2CPBA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in dodecylphosphocholine micelles, 25 lowest energy structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M13 MAJOR COAT PROTEIN
molecule tags Viral protein
source organism Enterobacteria phage m13
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpbA00
1HGVA 2C0XA 1HH0A 1NH4A 1FDMA 2CPBA 1HGZA 2CPSA 2C0WA 1IFDA 1IFJA 1IFIA 2MJZA
chains in the Genus database with same CATH superfamily
1JMBA 2H8PD 1LWUC 1N7SB 1FE6A 2FXPA 1IO4A 1BGYJ 1J1EB 2WWWA 4IFMA 2HYNA 2N1TA 3TYYA 1NO4A 3A3YB 3B8EB 4DZOA 2KSEA 1HH0A 3CMAP 1FC2C 1N73C 1HF9A 3P8MC 3TNUA 2W8ZA 4NPEA 1JB0J 4BRYB 2G8YA 4U7JA 2OYHC 3CPWO 1IFIA 3L75D 1URQC 1ZLLA 4EIJA 4XE5B 2Q6QA 5AW8B 1KQSO 2Y0EA 1U7MA 5CCHC 3H32B 4ASVA 2YIUB 3CC2P 4YXWH 1TU3F 2J59M 2ZYDA 3JCUH 1RH5B 1KC8Q 1BDDA 1KYOH 1YYCA 3O8ZA 5AVZB 3Q5RA 1XTCC 1H89A 5AVXB 3RK3C 2H7HA 1LWUA 1H0TB 1SQPJ 3L75E 4H44C 4K35A 4WY4C 5KAFE 3CCSP 2W6AA 1ZV8A 2QJPC 1LTSC 3AE1C 1K04A 1KORA 3I5CA 3PLNA 4H13D 5CCHA 1FZCC 1FDMA 1NTZD 3LW5J 5H2FH 1JMMA 3OA7A 3AEEC 1W2BO 1QVFO 1N7LA 2YMYA 2M3BA 1SQXK 2ZVNB 3C9IA 3H1JJ 3L72G 1GK4A 1L4AD 1PGJA 3H1HG 1AQTA 3I56P 2XKMA 3Q2YA 4OVNF 1OXZA 1DH3A 5CBNA 1KV4A 2OARA 3CCEP 4RO0A 4JQ0D 3VP9A 2P7JA 3S9OA 1SFCC 3WUTA 3A5TA 1EZVE 2A06D 4H0LD 1QLED 1BCCE 4PJ0E 2IFMA 3M9QA 2CPBA 3AECC 1URQB 1URQD 2YO2A 2L5GB 3VOPA 1RHZB 3KHUA 1LTTC 1ZOYC 3R2PA 1SQQG 1KFMA 2FY8A 2M5AB 2WPQA 2O01J 3L73J 2RMZA 3H1JD 5CCGD 5APQA 5L8RJ 1QL1A 2VRSA 1T6AA 2M5AA 3KZIE 3USSA 1LTJC 3NXSA 4NPDA 1S5LH 3ABVC 1OVUA 1N7SD 2R32A 4H44B 4LC1A 1NVOA 3FXDA 3W68A 1PP9J 2CK3H 3LW5H 1URQA 1NTMJ 3VTPC 3L71E 1S3JA 1JNMA 1P84E 2PRRA 5M1BA 1OZHA 2HODB 3B5ND 2YNYA 4D6TE 1AVOA 1GU4A 2DW3A 2ZT9D 1HWTC 1PPJG 1VPCA 4BWNA 1NAFA 5KLVD 2C0WA 2BASA 4I6MC 1T3UA 2YIUC 2A06G 3NMDA 2YKPA 2JEEA 2KZIA 4H0LC 1PPJE 2ZVOB 3AE8C 1RF0A 4ZMDA 4L73A 3T97B 1YTZI 5GTIE 2HPCA 2YKQA 3ITKA 3B5NA 3WUVA 1PP9D 3WU2E 3F89A 3E7KA 1H0TA 1SQQK 1OW8A 2B87B 2K9JA 3TGUJ 1M8OB 1RF1B 1SQXD 4WBAA 4Z1MH 2R5DA 1NYHA 2QJKC 3FWNA 3M9BA 2WSCH 3II6A 1HGZA 2YMKA 5B66E 1SQQD 4HJGH 1AA0A 2NRGA 2KS1B 2XV5A 3B4SA 3GF7A 1L4AA 1EDIA 3SFDC 3FXEA 3HD7A 3AE4C 2KUBA 1NU1E 1BGYG 2AEFA 2FYNC 2JWDA 2WSEJ 2YO3A 4HH2A 2NZ2A 4R4MA 5AVWB 3VN0A 4BRYA 1NJIQ 3AEFC 3RL0C 1EDJA 4K3AA 1FOSE 2Y9YA 1ZR2A 1VQ4P 3HE4B 2FFDB 2WPRA 3A7OA 3CL3D 2XNDH 5TJHA 1KD1Q 1MUUA 2GUVA 1NTMD 2QIWA 2ZAEB 3RGUA 1JM0A 1L0LE 1N2DC 2E75C 2E5YA 3M9HA 4C7RA 3H1KG 1Y47A 3H1IJ 1L0LD 1SVFA 2GUSA 3HD7D 2OYIC 1LTJB 1LTJA 1NTME 1NU1J 1KYOD 1HVVA 3PH0A 3M0DC 1HTLC 3D6ZA 4JYBA 2WMMA 3W67A 2IBZI 3HTKB 1KMIZ 1PGPA 2Q5UA 1E79H 1AVYA 2IDBA 3C1LA 1RF1C 1JUNA 3BRTB 3L72D 5KAIE 1S9KE 5KAFH 4OWFA 1NTMG 4I2LC 2FFDA 1K05A 3L37A 3L74D 1JY2N 3GHGC 4L76A 1S2EA 1R5LA 3H6PA 5KKZC 3Q5PA 1R8EA 1SQQE 1K9MQ 2Z4EA 1VQOP 1ZN5A 2QJYC 1SQXJ 1UIIA 3E1RA 1JY2O 1MZ9A 4PD4I 1L4AB 1J1DC 2HG5D 1ZXGA 1Z56A 2KIKA 4EDFA 1VQNP 1QX8A 5C39A 1BDCA 2D2CD 3AE6C 1RE4A 1IC2A 4LLHA 3AEGC 3HE5B 3TK1A 1PP9E 4H13B 1DX7A 3D70A 3R4YA 2JDIH 2AEMA 2V4HA 4JPZB 2B87A 4B86A 5KJ7D 1JY3O 2QEXP 2P67A 1PPJD 2ZT9B 1GD2E 1KTMA 2HLOA 3B5NB 2BCCE 4O9BA 3V2PA 3M06A 4N78D 1HBWA 2LXBA 1X8YA 1X9VA 2HFED 2WPVB 2W6JH 2IYPA 2R3SA 1JY2P 3MD0A 3V2QA 5B66H 1A02J 1QGKB 2FYNB 2E76B 2XZRA 3A0HE 3HRNA 4D6TD 2KNCA 4UB6H 1NTKE 2KSJA 1CZQA 3Q3DA 1P84D 3BCCD 4DJGA 3L71D 2ZYGA 1AFOA 1YQ4C 3H1JG 3KYQA 1XTGB 2Q7CA 5KLIC 1GL2B 3V5BA 3L70G 3V4QA 3A0BH 3MZWB 3L75G 2B9BA 5GTIH 1X79B 1Q2NA 3H1HJ 5CHXA 2IBZE 3KDPB 3U59A 1RE3C 2CPSA 2QE7H 1HJ0A 2W83C 3L72J 3P32A 1L0ND 1VQKP 3RK3D 3H1JE 3NTNA 2WSFJ 5AVVB 1SQQJ 4NPFX 1CW5A 2KYVA 1FS0E 3PHLA 2JR8A 2N1TD 2QVAA 4H13C 2NPSB 3G3ZA 3GMAA 5APWA 4BXLA 2AXCA 4PV1D 1YTZT 3CWBD 1SQXG 2R3CA 1BCCD 2C0XA 3ZDMA 2K37A 1KB9E 1ZW0A 2GA1A 3B5NC 4DT0A 1EZVD 