3RK2B

Truncated snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
59
structure length
59
Chain Sequence
b'SALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 26
structure length 59
sequence length 59
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk2B00
3RK2B 3KYQA 1XTGB 2NPSC 5CCHD 2N1TC 4W80A 5KJ7A 3P8CE 1NHLA 4LGDE 1KILC 4WY4D 1JTHB 1JTHA 1N7SC 4WY4B 4W7ZA 3HD7A 1L4AC 2HFED 4N78E 3RK2C 2HG5D 5CCGC 1T3JA 1URQD 3RK3D 1URQB 3RK3B 3VOPA 5CCHA 2YMYA 5KJ7C 3B5ND 3PP5A 1SFCC 3RL0C 2WZ7A 3B5NB 3B5NA 4WY4A 2NPSD 1GL2C 2XDJA 2NPSB 3HD7C 2N1TD 4W7YA 2N1TB 4OH8B 1KILD 4JF7A 1KILB 3HTKB 1URQA 1N7SD 2H8PD 1N7SB 1L4AD 5CCHC 2PP6A 1L4AB 1HVVA 5CCGD 3B5NC 5CCGA 4WY4C 3M0DC 2NPSA 2N1TA 5KJ7D 1SFCD 3RL0D 1SFCB 1SFCA 3RL0B 1KILA 3TSIA 1URQC 3RK3C 1N7SA 1GL2D 2M8RA 2KOGA 1GL2B 3HD7D 1GL2A 1L4AA 3RK2D 3HD7B
chains in the Genus database with same CATH superfamily
4XE5B 3AECC 1KB9D 3IN6A 2WSFH 2NPSC 2FXMA 1SQQD 1VQMP 3SSUA 3L73G 5BVZA 3TK1A 2FYUK 2OYHC 1WT6A 3H1IG 2ZYDA 2P10A 3MUDA 1EZVD 2O1KA 4D6TG 3VOPA 4I6MC 3CCVP 2IZ1A 1AVOA 1SFCC 1N73B 1SQQG 1TU3F 4EIJA 5AVWB 3E1RA 2C9NY 5GTIH 1PV3A 4IL6E 3CXHD 1KILD 2WPVB 1NVOA 1KILB 3L75J 1E79H 2YKQA 5CBOA 1AFOA 3PLNA 4IOIH 3HRNA 1RF0C 2RN0A 1U57A 1KB9H 5GTHE 1LTAC 4I1LA 1L0LK 3IAOA 5KAFE 1FOSF 3LIEA 3L74J 2W6BA 2M3BA 1JCDA 1RE4A 2R32A 1FZBA 3VMAA 4KJMA 2WITA 5KLVE 1VL2A 5TJHA 2E42A 3L72D 2LR2A 3V2QA 1PZQA 1LTGC 1SQBD 1ZR2A 4W80A 1PIXA 4UB6E 3L35A 1QGKB 1JCCA 2H89C 1LGHB 1SQPE 5AVYB 2JKVA 4XA4A 2BEZF 1KMIZ 1X8YA 3TNUB 2QIWA 3RL0C 2KS1A 1FOSE 1KB9I 1SQBG 2G3AA 3NFQA 2IBZD 3H1HD 1SQQK 1FZAA 1AA0A 2RKLA 1OX3A 2OYHA 2C9LY 2IPPA 1GU4A 1YHQP 1EZVI 4WWIA 1BDDA 3CC7P 2I8DA 2BCCJ 2HODA 3CLQA 4KT0J 2KB7P 1SFCA 1RF1C 1G2CB 1SQVD 1GK4A 3H1HG 1FZCA 2QA4P 2RH0A 4K3AA 3V6IA 5BU8B 3H25A 1YJ9P 3AE8C 2PRRA 2W27A 5BU5A 1K04A 2WSFJ 3VN0A 1L0LJ 5KJ7A 3R2PA 4WY4D 1JTHB 4WY4B 1OMIA 3OJAB 4L73A 3L36A 1SQXJ 1OVUA 1SQVG 1JEKA 1OVRA 2OTKE 3D71A 5GTHH 3NXSA 3L71J 1ZOYC 1PL5A 3B5NA 1VQPP 2HLOA 3CCRP 3HE5A 1EXJA 1KZUB 3CCUP 1H0TB 3L74E 3M0AA 3U1AA 1SQBK 2AXTE 2R44A 3O6QA 2Y0EA 2J58A 3H1LE 2B9BA 5CCGD 3L70G 5C39A 3BRTB 3FGAD 1HUCA 1P84E 3GF7A 4K35A 4U3FJ 4GODA 2R5DA 2N1TA 2FYNC 3AE4C 1Q7YQ 1S9KD 2OYIA 2Q6QA 1QL2A 1LT9B 3B71A 5TISE 3ITKA 1BGYE 2IBZI 1VQ6P 1JY3N 3EFGA 1NJIQ 2KSEA 1N8RQ 3TDKA 2QJYC 2FYUE 1YJNP 3AEDC 3KXDA 1Q2NA 2JP3A 3Q2YA 1PPJD 1IO4A 2FXPA 2FFDC 2WQYC 4BWNA 2KSJA 3RK2C 1Q81Q 5KKZC 1KYOD 5AW6B 2JO1A 4ZKPA 4GOFA 2HR3A 3MP7B 1SQVK 3U1CA 3D70A 3PH0A 2WWWA 1T2KD 2H7HA 3Q3DA 3CMEP 1J1DB 3G4SP 1FS0E 2CK3H 2BCCE 1H88A 1FZFA 1GL2C 1NU1J 2WT7B 2KXPB 1NTMD 1PPJG 3WU2E 3KZIE 2ZXXA 4PV1D 4PV1B 3A0HE 4HH2A 1YYCA 3F89A 1LWUA 3H1JE 1SVFA 4XFJA 2KZJA 1VQ7P 1IK9A 1L0LE 1LP1B 3KPEA 1YI2P 3OW2O 1NTKD 1S4XA 3KHUA 1ZMEC 1FBMA 1AVYA 1NTMG 4RESB 3CCJP 1N73C 3C9IA 1X79B 2IYPA 3V2RA 4IL6X 3Q5RA 2WSEH 1CZQA 4GDOA 1KYOH 1OW7A 5APSA 3L71E 1JM0A 2WSCH 2IFMA 1L0ND 3GW6A 1CW5A 5CCHD 3P8CE 4RO0A 1KILC 2K1AA 1NTZG 1T6AA 3TGUE 2AEJA 2KNCA 1FDOA 1NTKG 3FWLA 1G1IA 2YMKA 3LW5J 3M06A 5AW2B 5GTIE 4Z1MH 4N78E 2QM8A 3H1IE 1VQ8P 3BATA 2I1JA 1YQ4C 3CD6P 3D6YA 1IFJA 4WB4A 1ZRTE 2K88A 4ZNCA 4BRYB 1KB9E 2R3CA 3ABVC 1LTSC 3VMXA 1LTBC 2OQQA 1SQQE 2VRSA 5KLVJ 2FYNB 1T8ZA 1RE3C 3IF4A 3PRJA 5B66H 3VTPC 3CCMP 1IFMA 2JWDA 2O1JA 1OXZA 3Q1MA 1M7LA 1JY3P 4CPGA 1PP9D 1KYOI 2YIUC 1EZVE 1VQLP 1MV8A 2E75C 5AW4B 3HTKA 2LXBA 1CI6B 1N7SA 2ITAA 2KYVA 1GL2A 1CSBA 3RK2D 2B87A 1KFNA 2M5AA 3RK2B 3WMM0 1KILE 2POHA 1NTMK 2HPCB 1BDCA 3RL0g 1MFTA 2FXOA 1N2DC 5APXA 4H0LD 1HBWA 2KK7A 4H0LB 1S2EA 4HB1A 2OTJP 2E43A 1NU1E 2UWJE 3P32A 1VQ5P 1A02J 3HD7A 5K5GB 2PGDA 4D6TD 1D7MA 2YKPA 3A7OA 1URQD 1EC5A 1JMMA 1SQXG 1URQB 3H1KJ 3OAKA 1JO5A 1GDTA 3GHGB 3L72E 1MFZA 4ASWA 3I5CA 3SWYA 3WUVA 2KZIA 1SQBE 1YITP 1L0NK 3AEFC 3AEGC 4ASVA 5DJUB 