2CPBA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in dodecylphosphocholine micelles, 25 lowest energy structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M13 MAJOR COAT PROTEIN
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpbA00
2MJZA 2C0WA 1IFIA 1IFDA 1HGZA 1HGVA 1HH0A 2C0XA 2CPBA 1FDMA 1NH4A 2CPSA 1IFJA
chains in the Genus database with same CATH superfamily
1W5CE 1UIIA 4DCKA 5APQA 1SQVE 3B5ND 1ZXGA 1P84I 1ZW0A 3BATA 5KLVG 3OJAB 5K5GB 2YKQA 2HODB 4IOIH 3GHGC 3HE5B 2QJKC 2OYHA 1AV1A 1S4XA 3H1JE 1EZVE 2FYZA 3OA7A 2L91A 2KZJA 5CJ4A 2E5TA 4Y99B 1LT9B 2WPSA 1T6AA 4U3FD 1FZCC 2ITAA 1BCCJ 1NTZE 2FYNB 2NPSB 3C8VA 1AVYA 3Q3DA 4ASVA 3V2RA 1R8EA 4UB6E 3LW5H 2WQYC 1A02J 3HTKA 2KLVA 1L0NJ 3O6QB 1FOSE 3CCSP 2IX7C 5APWA 1JMMA 1VF5B 2JKVA 3NXSA 3KZIE 3H1LJ 2PFXA 1JOCA 1HGVA 2XKMA 1BDDA 2JWDA 2FXMA 1S9KE 3H1LG 1JY3N 1USEA 4JYCA 1SQXE 3T97B 1SFCB 2FXOA 4TT3H 3H1KG 2IBZD 1URQA 1JTHB 1WT6A 3I55P 2RMZA 3M9QA 2N9YB 4H0LB 3G71P 1Q81Q 1RE3C 1Y9BA 3MGNA 1OW8A 1S72P 1SQPE 5GTHH 2ZJSE 4AUWA 2HPCB 1KMIZ 3H32A 2QG4A 3S9OA 5KKZC 2BCCG 1TU3F 3AE1C 4W7ZA 2N9BA 5DJUB 1RQUA 1MFTA 3WUUA 4DT0A 4BRYB 1YIJP 3RL0B 3CX5E 2B89A 5BU8B 1YHQP 1WRGA 3C1LA 3QWOC 3W67A 1LTJC 1GL2C 2BEZF 1EDIA 1KILB 3H1HD 1EDJA 1XTGB 1N73C 1PP9E 5B66H 3L75D 2C0WA 1MUUA 3S1KA 2ZVNB 3W68A 3L71D 1SVFA 2B87A 2KP8A 4B86A 3MD0A 1R5SA 3B5NB 2R32A 1N2DC 1PGJA 1A02F 1Q90D 2KYVA 4I2LC 1BSHA 1NTZK 1SQQK 1QGKB 1LTAC 1VPCA 2MJZA 3HD7C 4D6TD 3FGAD 1Q2NA 3HUSA 4GODA 2A45G 2XV5A 3A7OA 2HFED 2P10A 1BGYD 2K88A 3MUDC 3CLQA 4OVNF 5TISE 1YBKA 2YNYA 1GW4A 3L4FA 2HODA 3A5TA 3TK1A 3CCUP 3CCLP 1NU1J 2JEEA 4LC1A 2FYUJ 3HE4B 3VTPC 1NTMD 4I6MC 1EDLA 4K35A 1EXIA 2R3CA 2J58A 1YJ9P 3L36A 3A0HH 4OGQD 4PD4I 3V2QA 4EOTA 4UB8H 3L72G 1SQQD 3VYIA 3M0DA 1JY2P 1M1JB 4XA4A 5GTIE 5AW5B 3BCCG 2OTJP 4PJ0H 3L70E 1AQ5A 1PPJG 3P8CE 2GUSA 1AFOA 2L5GB 2R5BA 1SQBJ 2V7QH 2KNCB 3JC22 2QE7H 2WSFJ 5KLIC 1J1DB 1OXZA 4W7YA 1KORA 2HLOA 5B5EH 2WSEH 3RK2C 4WVZA 3NTNA 1SFCA 3B8EB 1AQTA 3C9IA 3CMAP 1KILE 2H89C 3SWKA 1H0TA 1DH3A 2AXCA 3L74D 4IFDK 1LWUC 1DEEG 3RK3B 3PHLA 4IL6X 3O8ZA 4C7NA 1T2KC 1FDOA 4PV1C 1L0NK 2XDJA 3TF5A 2HPCA 1K9MQ 3H25A 5KLVD 3M0AA 1FJPA 5KAIH 3R4YA 4IL6E 1RE4A 2GUVA 2E76C 4H13C 3N7NA 2FYUE 4L74A 3TGUE 3H1IG 4O9BA 4MN4C 3LIDA 2W6JH 1KN7A 4U3FE 5APXA 3SFEC 1YI2P 3WU2H 1BCCD 3PP5A 2KSJA 1YTZI 2QJYB 2ZAEB 3VMXA 1L4AC 3CWBJ 1E79H 3CC4P 1BE3J 1N7SC 2HG5D 5APUA 3BRTB 3TNUB 2XZRA 1RF0C 4PJ0E 2WMMA 3KPEA 3FX0A 1OVVA 1MKMA 1JCDA 5AW3B 1NTKJ 1GK6A 3AE9C 1KB9D 1EXJA 1RHZB 1JY2N 3CPWO 3CCEP 2WSCJ 3L73G 2Y9YA 3G6EP 4DOJA 3H1LD 2KZIA 1SQVJ 4C7RA 4GKGA 4BXLA 3VP9A 2KOGA 3H1KD 1SS1A 2K9JB 1BGYG 4H44B 1ZRTE 2R44A 2N1TB 4OH8B 5L8RJ 5AVUB 1SQVG 2OYHC 2BEQD 2IBZE 1KYOD 5AVXB 1QL1A 5AVQB 1GL2D 1YITP 4KHXA 2AXTH 3M9HA 2M0BA 2RN0A 2ZXEB 3H1JG 1EZVG 2KS1B 1GTWA 3AE8C 3MIWA 1JNMA 1AA0A 1M56D 1S5LH 2XU6A 3AEAC 3S4RA 4PD4D 2FXPA 1NTZG 4XFJA 5KAIE 3AEDC 3RK3E 4EI2A 3KHUA 1VQNP 1M1JA 1L0LJ 1PV3A 3GHGB 1D7MA 3PH0A 2QJKB 3HD7D 3R2PA 2B9BA 3LIEA 4KJMA 4JQ0D 3V6IA 2H88C 3PTZA 2IYOA 1Y8AA 1FZAA 1PFIA 3WUTA 2OYIA 1URQC 1SQXJ 3JCUH 2YMKA 1OW7A 1W2BO 3AEGC 1BE3E 3L71E 1NU1K 1XTCC 4GDOA 3P8MC 2FYUK 3GMAA 2UWJE 3AEEC 2AEJA 1DX7A 2WITA 2YKOA 4R4LA 4DZOA 1G1JA 3A3YB 1SQPJ 2OTKE 1VQ8P 4GOFA 1MFZA 4DJGA 4D6TE 4KT0J 4EIJA 1X22A 2AEMA 1HF9A 3VOPA 1P84E 2YIUC 1M1KQ 1BDCA 2O01J 2AXTE 2YMYA 2KXPB 2O1KA 3P32A 1SQBK 3FXEA 1S2EA 2YO2A 1LNQA 3EWKA 4Z1MH 3KDPB 3AEFC 2WT7A 3RBZA 2FFDA 1EC5A 1ZV8A 1JMBA 1PP9J 1BCCG 3IF4A 1OVUA 3L72D 3RK2D 1VQ4P 1FBMA 3LW5J 2P1JA 3H6PA 2LXBA 3GF3A 5KKZB 1YQ4C 3NMDA 3BCCD 4LGDE 1L0LE 5AVZB 1JUNA 1L0NG 1NHLA 1FC2C 2Q3IA 2ZT9C 1IFMA 2JJLA 4TLFA 3D71A 1PPJD 3IFMA 4R4MA 1QEXA 3TNUA 1PL5A 3USSA 3CCRP 1T2KD 5CCGC 3II6A 3A0BH 1FOSF 4PV1D 