4JF7A 1FJPA 1MFZA 3MHVA 1Q7YQ 5AW7B 4GODA 3AE2C 5KKZB 4YPCA 1FOSF 5BVZA 3N4XA 2BCCJ 2JP3A 2QJYB 3QH9A 4RESB 3OW2O 1EDKA 3E1IA 2V7QH 4IL6E 1UIXA 1LTIC 1N73B 3CC7P 3CCQP 2B89A 5KTBA 4C7NA 4TT3H 4ZKPA 4WY4A 1KQFB 1J2JB 1SP4A 3O6QA 4IFFA 2Z5IA 1FZCA 1M1JC 1ZP0C 2KK7A 1NU1K 1JEKA 1KILA 2OYOA 2PGDA 4I7ZB 3M0DA 5APUA 5AW2B 3UIAA 3L71G 3KPEA 1T2KD 1JY3P 1KILB 3V2RA 3P8CE 1NTZK 1LWUB 1N7SC 1Y9BA 3K5BA 5AVQB 3O6QB 1DD3A 2IYOA 3RL0D 1Y8AA 2JKVA 4WY4B 2O01N 3H1IG 5E79E 2XDJA 2QJPB 1L0LJ 2P10A 5TISH 1VF5D 1N73A 2YXRB 1IFJA 3RK2B 2KZJA 1IFMA 1S4XA 4JBZA 1OFCX 2I8DA 1T8ZA 1M90Q 5KLVG 3H1IE 3HD7C 3TNUB 2Y0CA 2Y0DA 1KQLA 1WRGA 3U1CA 1SQVD 5GTHE 2WSFH 1OW7A 1P84H 2QM7A 1E5WA 1BE3D 2XU6A 1SFCB 5K5GB 2KOGA 2A45I 4JYCA 1KN7A 1Q81Q 1KB9H 1LNQA 1N7SA 2FYUD 1OVVA 2IX7C 4KJMA 2V7QJ 1YI2P 2FYZA 4D6TJ 1SQPK 1KQGB 1PFIA 1M1JB 3JCUE 1M7LA 3D6YA 1CI6B 1SQBK 1NU1G 1NTKG 1G2CA 3PTZA 5H2FE 2JJLA 3V4WA 2E74B 2JO1A 1LP1B 1S5LE 4HYTB 4YTPC 1GU5A 4WWIA 1EXJA 1L0NE 1NTZG 2FKWB 4GOFA 3VMYA 1GL2A 1SS1A 2IBZD 1SQBD 5E79H 1JO5A 2OTKE 2WVRA 2NPSD 5AW4B 3WMM0 3CX5D 2A45G 1KYOI 3L73E 3MUDC 4PD4D 2FXMA 3H1KD 1QVGO 3AE9C 2FYUK 3H1LG 4WVZA 3EFGA 3GG2A 2M0BA 4M3LA 1VF5C 1NTKD 2Z5HA 3L70J 5CJ4A 3G71P 3BVHA 1BCCJ 5KLVK 1NAYA 3HUSB 1PGOA 2E75D 3BCCJ 3CXHE 3L73G 5KJ7C 3D71A 1AQ5A 2K1AA 5CBOA 3F5HA 1OW6A 1GL2D 4TLFA 2ITAA 3SFEC 1L2PA 2WSEH 4ZNCA 1BGYD 3KQGA 3GW6A 1ZR4A 1AJYA 3EWKA 2E76D 5APYA 5APXA 3H1LD 3TSIA 2R44A 3S4RA 1Q86Q 1M1KQ 1S1CX 1SQVJ 1EQ7A 4GIFA 3A2AA 5KJ7A 1EZVG 2YKOA 3L73D 1IJDB 3MIWA 4YXDC 3CCVP 5CJ0A 1MV8A 1FU1A 1KZUB 3OAKA 2PAJA 3MP7B 4W80A 1G1JA 5DJUB 5APTA 2L91A 1JTHB 1HJBA 3CWBG 3CX5I 3L74E 4OGQB 1OVRA 2WQYC 1BSNA 1X0TA 1LP1A 1SLQA 2BCCG 3HTKA 1T3JA 1K8AQ 3BATA 3KZIH 1PV3A 3L72E 3M91A 1A02F 2R5BA 1SQVK 2IZ0A 3H1HE 4PV1B 2C9LY 1EZVI 2B88A 2QRXA 3CLQA 3VMZA 2I1JA 3AE3C 1FDIA 3L74G 3OJAB 3CD6P 5AW6B 1KYOE 3RBXA 1SQVE 2E74C 2H88C 1FZFA 1JY3N 1FJKA 1NTKJ 1RQVA 1SQPE 3L70D 3L75J 3RK3B 3L70E 4UB6E 1RQUA 3HE4A 2W6BA 4WB4A 2O1JA 5AVYB 1LT9B 1VL2A 4U3FE 1OIPA 1SFCD 2WITA 1YJ9P 4AUWA 4RKUJ 4EYYQ 1LGHB 1USDA 1G1IA 2O1KA 2FYUJ 1MFTA 2UWJE 1M57D 2O01H 3H1HD 3G6EP 3MGNA 2PFXA 3BASA 2KS1A 1JTHA 3PJSK 2KLUA 1DIPA 5APSA 1NU1D 4U3FG 3IF4A 3HUSC 1S5LX 2OQQA 5AW9B 3EFFK 3RK2D 2E42A 2J58A 2ZYAA 2POHA 3FX0A 3VP8A 2OTJP 3GF3A 3V2NA 3CXHH 2E75B 1EC5A 2JWAA 3M0AA 1LT1A 4L75A 1QEXA 1JCCA 3L35A 4WY4D 3LIDA 2OYIB 2W27A 1SQBJ 3KXDA 1FZEA 2G3AA 4D6TG 1FAVA 1K73Q 2O3JA 3CCUP 3FGAD 4PV1C 2HPCB 3B71A 1BE3J 2IPPA 3S1KA 1FZCB 1USEA 4ZKUA 2MKVA 2P58A 2ZT9C 1EXIA 3H1LE 2IZ1A 2WT7A 2WPSA 1FZBA 1L0NJ 4N6JA 1IFDA 3IFMA 1GW3A 3HUSA 4IL6X 1KILE 3GHGB 1NWQA 2E74D 1X22A 4PJ0H 5AVUB 3VMAA 1VQ9P 1R5SA 3JC22 3CCMP 1L0LG 3CXHD 4EI2A 4OGQC 1IK7A 2N9YB 4GKGA 1J1DB 2AEJA 1BSHA 5AW5B 3H1LJ 3BRVB 1VQ5P 3AE5C 2MJZA 1L0NK 1W2EA 5B5EH 4DCKA 2N9BA 5KLIB 1AV1A 1NH4A 1D7MA 3A0HH 4RJTA 2I1KA 3TGUD 2Q3EA 4PD4E 4C46A 2H89C 3H25A 3CX5E 3CCRP 1GZLA 3AEBC 1G2CB 1LTBC 4R4LA 1FZAA 1NOHA 2M3EA 4GDOA 1VQ6P 1M56D 3MTUE 1VQ7P 2RN0A 1YJWP 3AEDC 4Y99B 3CXHI 2D2CC 1RF0C 3TGUE 1LT9C 4U3FJ 2NPSC 2W90A 4H44D 3CMEP 1WMKA 2IFNA 4IFDK 2K88A 2ZJSE 3N7NA 1DEEG 1SFCA 2QJKB 5EFWB 5BU8B 3GLMA 5CCGA 1GK6A 1GL2C 2PP6A 2KNCB 1PP9G 3U1AA 1GW4A 1BE3E 1KILD 3RBZA 1PZQA 1PGQA 5BU5A 2GM4A 4KT0J 3WU2H 3CWBJ 1GTWA 1L0LK 1KB9I 3H1ID 4H0LB 4L74A 3GHGA 3RL0B 3CX5H 2QA4P 3P8CD 1SQPG 3L71J 3CCLP 2WT7B 1RY3A 1JCDA 1L0NG 1NTZE 1SQBG 3P7KA 1NTKK 1YJNP 1VQ8P 2E43A 4OH8B 3AEAC 3HE5A 5CCHD 4ASWA 3CC4P 2OTLP 3G9RA 3H32A 1N8RQ 1RE4C 3WUUA 1OX3A 2E5TA 1NHLA 1BCCG 2Q1KA 3L74J 1IFNA 4AQRD 1HUCA 3SWYA 2ZFCA 1YIJP 2D2CB 2OYIA 1U57A 1FDOA 3CI9A 1OWAA 3FWLA 2IBZG 1S72P 2FYUG 1OMIA 1Q90D 1FBMA 2QG4A 1RF1A 3V6IA 1H8AA 4C7NB 2QSIA 3LIEA 1MKMA 4AYCA 3CCJP 5AW0B 2Q9IA 3SWKA 1IZNB 4A7PA 2N1TB 