1HVVA 1S1CX 3AEAC 3CWBD 2ZYGA 2J5UA 4WY4C 3CMAP 1PFIA 4I2LC 2ZT9D 3FX0A 3K5BA 2ZT9B 4LC1A 4R4LA 4A7PA 4U3FG 2A06D 2LKMA 1ZLLA 1Z56A 2KOGA 3FXEA 1L4AA 1AV1A 2ZYAA 2NRGA 4KHXA 1OVVA 1USEA 3L37A 2IBZE 3H1HE 1RE3A 1VPCA 4EYYQ 2WSEJ 3MIWA 2OTLP 1QEXA 3CWBG 3GMAA 2WSCJ 1NHLA 4LGDE 4L75A 3CC4P 2YKOA 1E5WA 3S1KA 3BASA 3H1LJ 2C0WA 4I7ZB 2A06G 5CCGC 1A02F 1YQ3C 3AE6C 3HUSA 3V5BA 3AE9C 3USSA 3CCEP 1SQVE 2Q7CA 3SWFA 2KIKA 4TT3H 3PP5A 1EDJA 3GLMA 2WZ7A 2ZFCA 1OIPA 2YIUB 4AYCA 2YXQB 1DIPA 1LT9C 1M90Q 2E75D 2E75B 1KFMA 1BGYJ 2QVAA 1K73Q 3CXHH 4BXLA 1KD1Q 4JF7A 1VQNP 3BCCJ 2PP6A 5B5EH 2FYUJ 3VP8A 2ZAEB 2W6AA 1LTIC 2NPSA 1MKMA 2K9YA 3V4QA 3A2AA 3S9OA 4ZKUA 1S72P 1DEBA 1UIIA 1DX7A 1J2JB 1T2KC 1J1DC 3MTUE 4DT0A 3RBXA 3HE4B 3H1KE 4IFDK 5CJ0A 1BCCJ 1Q82Q 3UIAA 3CC2P 2KS1B 5APTA 4H44D 4PV1C 4H44B 1JTHA 5M1BA 4W7ZA 3C1LA 3CXHI 1S3JA 4DOJA 3H1JJ 2MKVA 3Q5PA 4C7NB 3W67A 1EXIA 3NMDA 1RF0A 1UIXA 1HGZA 1YTZI 2FYZA 1NWQA 2HODB 1SQPD 3AEBC 1OWAA 1KQFB 3L70D 1KQGB 2MJZA 2NZ2A 5AVSB 2CPBA 1S5LH 5CCHC 1FZCB 2SPZA 3JC22 3I56P 2A45G 3EFFK 5CCGA 3IFMA 3L73J 4YPCA 1KYOE 2GM4A 3RGUA 3TGUJ 1JY2O 4HKZH 2P2UA 5KJ7D 1HJBA 1BE3D 5AW0B 3H1IJ 2Y0CA 1SQPG 1N86A 4NPFX 2WPRA 1Q86Q 1HH0A 3SFEC 2JDIH 1KC8Q 2K3RA 1SQQJ 3CL3D 2AEMA 1VQOP 1L2PA 3E1IA 1LTJB 4C7RA 1KORA 2KUBA 1PGOA 5CHXA 3HE5B 1BE3G 3Q5SA 5H2FH 5B66E 3JCUH 3BCCE 2V7QH 3CX5D 1IJDB 2P7JA 3O6QB 1M56D 1ZXGA 2OARA 2O01N 1XTCC 5KTBA 2XU6A 2N1TD 2WVRA 1L0NE 5AW9B 2Y9YA 2BASA 2N1TB 2AXCA 3L75D 1RF1A 2OYIB 1MUUA 1DD4A 4OWFA 2R3SA 4H0LC 1BCCE 4NPEA 3WUTA 2JWAA 3M0DC 3L74D 4HJGH 2W90A 2K9JA 3EWKA 5KAIH 2C0XA 1URQC 3VP9A 3L75G 1M1JB 3GHGC 1H89A 4H13D 3L72J 2YNYA 3V2NA 4H13B 3VYIA 4ZMDA 1NTZD 2N9YB 3CX5H 3T97A 3H32A 5AVQB 2IYOA 2W83C 1SQBJ 1Y47A 1K9MQ 1PP9E 1U7MA 3A0BH 3L74G 2QJKB 1OFCX 3LIDA 3MHVA 2FKWB 5AVXB 1NAFA 1PGPA 2PAJA 2ZT9C 1LWUB 3L73E 5E79H 1DH3A 1GW4A 2WPQA 4BRYA 3CPWO 1KQLA 2Y9ZA 4W7YA 2JJLA 3MUDC 4OH8B 4N6JA 4UB8H 1VF5D 3H1HJ 2QRXA 5CMZA 1SP4A 1W5CE 1BGYG 2KLVA 2M0BA 1JUNA 2YXRB 2Q1KA 2Z5IA 3A3YB 3BRVB 2Q5UA 4D6TE 1GTWA 3CX5I 2BCCD 2LXCB 5KLIB 2N9BA 3MD0A 1R5SA 4I7ZC 3CCQP 2G8YA 1RHZB 1WMKA 1X9VA 2R5BA 2FFDA 2M8RA 1SQVJ 1IK7A 3AEEC 5AW7B 2B88A 1HGVA 1K05A 3B8EB 1RQVA 1L0LD 4GT1A 3KDPB 2BCCG 3CWBE 1RE4C 1M1KQ 2JEEA 1BSHA 1U7JA 5CJ4A 4Y28J 1SQXD 2HFED 4GKGA 2FY8A 1H8AA 4O9BA 4YXWH 3CXHE 2XNDH 1T3UA 3L71D 2A06E 1EQ7A 1HWTC 1WRGA 1QLED 3H1JG 1K8AQ 5B5EE 4Y99C 2K37A 3GHGA 1VQ4P 2KLUA 1L0LG 4N3YB 1NTZK 4N78D 1W2EA 5DJTB 1NTKK 3HTKB 2RMZA 1N7SD 1N7SB 4JPZB 3QH9A 5AVTB 1N73A 3GG2A 2B87B 3U59A 2M5AB 3L71G 4H44C 4L74A 2AEFA 4JYBA 4U3FD 1R8EA 1FJKA 3TGUG 2ZJSE 1KILA 3TSIA 3SFDC 3TYYA 1GZLA 1RQUA 1J1EB 4WVZA 2OYOA 1MZ9A 3HD7D 3TF5A 3HD7B 1IC2A 1ZR4A 2V4HA 1GU5A 2P1JA 4JBZA 4AQRD 4PD4D 4PJ0H 3G3ZA 2PFXA 5AVZB 2E5TA 3W68A 4EI2A 2XZRA 2XV5A 1FDIA 1FZCC 2WTYA 1IFIA 3RK3D 1EDKA 3RK3B 5AVUB 1S5LE 1FZGA 2YMYA 5KJ7C 3O8ZA 1EZVG 1Y8AA 2Y0DA 1NU1D 3EQ2A 1YJWP 4IFMA 5APWA 2WMMA 1NTMJ 3N4XA 1PGJA 1YTZT 1OW8A 3TNUA 1L4AD 2Z5HA 1AQTA 2YO3A 1L4AB 1LTJC 1SQXK 2H43A 3B5NC 5AW5B 4LLHA 2IDBA 1NO4A 4PD4H 1NTZJ 3F5HA 3AE7C 1NU1G 1NTKJ 1VQKP 3R4YA 2CPSA 3PTZA 2O01H 4DJGA 1EDIA 1G1JA 3L4FA 5H2FE 3JCUE 1GW3A 3AE3C 3HE4A 3L70E 2WSSH 3HUSB 2IFNA 2N1TC 3L72G 1L0NJ 4Y99B 1G2CA 2E74D 2OYIC 1FDMA 3A5TA 1KN7A 2E74B 2XNXA 4GIFA 2QG4A 5CBNA 1PGQA 1RH5B 5APQA 2QJPC 2HG5D 1BE3E 1KTMA 4OGQD 4OGQB 3KQGA 4C7NA 1USDA 2D2CD 3B4SA 2E76D 2D2CB 3G6EP 2E76B 1FAVA 2L5GB 4TLFA 3GF3A 4WY4A 4WBAA 2NPSD 2XDJA 3M9BA 4PD4I 2NPSB 4MN4C 5KLVD 1M1JC 1X22A 2I1KA 2KP8A 1S9KE 2Q3EA 2OYHB 4H13C 5KAIE 2DW3A 1NH4A 1VQ9P 3V4WA 3WUUA 2IBZG 1QL1A 2GUVA 2QJKC 1PP9J 4C46A 4NPDA 3CX5E 1H0TA 3RBZA 2GA1A 4IL6H 1SFCD 1SFCB 3G71P 1IZNB 1PPJE 5KLVG 3A0BE 1M57D 3LW5H 1NU1K 5APYA 1LWUC 1FE6A 1XTGB 3S4RA 3CCLP 3L75E 5EFWB 2XKMA 3I55P 1FJPA 