1N7S A;  3TYY A;  4M3L A;  5CHX A;  1J1D B;  2XU6 A;  2NPS D;  2FFD B;  3OAK A;  4W7Z A;  1GL2 C;  3P8M C;  1KIL A;  3M0A A;  2POH A;  2KOG A;  1J2J B;  4XE5 B;  1IFJ A;  1T2K D;  3V4Q A;  1JUN A;  3B5N B;  3P8C E;  2Z5I A;  2FFD A;  1MZ9 A;  1M1J A;  2J58 A;  2HLO A;  2OYH C;  1G2C A;  1LT9 C;  4GT1 A;  1KFM A;  1GZL A;  3HE4 A;  5AW6 B;  3B5N A;  1URQ A;  3CLQ A;  3NMD A;  3OJA B;  4LGD E;  2NPS B;  1IFN A;  1RE4 A;  1RF0 C;  1FZA A;  1L4A C;  1FU1 A;  1SLQ A;  1GK4 A;  3GHG B;  4N78 E;  1H89 A;  1LWU B;  4W80 A;  5CCG C;  1YTZ I;  3HE5 B;  1H8A A;  2YMY A;  5BU5 A;  4IFF A;  1HGV A;  1L0N K;  5KJ7 A;  2KP8 A;  3GHG A;  4Y99 C;  2CPB A;  1W2E A;  1GL2 B;  2PAJ A;  1PFI A;  3EQ2 A;  1OXZ A;  5AW9 B;  1LTT C;  1CZQ A;  1NKZ B;  4WY4 C;  1FJP A;  4XA4 A;  1X79 B;  1N7L A;  3RK2 C;  5AW8 B;  1JTH A;  1N7S C;  5APU A;  3UIA A;  2XZR A;  2R3C A;  3A7O A;  3VN0 A;  2OYH B;  1HVV A;  3NTN A;  5AVU B;  3I5C A;  3TNU A;  4HYT B;  4N6J A;  5APT A;  1GW4 A;  1SQP K;  3M0D C;  1DH3 A;  1LTJ B;  2WT7 A;  3V2Q A;  1JCD A;  1A02 F;  3RK3 D;  1ZR4 A;  2WPQ A;  3V4W A;  1Z56 A;  1N86 A;  2VRS A;  3O8Z A;  3RK2 D;  3B8E B;  4I1L A;  2C9L Y;  1LTJ A;  2WPS A;  3HUS C;  3M9H A;  2KYV A;  2H43 A;  2M8R A;  5AW1 B;  1URQ C;  1RF1 B;  1LGH B;  3V2N A;  3T97 A;  1GW3 A;  4Y99 B;  3MUD A;  1FZC B;  3L35 A;  2OAR A;  2HYN A;  3VTP C;  3VMX A;  4EIJ A;  5AVW B;  5APV A;  1J1E C;  1RF1 A;  3KQG A;  1X9V A;  1NOH A;  1NHL A;  3V5B A;  2FYZ A;  3RK2 B;  2J59 M;  1FZC A;  5AVS B;  4ZKP A;  5CCH A;  1SQB K;  2BAS A;  3E1I A;  1G1J A;  3R2P A;  3RL0 C;  2N1T A;  2XV5 A;  1GK6 A;  2R32 A;  3MGN A;  5KTB A;  2H8P D;  4IFM A;  1SFC C;  1WT6 A;  3OA7 A;  2WIT A;  1JCC A;  3HTK B;  3BAS A;  5BU8 B;  4C46 A;  2OYI C;  1NTK K;  4OH8 B;  1YYC A;  2HFE D;  1S9K E;  2WTY A;  1IK9 A;  5KLV K;  1SP4 A;  1GL2 D;  1CW5 A;  2C0W A;  5APX A;  3KDP B;  4DZO A;  2W6B A;  1NTM K;  3M9B A;  3HD7 C;  2XKM A;  1DX7 A;  2W6A A;  3L4F A;  1IFI A;  5APQ A;  2XDJ A;  2R5B A;  1LTG C;  2E43 A;  4LLH A;  1LTS C;  1ZN5 A;  3N7N A;  2NPS A;  4I2L C;  1QL1 A;  1XTG B;  2HOD B;  2Q9I A;  2H7H A;  1KZU B;  3LIE A;  1X8Y A;  4I6M C;  1T8Z A;  1FOS E;  3A5T A;  