4QMAA 3QWOC 2FFDC 2WTYA 3NFQA 4U3FD 1GMJA 5AVTB 1CSBA 4GT1A 2AXTE 3MUDA 1H88A 1LJ2A 1L4AC 1SQPD 1LT9A 2SPZA 4W7ZA 5AW3B 1GDTA 4XA4A 3SWFA 4HKZH 5AVRB 2OYHA 1Q82Q 4OGQD 1NTZJ 3EQ2A 1LTGC 2NPSA 3VMXA 1KB9D 1KFNA 1PIXA 3Q5SA 2FXOA 1EDLA 1NKZB 2J5UA 5TISE 3CWBE 5AW1B 4CPGA 3RK2C 1ZRTD 4IOIH 5APVA 1T2KC 1VDFA 1J1EC 5B5EE 3Q1MA 3RK3E 3HD7B 3BCCG 3VYIA 2BEZF 2H43A 2LR2A 5CMZA 1SQXE 2ZXXA 1VQMP 1SQVG 1P84I 3SSUA 2N1TC 1PL5A 2OGUA 2C9NY 4I1LA 1VF5B 2P1JA 2LXCB 5GTHH 3TGUG 3BCCE 2KLVA 2K9JB 2M8RA 3IN6A 2YXQB 4KHXA 1YBKA 2AXTH 4UB8E 1DD4A 4XFJA 4IL6H 4DOJA 2KXPB 1BGYE 2RH0A 4MN4C 2QM8A 2WZ7A 2BEQD 3T97A 1YITP 3TF5A 2K3RA 1RE3A 5AVSB 1ZMEC 2K9YA 2P2UA 2KP8A 2KB7P 3JSVC 2RKLA 4N78E 2A45H 1YHQP 5KLVE 1VQLP 2Y9ZA 1HGVA 2BCCD 3IAOA 3TDKA 2WSCJ 1N86A 1IK9A 1BE3G 4UB8H 2XNXA 3AE7C 3PP5A 3A0BE 2E76C 4N3YB 3I55P 3PRJA 5KLVJ 2HR3A 3H1KE 2HODA 4W7YA 1SQBE 1NTMK 5KAIH 1WT6A 5CCGC 2WSSH 2FBWC 1YQ3C 4Y28J 2LKMA 3L36A 1VQPP 3C8VA 3L4FA 2ZXEB 3H1KJ 1LTAC 2KI7B 4GOEA 1IFPA 1ZRTE 4HB1A 4LGDE 4PD4H 2Q3IA 3G4SP 4EOTA 1FZGA 3IR9A 1NGMB 1JOCA 1NKNA 1S9KD 3RL0g 4Y99C 2OYHB 1U7JA 2A06E 2FYUE 1CI6A 4I7ZC 1DEBA 1QL2A 1W5CE 1M1JA 1KILC 5DJTB
chains in the Genus database with same CATH topology
2H8PD 1LWUC 1N7SB 1IO4A 1J1EB 2WWWA 4IFMA 2HYNA 2N1TA 3TYYA 1NO4A 3A3YB 3B8EB 4DZOA 1HH0A 1N73C 3P8MC 3TNUA 1IFIA 1URQC 1ZLLA 4EIJA 4XE5B 5AW8B 5CCHC 3H32B 2J59M 5AVZB 1YYCA 3O8ZA 1H89A 2H7HA 1XTCC 5AVXB 3RK3C 1LWUA 4WY4C 2W6AA 1ZV8A 4Y99B 1LTSC 3I5CA 5CCHA 2OYHC 1FZCC 1FDMA 1JMMA 3OA7A 1N7LA 2YMYA 2M3BA 1SQXK 3C9IA 3P8CE 1GK4A 1L4AD 2XKMA 1DH3A 1OXZA 2OARA 3VP9A 2P7JA 3A5TA 1SFCC 2IFMA 3M9QA 2CPBA 1URQB 1URQD 2YO2A 2L5GB 3VOPA 1LTTC 3R2PA 1KFMA 2WPQA 5CCGD 5APQA 1QL1A 2VRSA 1LTJC 3NXSA 4LC1A 1N7SD 2R32A 3LW5H 1URQA 3VTPC 1JNMA 2HODB 3B5ND 2YNYA 1GU4A 1VPCA 1NAFA 2C0WA 2BASA 4I6MC 1T3UA 3NMDA 2YKPA 2JEEA 1RF0A 1YTZI 2HPCA 2YKQA 3B5NA 1SQQK 1RF1B 4WBAA 2R5DA 3M9BA 2WSCH 3II6A 1HGZA 1FJPA 2XV5A 1L4AA 3HD7A 2YO3A 5AVWB 4HH2A 3VN0A 3RL0C 1FOSE 1ZR2A 3HE4B 2FFDB 2WPRA 3A7OA 3CL3D 1MUUA 2GUVA 1N2DC 4C7RA 3M9HA 3HD7D 2OYIC 1SVFA 2GUSA 1LTJB 1LTJA 1HVVA 3M0DC 1HTLC 4JYBA 3HTKB 2Q5UA 1RF1C 1JUNA 3BRTB 1S9KE 2FFDA 4I2LC 3L37A 1JY2N 3GHGC 1HWTC 3H6PA 2Z4EA 1ZN5A 1JY2O 1MZ9A 1L4AB 1J1DC 2HG5D 1Z56A 1RE4A 1IC2A 4LLHA 3TK1A 3HE5B 1DX7A 1RF1A 4B86A 1GD2E 5KJ7D 1JY3O 2P67A 2HLOA 3B5NB 4O9BA 3V2PA 3M06A 4N78D 1HBWA 1X8YA 1X9VA 2HFED 3V2QA 3MD0A 1JY2P 1A02J 2XZRA 3HRNA 1GTWA 2KSJA 1CZQA 1AFOA 3KYQA 2Q7CA 1XTGB 3V5BA 1GL2B 3V4QA 1X79B 5CHXA 3U59A 3KDPB 1RE3C 2CPSA 3P32A 3RK3D 3NTNA 1CW5A 5AVVB 2KYVA 2N1TD 2NPSB 3G3ZA 5APWA 1YTZT 2R3CA 2C0XA 3B5NC 4JF7A 1MFZA 5AW7B 1FOSF 5BVZA 3N4XA 4RESB 3E1IA 1LTIC 1N73B 5KTBA 4C7NA 4ZKPA 4WY4A 1J2JB 1SP4A 4IFFA 2Z5IA 1FZCA 1M1JC 1NU1K 1KILA 5APUA 3M0DA 5AW2B 3UIAA 3KPEA 1T2KD 1JY3P 1KILB 3V2RA 1NTZK 1LWUB 1N7SC 5AVQB 3RL0D 4WY4B 2XDJA 1N73A 1IFJA 3RK2B 1IFMA 1T8ZA 3TNUB 3HD7C 1KQLA 1WRGA 3U1CA 2WSFH 2QM7A 1E5WA 2XU6A 1SFCB 2KOGA 2A45I 4JYCA 1N7SA 2IX7C 2FYZA 1SQPK 1PFIA 1M1JB 1M7LA 1CI6B 1SQBK 1G2CA 2JJLA 3V4WA 4HYTB 1GU5A 2FKWB 3VMYA 1GL2A 1JO5A 5AW4B 2NPSD 3WMM0 2A45G 2FXMA 2FYUK 3EFGA 4M3LA 2Z5HA 5CJ4A 3BVHA 5KLVK 3HUSB 1AQ5A 5KJ7C 1GL2D 2WSEH 3KQGA 1ZR4A 5APYA 5APXA 3TSIA 1EQ7A 4GIFA 3A2AA 5KJ7A 2YKOA 3MIWA 1IJDB 5CJ0A 1MV8A 1FU1A 1KZUB 3OAKA 2PAJA 4W80A 5APTA 1G1JA 1JTHB 1HJBA 1SLQA 3HTKA 1T3JA 1A02F 3BATA 3M91A 2R5BA 1SQVK 2C9LY 3CLQA 3VMZA 2I1JA 3OJAB 5AW6B 1FZFA 1JY3N 1FJKA 3RK3B 3HE4A 2W6BA 4WB4A 2O1JA 5AVYB 1LT9B 4AUWA 2WITA 1SFCD 1LGHB 1G1IA 2O1KA 2O01H 3MGNA 3BASA 1JTHA 5APSA 3HUSC 5AW9B 3RK2D 2E42A 2J58A 2POHA 3VP8A 3V2NA 3M0AA 1JCCA 3L35A 4WY4D 3LIDA 2OYIB 2W27A 1FZEA 1FAVA 2HPCB 2IPPA 1FZCB 4ZKUA 2WT7A 2WPSA 1FZBA 4N6JA 1IFDA 3IFMA 1GW3A 3HUSA 1NWQA 3GHGB 