3OA7A 5KAFH 3II6A 4RJTA 4OVNF 1VF5C 5E79E 1KV4A 1LTJA 2M3EA 1JY3O 1LT9A 4IFFA 1NTME 2ZVOB 4UB8E 5AVVB 4D6TJ 1DD3A 1DEEG 4L76A 3AE1C 5KLIC 3H1KD 2A45H 2E5YA 3FXDA 1LTTC 3H6PA 3E7KA 2H88C 1JMBA 3B5ND 3B5NB 3MGNA 2WPSA 4UB6H 2L91A 1NTZE 1NTKE 2J59M 1QVFO 1JY2N 3ZDMA 2H8PD 5L8RJ 1GD2E 2BEQD 3MZWB 4DCKA 4JYCA 4M3LA 4EDFA 3AE2C 1LNQA 2HYNA 3H1KG 5AVRB 1GK6A 3CWBJ 1N7LA 3D6ZA 5APUA 2WT7A 1BSNA 1ZW0A 3FWNA 3RL0D 1IFDA 3RL0B 1OZHA 1GMJA 3BVHA 1IFPA 1M1JA 1EDLA 2IX7C 2QJPB 2O01J 5KLVK 4EOTA 3SWKA 2P67A 2A45I 1HTLC 1LP1A 3V2PA 4AUWA 1AQ5A 1ZN5A 3IR9A 1JOCA 1HF9A 1N7SC 3H1LD 3PHLA 4YXDC 4HYTB 1NKZB 1SQPK 2KI7B 1T3JA 1P84D 3CI9A 2O3JA 1RF1B 1ZP0C 1FU1A 5AW1B 5CCHA 2IZ0A 3PJSK 3CCSP 2P58A 2QEXP 1J1EC 1BGYD 3HD7C 1NGMB 3BCCD 2K9JB 4RKUJ 5AW3B 3VMYA 3H1LG 1SS1A 2GUSA 4YTPC 2FYUD 1SQXE 3M9HA 1W2BO 5APVA 4DZOA 2YO2A 1RY3A 3QWOC 1LT1A 1NOHA 3T97B 4PJ0E 3H32B 1S5LX 1NYHA 2FBWC 3P7KA 1VF5B 2AXTH 3RK3C 3VMZA 3BCCG 1FC2C 1YBKA 2ZXEB 4U7JA 3KYQA 1R5LA 1BCCD 1P84H 2FYUG 1YIJP 2JR8A 4B86A 1X0TA 1OW6A 2W6JH 1M8OB 1AJYA 1SLQA 1CI6A 1ZV8A 2KNCB 1L0NG 2B89A 4U3FE 5TISH 2QM7A 1L4AC 1QVGO 1KQSO 1HJ0A 3H1JD 4JQ0D 1JY2P 1JNMA 3G9RA 2HPCA 3AE5C 3M9QA 2QSIA 2QE7H 1IFNA 1BCCG 3NTNA 4R4MA 2Z4EA 3M0DA 1JB0J 2OGUA 1QX8A 1NAYA 1VDFA 4PD4E 2QJYB 1SQPJ 2V7QJ 3HUSC 4QMAA 1URQA 3L70J 2FFDB 1Y9BA 3N7NA 3P8CD 1Q90D 3L73D 3TGUD 1P84I 2E74C 5KKZB 3M91A 2Q3IA 2ZVNB 3RK3E 2Q9IA 1FZEA 3H1ID 1PP9G 1NKNA 3WU2H 1BE3J 3KZIH 4GOEA 3JSVC 5AW8B 4OGQC 3P8MC 3A0HH 1GL2D 2W8ZA 1ZRTD 1GL2B 1LJ2A 2D2CC 3C8VA 2E76C
chains in the Genus database with same CATH topology
2WPRA 3V2RA 4XE5B 2WSEH 1CZQA 1HH0A 1GW3A 3HE4A 5APSA 2WSFH 3HUSB 2IFNA 2NPSC 2FXMA 2WSCH 2IFMA 1CW5A 5BVZA 3TK1A 2N1TC 5CCHD 3CL3D 3P8CE 4Y99B 2FYUK 2OYHC 3E1IA 1KILC 1LTJB 1G2CA 2OYIC 4C7RA 1FDMA 1WT6A 3A5TA 2XNXA 4GIFA 5CHXA 3HE5B 1G1IA 3M06A 5AW2B 4N78E 5APQA 2QM8A 3MUDA 2HG5D 3BATA 2I1JA 2O1KA 1IFJA 1IJDB 3KQGA 4C7NA 4WB4A 2P7JA 3VOPA 4I6MC 1SFCC 1N73B 2OARA 1FAVA 2L5GB 4WY4A 4WBAA 2R3CA 4EIJA 1LTSC 2NPSD 3VMXA 1XTCC 1LTBC 2XDJA 3M9BA 5AVWB 5KTBA 2NPSB 1M1JC 2VRSA 2XU6A 2C9NY 2N1TD 5AW9B 2BASA 1T8ZA 2N1TB 1RE3C 2I1KA 2KP8A 3VTPC 1S9KE 1KILD 2OYHB 1RF1A 1IFMA 1KILB 2OYIB 1MUUA 1NH4A 2O1JA 2YKQA 3V4WA 1OXZA 1AFOA 1M7LA 1JY3P 1QL1A 2GUVA 3HRNA 1RF0C 4C46A 3M0DC 1MV8A 1LTAC 4I1LA 1L0LK 1FOSF 3LIEA 1SFCD 2W6BA 5AW4B 1SFCB 2M3BA 3HTKA 1JCDA 1RE4A 2C0XA 1URQC 2R32A 1CI6B 1FZBA 1N7SA 2KYVA 3LW5H 3VP9A 1GL2A 1NU1K 2WITA 1CSBA 1M1JB 5APYA 3RK2D 3GHGC 1LWUC 1KFNA 3RK2B 1H89A 2E42A 3V2QA 1XTGB 3WMM0 2YNYA 3V2NA 2POHA 1NTMK 3VYIA 2HPCB 1LTGC 1N2DC 5APXA 2XKMA 3T97A 3H32A 1FJPA 1ZR2A 5AVQB 1HBWA 4W80A 3OA7A 3II6A 1LTJA 2E43A 1LT9A 1JY3O 3L35A 3P32A 1A02J 3HD7A 3LIDA 1JCCA 1LGHB 5AVYB 4IFFA 2FKWB 5AVXB 5AVVB 2YKPA 1NAFA 4XA4A 3A7OA 1URQD 1JMMA 2A45H 1URQB 3OAKA 2PAJA 1LTTC 1X8YA 3H6PA 1JO5A 3TNUB 3B5ND 1GDTA 3GHGB 3RL0C 1LWUB 3B5NB 1MFZA 1DH3A 1GW4A 3MGNA 2WPQA 1FOSE 2WPSA 3I5CA 3SWYA 1KQLA 3NFQA 4W7YA 2JJLA 4OH8B 1SQQK 1FZAA 1L0NK 4N6JA 5CMZA 2J59M 1SP4A 2OYHA 1JY2N 2C9LY 2IPPA 2H8PD 1GD2E 2KLVA 4JYCA 1JUNA 4M3LA 3A3YB 2Z5IA 3BRVB 1HVVA 1GU4A 2Q5UA 2HYNA 5AVRB 1GTWA 1GK6A 1N7LA 4WY4C 5APUA 1PFIA 2N9BA 3MD0A 2WT7A 4I2LC 2HODA 3CLQA 4LC1A 3RL0D 2KB7P 1SFCA 1IFDA 3RL0B 1RF1C 1G2CB 1X9VA 2R5BA 1GK4A 2LKMA 1ZLLA 2FFDA 2M8RA 3BVHA 1Z56A 2KOGA 1L4AA 4KHXA 1M1JA 1FZCA 2IX7C 3L37A 5KLVK 4EOTA 1RE3A 5AW7B 5BU8B 1VPCA 2P67A 2A45I 1HTLC 1HGVA 3B8EB 3V2PA 4AUWA 2W27A 3MIWA 5BU5A 1AQ5A 3VN0A 5KJ7A 1NHLA 1ZN5A 4GT1A 3KDPB 4LGDE 3IR9A 1JOCA 3R2PA 1RE4C 4WY4D 2YKOA 2JEEA 1JTHB 1N7SC 4WY4B 1E5WA 5CJ4A 3OJAB 3BASA 2HFED 3L36A 4GKGA 4HYTB 1NKZB 1H8AA 4O9BA 2C0WA 1SQPK 5CCGC 1T3JA 1A02F 1T3UA 3CI9A 3HUSA 3V5BA 1RF1B 1EQ7A 3L4FA 2Q7CA 3SWFA 1HWTC 1WRGA 3NXSA 1FU1A 5AW1B 5CCHA 3PP5A 4Y99C 2WZ7A 3GHGA 