1LWU A;  1L4A D;  3HD7 D;  1VDF A;  3HE5 A;  2O1J A;  4WBA A;  2O01 H;  4WB4 A;  2GUV A;  4KHX A;  1CSB A;  2HOD A;  1SFC B;  1RY3 A;  2QM8 A;  5AW2 B;  2WWW A;  5CCG D;  1RE3 C;  1ZR2 A;  1NKN A;  2A45 I;  3EFG A;  1N73 C;  1SQQ K;  2IFM A;  1JMM A;  1NU1 K;  1FDM A;  1IJD B;  3P8C D;  1HH0 A;  2Q5U A;  1EQ7 A;  1GL2 A;  2A45 G;  1SQX K;  1GU4 A;  1NO4 A;  2WZ7 A;  1JO5 A;  1JOC A;  1LT9 B;  2WSC H;  5AW4 B;  1S9K D;  2WPR A;  1JY3 N;  4JYB A;  4O9B A;  5CJ4 A;  2C9N Y;  1KIL C;  2P1J A;  5CJ0 A;  5AVV B;  4AQR D;  3U1A A;  1J1D C;  1L4A B;  2OYH A;  3HD7 B;  4WY4 D;  2FFD C;  1LT9 A;  3VYI A;  1M1J C;  2WSF H;  1N7S D;  1SQV K;  4N78 D;  4JYC A;  1LTA C;  1HTL C;  5AVR B;  2ZFC A;  1NTZ K;  3IR9 A;  1RF0 A;  2IX7 C;  3B5N C;  2C0X A;  1L4A A;  1T3J A;  4GIF A;  1KIL D;  2Q7C A;  2WSE H;  1ZLL A;  3V2P A;  1RE4 C;  3PP5 A;  3P7K A;  1H88 A;  4HH2 A;  5AW3 B;  2P67 A;  3M9Q A;  5CCG A;  1ZV8 A;  1MUU A;  2I1J A;  2KSJ A;  3M06 A;  2A45 H;  4LC1 A;  2JJL A;  1FZB A;  1IFD A;  3H32 B;  3LID A;  4GKG A;  1DEB A;  4WY4 B;  1JY3 O;  3LW5 H;  1N73 B;  1KQL A;  1HWT C;  1KFN A;  5KJ7 C;  1N7S B;  1URQ D;  3GHG C;  3SWY A;  2Z5H A;  1YTZ T;  1QL2 A;  3SWF A;  2CPS A;  3U59 A;  1T2K C;  5AVT B;  2Q3I A;  1FZE A;  2Z4E A;  4WY4 A;  1KIL B;  1HGZ A;  5AW7 B;  1JNM A;  3VMZ A;  2IPP A;  3KYQ A;  5AVZ B;  1JY2 N;  2YO3 A;  1N2D C;  3BAT A;  3C9I A;  1M1J B;  4AYC A;  3M0D A;  3VOP A;  2YO2 A;  5KJ7 D;  1MV8 A;  1G2C B;  3HTK A;  5CMZ A;  2R5D A;  5APS A;  2GM4 A;  3RL0 D;  1SVF A;  2HPC B;  3HUS B;  2FXM A;  3HE4 B;  3BVH A;  1SFC D;  1URQ B;  4AUW A;  3TSI A;  1FBM A;  3G3Z A;  3A2A A;  4JF7 A;  2HPC A;  3NXS A;  2P2U A;  1IO4 A;  3HUS A;  5APW A;  1LTJ C;  5AW0 B;  3VP8 A;  3VMY A;  3L36 A;  4IFD K;  5APY A;  2YKP A;  1J1E B;  4EOT A;  3H6P A;  3II6 A;  1IC2 A;  2ZXE B;  2FKW B;  1VPC A;  3BRV B;  3RL0 B;  2LKM A;  1HUC A;  3KPE A;  1JY2 P;  1JY2 O;  1MFZ A;  1GU5 A;  1L0L K;  3U1C A;  3M91 A;  5BVZ A;  1RF1 C;  1FAV A;  2OYI B;  1GDT A;  4C7R A;  3BRT B;  3VP9 A;  2W27 A;  1HJB A;  4B86 A;  2YNY A;  5AVX B;  1FZC C;  2YKQ A;  1JTH B;  2E42 A;  5CCH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...