5AVUB 4GKGA 1J1DB 5AW5B 3BRVB 2MJZA 1L0NK 1W2EA 2N9BA 1NH4A 2I1KA 4C46A 1GZLA 1G2CB 1LTBC 1FZAA 1NOHA 3MTUE 1H88A 1RF0C 1LT9C 2NPSC 2IFNA 4IFDK 3N7NA 1SFCA 5BU8B 5CCGA 1GK6A 1GL2C 2PP6A 3U1AA 1GW4A 1KILD 5BU5A 2GM4A 1L0LK 3GHGA 3RL0B 3P8CD 2WT7B 1JCDA 1RY3A 3P7KA 1NTKK 2E43A 4OH8B 3HE5A 5CCHD 3H32A 1RE4C 1NHLA 1IFNA 4AQRD 1HUCA 3SWYA 2ZFCA 2OYIA 3CI9A 1OWAA 1FBMA 1H8AA 4C7NB 3LIEA 4AYCA 5AW0B 2Q9IA 2N1TB 2FFDC 2WTYA 3NFQA 5AVTB 1CSBA 4GT1A 3MUDA 1L4AC 1LT9A 4W7ZA 5AW3B 1GDTA 4XA4A 3SWFA 2OYHA 5AVRB 3EQ2A 1LTGC 2NPSA 3VMXA 1KFNA 1NKZB 5AW1B 3RK2C 5APVA 1T2KC 1VDFA 1J1EC 3HD7B 3VYIA 2H43A 5CMZA 2N1TC 2C9NY 4I1LA 2P1JA 2KLVA 2M8RA 4KHXA 4DOJA 2QM8A 2WZ7A 3T97A 1RE3A 5AVSB 2P2UA 2KP8A 2KB7P 4N78E 2A45H 1HGVA 1N86A 1IK9A 2XNXA 3PP5A 4N3YB 2HODA 4W7YA 1NTMK 1WT6A 5CCGC 2LKMA 3L36A 3L4FA 2ZXEB 1LTAC 4LGDE 4EOTA 2Q3IA 1FZGA 3IR9A 1JOCA 1NKNA 1S9KD 4Y99C 2OYHB 1CI6A 1DEBA 1QL2A 1M1JA 1KILC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGV A;  2C0X A;  1HH0 A;  1NH4 A;  1FDM A;  2CPB A;  1HGZ A;  2CPS A;  2C0W A;  1IFD A;  1IFJ A;  1IFI A;  2MJZ A; 
#chains in the Genus database with same CATH topology
 1JMB A;  2H8P D;  1LWU C;  1N7S B;  1FE6 A;  2FXP A;  1IO4 A;  1BGY J;  1J1E B;  2WWW A;  4IFM A;  2HYN A;  2N1T A;  3TYY A;  1NO4 A;  3A3Y B;  3B8E B;  4DZO A;  2KSE A;  1HH0 A;  3CMA P;  1FC2 C;  1N73 C;  1HF9 A;  3P8M C;  3TNU A;  2W8Z A;  4NPE A;  1JB0 J;  4BRY B;  2G8Y A;  4U7J A;  2OYH C;  3CPW O;  1IFI A;  3L75 D;  1URQ C;  1ZLL A;  4EIJ A;  4XE5 B;  2Q6Q A;  5AW8 B;  1KQS O;  2Y0E A;  1U7M A;  5CCH C;  3H32 B;  4ASV A;  2YIU B;  3CC2 P;  4YXW H;  1TU3 F;  2J59 M;  2ZYD A;  3JCU H;  1RH5 B;  1KC8 Q;  1BDD A;  1KYO H;  1YYC A;  3O8Z A;  5AVZ B;  3Q5R A;  1XTC C;  1H89 A;  5AVX B;  3RK3 C;  2H7H A;  1LWU A;  1H0T B;  1SQP J;  3L75 E;  4H44 C;  4K35 A;  4WY4 C;  5KAF E;  3CCS P;  2W6A A;  1ZV8 A;  2QJP C;  1LTS C;  3AE1 C;  1K04 A;  1KOR A;  3I5C A;  3PLN A;  4H13 D;  5CCH A;  1FZC C;  1FDM A;  1NTZ D;  3LW5 J;  5H2F H;  1JMM A;  3OA7 A;  3AEE C;  1W2B O;  1QVF O;  1N7L A;  2YMY A;  2M3B A;  1SQX K;  2ZVN B;  3C9I A;  3H1J J;  3L72 G;  1GK4 A;  1L4A D;  1PGJ A;  3H1H G;  1AQT A;  3I56 P;  2XKM A;  3Q2Y A;  4OVN F;  1OXZ A;  1DH3 A;  5CBN A;  1KV4 A;  2OAR A;  3CCE P;  4RO0 A;  4JQ0 D;  3VP9 A;  2P7J A;  3S9O A;  1SFC C;  3WUT A;  3A5T A;  1EZV E;  2A06 D;  4H0L D;  1QLE D;  1BCC E;  4PJ0 E;  2IFM A;  3M9Q A;  2CPB A;  3AEC C;  1URQ B;  1URQ D;  2YO2 A;  2L5G B;  3VOP A;  1RHZ B;  3KHU A;  1LTT C;  1ZOY C;  3R2P A;  1SQQ G;  1KFM A;  2FY8 A;  2M5A B;  2WPQ A;  2O01 J;  3L73 J;  2RMZ A;  3H1J D;  5CCG D;  5APQ A;  5L8R J;  1QL1 A;  2VRS A;  1T6A A;  2M5A A;  3KZI E;  3USS A;  1LTJ C;  3NXS A;  4NPD A;  1S5L H;  3ABV C;  1OVU A;  1N7S D;  2R32 A;  4H44 B;  4LC1 A;  1NVO A;  3FXD A;  3W68 A;  1PP9 J;  2CK3 H;  3LW5 H;  1URQ A;  1NTM J;  3VTP C;  3L71 E;  1S3J A;  1JNM A;  1P84 E;  2PRR A;  5M1B A;  1OZH A;  2HOD B;  3B5N D;  2YNY A;  4D6T E;  1AVO A;  1GU4 A;  2DW3 A;  2ZT9 D;  1HWT C;  1PPJ G;  1VPC A;  4BWN A;  1NAF A;  5KLV D;  2C0W A;  2BAS A;  4I6M C;  1T3U A;  2YIU C;  2A06 G;  3NMD A;  2YKP A;  2JEE A;  2KZI A;  4H0L C;  1PPJ E;  2ZVO B;  3AE8 C;  1RF0 A;  4ZMD A;  4L73 A;  3T97 B;  1YTZ I;  5GTI E;  2HPC A;  2YKQ A;  3ITK A;  3B5N A;  3WUV A;  1PP9 D;  3WU2 E;  3F89 A;  3E7K A;  1H0T A;  1SQQ K;  1OW8 A;  2B87 B;  2K9J A;  3TGU J;  1M8O B;  1RF1 B;  1SQX D;  4WBA A;  4Z1M H;  2R5D A;  1NYH A;  2QJK C;  3FWN A;  3M9B A;  2WSC H;  3II6 A;  1HGZ A;  2YMK A;  5B66 E;  1SQQ D;  4HJG H;  1AA0 A;  2NRG A;  2KS1 B;  2XV5 A;  3B4S A;  3GF7 A;  1L4A A;  1EDI A;  3SFD C;  3FXE A;  3HD7 A;  3AE4 C;  2KUB A;  1NU1 E;  1BGY G;  2AEF A;  2FYN C;  2JWD