2ZFCA 3B5NA 4AYCA 2HLOA 1J1EC 1LT9C 3HE5A 1KZUB 4N3YB 3M0AA 3HD7C 1NTZK 1KFMA 4N78D 1W2EA 3U1AA 1SQBK 1NTKK 4JF7A 5AW3B 3HTKB 3VMYA 1N7SD 2GUSA 1N7SB 2J58A 2PP6A 5AVTB 1N73A 3M9HA 3U59A 5CCGD 5APVA 4DZOA 3BRTB 3VP8A 1HUCA 2YO2A 2W6AA 1LTIC 4JYBA 2NPSA 3V4QA 1RY3A 1NOHA 1FJKA 2R5DA 3A2AA 2N1TA 3H32B 3P7KA 1S9KD 1KILA 2OYIA 3TSIA 3TYYA 4ZKUA 1GZLA 3RK3C 1J1EB 1LT9B 1QL2A 1DEBA 1MZ9A 3HD7D 1DX7A 3VMZA 3HD7B 1J2JB 1IC2A 2ZXEB 1T2KC 3KYQA 1J1DC 3MTUE 1ZR4A 1JY3N 3HE4B 1GU5A 3EFGA 2P1JA 4IFDK 5CJ0A 4AQRD 3UIAA 4B86A 3G3ZA 5AVZB 5APTA 1SLQA 1CI6A 1ZV8A 1IO4A 1JTHA 2FFDC 4W7ZA 2QM7A 1L4AC 2KSJA 2XV5A 2XZRA 1FZCC 3RK2C 4DOJA 1JY2P 2WTYA 5AW6B 1IFIA 1JNMA 2HPCA 3RK3D 3M9QA 4C7NB 4ZKPA 3RK3B 5AVUB 1SQVK 1FZGA 2YMYA 5KJ7C 3U1CA 1IFNA 3O8ZA 2WWWA 1T2KD 3NTNA 2H7HA 1J1DB 3NMDA 1RF0A 2Z4EA 1HGZA 3M0DA 1H88A 3EQ2A 1FZFA 1VDFA 1YTZI 1GL2C 2FYZA 2WT7B 1NWQA 4IFMA 2HODB 5APWA 1OWAA 2MJZA 3HUSC 3N4XA 1URQA 1YTZT 5AVSB 4HH2A 1YYCA 2FFDB 3N7NA 2CPBA 3TNUA 1L4AD 3P8CD 2Z5HA 5CCHC 2YO3A 1L4AB 1LWUA 1FZCB 1LTJC 1SQXK 1SVFA 3B5NC 5AW5B 2H43A 2A45G 4LLHA 3IFMA 5CCGA 2GM4A 3M91A 2Q3IA 1NO4A 1IK9A 1JY2O 3KPEA 2P2UA 2Q9IA 5KJ7D 1FZEA 1HJBA 5AW0B 1NKNA 5AW8B 3P8MC 1FBMA 1GL2D 1N86A 2CPSA 1GL2B 2O01H 4RESB 1N73C 1G1JA 3C9IA 1X79B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK2 B;  3KYQ A;  1XTG B;  2NPS C;  5CCH D;  2N1T C;  4W80 A;  5KJ7 A;  3P8C E;  1NHL A;  4LGD E;  1KIL C;  4WY4 D;  1JTH B;  1JTH A;  1N7S C;  4WY4 B;  4W7Z A;  3HD7 A;  1L4A C;  2HFE D;  4N78 E;  3RK2 C;  2HG5 D;  5CCG C;  1T3J A;  1URQ D;  3RK3 D;  1URQ B;  3RK3 B;  3VOP A;  5CCH A;  2YMY A;  5KJ7 C;  3B5N D;  3PP5 A;  1SFC C;  3RL0 C;  2WZ7 A;  3B5N B;  3B5N A;  4WY4 A;  2NPS D;  1GL2 C;  2XDJ A;  2NPS B;  3HD7 C;  2N1T D;  4W7Y A;  2N1T B;  4OH8 B;  1KIL D;  4JF7 A;  1KIL B;  3HTK B;  1URQ A;  1N7S D;  2H8P D;  1N7S B;  1L4A D;  5CCH C;  2PP6 A;  1L4A B;  1HVV A;  5CCG D;  3B5N C;  5CCG A;  4WY4 C;  3M0D C;  2NPS A;  2N1T A;  5KJ7 D;  1SFC D;  3RL0 D;  1SFC B;  1SFC A;  3RL0 B;  1KIL A;  3TSI A;  1URQ C;  3RK3 C;  1N7S A;  1GL2 D;  2M8R A;  2KOG A;  1GL2 B;  3HD7 D;  1GL2 A;  1L4A A;  3RK2 D;  3HD7 B; 
#chains in the Genus database with same CATH topology
 4XE5 B;  3AEC C;  1KB9 D;  3IN6 A;  2WSF H;  2NPS C;  2FXM A;  1SQQ D;  1VQM P;  3SSU A;  3L73 G;  5BVZ A;  3TK1 A;  2FYU K;  2OYH C;  1WT6 A;  3H1I G;  2ZYD A;  2P10 A;  3MUD A;  1EZV D;  2O1K A;  4D6T G;  3VOP A;  4I6M C;  3CCV P;  2IZ1 A;  1AVO A;  1SFC C;  1N73 B;  1SQQ G;  1TU3 F;  4EIJ A;  5AVW B;  3E1R A;  2C9N Y;  5GTI H;  1PV3 A;  4IL6 E;  3CXH D;  1KIL D;  2WPV B;  1NVO A;  1KIL B;  3L75 J;  1E79 H;  2YKQ A;  5CBO A;  1AFO A;  3PLN A;  4IOI H;  3HRN A;  1RF0 C;  2RN0 A;  1U57 A;  1KB9 H;  5GTH E;  1LTA C;  4I1L A;  1L0L K;  3IAO A;  5KAF E;  1FOS F;  3LIE A;  3L74 J;  2W6B A;  2M3B A;  1JCD A;  1RE4 A;  2R32 A;  1FZB A;  3VMA A;  4KJM A;  2WIT A;  5KLV E;  1VL2 A;  5TJH A;  2E42 A;  3L72 D;  2LR2 A;  3V2Q A;  1PZQ A;  1LTG C;  1SQB D;  1ZR2 A;  4W80 A;  1PIX A;  4UB6 E;  3L35 A;  1QGK B;  1JCC A;  2H89 C;  1LGH B;  1SQP E;  5AVY B;  2JKV A;  4XA4 A;  2BEZ F;  1KMI Z;  1X8Y A;  3TNU B;  2QIW A;  3RL0 C;  2KS1 A;  1FOS E;  1KB9 I;  1SQB G;  2G3A A;  3NFQ A;  2IBZ D;  3H1H D;  1SQQ K;  1FZA A;  1AA0 A;  2RKL A;  1OX3 A;  2OYH A;  2C9L Y;  2IPP A;  1GU4 A;  1YHQ P;  1EZV I;  4WWI A;  1BDD A;  3CC7 P;  2I8D A;  2BCC J;  2HOD A;  3CLQ A;  4KT0 J;  2KB7 P;  1SFC A;  1RF1 C;  1G2C B;  1SQV D;  1GK4 A;  3H1H G;  1FZC A;  2QA4 P;  2RH0 A;  4K3A A;  3V6I A;  5BU8 B;  3H25 A;  1YJ9 P;  3AE8 C;  2PRR A;  2W27 A;  5BU5 A;  1K04 A;  2WSF J;  3VN0 A;  1L0L J;  5KJ7 A;  3R2P A;  4WY4 D;  1JTH B;  4WY4 B;  1OMI A;  3OJA B;  4L73 A;  3L36 A;  1SQX J;  1OVU A;  1SQV G;  1JEK A;  1OVR