3HUSC 2KIKA 3Q5RA 4N78D 1KB9H 1LTJB 1GL2B 3JCUE 2R5DA 3V5BA 4ZKPA 2LR2A 2K9JA 4RJTA 2E76D 4H13D 2N1TA 3CC2P 1QLED 4ZKUA 1VQKP 1KYOH 2W6BA 2Y0DA 1AJYA 1VQOP 5APVA 4HB1A 2J59M 4IFMA 2NRGA 2FYNC 1L4AD 2KS1A 3MTUE 3HD7B 3M0DC 2W90A 2WSSH 3CI9A 3AE7C 1VQ5P 1JO5A 3GLMA 1FE6A 4WY4A 2A06G 3WMM0 4WB4A 1N7SD 3PJSK 4PD4H 1NWQA 5TJHA 1RF1B 4QMAA 1NTKK 3GF7A 5AVWB 3V4QA 2QRXA 1VQMP 1OMIA 5AW4B 5H2FH 3H1ID 3L70J 1IJDB 2KK7A 4BWNA 1SQVK 1VF5C 3FWLA 1CI6B 1IK9A 1J1EC 1LJ2A 2P7JA 2CK3H 1ZR4A 1N8RQ 2Q5UA 1PGOA 1FZGA 3PLNA 4AQRD 2Q7CA 2YXRB 2O1JA 3RBXA 1KB9I 3A0BE 3L73D 2JDIH 1NTKD 3Q2YA 3VMYA 3I5CA 4U7JA 1NGMB 2A45H 4A7PA 2QVAA 2P58A 1SQVD 3H1KE 5E79H 1FDMA 1L0LK 4WBAA 1PGQA 1KYOI 5KLIB 1QVGO 3BRVB 1VQ6P 3HE5A 1KYOE 1GU4A 5GTHE 4NPDA 2RKLA 3H1JD 3TGUJ 1EZVD 1LT9A 2P2UA 1LWUB 1NU1G 4U3FJ 1SQXK 2FYUG 1URQD 3TGUG 2NPSA 1NTZD 5DJTB 2BCCE 3WUVA 4PD4E 3CXHD 4PV1B 2M8RA 3O6QA 2QJPC 1SQPK 2J5UA 4K3AA 5H2FE 1HJ0A 1PZQA 1OVRA 2JWAA 2RH0A 1OX3A 2V7QJ 2E76B 5B66E 2K37A 3MHVA 1S3JA 4C46A 1DD4A 1IFDA 1SQBG 1KQFB 4NPFX 4L76A 3IR9A 2QIWA 1S9KD 1GW3A 1NOHA 1T3JA 2WSEJ 3T97A 1H88A 4HJGH 1ZOYC 2JO1A 1K8AQ 1JTHA 2Q6QA 2KI7B 1L4AB 1U7MA 2YO3A 3CC7P 3ZDMA 1N7SB 3IN6A 4EYYQ 1CZQA 2A45I 1MZ9A 1NAFA 1NKZB 4EDFA 3AE2C 2KB7P 2HR3A 3Q1MA 2LKMA 2CPBA 5AW0B 1RH5B 2GM4A 5KJ7A 1H89A 1OFCX 2ZT9D 3VP8A 1M1JC 4BRYA 5CCGD 1RF1A 1IFNA 2M5AB 3CX5D 5AVTB 1VL2A 1OW6A 3CL3D 3A0HE 2Y9ZA 1KILA 3H1HJ 1K05A 4UB8E 5CCHA 3U1AA 2E74C 1NVOA 2OYIC 2Z5HA 1SP4A 1LT1A 3D70A 1KC8Q 2SPZA 3M9BA 3L72E 5CMZA 3L75J 3V4WA 1X8YA 1VQ7P 3L71J 1L0ND 3HTKB 3CWBG 1NH4A 5APTA 3G3ZA 2PGDA 3BCCE 3KQGA 2HYNA 3B5NA 4RKUJ 2K1AA 3U1CA 1BE3G 1IFIA 3AEBC 5AW9B 4HKZH 1PPJE 1JB0J 2WPRA 3SFDC 3RK3C 1NTKG 1K04A 2IYPA 1S1CX 1H8AA 5APSA 4D6TJ 5CBOA 5B5EE 2C0XA 3BASA 2CPSA 1ZLLA 2DW3A 1URQB 4OGQB 2MKVA 1CSBA 1VQ9P 1NJIQ 1VF5D 1KFMA 3VMAA 1VDFA 1RQVA 1DIPA 3VMZA 4JYBA 2FFDC 2P67A 1ZP0C 3AECC 3HE4A 1EDKA 1NTMJ 1YTZT 1LWUA 3JSVC 2A06D 3H32B 3GG2A 2QJYC 3TSIA 1KFNA 1IFPA 3AE3C 2M3BA 1NAYA 1LTSC 3CXHH 3V2PA 3RL0g 1J2JB 2YIUB 3MZWB 2V4HA 3H1IE 1L0LG 3WU2E 3H1HE 4JF7A 1FZCB 3V2NA 5AVSB 3M91A 1NKNA 1HJBA 3SWFA 2KNCA 1LTGC 3L75E 1HTLC 2D2CC 1IO4A 4H44C 2N1TC 1SQXG 2B87B 1JY3O 1HUCA 3OW2O 3L74J 2ZT9B 2M3EA 2WWWA 2IFNA 2W6AA 3EQ2A 3L73E 1SQPG 3CD6P 4WY4C 1KQLA 1FU1A 5AW7B 1U57A 2WTYA 5KAFH 1G2CB 3U59A 2H43A 1BGYE 2Q1KA 1ZR2A 1S5LX 5KLVJ 3SWYA 1QL2A 5C39A 1FZBA 1X9VA 1EZVI 1NU1D 1S5LE 4W80A 2M5AA 1HVVA 2Y0EA 3CX5H 1NTME 2FYUD 2OYOA 2O01H 2LXCB 3TGUD 1YQ3C 3E7KA 3K5BA 3CCQP 3CXHI 2H8PD 2E75C 1PP9G 1IZNB 4I7ZC 1SQQE 5AW2B 3L35A 3HRNA 3CXHE 3EFFK 2POHA 1KTMA 1W2EA 3OAKA 1NO4A 2WPQA 2Z5IA 3F5HA 1KD1Q 5EFWB 1M8OB 2B88A 1K73Q 2W83C 1SQBD 3E1IA 3RGUA 1N73B 1KZUB 3GW6A 2IFMA 1ZN5A 3E1RA 1J1EB 2WVRA 3H1KJ 1NYHA 2ZVOB 3PRJA 1ZRTD 2K3RA 3AE5C 3KYQA 3L74E 4Y99C 1LT9C 5TISH 1H0TB 1Q86Q 2E74D 1OZHA 4HYTB 1JM0A 1QVFO 2NPSC 2IPPA 3P7KA 4C7NB 2QM7A 2GA1A 5KAFE 2BCCJ 2XNDH 5KLVE 2QM8A 2NZ2A 4Y28J 2OARA 1Z56A 3D6YA 3G4SP 3A2AA 2YKPA 3CX5I 3RK3D 2R3SA 3GHGA 5BU5A 5GTIH 4YXWH 3N4XA 3L70G 3IAOA 2E5YA 1BCCE 4YPCA 2PAJA 1FZCA 3UIAA 1SFCC 2H7HA 2FKWB 2C9NY 1DD3A 3CWBD 4GOEA 4H0LC 1USDA 5AVVB 4ZNCA 1FS0E 1L0NE 1BE3D 2G8YA 2W8ZA 2KLUA 1E5WA 2QJPB 1NTMK 1N7LA 1KB9E 1RY3A 2OGUA 3BVHA 4N6JA 1YJNP 1M90Q 2KUBA 3H1LE 1U7JA 5CBNA 1FZFA 5KJ7C 5CCGA 2ZYGA 4L73A 1LP1B 2I1JA 1T3UA 1RE4C 4RO0A 2IZ1A 1G2CA 4YXDC 3RL0C 4ZMDA 3CCVP 1P84D 2ZYAA 1RF1C 1GK4A 3RK2B 3AE4C 1IK7A 2ZXXA 3B71A 1EQ7A 2E43A 1KILC 3VN0A 4IL6H 1RE3A 5CCHC 2Q3EA 2D2CD 3TYYA 3CCJP 2WPVB 1GMJA 3I56P 4U3FG 2JP3A 4H44D 1IC2A 4IFFA 2N1TD 2VRSA 3B4SA 2A06E 3L72J 5AVYB 3B5NC 1PGPA 1WMKA 1HBWA 3BCCJ 2OQQA 1VQLP 2FBWC 1L0LD 1G1IA 2G3AA 4H13B 5CJ0A 4WY4D 5KLVK 1L2PA 1LTJA 1GL2A 4OWFA 1N73A 1JY2O 1M7LA 1JCCA 2E74B 2OYIB 