A;  2WSE J;  2YO3 A;  4HH2 A;  2NZ2 A;  4R4M A;  5AVW B;  3VN0 A;  4BRY A;  1NJI Q;  3AEF C;  3RL0 C;  1EDJ A;  4K3A A;  1FOS E;  2Y9Y A;  1ZR2 A;  1VQ4 P;  3HE4 B;  2FFD B;  2WPR A;  3A7O A;  3CL3 D;  2XND H;  5TJH A;  1KD1 Q;  1MUU A;  2GUV A;  1NTM D;  2QIW A;  2ZAE B;  3RGU A;  1JM0 A;  1L0L E;  1N2D C;  2E75 C;  2E5Y A;  3M9H A;  4C7R A;  3H1K G;  1Y47 A;  3H1I J;  1L0L D;  1SVF A;  2GUS A;  3HD7 D;  2OYI C;  1LTJ B;  1LTJ A;  1NTM E;  1NU1 J;  1KYO D;  1HVV A;  3PH0 A;  3M0D C;  1HTL C;  3D6Z A;  4JYB A;  2WMM A;  3W67 A;  2IBZ I;  3HTK B;  1KMI Z;  1PGP A;  2Q5U A;  1E79 H;  1AVY A;  2IDB A;  3C1L A;  1RF1 C;  1JUN A;  3BRT B;  3L72 D;  5KAI E;  1S9K E;  5KAF H;  4OWF A;  1NTM G;  4I2L C;  2FFD A;  1K05 A;  3L37 A;  3L74 D;  1JY2 N;  3GHG C;  4L76 A;  1S2E A;  1R5L A;  3H6P A;  5KKZ C;  3Q5P A;  1R8E A;  1SQQ E;  1K9M Q;  2Z4E A;  1VQO P;  1ZN5 A;  2QJY C;  1SQX J;  1UII A;  3E1R A;  1JY2 O;  1MZ9 A;  4PD4 I;  1L4A B;  1J1D C;  2HG5 D;  1ZXG A;  1Z56 A;  2KIK A;  4EDF A;  1VQN P;  1QX8 A;  5C39 A;  1BDC A;  2D2C D;  3AE6 C;  1RE4 A;  1IC2 A;  4LLH A;  3AEG C;  3HE5 B;  3TK1 A;  1PP9 E;  4H13 B;  1DX7 A;  3D70 A;  3R4Y A;  2JDI H;  2AEM A;  2V4H A;  4JPZ B;  2B87 A;  4B86 A;  5KJ7 D;  1JY3 O;  2QEX P;  2P67 A;  1PPJ D;  2ZT9 B;  1GD2 E;  1KTM A;  2HLO A;  3B5N B;  2BCC E;  4O9B A;  3V2P A;  3M06 A;  4N78 D;  1HBW A;  2LXB A;  1X8Y A;  1X9V A;  2HFE D;  2WPV B;  2W6J H;  2IYP A;  2R3S A;  1JY2 P;  3MD0 A;  3V2Q A;  5B66 H;  1A02 J;  1QGK B;  2FYN B;  2E76 B;  2XZR A;  3A0H E;  3HRN A;  4D6T D;  2KNC A;  4UB6 H;  1NTK E;  2KSJ A;  1CZQ A;  3Q3D A;  1P84 D;  3BCC D;  4DJG A;  3L71 D;  2ZYG A;  1AFO A;  1YQ4 C;  3H1J G;  3KYQ A;  1XTG B;  2Q7C A;  5KLI C;  1GL2 B;  3V5B A;  3L70 G;  3V4Q A;  3A0B H;  3MZW B;  3L75 G;  2B9B A;  5GTI H;  1X79 B;  1Q2N A;  3H1H J;  5CHX A;  2IBZ E;  3KDP B;  3U59 A;  1RE3 C;  2CPS A;  2QE7 H;  1HJ0 A;  2W83 C;  3L72 J;  3P32 A;  1L0N D;  1VQK P;  3RK3 D;  3H1J E;  3NTN A;  2WSF J;  5AVV B;  1SQQ J;  4NPF X;  1CW5 A;  2KYV A;  1FS0 E;  3PHL A;  2JR8 A;  2N1T D;  2QVA A;  4H13 C;  2NPS B;  3G3Z A;  3GMA A;  5APW A;  4BXL A;  2AXC A;  4PV1 D;  1YTZ T;  3CWB D;  1SQX G;  2R3C A;  1BCC D;  2C0X A;  3ZDM A;  2K37 A;  1KB9 E;  1ZW0 A;  2GA1 A;  3B5N C;  4DT0 A;  1EZV D;  4JF7 A;  1FJP A;  1MFZ A;  3MHV A;  1Q7Y Q;  5AW7 B;  4GOD A;  3AE2 C;  5KKZ B;  4YPC A;  1FOS F;  5BVZ A;  3N4X A;  2BCC J;  2JP3 A;  2QJY B;  3QH9 A;  4RES B;  3OW2 O;  1EDK A;  3E1I A;  2V7Q H;  4IL6 E;  1UIX A;  1LTI C;  1N73 B;  3CC7 P;  3CCQ P;  2B89 A;  5KTB A;  4C7N A;  4TT3 H;  4ZKP A;  4WY4 A;  1KQF B;  1J2J B;  1SP4 A;  3O6Q A;  4IFF A;  2Z5I A;  1FZC A;  1M1J C;  1ZP0 C;  2KK7 A;  1NU1 K;  1JEK A;  1KIL A;  2OYO A;  2PGD A;  4I7Z B;  3M0D A;  5APU A;  5AW2 B;  3UIA A;  3L71 G;  3KPE A;  1T2K D;  1JY3 P;  1KIL B;  3V2R A;  3P8C E;  1NTZ K;  1LWU B;  1N7S C;  1Y9B A;  3K5B A;  5AVQ B;  3O6Q B;  1DD3 A;  2IYO A;  3RL0 D;  1Y8A A;  2JKV A;  4WY4 B;  2O01 N;  3H1I G;  5E79 E;  2XDJ A;  2QJP B;  1L0L J;  2P10 A;  5TIS H;  1VF5 D;  1N73 A;  2YXR B;  1IFJ A;  3RK2 B;  2KZJ A;  1IFM A;  1S4X A;  4JBZ A;  1OFC X;  2I8D A;  1T8Z A;  1M90 Q;  5KLV G;  3H1I E;  3HD7 C;  3TNU B;  2Y0C A;  2Y0D A;  1KQL A;  1WRG A;  3U1C A;  1SQV D;  5GTH E;  2WSF H;  1OW7 A;  1P84 H;  2QM7 A;  1E5W A;  1BE3 D;  2XU6 A;  1SFC B;  5K5G B;  2KOG A;  2A45 I;  4JYC A;  1KN7 A;  1Q81 Q;  1KB9 H;  1LNQ A;  1N7S A;  2FYU D;  1OVV A;  2IX7 C;  4KJM A;  2V7Q J;  1YI2 P;  2FYZ A;  4D6T J;  1SQP K;  1KQG B;  1PFI A;  1M1J B;  3JCU E;  1M7L A;  3D6Y A;  1CI6 B;  1SQB K;  1NU1 G;  1NTK G;  1G2C A;  3PTZ A;  5H2F E;  2JJL A;  3V4W A;  2E74 B;  2JO1 A;  1LP1 B;  1S5L E;  4HYT B;  