A;  2OTK E;  3D71 A;  5GTH H;  3NXS A;  3L71 J;  1ZOY C;  1PL5 A;  3B5N A;  1VQP P;  2HLO A;  3CCR P;  3HE5 A;  1EXJ A;  1KZU B;  3CCU P;  1H0T B;  3L74 E;  3M0A A;  3U1A A;  1SQB K;  2AXT E;  2R44 A;  3O6Q A;  2Y0E A;  2J58 A;  3H1L E;  2B9B A;  5CCG D;  3L70 G;  5C39 A;  3BRT B;  3FGA D;  1HUC A;  1P84 E;  3GF7 A;  4K35 A;  4U3F J;  4GOD A;  2R5D A;  2N1T A;  2FYN C;  3AE4 C;  1Q7Y Q;  1S9K D;  2OYI A;  2Q6Q A;  1QL2 A;  1LT9 B;  3B71 A;  5TIS E;  3ITK A;  1BGY E;  2IBZ I;  1VQ6 P;  1JY3 N;  3EFG A;  1NJI Q;  2KSE A;  1N8R Q;  3TDK A;  2QJY C;  2FYU E;  1YJN P;  3AED C;  3KXD A;  1Q2N A;  2JP3 A;  3Q2Y A;  1PPJ D;  1IO4 A;  2FXP A;  2FFD C;  2WQY C;  4BWN A;  2KSJ A;  3RK2 C;  1Q81 Q;  5KKZ C;  1KYO D;  5AW6 B;  2JO1 A;  4ZKP A;  4GOF A;  2HR3 A;  3MP7 B;  1SQV K;  3U1C A;  3D70 A;  3PH0 A;  2WWW A;  1T2K D;  2H7H A;  3Q3D A;  3CME P;  1J1D B;  3G4S P;  1FS0 E;  2CK3 H;  2BCC E;  1H88 A;  1FZF A;  1GL2 C;  1NU1 J;  2WT7 B;  2KXP B;  1NTM D;  1PPJ G;  3WU2 E;  3KZI E;  2ZXX A;  4PV1 D;  4PV1 B;  3A0H E;  4HH2 A;  1YYC A;  3F89 A;  1LWU A;  3H1J E;  1SVF A;  4XFJ A;  2KZJ A;  1VQ7 P;  1IK9 A;  1L0L E;  1LP1 B;  3KPE A;  1YI2 P;  3OW2 O;  1NTK D;  1S4X A;  3KHU A;  1ZME C;  1FBM A;  1AVY A;  1NTM G;  4RES B;  3CCJ P;  1N73 C;  3C9I A;  1X79 B;  2IYP A;  3V2R A;  4IL6 X;  3Q5R A;  2WSE H;  1CZQ A;  4GDO A;  1KYO H;  1OW7 A;  5APS A;  3L71 E;  1JM0 A;  2WSC H;  2IFM A;  1L0N D;  3GW6 A;  1CW5 A;  5CCH D;  3P8C E;  4RO0 A;  1KIL C;  2K1A A;  1NTZ G;  1T6A A;  3TGU E;  2AEJ A;  2KNC A;  1FDO A;  1NTK G;  3FWL A;  1G1I A;  2YMK A;  3LW5 J;  3M06 A;  5AW2 B;  5GTI E;  4Z1M H;  4N78 E;  2QM8 A;  3H1I E;  1VQ8 P;  3BAT A;  2I1J A;  1YQ4 C;  3CD6 P;  3D6Y A;  1IFJ A;  4WB4 A;  1ZRT E;  2K88 A;  4ZNC A;  4BRY B;  1KB9 E;  2R3C A;  3ABV C;  1LTS C;  3VMX A;  1LTB C;  2OQQ A;  1SQQ E;  2VRS A;  5KLV J;  2FYN B;  1T8Z A;  1RE3 C;  3IF4 A;  3PRJ A;  5B66 H;  3VTP C;  3CCM P;  1IFM A;  2JWD A;  2O1J A;  1OXZ A;  3Q1M A;  1M7L A;  1JY3 P;  4CPG A;  1PP9 D;  1KYO I;  2YIU C;  1EZV E;  1VQL P;  1MV8 A;  2E75 C;  5AW4 B;  3HTK A;  2LXB A;  1CI6 B;  1N7S A;  2ITA A;  2KYV A;  1GL2 A;  1CSB A;  3RK2 D;  2B87 A;  1KFN A;  2M5A A;  3RK2 B;  3WMM 0;  1KIL E;  2POH A;  1NTM K;  2HPC B;  1BDC A;  3RL0 g;  1MFT A;  2FXO A;  1N2D C;  5APX A;  4H0L D;  1HBW A;  2KK7 A;  4H0L B;  1S2E A;  4HB1 A;  2OTJ P;  2E43 A;  1NU1 E;  2UWJ E;  3P32 A;  1VQ5 P;  1A02 J;  3HD7 A;  5K5G B;  2PGD A;  4D6T D;  1D7M A;  2YKP A;  3A7O A;  1URQ D;  1EC5 A;  1JMM A;  1SQX G;  1URQ B;  3H1K J;  3OAK A;  1JO5 A;  1GDT A;  3GHG B;  3L72 E;  1MFZ A;  4ASW A;  3I5C A;  3SWY A;  3WUV A;  2KZI A;  1SQB E;  1YIT P;  1L0N K;  3AEF C;  3AEG C;  4ASV A;  5DJU B;  1HVV A;  1S1C X;  3AEA C;  3CWB D;  2ZYG A;  2J5U A;  4WY4 C;  3CMA P;  1PFI A;  4I2L C;  2ZT9 D;  3FX0 A;  3K5B A;  2ZT9 B;  4LC1 A;  4R4L A;  4A7P A;  4U3F G;  2A06 D;  2LKM A;  1ZLL A;  1Z56 A;  2KOG A;  3FXE A;  1L4A A;  1AV1 A;  2ZYA A;  2NRG A;  4KHX A;  1OVV A;  1USE A;  3L37 A;  2IBZ E;  3H1H E;  1RE3 A;  1VPC A;  4EYY Q;  2WSE J;  3MIW A;  2OTL P;  1QEX A;  3CWB G;  3GMA A;  2WSC J;  1NHL A;  4LGD E;  4L75 A;  3CC4 P;  2YKO A;  1E5W A;  3S1K A;  3BAS A;  3H1L J;  2C0W A;  4I7Z B;  2A06 G;  5CCG C;  1A02 F;  1YQ3 C;  3AE6 C;  3HUS A;  3V5B A;  3AE9 C;  3USS A;  3CCE P;  1SQV E;  2Q7C A;  3SWF A;  2KIK A;  4TT3 H;  3PP5 A;  1EDJ A;  3GLM A;  2WZ7 A;  2ZFC A;  1OIP A;  2YIU B;  4AYC A;  2YXQ B;  1DIP A;  1LT9 C;  1M90 Q;  2E75 D;  2E75 B;  1KFM A;  1BGY J;  2QVA A;  1K73 Q;  3CXH H;  4BXL A;  1KD1 Q;  4JF7 A;  1VQN P;  3BCC J;  2PP6 A;  5B5E H;  2FYU J;  3VP8 A;  2ZAE B;  2W6A A;  1LTI C;  2NPS A;  1MKM A;  2K9Y A;  3V4Q A;  3A2A A;  3S9O A;  4ZKU A;  1S72 P;  1DEB