1SQXD 2WSFH 2Y0CA 1FZEA 4JBZA 1PIXA 1OWAA 2Z4EA 2IBZG 5AW6B 4WWIA 2I1KA 1CW5A 1YYCA 1MV8A 2QA4P 1SQPD 2E75D 1VQPP 2K9YA 5BVZA 2Q9IA 1LGHB 5E79E 2OTLP 2QEXP 3ITKA 3HD7A 2YXQB 1X79B 2XNXA 2OYHB 1OIPA 3MUDA 4JPZB 1LTTC 1N86A 1DEBA 3L37A 3H1IJ 1HH0A 3M06A 2KSEA 1NU1E 1M57D 1CI6A 2WT7B 1FDIA 1GD2E 3NFQA 2FFDB 1YJWP 3ABVC 1PP9D 3EFGA 1J1DC 4GT1A 3H1HG 3FXDA 5AW8B 3TDKA 1KV4A 2PRRA 3KXDA 4LLHA 5APYA 3L75G 4HH2A 3AE6C 3L71G 5KTBA 2NPSD 4L75A 1R5LA 4I1LA 1ZMEC 4N78E 1GU5A 2C9LY 3L73J 1LTBC 2IZ0A 3QH9A 2ZFCA 1SLQA 1SQBE 1IFJA 1Y47A 1KQSO 3Q5SA 1KQGB 2WSCH 4D6TG 1Q7YQ 1BGYJ 5CHXA 2BASA 2WZ7A 1JEKA 1LP1A 2D2CB 2IBZI 1T8ZA 2O01N 1P84H 1BSNA 4AYCA 2QSIA 2O3JA 1AVOA 3H1JJ 2AEFA 5M1BA 4ASWA 1SFCD 3CCMP 1FAVA 4N3YB 1NTMG 1NTZJ 1Q82Q 4YTPC 1LTIC 1SQQJ 4H0LD 2IDBA 2E42A 2BCCD 4WY4B 5AW1B 4UB6H 1SQQG 2PP6A 1FJKA 3SSUA 5AVRB 1UIXA 3L70D 4NPEA 1JY3P 3P8CD 2ZYDA 4RESB 5KJ7D 3KZIH 3D6ZA 1X0TA 3MP7B 1HGZA 3RL0D 4XE5B 1GDTA 2FY8A 3Q5PA 2I8DA 2E75B 4I7ZB 3CWBE 3G9RA 4OGQC 1HWTC 1L4AA 1KILD 4CPGA 3CMEP 1GZLA 4M3LA 5CCHD 1N7SA 3F89A 1RF0A 1NTKE 4GIFA 3L74G 3HUSB 2W27A 3FWNA 2JR8A 1QX8A
chains in the Genus database with same CATH topology
2OARA 1JCDA 5AW3B 1SQPK 1GK6A 1Z56A 5APQA 1JY2N 3B5ND 3A2AA 2YKPA 4DOJA 3BATA 3RK3D 4C7RA 3OJAB 4GKGA 3GHGA 2YKQA 3VP9A 5BU5A 2HODB 2KOGA 3GHGC 4C46A 3N4XA 3HE5B 2N1TB 4OH8B 2OYHA 1IFDA 5AVUB 2OYHC 2FYZA 3OA7A 3IR9A 5CJ4A 2PAJA 1S9KD 4Y99B 1FZCA 1GW3A 1NOHA 1LT9B 1T3JA 3T97A 2WPSA 5AVXB 1H88A 3UIAA 1QL1A 5AVQB 1FZCC 1GL2D 1SFCC 2H7HA 4KHXA 2FKWB 1JTHA 2C9NY 1L4AB 2NPSB 3M9HA 2YO3A 2ZXEB 5AVVB 1GTWA 1N7SB 3V2RA 3MIWA 1JNMA 1CZQA 2A45I 1MZ9A 1NAFA 3LW5H 2XU6A 1NKZB 1A02J 1E5WA 3HTKA 2KLVA 1NTMK 1N7LA 1FOSE 2KB7P 1RY3A 3BVHA 4N6JA 2LKMA 2IX7C 5APWA 2CPBA 5AW0B 2GM4A 5KJ7A 1FZFA 1H89A 1JMMA 1M1JA 5KJ7C 3NXSA 3VP8A 5CCGA 1M1JC 3GHGB 1JOCA 2I1JA 1T3UA 3HD7D 1RE4C 3R2PA 1HGVA 2XKMA 5CCGD 1G2CA 1RF1A 3RL0C 3LIEA 2FXMA 1IFNA 1S9KE 1RF1C 1GK4A 3RK2B 5AVTB 1JY3N 4JYCA 1SFCB 1FZAA 1PFIA 3CL3D 1URQA 1KILA 1EQ7A 1JTHB 2OYIA 1WT6A 1URQC 2E43A 5CCHA 1KILC 3U1AA 2OYIC 2Z5HA 3M9QA 3VN0A 1RE3A 5CCHC 1SP4A 3M9BA 1RE3C 3TYYA 5CMZA 1NU1K 3V4WA 1XTCC 1IC2A 3P8MC 4IFFA 2N1TD 1X8YA 3MGNA 2FYUK 2VRSA 3HTKB 1NH4A 1DX7A 5APTA 2WITA 2YKOA 3G3ZA 3KQGA 4AUWA 2HPCB 2HYNA 4DZOA 3B5NA 1G1JA 3A3YB 5AVYB 3U1CA 3B5NC 3H32A 1IFIA 5AW9B 1HBWA 2WPRA 1MFZA 4W7ZA 3RK3C 4EIJA 1G1IA 2N9BA 3VOPA 1H8AA 5CJ0A 5APSA 3RL0B 4WY4D 5BU8B 2C0XA 1WRGA 5KLVK 3BASA 1LTJA 1GL2A 1LTJC 2YMYA 1N73A 1GL2C 1JY2O 2CPSA 1ZLLA 2O1KA 3P32A 1SQBK 1URQB 1KILB 1M7LA 1JCCA 1XTGB 1N73C 2OYIB 2YO2A 1CSBA 2WSFH 3KDPB 2WT7A 1FZEA 1KFMA 1OWAA 1VDFA 2FFDA 2C0WA 3VMZA 1MUUA 4JYBA 2Z4EA 1ZV8A 2FFDC 5AW6B 2P67A 1SVFA 3HE4A 2KP8A 3RK2D 1FBMA 2I1KA 4B86A 1CW5A 2P1JA 1YTZT 3H6PA 1YYCA 3MD0A 1LWUA 1MV8A 3B5NB 2R32A 1N2DC 3H32B 3NMDA 4LGDE 5BVZA 1A02F 3TSIA 2Q9IA 5AVZB 1JUNA 1LGHB 2KYVA 2Q3IA 1NHLA 1KFNA 1NTZK 4I2LC 1IFMA 2M3BA 2JJLA 1SQQK 1LTSC 3HD7A 3IFMA 1LTAC 1VPCA 3V2PA 1X79B 3TNUA 1J2JB 2MJZA 3HD7C 3HUSA 1T2KD 2XNXA 5CCGC 3II6A 2A45G 2XV5A 3A7OA 1FOSF 2HFED 3HUSC 2OYHB 4N78D 1LTJB 3MUDA 1GL2B 4JF7A 3CLQA 1FZCB 1LTTC 1N86A 1DEBA 3V2NA 5AVSB 3M91A 3L37A 1NKNA 2R5DA 1HJBA 3SWFA 1HH0A 3V5BA 1LTGC 2YNYA 4ZKPA 3M06A 1GW4A 3L4FA 2HODA 1CI6A 2WT7B 3A5TA 1GD2E 1HTLC 3TK1A 3NFQA 2N1TA 2FFDB 1IO4A 3EFGA 2N1TC 2JEEA 1J1DC 4ZKUA 4GT1A 4LC1A 3HE4B 3VTPC 5AW8B 2W6BA 1JY3O 4I6MC 4LLHA 5APYA 2R3CA 2J58A 4HH2A 5APVA 3L36A 1HUCA 2J59M 4IFMA 3V2QA 4EOTA 5KTBA 3VYIA 2WWWA 2IFNA 2W6AA 1L4AD 3M0DA 3MTUE 1JY2P 2NPSD 1M1JB 3EQ2A 3HD7B 4XA4A 3M0DC 3CI9A 1JO5A 4WY4A 4I1LA 5AW5B 3WMM0 4WB4A 1N7SD 4WY4C 1KQLA 4N78E 1GU5A 1NWQA 2C9LY 1FU1A 5AW7B 1LTBC 2WTYA 1G2CB 3U59A 2H43A 2ZFCA 1SLQA 1RF1B 1NTKK 1ZR2A 5AVWB 1AQ5A 3V4QA 1IFJA 