4YTP C;  1GU5 A;  4WWI A;  1EXJ A;  1L0N E;  1NTZ G;  2FKW B;  4GOF A;  3VMY A;  1GL2 A;  1SS1 A;  2IBZ D;  1SQB D;  5E79 H;  1JO5 A;  2OTK E;  2WVR A;  2NPS D;  5AW4 B;  3WMM 0;  3CX5 D;  2A45 G;  1KYO I;  3L73 E;  3MUD C;  4PD4 D;  2FXM A;  3H1K D;  1QVG O;  3AE9 C;  2FYU K;  3H1L G;  4WVZ A;  3EFG A;  3GG2 A;  2M0B A;  4M3L A;  1VF5 C;  1NTK D;  2Z5H A;  3L70 J;  5CJ4 A;  3G71 P;  3BVH A;  1BCC J;  5KLV K;  1NAY A;  3HUS B;  1PGO A;  2E75 D;  3BCC J;  3CXH E;  3L73 G;  5KJ7 C;  3D71 A;  1AQ5 A;  2K1A A;  5CBO A;  3F5H A;  1OW6 A;  1GL2 D;  4TLF A;  2ITA A;  3SFE C;  1L2P A;  2WSE H;  4ZNC A;  1BGY D;  3KQG A;  3GW6 A;  1ZR4 A;  1AJY A;  3EWK A;  2E76 D;  5APY A;  5APX A;  3H1L D;  3TSI A;  2R44 A;  3S4R A;  1Q86 Q;  1M1K Q;  1S1C X;  1SQV J;  1EQ7 A;  4GIF A;  3A2A A;  5KJ7 A;  1EZV G;  2YKO A;  3L73 D;  1IJD B;  3MIW A;  4YXD C;  3CCV P;  5CJ0 A;  1MV8 A;  1FU1 A;  1KZU B;  3OAK A;  2PAJ A;  3MP7 B;  4W80 A;  1G1J A;  5DJU B;  5APT A;  2L91 A;  1JTH B;  1HJB A;  3CWB G;  3CX5 I;  3L74 E;  4OGQ B;  1OVR A;  2WQY C;  1BSN A;  1X0T A;  1LP1 A;  1SLQ A;  2BCC G;  3HTK A;  1T3J A;  1K8A Q;  3BAT A;  3KZI H;  1PV3 A;  3L72 E;  3M91 A;  1A02 F;  2R5B A;  1SQV K;  2IZ0 A;  3H1H E;  4PV1 B;  2C9L Y;  1EZV I;  2B88 A;  2QRX A;  3CLQ A;  3VMZ A;  2I1J A;  3AE3 C;  1FDI A;  3L74 G;  3OJA B;  3CD6 P;  5AW6 B;  1KYO E;  3RBX A;  1SQV E;  2E74 C;  2H88 C;  1FZF A;  1JY3 N;  1FJK A;  1NTK J;  1RQV A;  1SQP E;  3L70 D;  3L75 J;  3RK3 B;  3L70 E;  4UB6 E;  1RQU A;  3HE4 A;  2W6B A;  4WB4 A;  2O1J A;  5AVY B;  1LT9 B;  1VL2 A;  4U3F E;  1OIP A;  1SFC D;  2WIT A;  1YJ9 P;  4AUW A;  4RKU J;  4EYY Q;  1LGH B;  1USD A;  1G1I A;  2O1K A;  2FYU J;  1MFT A;  2UWJ E;  1M57 D;  2O01 H;  3H1H D;  3G6E P;  3MGN A;  2PFX A;  3BAS A;  2KS1 A;  1JTH A;  3PJS K;  2KLU A;  1DIP A;  5APS A;  1NU1 D;  4U3F G;  3IF4 A;  3HUS C;  1S5L X;  2OQQ A;  5AW9 B;  3EFF K;  3RK2 D;  2E42 A;  2J58 A;  2ZYA A;  2POH A;  3FX0 A;  3VP8 A;  2OTJ P;  3GF3 A;  3V2N A;  3CXH H;  2E75 B;  1EC5 A;  2JWA A;  3M0A A;  1LT1 A;  4L75 A;  1QEX A;  1JCC A;  3L35 A;  4WY4 D;  3LID A;  2OYI B;  2W27 A;  1SQB J;  3KXD A;  1FZE A;  2G3A A;  4D6T G;  1FAV A;  1K73 Q;  2O3J A;  3CCU P;  3FGA D;  4PV1 C;  2HPC B;  3B71 A;  1BE3 J;  2IPP A;  3S1K A;  1FZC B;  1USE A;  4ZKU A;  2MKV A;  2P58 A;  2ZT9 C;  1EXI A;  3H1L E;  2IZ1 A;  2WT7 A;  2WPS A;  1FZB A;  1L0N J;  4N6J A;  1IFD A;  3IFM A;  1GW3 A;  3HUS A;  4IL6 X;  1KIL E;  3GHG B;  1NWQ A;  2E74 D;  1X22 A;  4PJ0 H;  5AVU B;  3VMA A;  1VQ9 P;  1R5S A;  3JC2 2;  3CCM P;  1L0L G;  3CXH D;  4EI2 A;  4OGQ C;  1IK7 A;  2N9Y B;  4GKG A;  1J1D B;  2AEJ A;  1BSH A;  5AW5 B;  3H1L J;  3BRV B;  1VQ5 P;  3AE5 C;  2MJZ A;  1L0N K;  1W2E A;  5B5E H;  4DCK A;  2N9B A;  5KLI B;  1AV1 A;  1NH4 A;  1D7M A;  3A0H H;  4RJT A;  2I1K A;  3TGU D;  2Q3E A;  4PD4 E;  4C46 A;  2H89 C;  3H25 A;  3CX5 E;  3CCR P;  1GZL A;  3AEB C;  1G2C B;  1LTB C;  4R4L A;  1FZA A;  1NOH A;  2M3E A;  4GDO A;  1VQ6 P;  1M56 D;  3MTU E;  1VQ7 P;  2RN0 A;  1YJW P;  3AED C;  4Y99 B;  3CXH I;  2D2C C;  1RF0 C;  3TGU E;  1LT9 C;  4U3F J;  2NPS C;  2W90 A;  4H44 D;  3CME P;  1WMK A;  2IFN A;  4IFD K;  2K88 A;  2ZJS E;  3N7N A;  1DEE G;  1SFC A;  2QJK B;  5EFW B;  5BU8 B;  3GLM A;  5CCG A;  1GK6 A;  1GL2 C;  2PP6 A;  2KNC B;  1PP9 G;  3U1A A;  1GW4 A;  1BE3 E;  1KIL D;  3RBZ A;  1PZQ A;  1PGQ A;  5BU5 A;  2GM4 A;  4KT0 J;  3WU2 H;  3CWB J;  1GTW A;  1L0L K;  1KB9 I;  3H1I D;  4H0L B;  4L74 A;  3GHG A;  3RL0 B;  3CX5 H;  2QA4 P;  3P8C D;  1SQP G;  3L71 J;  3CCL P;  2WT7 B;  1RY3 A;  1JCD A;  1L0N G;  1NTZ E;  1SQB G;  3P7K A;  1NTK K;  1YJN P;  1VQ8 P;  2E43 A;  4OH8 B;  3AEA C;  3HE5 A;  5CCH D;  4ASW