A;  1UII A;  1DX7 A;  1J2J B;  1T2K C;  1J1D C;  3MTU E;  4DT0 A;  3RBX A;  3HE4 B;  3H1K E;  4IFD K;  5CJ0 A;  1BCC J;  1Q82 Q;  3UIA A;  3CC2 P;  2KS1 B;  5APT A;  4H44 D;  4PV1 C;  4H44 B;  1JTH A;  5M1B A;  4W7Z A;  3C1L A;  3CXH I;  1S3J A;  4DOJ A;  3H1J J;  2MKV A;  3Q5P A;  4C7N B;  3W67 A;  1EXI A;  3NMD A;  1RF0 A;  1UIX A;  1HGZ A;  1YTZ I;  2FYZ A;  1NWQ A;  2HOD B;  1SQP D;  3AEB C;  1OWA A;  1KQF B;  3L70 D;  1KQG B;  2MJZ A;  2NZ2 A;  5AVS B;  2CPB A;  1S5L H;  5CCH C;  1FZC B;  2SPZ A;  3JC2 2;  3I56 P;  2A45 G;  3EFF K;  5CCG A;  3IFM A;  3L73 J;  4YPC A;  1KYO E;  2GM4 A;  3RGU A;  3TGU J;  1JY2 O;  4HKZ H;  2P2U A;  5KJ7 D;  1HJB A;  1BE3 D;  5AW0 B;  3H1I J;  2Y0C A;  1SQP G;  1N86 A;  4NPF X;  2WPR A;  1Q86 Q;  1HH0 A;  3SFE C;  2JDI H;  1KC8 Q;  2K3R A;  1SQQ J;  3CL3 D;  2AEM A;  1VQO P;  1L2P A;  3E1I A;  1LTJ B;  4C7R A;  1KOR A;  2KUB A;  1PGO A;  5CHX A;  3HE5 B;  1BE3 G;  3Q5S A;  5H2F H;  5B66 E;  3JCU H;  3BCC E;  2V7Q H;  3CX5 D;  1IJD B;  2P7J A;  3O6Q B;  1M56 D;  1ZXG A;  2OAR A;  2O01 N;  1XTC C;  5KTB A;  2XU6 A;  2N1T D;  2WVR A;  1L0N E;  5AW9 B;  2Y9Y A;  2BAS A;  2N1T B;  2AXC A;  3L75 D;  1RF1 A;  2OYI B;  1MUU A;  1DD4 A;  4OWF A;  2R3S A;  4H0L C;  1BCC E;  4NPE A;  3WUT A;  2JWA A;  3M0D C;  3L74 D;  4HJG H;  2W90 A;  2K9J A;  3EWK A;  5KAI H;  2C0X A;  1URQ C;  3VP9 A;  3L75 G;  1M1J B;  3GHG C;  1H89 A;  4H13 D;  3L72 J;  2YNY A;  3V2N A;  4H13 B;  3VYI A;  4ZMD A;  1NTZ D;  2N9Y B;  3CX5 H;  3T97 A;  3H32 A;  5AVQ B;  2IYO A;  2W83 C;  1SQB J;  1Y47 A;  1K9M Q;  1PP9 E;  1U7M A;  3A0B H;  3L74 G;  2QJK B;  1OFC X;  3LID A;  3MHV A;  2FKW B;  5AVX B;  1NAF A;  1PGP A;  2PAJ A;  2ZT9 C;  1LWU B;  3L73 E;  5E79 H;  1DH3 A;  1GW4 A;  2WPQ A;  4BRY A;  3CPW O;  1KQL A;  2Y9Z A;  4W7Y A;  2JJL A;  3MUD C;  4OH8 B;  4N6J A;  4UB8 H;  1VF5 D;  3H1H J;  2QRX A;  5CMZ A;  1SP4 A;  1W5C E;  1BGY G;  2KLV A;  2M0B A;  1JUN A;  2YXR B;  2Q1K A;  2Z5I A;  3A3Y B;  3BRV B;  2Q5U A;  4D6T E;  1GTW A;  3CX5 I;  2BCC D;  2LXC B;  5KLI B;  2N9B A;  3MD0 A;  1R5S A;  4I7Z C;  3CCQ P;  2G8Y A;  1RHZ B;  1WMK A;  1X9V A;  2R5B A;  2FFD A;  2M8R A;  1SQV J;  1IK7 A;  3AEE C;  5AW7 B;  2B88 A;  1HGV A;  1K05 A;  3B8E B;  1RQV A;  1L0L D;  4GT1 A;  3KDP B;  2BCC G;  3CWB E;  1RE4 C;  1M1K Q;  2JEE A;  1BSH A;  1U7J A;  5CJ4 A;  4Y28 J;  1SQX D;  2HFE D;  4GKG A;  2FY8 A;  1H8A A;  4O9B A;  4YXW H;  3CXH E;  2XND H;  1T3U A;  3L71 D;  2A06 E;  1EQ7 A;  1HWT C;  1WRG A;  1QLE D;  3H1J G;  1K8A Q;  5B5E E;  4Y99 C;  2K37 A;  3GHG A;  1VQ4 P;  2KLU A;  1L0L G;  4N3Y B;  1NTZ K;  4N78 D;  1W2E A;  5DJT B;  1NTK K;  3HTK B;  2RMZ A;  1N7S D;  1N7S B;  4JPZ B;  3QH9 A;  5AVT B;  1N73 A;  3GG2 A;  2B87 B;  3U59 A;  2M5A B;  3L71 G;  4H44 C;  4L74 A;  2AEF A;  4JYB A;  4U3F D;  1R8E A;  1FJK A;  3TGU G;  2ZJS E;  1KIL A;  3TSI A;  3SFD C;  3TYY A;  1GZL A;  1RQU A;  1J1E B;  4WVZ A;  2OYO A;  1MZ9 A;  3HD7 D;  3TF5 A;  3HD7 B;  1IC2 A;  1ZR4 A;  2V4H A;  1GU5 A;  2P1J A;  4JBZ A;  4AQR D;  4PD4 D;  4PJ0 H;  3G3Z A;  2PFX A;  5AVZ B;  2E5T A;  3W68 A;  4EI2 A;  2XZR A;  2XV5 A;  1FDI A;  1FZC C;  2WTY A;  1IFI A;  3RK3 D;  1EDK A;  3RK3 B;  5AVU B;  1S5L E;  1FZG A;  2YMY A;  5KJ7 C;  3O8Z A;  1EZV G;  1Y8A A;  2Y0D A;  1NU1 D;  3EQ2 A;  1YJW P;  4IFM A;  5APW A;  2WMM A;  1NTM J;  3N4X A;  1PGJ A;  1YTZ T;  1OW8 A;  3TNU A;  1L4A D;  2Z5H A;  1AQT A;  2YO3 A;  1L4A B;  1LTJ C;  1SQX K;  2H43 A;  3B5N C;  5AW5 B;  4LLH A;  2IDB A;  1NO4 A;  4PD4 H;  1NTZ J;  3F5H A;  3AE7 C;  1NU1 G;  1NTK J;  1VQK P;  3R4Y A;  2CPS A;  3PTZ A;  2O01 H;  4DJG A;  1EDI A;  1G1J A;  3L4F A;  5H2F E;  3JCU E;  1GW3 A;  3AE3 C;  3HE4 A;  3L70 E;  2WSS H;  3HUS B;  2IFN A;  2N1T C;  