3P8CE 2GUSA 2WSCH 1AFOA 5AW4B 3SWYA 2L5GB 5CHXA 2BASA 1QL2A 1IJDB 2R5BA 2WZ7A 1FZBA 1X9VA 1SQVK 1CI6B 1T8ZA 1IK9A 1J1EC 1J1DB 1OXZA 2P7JA 4W7YA 4W80A 1HVVA 1ZR4A 2O01H 2HLOA 4AYCA 2WSEH 3RK2C 3NTNA 1SFCA 3B8EB 3C9IA 2Q5UA 2H8PD 1SFCD 1DH3A 1FZGA 4IFDK 1LWUC 5AW2B 3L35A 3HRNA 4AQRD 2Q7CA 2POHA 1FAVA 4N3YB 3RK3B 1W2EA 1LTIC 3OAKA 2O1JA 2E42A 4WY4B 3O8ZA 5AW1B 4C7NA 1T2KC 1NO4A 1L0NK 2XDJA 2WPQA 2Z5IA 2HPCA 2PP6A 3VMYA 3I5CA 1FJKA 5AVRB 2A45H 3E1IA 3M0AA 1JY3P 1N73B 1KZUB 3P8CD 1FJPA 2IFMA 1FDMA 1RE4A 1L0LK 1ZN5A 4RESB 4WBAA 5KJ7D 1J1EB 2GUVA 3BRVB 3N7NA 3HE5A 1GU4A 1HGZA 4O9BA 3RL0D 4XE5B 3LIDA 1GDTA 5APXA 3KYQA 1LT9A 4Y99C 2P2UA 1LT9C 1LWUB 3PP5A 1HWTC 2KSJA 1SQXK 1YTZI 1URQD 1L4AA 1KILD 3VMXA 4HYTB 2NPSA 1GZLA 4M3LA 1L4AC 5CCHD 2NPSC 1N7SA 2IPPA 3P7KA 1RF0A 1N7SC 4GIFA 2HG5D 2M8RA 2QM7A 5APUA 3BRTB 3TNUB 4C7NB 2XZRA 1RF0C 3HUSB 2W27A 3KPEA 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  2C0W A;  1IFI A;  1IFD A;  1HGZ A;  1HGV A;  1HH0 A;  2C0X A;  2CPB A;  1FDM A;  1NH4 A;  2CPS A;  1IFJ A; 
#chains in the Genus database with same CATH topology
 1W5C E;  1UII A;  4DCK A;  5APQ A;  1SQV E;  3B5N D;  1ZXG A;  1P84 I;  1ZW0 A;  3BAT A;  5KLV G;  3OJA B;  5K5G B;  2YKQ A;  2HOD B;  4IOI H;  3GHG C;  3HE5 B;  2QJK C;  2OYH A;  1AV1 A;  1S4X A;  3H1J E;  1EZV E;  2FYZ A;  3OA7 A;  2L91 A;  2KZJ A;  5CJ4 A;  2E5T A;  4Y99 B;  1LT9 B;  2WPS A;  1T6A A;  4U3F D;  1FZC C;  2ITA A;  1BCC J;  1NTZ E;  2FYN B;  2NPS B;  3C8V A;  1AVY A;  3Q3D A;  4ASV A;  3V2R A;  1R8E A;  4UB6 E;  3LW5 H;  2WQY C;  1A02 J;  3HTK A;  2KLV A;  1L0N J;  3O6Q B;  1FOS E;  3CCS P;  2IX7 C;  5APW A;  1JMM A;  1VF5 B;  2JKV A;  3NXS A;  3KZI E;  3H1L J;  2PFX A;  1JOC A;  1HGV A;  2XKM A;  1BDD A;  2JWD A;  2FXM A;  1S9K E;  3H1L G;  1JY3 N;  1USE A;  4JYC A;  1SQX E;  3T97 B;  1SFC B;  2FXO A;  4TT3 H;  3H1K G;  2IBZ D;  1URQ A;  1JTH B;  1WT6 A;  3I55 P;  2RMZ A;  3M9Q A;  2N9Y B;  4H0L B;  3G71 P;  1Q81 Q;  1RE3 C;  1Y9B A;  3MGN A;  1OW8 A;  1S72 P;  1SQP E;  5GTH H;  2ZJS E;  4AUW A;  2HPC B;  1KMI Z;  3H32 A;  2QG4 A;  3S9O A;  5KKZ C;  2BCC G;  1TU3 F;  3AE1 C;  4W7Z A;  2N9B A;  5DJU B;  1RQU A;  1MFT A;  3WUU A;  4DT0 A;  4BRY B;  1YIJ P;  3RL0 B;  3CX5 E;  2B89 A;  5BU8 B;  1YHQ P;  1WRG A;  3C1L A;  3QWO C;  3W67 A;  1LTJ C;  1GL2 C;  2BEZ F;  1EDI A;  1KIL B;  3H1H D;  1EDJ A;  1XTG B;  1N73 C;  1PP9 E;  5B66 H;  3L75 D;  2C0W A;  1MUU A;  3S1K A;  2ZVN B;  3W68 A;  3L71 D;  1SVF A;  2B87 A;  2KP8 A;  4B86 A;  3MD0 A;  1R5S A;  3B5N B;  2R32 A;  1N2D C;  1PGJ A;  1A02 F;  1Q90 D;  2KYV A;  4I2L C;  1BSH A;  1NTZ K;  1SQQ K;  1QGK B;  1LTA C;  1VPC A;  2MJZ A;  3HD7 C;  4D6T D;  3FGA D;  1Q2N A;  3HUS A;  4GOD A;  2A45 G;  2XV5 A;  3A7O A;  2HFE D;  2P10 A;  1BGY D;  2K88 A;  3MUD C;  3CLQ A;  4OVN F;  5TIS E;  1YBK A;  2YNY A;  1GW4 A;  3L4F A;  2HOD A;  3A5T A;  3TK1 A;  3CCU P;  3CCL P;  1NU1 J;  2JEE A;  4LC1 A;  2FYU J;  3HE4 B;  3VTP C;  1NTM D;  4I6M C;  1EDL A;  4K35 A;  1EXI A;  2R3C A;  2J58 A;  1YJ9 P;  3L36 A;  3A0H H;  4OGQ D;  4PD4 I;  3V2Q A;  4EOT A;  4UB8 H;  3L72 G;  1SQQ D;  3VYI A;  3M0D A;  1JY2 P;  1M1J B;  4XA4 A;  5GTI E;  5AW5 B;  3BCC G;  2OTJ P;  4PJ0 H;  3L70 E;  1AQ5 A;  1PPJ G;  3P8C E;  2GUS A;  1AFO A;  2L5G B;  2R5B A;  1SQB J;  2V7Q H;  2KNC B;  3JC2 2;  2QE7 H;  2WSF J;  5KLI C;  1J1D B;  1OXZ A;  4W7Y A;  1KOR A;  2HLO A;  5B5E H;  2WSE H;  3RK2 C;  4WVZ A;  3NTN A;  1SFC A;  3B8E B;  1AQT A;  3C9I A;  3CMA P;  1KIL E;  2H89 C;  3SWK A;  1H0T A;  1DH3 A;  2AXC A;  3L74 D;  4IFD K;  1LWU C;  1DEE G;  3RK3 B;  3PHL A;  4IL6 X;  3O8Z A;  4C7N A;  1T2K C;  1FDO A;  4PV1 C;  1L0N K;  2XDJ A;  3TF5 A;  2HPC A;  1K9M