A;  3CC4 P;  2OTL P;  3G9R A;  3H32 A;  1N8R Q;  1RE4 C;  3WUU A;  1OX3 A;  2E5T A;  1NHL A;  1BCC G;  2Q1K A;  3L74 J;  1IFN A;  4AQR D;  1HUC A;  3SWY A;  2ZFC A;  1YIJ P;  2D2C B;  2OYI A;  1U57 A;  1FDO A;  3CI9 A;  1OWA A;  3FWL A;  2IBZ G;  1S72 P;  2FYU G;  1OMI A;  1Q90 D;  1FBM A;  2QG4 A;  1RF1 A;  3V6I A;  1H8A A;  4C7N B;  2QSI A;  3LIE A;  1MKM A;  4AYC A;  3CCJ P;  5AW0 B;  2Q9I A;  3SWK A;  1IZN B;  4A7P A;  2N1T B;  4QMA A;  3QWO C;  2FFD C;  2WTY A;  3NFQ A;  4U3F D;  1GMJ A;  5AVT B;  1CSB A;  4GT1 A;  2AXT E;  3MUD A;  1H88 A;  1LJ2 A;  1L4A C;  1SQP D;  1LT9 A;  2SPZ A;  4W7Z A;  5AW3 B;  1GDT A;  4XA4 A;  3SWF A;  4HKZ H;  5AVR B;  2OYH A;  1Q82 Q;  4OGQ D;  1NTZ J;  3EQ2 A;  1LTG C;  2NPS A;  3VMX A;  1KB9 D;  1KFN A;  1PIX A;  3Q5S A;  2FXO A;  1EDL A;  1NKZ B;  2J5U A;  5TIS E;  3CWB E;  5AW1 B;  4CPG A;  3RK2 C;  1ZRT D;  4IOI H;  5APV A;  1T2K C;  1VDF A;  1J1E C;  5B5E E;  3Q1M A;  3RK3 E;  3HD7 B;  3BCC G;  3VYI A;  2BEZ F;  2H43 A;  2LR2 A;  5CMZ A;  1SQX E;  2ZXX A;  1VQM P;  1SQV G;  1P84 I;  3SSU A;  2N1T C;  1PL5 A;  2OGU A;  2C9N Y;  4I1L A;  1VF5 B;  2P1J A;  2LXC B;  5GTH H;  3TGU G;  3BCC E;  2KLV A;  2K9J B;  2M8R A;  3IN6 A;  2YXQ B;  4KHX A;  1YBK A;  2AXT H;  4UB8 E;  1DD4 A;  4XFJ A;  4IL6 H;  4DOJ A;  2KXP B;  1BGY E;  2RH0 A;  4MN4 C;  2QM8 A;  2WZ7 A;  2BEQ D;  3T97 A;  1YIT P;  3TF5 A;  2K3R A;  1RE3 A;  5AVS B;  1ZME C;  2K9Y A;  2P2U A;  2KP8 A;  2KB7 P;  3JSV C;  2RKL A;  4N78 E;  2A45 H;  1YHQ P;  5KLV E;  1VQL P;  2Y9Z A;  1HGV A;  2BCC D;  3IAO A;  3TDK A;  2WSC J;  1N86 A;  1IK9 A;  1BE3 G;  4UB8 H;  2XNX A;  3AE7 C;  3PP5 A;  3A0B E;  2E76 C;  4N3Y B;  3I55 P;  3PRJ A;  5KLV J;  2HR3 A;  3H1K E;  2HOD A;  4W7Y A;  1SQB E;  1NTM K;  5KAI H;  1WT6 A;  5CCG C;  2WSS H;  2FBW C;  1YQ3 C;  4Y28 J;  2LKM A;  3L36 A;  1VQP P;  3C8V A;  3L4F A;  2ZXE B;  3H1K J;  1LTA C;  2KI7 B;  4GOE A;  1IFP A;  1ZRT E;  4HB1 A;  4LGD E;  4PD4 H;  2Q3I A;  3G4S P;  4EOT A;  1FZG A;  3IR9 A;  1NGM B;  1JOC A;  1NKN A;  1S9K D;  3RL0 g;  4Y99 C;  2OYH B;  1U7J A;  2A06 E;  2FYU E;  1CI6 A;  4I7Z C;  1DEB A;  1QL2 A;  1W5C E;  1M1J A;  1KIL C;  5DJT B; 
#chains in the Genus database with same CATH homology
 2H8P D;  1LWU C;  1N7S B;  1IO4 A;  1J1E B;  2WWW A;  4IFM A;  2HYN A;  2N1T A;  3TYY A;  1NO4 A;  3A3Y B;  3B8E B;  4DZO A;  1HH0 A;  1N73 C;  3P8M C;  3TNU A;  1IFI A;  1URQ C;  1ZLL A;  4EIJ A;  4XE5 B;  5AW8 B;  5CCH C;  3H32 B;  2J59 M;  5AVZ B;  1YYC A;  3O8Z A;  1H89 A;  2H7H A;  1XTC C;  5AVX B;  3RK3 C;  1LWU A;  4WY4 C;  2W6A A;  1ZV8 A;  4Y99 B;  1LTS C;  3I5C A;  5CCH A;  2OYH C;  1FZC C;  1FDM A;  1JMM A;  3OA7 A;  1N7L A;  2YMY A;  2M3B A;  1SQX K;  3C9I A;  3P8C E;  1GK4 A;  1L4A D;  2XKM A;  1DH3 A;  1OXZ A;  2OAR A;  3VP9 A;  2P7J A;  3A5T A;  1SFC C;  2IFM A;  3M9Q A;  2CPB A;  1URQ B;  1URQ D;  2YO2 A;  2L5G B;  3VOP A;  1LTT C;  3R2P A;  1KFM A;  2WPQ A;  5CCG D;  5APQ A;  1QL1 A;  2VRS A;  1LTJ C;  3NXS A;  4LC1 A;  1N7S D;  2R32 A;  3LW5 H;  1URQ A;  3VTP C;  1JNM A;  2HOD B;  3B5N D;  2YNY A;  1GU4 A;  1VPC A;  1NAF A;  2C0W A;  2BAS A;  4I6M C;  1T3U A;  3NMD A;  2YKP A;  2JEE A;  1RF0 A;  1YTZ I;  2HPC A;  2YKQ A;  3B5N A;  1SQQ K;  1RF1 B;  4WBA A;  2R5D A;  3M9B A;  2WSC H;  3II6 A;  1HGZ A;  1FJP A;  2XV5 A;  1L4A A;  3HD7 A;  2YO3 A;  5AVW B;  4HH2 A;  3VN0 A;  3RL0 C;  1FOS E;  1ZR2 A;  3HE4 B;  2FFD B;  2WPR A;  3A7O A;  3CL3 D;  1MUU A;  2GUV A;  1N2D C;  4C7R A;  3M9H A;  3HD7 D;  2OYI C;  1SVF A;  2GUS A;  1LTJ B;  1LTJ A;  1HVV A;  3M0D C;  1HTL C;  4JYB A;  3HTK B;  2Q5U A;  1RF1 C;  1JUN A;  3BRT B;  1S9K E;  2FFD A;  4I2L C;  3L37 A;  1JY2 N;  3GHG C;  1HWT C;  3H6P A;  