3L72 G;  1L0N J;  4Y99 B;  1G2C A;  2E74 D;  2OYI C;  1FDM A;  3A5T A;  1KN7 A;  2E74 B;  2XNX A;  4GIF A;  2QG4 A;  5CBN A;  1PGQ A;  1RH5 B;  5APQ A;  2QJP C;  2HG5 D;  1BE3 E;  1KTM A;  4OGQ D;  4OGQ B;  3KQG A;  4C7N A;  1USD A;  2D2C D;  3B4S A;  2E76 D;  2D2C B;  3G6E P;  2E76 B;  1FAV A;  2L5G B;  4TLF A;  3GF3 A;  4WY4 A;  4WBA A;  2NPS D;  2XDJ A;  3M9B A;  4PD4 I;  2NPS B;  4MN4 C;  5KLV D;  1M1J C;  1X22 A;  2I1K A;  2KP8 A;  1S9K E;  2Q3E A;  2OYH B;  4H13 C;  5KAI E;  2DW3 A;  1NH4 A;  1VQ9 P;  3V4W A;  3WUU A;  2IBZ G;  1QL1 A;  2GUV A;  2QJK C;  1PP9 J;  4C46 A;  4NPD A;  3CX5 E;  1H0T A;  3RBZ A;  2GA1 A;  4IL6 H;  1SFC D;  1SFC B;  3G71 P;  1IZN B;  1PPJ E;  5KLV G;  3A0B E;  1M57 D;  3LW5 H;  1NU1 K;  5APY A;  1LWU C;  1FE6 A;  1XTG B;  3S4R A;  3CCL P;  3L75 E;  5EFW B;  2XKM A;  3I55 P;  1FJP A;  3OA7 A;  5KAF H;  3II6 A;  4RJT A;  4OVN F;  1VF5 C;  5E79 E;  1KV4 A;  1LTJ A;  2M3E A;  1JY3 O;  1LT9 A;  4IFF A;  1NTM E;  2ZVO B;  4UB8 E;  5AVV B;  4D6T J;  1DD3 A;  1DEE G;  4L76 A;  3AE1 C;  5KLI C;  3H1K D;  2A45 H;  2E5Y A;  3FXD A;  1LTT C;  3H6P A;  3E7K A;  2H88 C;  1JMB A;  3B5N D;  3B5N B;  3MGN A;  2WPS A;  4UB6 H;  2L91 A;  1NTZ E;  1NTK E;  2J59 M;  1QVF O;  1JY2 N;  3ZDM A;  2H8P D;  5L8R J;  1GD2 E;  2BEQ D;  3MZW B;  4DCK A;  4JYC A;  4M3L A;  4EDF A;  3AE2 C;  1LNQ A;  2HYN A;  3H1K G;  5AVR B;  1GK6 A;  3CWB J;  1N7L A;  3D6Z A;  5APU A;  2WT7 A;  1BSN A;  1ZW0 A;  3FWN A;  3RL0 D;  1IFD A;  3RL0 B;  1OZH A;  1GMJ A;  3BVH A;  1IFP A;  1M1J A;  1EDL A;  2IX7 C;  2QJP B;  2O01 J;  5KLV K;  4EOT A;  3SWK A;  2P67 A;  2A45 I;  1HTL C;  1LP1 A;  3V2P A;  4AUW A;  1AQ5 A;  1ZN5 A;  3IR9 A;  1JOC A;  1HF9 A;  1N7S C;  3H1L D;  3PHL A;  4YXD C;  4HYT B;  1NKZ B;  1SQP K;  2KI7 B;  1T3J A;  1P84 D;  3CI9 A;  2O3J A;  1RF1 B;  1ZP0 C;  1FU1 A;  5AW1 B;  5CCH A;  2IZ0 A;  3PJS K;  3CCS P;  2P58 A;  2QEX P;  1J1E C;  1BGY D;  3HD7 C;  1NGM B;  3BCC D;  2K9J B;  4RKU J;  5AW3 B;  3VMY A;  3H1L G;  1SS1 A;  2GUS A;  4YTP C;  2FYU D;  1SQX E;  3M9H A;  1W2B O;  5APV A;  4DZO A;  2YO2 A;  1RY3 A;  3QWO C;  1LT1 A;  1NOH A;  3T97 B;  4PJ0 E;  3H32 B;  1S5L X;  1NYH A;  2FBW C;  3P7K A;  1VF5 B;  2AXT H;  3RK3 C;  3VMZ A;  3BCC G;  1FC2 C;  1YBK A;  2ZXE B;  4U7J A;  3KYQ A;  1R5L A;  1BCC D;  1P84 H;  2FYU G;  1YIJ P;  2JR8 A;  4B86 A;  1X0T A;  1OW6 A;  2W6J H;  1M8O B;  1AJY A;  1SLQ A;  1CI6 A;  1ZV8 A;  2KNC B;  1L0N G;  2B89 A;  4U3F E;  5TIS H;  2QM7 A;  1L4A C;  1QVG O;  1KQS O;  1HJ0 A;  3H1J D;  4JQ0 D;  1JY2 P;  1JNM A;  3G9R A;  2HPC A;  3AE5 C;  3M9Q A;  2QSI A;  2QE7 H;  1IFN A;  1BCC G;  3NTN A;  4R4M A;  2Z4E A;  3M0D A;  1JB0 J;  2OGU A;  1QX8 A;  1NAY A;  1VDF A;  4PD4 E;  2QJY B;  1SQP J;  2V7Q J;  3HUS C;  4QMA A;  1URQ A;  3L70 J;  2FFD B;  1Y9B A;  3N7N A;  3P8C D;  1Q90 D;  3L73 D;  3TGU D;  1P84 I;  2E74 C;  5KKZ B;  3M91 A;  2Q3I A;  2ZVN B;  3RK3 E;  2Q9I A;  1FZE A;  3H1I D;  1PP9 G;  1NKN A;  3WU2 H;  1BE3 J;  3KZI H;  4GOE A;  3JSV C;  5AW8 B;  4OGQ C;  3P8M C;  3A0H H;  1GL2 D;  2W8Z A;  1ZRT D;  1GL2 B;  1LJ2 A;  2D2C C;  3C8V A;  2E76 C; 
#chains in the Genus database with same CATH homology