Q;  3H25 A;  5KLV D;  3M0A A;  1FJP A;  5KAI H;  3R4Y A;  4IL6 E;  1RE4 A;  2GUV A;  2E76 C;  4H13 C;  3N7N A;  2FYU E;  4L74 A;  3TGU E;  3H1I G;  4O9B A;  4MN4 C;  3LID A;  2W6J H;  1KN7 A;  4U3F E;  5APX A;  3SFE C;  1YI2 P;  3WU2 H;  1BCC D;  3PP5 A;  2KSJ A;  1YTZ I;  2QJY B;  2ZAE B;  3VMX A;  1L4A C;  3CWB J;  1E79 H;  3CC4 P;  1BE3 J;  1N7S C;  2HG5 D;  5APU A;  3BRT B;  3TNU B;  2XZR A;  1RF0 C;  4PJ0 E;  2WMM A;  3KPE A;  3FX0 A;  1OVV A;  1MKM A;  1JCD A;  5AW3 B;  1NTK J;  1GK6 A;  3AE9 C;  1KB9 D;  1EXJ A;  1RHZ B;  1JY2 N;  3CPW O;  3CCE P;  2WSC J;  3L73 G;  2Y9Y A;  3G6E P;  4DOJ A;  3H1L D;  2KZI A;  1SQV J;  4C7R A;  4GKG A;  4BXL A;  3VP9 A;  2KOG A;  3H1K D;  1SS1 A;  2K9J B;  1BGY G;  4H44 B;  1ZRT E;  2R44 A;  2N1T B;  4OH8 B;  5L8R J;  5AVU B;  1SQV G;  2OYH C;  2BEQ D;  2IBZ E;  1KYO D;  5AVX B;  1QL1 A;  5AVQ B;  1GL2 D;  1YIT P;  4KHX A;  2AXT H;  3M9H A;  2M0B A;  2RN0 A;  2ZXE B;  3H1J G;  1EZV G;  2KS1 B;  1GTW A;  3AE8 C;  3MIW A;  1JNM A;  1AA0 A;  1M56 D;  1S5L H;  2XU6 A;  3AEA C;  3S4R A;  4PD4 D;  2FXP A;  1NTZ G;  4XFJ A;  5KAI E;  3AED C;  3RK3 E;  4EI2 A;  3KHU A;  1VQN P;  1M1J A;  1L0L J;  1PV3 A;  3GHG B;  1D7M A;  3PH0 A;  2QJK B;  3HD7 D;  3R2P A;  2B9B A;  3LIE A;  4KJM A;  4JQ0 D;  3V6I A;  2H88 C;  3PTZ A;  2IYO A;  1Y8A A;  1FZA A;  1PFI A;  3WUT A;  2OYI A;  1URQ C;  1SQX J;  3JCU H;  2YMK A;  1OW7 A;  1W2B O;  3AEG C;  1BE3 E;  3L71 E;  1NU1 K;  1XTC C;  4GDO A;  3P8M C;  2FYU K;  3GMA A;  2UWJ E;  3AEE C;  2AEJ A;  1DX7 A;  2WIT A;  2YKO A;  4R4L A;  4DZO A;  1G1J A;  3A3Y B;  1SQP J;  2OTK E;  1VQ8 P;  4GOF A;  1MFZ A;  4DJG A;  4D6T E;  4KT0 J;  4EIJ A;  1X22 A;  2AEM A;  1HF9 A;  3VOP A;  1P84 E;  2YIU C;  1M1K Q;  1BDC A;  2O01 J;  2AXT E;  2YMY A;  2KXP B;  2O1K A;  3P32 A;  1SQB K;  3FXE A;  1S2E A;  2YO2 A;  1LNQ A;  3EWK A;  4Z1M H;  3KDP B;  3AEF C;  2WT7 A;  3RBZ A;  2FFD A;  1EC5 A;  1ZV8 A;  1JMB A;  1PP9 J;  1BCC G;  3IF4 A;  1OVU A;  3L72 D;  3RK2 D;  1VQ4 P;  1FBM A;  3LW5 J;  2P1J A;  3H6P A;  2LXB A;  3GF3 A;  5KKZ B;  1YQ4 C;  3NMD A;  3BCC D;  4LGD E;  1L0L E;  5AVZ B;  1JUN A;  1L0N G;  1NHL A;  1FC2 C;  2Q3I A;  2ZT9 C;  1IFM A;  2JJL A;  4TLF A;  3D71 A;  1PPJ D;  3IFM A;  4R4M A;  1QEX A;  3TNU A;  1PL5 A;  3USS A;  3CCR P;  1T2K D;  5CCG C;  3II6 A;  3A0B H;  1FOS F;  4PV1 D;  3HUS C;  2KIK A;  3Q5R A;  4N78 D;  1KB9 H;  1LTJ B;  1GL2 B;  3JCU E;  2R5D A;  3V5B A;  4ZKP A;  2LR2 A;  2K9J A;  4RJT A;  2E76 D;  4H13 D;  2N1T A;  3CC2 P;  1QLE D;  4ZKU A;  1VQK P;  1KYO H;  2W6B A;  2Y0D A;  1AJY A;  1VQO P;  5APV A;  4HB1 A;  2J59 M;  4IFM A;  2NRG A;  2FYN C;  1L4A D;  2KS1 A;  3MTU E;  3HD7 B;  3M0D C;  2W90 A;  2WSS H;  3CI9 A;  3AE7 C;  1VQ5 P;  1JO5 A;  3GLM A;  1FE6 A;  4WY4 A;  2A06 G;  3WMM 0;  4WB4 A;  1N7S D;  3PJS K;  4PD4 H;  1NWQ A;  5TJH A;  1RF1 B;  4QMA A;  1NTK K;  3GF7 A;  5AVW B;  3V4Q A;  2QRX A;  1VQM P;  1OMI A;  5AW4 B;  5H2F H;  3H1I D;  3L70 J;  1IJD B;  2KK7 A;  4BWN A;  1SQV K;  1VF5 C;  3FWL A;  1CI6 B;  1IK9 A;  1J1E C;  1LJ2 A;  2P7J A;  2CK3 H;  1ZR4 A;  1N8R Q;  2Q5U A;  1PGO A;  1FZG A;  3PLN A;  4AQR D;  2Q7C A;  2YXR B;  2O1J A;  3RBX A;  1KB9 I;  3A0B E;  3L73 D;  2JDI H;  1NTK D;  3Q2Y A;  3VMY A;  3I5C A;  4U7J A;  1NGM B;  2A45 H;  4A7P A;  2QVA A;  2P58 A;  1SQV D;  3H1K E;  5E79 H;  1FDM A;  1L0L K;  4WBA A;  1PGQ A;  1KYO I;  5KLI B;  1QVG O;  3BRV B;  1VQ6 P;  3HE5 A;  1KYO E;  1GU4 A;  5GTH E;  4NPD A;  2RKL A;  3H1J D;  3TGU J;  1EZV D;  1LT9 A;  2P2U A;  1LWU B;  1NU1 G;  4U3F J;  1SQX K;  2FYU G;  1URQ D;  3TGU G;  2NPS A;  1NTZ D;  5DJT B;  2BCC E;  3WUV A;  4PD4 E;  3CXH D;  4PV1 B;  2M8R A;  3O6Q A;  2QJP C;  