2Z4E A;  1ZN5 A;  1JY2 O;  1MZ9 A;  1L4A B;  1J1D C;  2HG5 D;  1Z56 A;  1RE4 A;  1IC2 A;  4LLH A;  3TK1 A;  3HE5 B;  1DX7 A;  1RF1 A;  4B86 A;  1GD2 E;  5KJ7 D;  1JY3 O;  2P67 A;  2HLO A;  3B5N B;  4O9B A;  3V2P A;  3M06 A;  4N78 D;  1HBW A;  1X8Y A;  1X9V A;  2HFE D;  3V2Q A;  3MD0 A;  1JY2 P;  1A02 J;  2XZR A;  3HRN A;  1GTW A;  2KSJ A;  1CZQ A;  1AFO A;  3KYQ A;  2Q7C A;  1XTG B;  3V5B A;  1GL2 B;  3V4Q A;  1X79 B;  5CHX A;  3U59 A;  3KDP B;  1RE3 C;  2CPS A;  3P32 A;  3RK3 D;  3NTN A;  1CW5 A;  5AVV B;  2KYV A;  2N1T D;  2NPS B;  3G3Z A;  5APW A;  1YTZ T;  2R3C A;  2C0X A;  3B5N C;  4JF7 A;  1MFZ A;  5AW7 B;  1FOS F;  5BVZ A;  3N4X A;  4RES B;  3E1I A;  1LTI C;  1N73 B;  5KTB A;  4C7N A;  4ZKP A;  4WY4 A;  1J2J B;  1SP4 A;  4IFF A;  2Z5I A;  1FZC A;  1M1J C;  1NU1 K;  1KIL A;  5APU A;  3M0D A;  5AW2 B;  3UIA A;  3KPE A;  1T2K D;  1JY3 P;  1KIL B;  3V2R A;  1NTZ K;  1LWU B;  1N7S C;  5AVQ B;  3RL0 D;  4WY4 B;  2XDJ A;  1N73 A;  1IFJ A;  3RK2 B;  1IFM A;  1T8Z A;  3TNU B;  3HD7 C;  1KQL A;  1WRG A;  3U1C A;  2WSF H;  2QM7 A;  1E5W A;  2XU6 A;  1SFC B;  2KOG A;  2A45 I;  4JYC A;  1N7S A;  2IX7 C;  2FYZ A;  1SQP K;  1PFI A;  1M1J B;  1M7L A;  1CI6 B;  1SQB K;  1G2C A;  2JJL A;  3V4W A;  4HYT B;  1GU5 A;  2FKW B;  3VMY A;  1GL2 A;  1JO5 A;  5AW4 B;  2NPS D;  3WMM 0;  2A45 G;  2FXM A;  2FYU K;  3EFG A;  4M3L A;  2Z5H A;  5CJ4 A;  3BVH A;  5KLV K;  3HUS B;  1AQ5 A;  5KJ7 C;  1GL2 D;  2WSE H;  3KQG A;  1ZR4 A;  5APY A;  5APX A;  3TSI A;  1EQ7 A;  4GIF A;  3A2A A;  5KJ7 A;  2YKO A;  3MIW A;  1IJD B;  5CJ0 A;  1MV8 A;  1FU1 A;  1KZU B;  3OAK A;  2PAJ A;  4W80 A;  5APT A;  1G1J A;  1JTH B;  1HJB A;  1SLQ A;  3HTK A;  1T3J A;  1A02 F;  3BAT A;  3M91 A;  2R5B A;  1SQV K;  2C9L Y;  3CLQ A;  3VMZ A;  2I1J A;  3OJA B;  5AW6 B;  1FZF A;  1JY3 N;  1FJK A;  3RK3 B;  3HE4 A;  2W6B A;  4WB4 A;  2O1J A;  5AVY B;  1LT9 B;  4AUW A;  2WIT A;  1SFC D;  1LGH B;  1G1I A;  2O1K A;  2O01 H;  3MGN A;  3BAS A;  1JTH A;  5APS A;  3HUS C;  5AW9 B;  3RK2 D;  2E42 A;  2J58 A;  2POH A;  3VP8 A;  3V2N A;  3M0A A;  1JCC A;  3L35 A;  4WY4 D;  3LID A;  2OYI B;  2W27 A;  1FZE A;  1FAV A;  2HPC B;  2IPP A;  1FZC B;  4ZKU A;  2WT7 A;  2WPS A;  1FZB A;  4N6J A;  1IFD A;  3IFM A;  1GW3 A;  3HUS A;  1NWQ A;  3GHG B;  5AVU B;  4GKG A;  1J1D B;  5AW5 B;  3BRV B;  2MJZ A;  1L0N K;  1W2E A;  2N9B A;  1NH4 A;  2I1K A;  4C46 A;  1GZL A;  1G2C B;  1LTB C;  1FZA A;  1NOH A;  3MTU E;  1H88 A;  1RF0 C;  1LT9 C;  2NPS C;  2IFN A;  4IFD K;  3N7N A;  1SFC A;  5BU8 B;  5CCG A;  1GK6 A;  1GL2 C;  2PP6 A;  3U1A A;  1GW4 A;  1KIL D;  5BU5 A;  2GM4 A;  1L0L K;  3GHG A;  3RL0 B;  3P8C D;  2WT7 B;  1JCD A;  1RY3 A;  3P7K A;  1NTK K;  2E43 A;  4OH8 B;  3HE5 A;  5CCH D;  3H32 A;  1RE4 C;  1NHL A;  1IFN A;  4AQR D;  1HUC A;  3SWY A;  2ZFC A;  2OYI A;  3CI9 A;  1OWA A;  1FBM A;  1H8A A;  4C7N B;  3LIE A;  4AYC A;  5AW0 B;  2Q9I A;  2N1T B;  2FFD C;  2WTY A;  3NFQ A;  5AVT B;  1CSB A;  4GT1 A;  3MUD A;  1L4A C;  1LT9 A;  4W7Z A;  5AW3 B;  1GDT A;  4XA4 A;  3SWF A;  2OYH A;  5AVR B;  3EQ2 A;  1LTG C;  2NPS A;  3VMX A;  1KFN A;  1NKZ B;  5AW1 B;  3RK2 C;  5APV A;  1T2K C;  1VDF A;  1J1E C;  3HD7 B;  3VYI A;  2H43 A;  5CMZ A;  2N1T C;  2C9N Y;  4I1L A;  2P1J A;  2KLV A;  2M8R A;  4KHX A;  4DOJ A;  2QM8 A;  2WZ7 A;  3T97 A;  1RE3 A;  5AVS B;  2P2U A;  2KP8 A;  2KB7 P;  4N78 E;  2A45 H;  1HGV A;  1N86 A;  1IK9 A;  2XNX A;  3PP5 A;  4N3Y B;  2HOD A;  4W7Y A;  1NTM K;  1WT6 A;  5CCG C;  2LKM A;  3L36 A;  3L4F A;  2ZXE B;  1LTA C;  4LGD E;  4EOT A;  2Q3I A;  1FZG A;  3IR9 A;  1JOC A;  1NKN A;  1S9K D;  4Y99 C;  2OYH B;  1CI6 A;  1DEB A;  1QL2 A;  1M1J A;  1KIL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...