1SQP K;  2J5U A;  4K3A A;  5H2F E;  1HJ0 A;  1PZQ A;  1OVR A;  2JWA A;  2RH0 A;  1OX3 A;  2V7Q J;  2E76 B;  5B66 E;  2K37 A;  3MHV A;  1S3J A;  4C46 A;  1DD4 A;  1IFD A;  1SQB G;  1KQF B;  4NPF X;  4L76 A;  3IR9 A;  2QIW A;  1S9K D;  1GW3 A;  1NOH A;  1T3J A;  2WSE J;  3T97 A;  1H88 A;  4HJG H;  1ZOY C;  2JO1 A;  1K8A Q;  1JTH A;  2Q6Q A;  2KI7 B;  1L4A B;  1U7M A;  2YO3 A;  3CC7 P;  3ZDM A;  1N7S B;  3IN6 A;  4EYY Q;  1CZQ A;  2A45 I;  1MZ9 A;  1NAF A;  1NKZ B;  4EDF A;  3AE2 C;  2KB7 P;  2HR3 A;  3Q1M A;  2LKM A;  2CPB A;  5AW0 B;  1RH5 B;  2GM4 A;  5KJ7 A;  1H89 A;  1OFC X;  2ZT9 D;  3VP8 A;  1M1J C;  4BRY A;  5CCG D;  1RF1 A;  1IFN A;  2M5A B;  3CX5 D;  5AVT B;  1VL2 A;  1OW6 A;  3CL3 D;  3A0H E;  2Y9Z A;  1KIL A;  3H1H J;  1K05 A;  4UB8 E;  5CCH A;  3U1A A;  2E74 C;  1NVO A;  2OYI C;  2Z5H A;  1SP4 A;  1LT1 A;  3D70 A;  1KC8 Q;  2SPZ A;  3M9B A;  3L72 E;  5CMZ A;  3L75 J;  3V4W A;  1X8Y A;  1VQ7 P;  3L71 J;  1L0N D;  3HTK B;  3CWB G;  1NH4 A;  5APT A;  3G3Z A;  2PGD A;  3BCC E;  3KQG A;  2HYN A;  3B5N A;  4RKU J;  2K1A A;  3U1C A;  1BE3 G;  1IFI A;  3AEB C;  5AW9 B;  4HKZ H;  1PPJ E;  1JB0 J;  2WPR A;  3SFD C;  3RK3 C;  1NTK G;  1K04 A;  2IYP A;  1S1C X;  1H8A A;  5APS A;  4D6T J;  5CBO A;  5B5E E;  2C0X A;  3BAS A;  2CPS A;  1ZLL A;  2DW3 A;  1URQ B;  4OGQ B;  2MKV A;  1CSB A;  1VQ9 P;  1NJI Q;  1VF5 D;  1KFM A;  3VMA A;  1VDF A;  1RQV A;  1DIP A;  3VMZ A;  4JYB A;  2FFD C;  2P67 A;  1ZP0 C;  3AEC C;  3HE4 A;  1EDK A;  1NTM J;  1YTZ T;  1LWU A;  3JSV C;  2A06 D;  3H32 B;  3GG2 A;  2QJY C;  3TSI A;  1KFN A;  1IFP A;  3AE3 C;  2M3B A;  1NAY A;  1LTS C;  3CXH H;  3V2P A;  3RL0 g;  1J2J B;  2YIU B;  3MZW B;  2V4H A;  3H1I E;  1L0L G;  3WU2 E;  3H1H E;  4JF7 A;  1FZC B;  3V2N A;  5AVS B;  3M91 A;  1NKN A;  1HJB A;  3SWF A;  2KNC A;  1LTG C;  3L75 E;  1HTL C;  2D2C C;  1IO4 A;  4H44 C;  2N1T C;  1SQX G;  2B87 B;  1JY3 O;  1HUC A;  3OW2 O;  3L74 J;  2ZT9 B;  2M3E A;  2WWW A;  2IFN A;  2W6A A;  3EQ2 A;  3L73 E;  1SQP G;  3CD6 P;  4WY4 C;  1KQL A;  1FU1 A;  5AW7 B;  1U57 A;  2WTY A;  5KAF H;  1G2C B;  3U59 A;  2H43 A;  1BGY E;  2Q1K A;  1ZR2 A;  1S5L X;  5KLV J;  3SWY A;  1QL2 A;  5C39 A;  1FZB A;  1X9V A;  1EZV I;  1NU1 D;  1S5L E;  4W80 A;  2M5A A;  1HVV A;  2Y0E A;  3CX5 H;  1NTM E;  2FYU D;  2OYO A;  2O01 H;  2LXC B;  3TGU D;  1YQ3 C;  3E7K A;  3K5B A;  3CCQ P;  3CXH I;  2H8P D;  2E75 C;  1PP9 G;  1IZN B;  4I7Z C;  1SQQ E;  5AW2 B;  3L35 A;  3HRN A;  3CXH E;  3EFF K;  2POH A;  1KTM A;  1W2E A;  3OAK A;  1NO4 A;  2WPQ A;  2Z5I A;  3F5H A;  1KD1 Q;  5EFW B;  1M8O B;  2B88 A;  1K73 Q;  2W83 C;  1SQB D;  3E1I A;  3RGU A;  1N73 B;  1KZU B;  3GW6 A;  2IFM A;  1ZN5 A;  3E1R A;  1J1E B;  2WVR A;  3H1K J;  1NYH A;  2ZVO B;  3PRJ A;  1ZRT D;  2K3R A;  3AE5 C;  3KYQ A;  3L74 E;  4Y99 C;  1LT9 C;  5TIS H;  1H0T B;  1Q86 Q;  2E74 D;  1OZH A;  4HYT B;  1JM0 A;  1QVF O;  2NPS C;  2IPP A;  3P7K A;  4C7N B;  2QM7 A;  2GA1 A;  5KAF E;  2BCC J;  2XND H;  5KLV E;  2QM8 A;  2NZ2 A;  4Y28 J;  2OAR A;  1Z56 A;  3D6Y A;  3G4S P;  3A2A A;  2YKP A;  3CX5 I;  3RK3 D;  2R3S A;  3GHG A;  5BU5 A;  5GTI H;  4YXW H;  3N4X A;  3L70 G;  3IAO A;  2E5Y A;  1BCC E;  4YPC A;  2PAJ A;  1FZC A;  3UIA A;  1SFC C;  2H7H A;  2FKW B;  2C9N Y;  1DD3 A;  3CWB D;  4GOE A;  4H0L C;  1USD A;  5AVV B;  4ZNC A;  1FS0 E;  1L0N E;  1BE3 D;  2G8Y A;  2W8Z A;  2KLU A;  1E5W A;  2QJP B;  1NTM K;  1N7L A;  1KB9 E;  1RY3 A;  2OGU A;  3BVH A;  4N6J A;  1YJN P;  1M90 Q;  2KUB A;  3H1L E;  1U7J A;  5CBN A;  1FZF A;  5KJ7 C;  5CCG A;  2ZYG A;  4L73 A;  1LP1 B;  2I1J A;  1T3U A;  1RE4 C;  4RO0 A;  2IZ1 A;  1G2C A;  4YXD C;  3RL0 C;  4ZMD A;  3CCV P;  1P84 D;  2ZYA A;  1RF1 C;  1GK4 A;  3RK2 B;  3AE4 C;  1IK7 A;  2ZXX A;  3B71 A;  1EQ7 A;  2E43 A;  1KIL C;  3VN0 A;  4IL6 H;  1RE3 A;  5CCH C;  2Q3E A;  2D2C D;  3TYY A;  3CCJ P;  2WPV B;  1GMJ A;  3I56 P;  4U3F G;  2JP3 A;  4H44 D;  1IC2 A;  4IFF A;  2N1T D;  2VRS A;  3B4S A;  2A06 E;  3L72 J;  5AVY B;  3B5N C;  1PGP A;  1WMK A;  1HBW A;  3BCC J;  2OQQ A;  1VQL P;  2FBW C;  1L0L D;  1G1I A;  2G3A A;  4H13 B;  5CJ0 A;  4WY4 D;  5KLV K;  1L2P A;  1LTJ A;  1GL2 A;  4OWF A;  1N73 A;  1JY2 O;  1M7L A;  1JCC A;  2E74 B;  2OYI B;  1SQX D;  2WSF H;  2Y0C A;  1FZE A;  4JBZ A;  1PIX A;  1OWA A;  2Z4E A;  2IBZ G;  5AW6 B;  4WWI A;  2I1K A;  1CW5 A;  1YYC A;  1MV8 A;  2QA4 P;  1SQP D;  2E75 D;  1VQP P;  2K9Y A;  5BVZ A;  2Q9I A;  1LGH B;  5E79 E;  2OTL P;  2QEX P;  3ITK A;  3HD7 A;  2YXQ B;  1X79 B;  2XNX A;  2OYH B;  1OIP A;  3MUD A;  4JPZ B;  1LTT C;  1N86 A;  1DEB A;  3L37 A;  3H1I J;  1HH0 A;  3M06 A;  2KSE A;  1NU1 E;  1M57 D;  1CI6 A;  2WT7 B;  1FDI A;  1GD2 E;  3NFQ A;  2FFD B;  1YJW P;  3ABV C;  1PP9 D;  3EFG A;  1J1D C;  4GT1 A;  3H1H G;  3FXD A;  5AW8 B;  3TDK A;  1KV4 A;  2PRR A;  3KXD A;  4LLH A;  5APY A;  3L75 G;  4HH2 A;  3AE6 C;  3L71 G;  5KTB A;  2NPS D;  4L75 A;  1R5L A;  4I1L A;  1ZME C;  4N78 E;  1GU5 A;  2C9L Y;  3L73 J;  1LTB C;  2IZ0 A;  3QH9 A;  2ZFC A;  1SLQ A;  1SQB E;  1IFJ A;  1Y47 A;  1KQS O;  3Q5S A;  1KQG B;  2WSC H;  4D6T G;  1Q7Y Q;  1BGY J;  5CHX A;  2BAS A;  2WZ7 A;  1JEK A;  1LP1 A;  2D2C B;  2IBZ I;  1T8Z A;  2O01 N;  1P84 H;  1BSN A;  4AYC A;  2QSI A;  2O3J A;  1AVO A;  3H1J J;  2AEF A;  5M1B A;  4ASW A;  1SFC D;  3CCM P;  1FAV A;  4N3Y B;  1NTM G;  1NTZ J;  1Q82 Q;  4YTP C;  1LTI C;  1SQQ J;  4H0L D;  2IDB A;  2E42 A;  2BCC D;  4WY4 B;  5AW1 B;  4UB6 H;  1SQQ G;  2PP6 A;  1FJK A;  3SSU A;  5AVR B;  1UIX A;  3L70 D;  4NPE A;  1JY3 P;  3P8C D;  2ZYD A;  4RES B;  5KJ7 D;  3KZI H;  3D6Z A;  1X0T A;  3MP7 B;  1HGZ A;  3RL0 D;  4XE5 B;  1GDT A;  2FY8 A;  3Q5P A;  2I8D A;  2E75 B;  4I7Z B;  3CWB E;  3G9R A;  4OGQ C;  1HWT C;  1L4A A;  1KIL D;  4CPG A;  3CME P;  1GZL A;  4M3L A;  5CCH D;  1N7S A;  3F89 A;  1RF0 A;  1NTK E;  4GIF A;  3L74 G;  3HUS B;  2W27 A;  3FWN A;  2JR8 A;  1QX8 A; 
#chains in the Genus database with same CATH homology
 2OAR A;  1JCD A;  5AW3 B;  1SQP K;  1GK6 A;  1Z56 A;  5APQ A;  1JY2 N;  3B5N D;  3A2A A;  2YKP A;  4DOJ A;  3BAT A;  3RK3 D;  4C7R A;  3OJA B;  4GKG A;  3GHG A;  2YKQ A;  3VP9 A;  5BU5 A;  2HOD B;  2KOG A;  3GHG C;  4C46 A;  3N4X A;  3HE5 B;  2N1T B;  4OH8 B;  2OYH A;  1IFD A;  5AVU B;  2OYH C;  2FYZ A;  3OA7 A;  3IR9 A;  5CJ4 A;  2PAJ A;  1S9K D;  4Y99 B;  1FZC A;  1GW3 A;  1NOH A;  1LT9 B;  1T3J A;  3T97 A;  2WPS A;  5AVX B;  1H88 A;  3UIA A;  1QL1 A;  5AVQ B;  1FZC C;  1GL2 D;  1SFC C;  2H7H A;  4KHX A;  2FKW B;  1JTH A;  2C9N Y;  1L4A B;  2NPS B;  3M9H A;  2YO3 A;  2ZXE B;  5AVV B;  1GTW A;  1N7S B;  3V2R A;  3MIW A;  1JNM A;  1CZQ A;  2A45 I;  1MZ9 A;  1NAF A;  3LW5 H;  2XU6 A;  1NKZ B;  1A02 J;  1E5W A;  3HTK A;  2KLV A;  1NTM K;  1N7L A;  1FOS E;  2KB7 P;  1RY3 A;  3BVH A;  4N6J A;  2LKM A;  2IX7 C;  5APW A;  2CPB A;  5AW0 B;  2GM4 A;  5KJ7 A;  1FZF A;  1H89 A;  1JMM A;  1M1J A;  5KJ7 C;  3NXS A;  3VP8 A;  5CCG A;  1M1J C;  3GHG B;  1JOC A;  2I1J A;  1T3U A;  3HD7 D;  1RE4 C;  3R2P A;  1HGV A;  2XKM A;  5CCG D;  1G2C A;  1RF1 A;  3RL0 C;  3LIE A;  2FXM A;  1IFN A;  1S9K E;  1RF1 C;  1GK4 A;  3RK2 B;  5AVT B;  1JY3 N;  4JYC A;  1SFC B;  1FZA A;  1PFI A;  3CL3 D;  1URQ A;  1KIL A;  1EQ7 A;  1JTH B;  2OYI A;  1WT6 A;  1URQ C;  2E43 A;  5CCH A;  1KIL C;  3U1A A;  2OYI C;  2Z5H A;  3M9Q A;  3VN0 A;  1RE3 A;  5CCH C;  1SP4 A;  3M9B A;  1RE3 C;  3TYY A;  5CMZ A;  1NU1 K;  3V4W A;  1XTC C;  1IC2 A;  3P8M C;  4IFF A;  2N1T D;  1X8Y A;  3MGN A;  2FYU K;  2VRS A;  3HTK B;  1NH4 A;  1DX7 A;  5APT A;  2WIT A;  2YKO A;  3G3Z A;  3KQG A;  4AUW A;  2HPC B;  2HYN A;  4DZO A;  3B5N A;  1G1J A;  3A3Y B;  5AVY B;  3U1C A;  3B5N C;  3H32 A;  1IFI A;  5AW9 B;  1HBW A;  2WPR A;  1MFZ A;  4W7Z A;  3RK3 C;  4EIJ A;  1G1I A;  2N9B A;  3VOP A;  1H8A A;  5CJ0 A;  5APS A;  3RL0 B;  4WY4 D;  5BU8 B;  2C0X A;  1WRG A;  5KLV K;  3BAS A;  1LTJ A;  1GL2 A;  1LTJ C;  2YMY A;  1N73 A;  1GL2 C;  1JY2 O;  2CPS A;  1ZLL A;  2O1K A;  3P32 A;  1SQB K;  1URQ B;  1KIL B;  1M7L A;  1JCC A;  1XTG B;  1N73 C;  2OYI B;  2YO2 A;  1CSB A;  2WSF H;  3KDP B;  2WT7 A;  1FZE A;  1KFM A;  1OWA A;  1VDF A;  2FFD A;  2C0W A;  3VMZ A;  1MUU A;  4JYB A;  2Z4E A;  1ZV8 A;  2FFD C;  5AW6 B;  2P67 A;  1SVF A;  3HE4 A;  2KP8 A;  3RK2 D;  1FBM A;  2I1K A;  4B86 A;  1CW5 A;  2P1J A;  1YTZ T;  3H6P A;  1YYC A;  3MD0 A;  1LWU A;  1MV8 A;  3B5N B;  2R32 A;  1N2D C;  3H32 B;  3NMD A;  4LGD E;  5BVZ A;  1A02 F;  3TSI A;  2Q9I A;  5AVZ B;  1JUN A;  1LGH B;  2KYV A;  2Q3I A;  1NHL A;  1KFN A;  1NTZ K;  4I2L C;  1IFM A;  2M3B A;  2JJL A;  1SQQ K;  1LTS C;  3HD7 A;  3IFM A;  1LTA C;  1VPC A;  3V2P A;  1X79 B;  3TNU A;  1J2J B;  2MJZ A;  3HD7 C;  3HUS A;  1T2K D;  2XNX A;  5CCG C;  3II6 A;  2A45 G;  2XV5 A;  3A7O A;  1FOS F;  2HFE D;  3HUS C;  2OYH B;  4N78 D;  1LTJ B;  3MUD A;  1GL2 B;  4JF7 A;  3CLQ A;  1FZC B;  1LTT C;  1N86 A;  1DEB A;  3V2N A;  5AVS B;  3M91 A;  3L37 A;  1NKN A;  2R5D A;  1HJB A;  3SWF A;  1HH0 A;  3V5B A;  1LTG C;  2YNY A;  4ZKP A;  3M06 A;  1GW4 A;  3L4F A;  2HOD A;  1CI6 A;  2WT7 B;  3A5T A;  1GD2 E;  1HTL C;  3TK1 A;  3NFQ A;  2N1T A;  2FFD B;  1IO4 A;  3EFG A;  2N1T C;  2JEE A;  1J1D C;  4ZKU A;  4GT1 A;  4LC1 A;  3HE4 B;  3VTP C;  5AW8 B;  2W6B A;  1JY3 O;  4I6M C;  4LLH A;  5APY A;  2R3C A;  2J58 A;  4HH2 A;  5APV A;  3L36 A;  1HUC A;  2J59 M;  4IFM A;  3V2Q A;  4EOT A;  5KTB A;  3VYI A;  2WWW A;  2IFN A;  2W6A A;  1L4A D;  3M0D A;  3MTU E;  1JY2 P;  2NPS D;  1M1J B;  3EQ2 A;  3HD7 B;  4XA4 A;  3M0D C;  3CI9 A;  1JO5 A;  4WY4 A;  4I1L A;  5AW5 B;  3WMM 0;  4WB4 A;  1N7S D;  4WY4 C;  1KQL A;  4N78 E;  1GU5 A;  1NWQ A;  2C9L Y;  1FU1 A;  5AW7 B;  1LTB C;  2WTY A;  1G2C B;  3U59 A;  2H43 A;  2ZFC A;  1SLQ A;  1RF1 B;  1NTK K;  1ZR2 A;  5AVW B;  1AQ5 A;  3V4Q A;  1IFJ A;  3P8C E;  2GUS A;  2WSC H;  1AFO A;  5AW4 B;  3SWY A;  2L5G B;  5CHX A;  2BAS A;  1QL2 A;  1IJD B;  2R5B A;  2WZ7 A;  1FZB A;  1X9V A;  1SQV K;  1CI6 B;  1T8Z A;  1IK9 A;  1J1E C;  1J1D B;  1OXZ A;  2P7J A;  4W7Y A;  4W80 A;  1HVV A;  1ZR4 A;  2O01 H;  2HLO A;  4AYC A;  2WSE H;  3RK2 C;  3NTN A;  1SFC A;  3B8E B;  3C9I A;  2Q5U A;  2H8P D;  1SFC D;  1DH3 A;  1FZG A;  4IFD K;  1LWU C;  5AW2 B;  3L35 A;  3HRN A;  4AQR D;  2Q7C A;  2POH A;  1FAV A;  4N3Y B;  3RK3 B;  1W2E A;  1LTI C;  3OAK A;  2O1J A;  2E42 A;  4WY4 B;  3O8Z A;  5AW1 B;  4C7N A;  1T2K C;  1NO4 A;  1L0N K;  2XDJ A;  2WPQ A;  2Z5I A;  2HPC A;  2PP6 A;  3VMY A;  3I5C A;  1FJK A;  5AVR B;  2A45 H;  3E1I A;  3M0A A;  1JY3 P;  1N73 B;  1KZU B;  3P8C D;  1FJP A;  2IFM A;  1FDM A;  1RE4 A;  1L0L K;  1ZN5 A;  4RES B;  4WBA A;  5KJ7 D;  1J1E B;  2GUV A;  3BRV B;  3N7N A;  3HE5 A;  1GU4 A;  1HGZ A;  4O9B A;  3RL0 D;  4XE5 B;  3LID A;  1GDT A;  5APX A;  3KYQ A;  1LT9 A;  4Y99 C;  2P2U A;  1LT9 C;  1LWU B;  3PP5 A;  1HWT C;  2KSJ A;  1SQX K;  1YTZ I;  1URQ D;  1L4A A;  1KIL D;  3VMX A;  4HYT B;  2NPS A;  1GZL A;  4M3L A;  1L4A C;  5CCH D;  2NPS C;  1N7S A;  2IPP A;  3P7K A;  1RF0 A;  1N7S C;  4GIF A;  2HG5 D;  2M8R A;  2QM7 A;  5APU A;  3BRT B;  3TNU B;  4C7N B;  2XZR A;  1RF0 C;  3HUS B;  2W27 A;  3KPE A;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...