 2WPR A;  3V2R A;  4XE5 B;  2WSE H;  1CZQ A;  1HH0 A;  1GW3 A;  3HE4 A;  5APS A;  2WSF H;  3HUS B;  2IFN A;  2NPS C;  2FXM A;  2WSC H;  2IFM A;  1CW5 A;  5BVZ A;  3TK1 A;  2N1T C;  5CCH D;  3CL3 D;  3P8C E;  4Y99 B;  2FYU K;  2OYH C;  3E1I A;  1KIL C;  1LTJ B;  1G2C A;  2OYI C;  4C7R A;  1FDM A;  1WT6 A;  3A5T A;  2XNX A;  4GIF A;  5CHX A;  3HE5 B;  1G1I A;  3M06 A;  5AW2 B;  4N78 E;  5APQ A;  2QM8 A;  3MUD A;  2HG5 D;  3BAT A;  2I1J A;  2O1K A;  1IFJ A;  1IJD B;  3KQG A;  4C7N A;  4WB4 A;  2P7J A;  3VOP A;  4I6M C;  1SFC C;  1N73 B;  2OAR A;  1FAV A;  2L5G B;  4WY4 A;  4WBA A;  2R3C A;  4EIJ A;  1LTS C;  2NPS D;  3VMX A;  1XTC C;  1LTB C;  2XDJ A;  3M9B A;  5AVW B;  5KTB A;  2NPS B;  1M1J C;  2VRS A;  2XU6 A;  2C9N Y;  2N1T D;  5AW9 B;  2BAS A;  1T8Z A;  2N1T B;  1RE3 C;  2I1K A;  2KP8 A;  3VTP C;  1S9K E;  1KIL D;  2OYH B;  1RF1 A;  1IFM A;  1KIL B;  2OYI B;  1MUU A;  1NH4 A;  2O1J A;  2YKQ A;  3V4W A;  1OXZ A;  1AFO A;  1M7L A;  1JY3 P;  1QL1 A;  2GUV A;  3HRN A;  1RF0 C;  4C46 A;  3M0D C;  1MV8 A;  1LTA C;  4I1L A;  1L0L K;  1FOS F;  3LIE A;  1SFC D;  2W6B A;  5AW4 B;  1SFC B;  2M3B A;  3HTK A;  1JCD A;  1RE4 A;  2C0X A;  1URQ C;  2R32 A;  1CI6 B;  1FZB A;  1N7S A;  2KYV A;  3LW5 H;  3VP9 A;  1GL2 A;  1NU1 K;  2WIT A;  1CSB A;  1M1J B;  5APY A;  3RK2 D;  3GHG C;  1LWU C;  1KFN A;  3RK2 B;  1H89 A;  2E42 A;  3V2Q A;  1XTG B;  3WMM 0;  2YNY A;  3V2N A;  2POH A;  1NTM K;  3VYI A;  2HPC B;  1LTG C;  1N2D C;  5APX A;  2XKM A;  3T97 A;  3H32 A;  1FJP A;  1ZR2 A;  5AVQ B;  1HBW A;  4W80 A;  3OA7 A;  3II6 A;  1LTJ A;  2E43 A;  1LT9 A;  1JY3 O;  3L35 A;  3P32 A;  1A02 J;  3HD7 A;  3LID A;  1JCC A;  1LGH B;  5AVY B;  4IFF A;  2FKW B;  5AVX B;  5AVV B;  2YKP A;  1NAF A;  4XA4 A;  3A7O A;  1URQ D;  1JMM A;  2A45 H;  1URQ B;  3OAK A;  2PAJ A;  1LTT C;  1X8Y A;  3H6P A;  1JO5 A;  3TNU B;  3B5N D;  1GDT A;  3GHG B;  3RL0 C;  1LWU B;  3B5N B;  1MFZ A;  1DH3 A;  1GW4 A;  3MGN A;  2WPQ A;  1FOS E;  2WPS A;  3I5C A;  3SWY A;  1KQL A;  3NFQ A;  4W7Y A;  2JJL A;  4OH8 B;  1SQQ K;  1FZA A;  1L0N K;  4N6J A;  5CMZ A;  2J59 M;  1SP4 A;  2OYH A;  1JY2 N;  2C9L Y;  2IPP A;  2H8P D;  1GD2 E;  2KLV A;  4JYC A;  1JUN A;  4M3L A;  3A3Y B;  2Z5I A;  3BRV B;  1HVV A;  1GU4 A;  2Q5U A;  2HYN A;  5AVR B;  1GTW A;  1GK6 A;  1N7L A;  4WY4 C;  5APU A;  1PFI A;  2N9B A;  3MD0 A;  2WT7 A;  4I2L C;  2HOD A;  3CLQ A;  4LC1 A;  3RL0 D;  2KB7 P;  1SFC A;  1IFD A;  3RL0 B;  1RF1 C;  1G2C B;  1X9V A;  2R5B A;  1GK4 A;  2LKM A;  1ZLL A;  2FFD A;  2M8R A;  3BVH A;  1Z56 A;  2KOG A;  1L4A A;  4KHX A;  1M1J A;  1FZC A;  2IX7 C;  3L37 A;  5KLV K;  4EOT A;  1RE3 A;  5AW7 B;  5BU8 B;  1VPC A;  2P67 A;  2A45 I;  1HTL C;  1HGV A;  3B8E B;  3V2P A;  4AUW A;  2W27 A;  3MIW A;  5BU5 A;  1AQ5 A;  3VN0 A;  5KJ7 A;  1NHL A;  1ZN5 A;  4GT1 A;  3KDP B;  4LGD E;  3IR9 A;  1JOC A;  3R2P A;  1RE4 C;  4WY4 D;  2YKO A;  2JEE A;  1JTH B;  1N7S C;  4WY4 B;  1E5W A;  5CJ4 A;  3OJA B;  3BAS A;  2HFE D;  3L36 A;  4GKG A;  4HYT B;  1NKZ B;  1H8A A;  4O9B A;  2C0W A;  1SQP K;  5CCG C;  1T3J A;  1A02 F;  1T3U A;  3CI9 A;  3HUS A;  3V5B A;  1RF1 B;  1EQ7 A;  3L4F A;  2Q7C A;  3SWF A;  1HWT C;  1WRG A;  3NXS A;  1FU1 A;  5AW1 B;  5CCH A;  3PP5 A;  4Y99 C;  2WZ7 A;  3GHG A;  2ZFC A;  3B5N A;  4AYC A;  2HLO A;  1J1E C;  1LT9 C;  3HE5 A;  1KZU B;  4N3Y B;  3M0A A;  3HD7 C;  1NTZ K;  1KFM A;  4N78 D;  1W2E A;  3U1A A;  1SQB K;  1NTK K;  4JF7 A;  5AW3 B;  3HTK B;  3VMY A;  1N7S D;  2GUS A;  1N7S B;  2J58 A;  2PP6 A;  5AVT B;  1N73 A;  3M9H A;  3U59 A;  5CCG D;  5APV A;  4DZO A;  3BRT B;  3VP8 A;  1HUC A;  2YO2 A;  2W6A A;  1LTI C;  4JYB A;  2NPS A;  3V4Q A;  1RY3 A;  1NOH A;  1FJK A;  2R5D A;  3A2A A;  2N1T A;  3H32 B;  3P7K A;  1S9K D;  1KIL A;  2OYI A;  3TSI A;  3TYY A;  4ZKU A;  1GZL A;  3RK3 C;  1J1E B;  1LT9 B;  1QL2 A;  1DEB A;  1MZ9 A;  3HD7 D;  1DX7 A;  3VMZ A;  3HD7 B;  1J2J B;  1IC2 A;  2ZXE B;  1T2K C;  3KYQ A;  1J1D C;  3MTU E;  1ZR4 A;  1JY3 N;  3HE4 B;  1GU5 A;  3EFG A;  2P1J A;  4IFD K;  5CJ0 A;  4AQR D;  3UIA A;  4B86 A;  3G3Z A;  5AVZ B;  5APT A;  1SLQ A;  1CI6 A;  1ZV8 A;  1IO4 A;  1JTH A;  2FFD C;  4W7Z A;  2QM7 A;  1L4A C;  2KSJ A;  2XV5 A;  2XZR A;  1FZC C;  3RK2 C;  4DOJ A;  1JY2 P;  2WTY A;  5AW6 B;  1IFI A;  1JNM A;  2HPC A;  3RK3 D;  3M9Q A;  4C7N B;  4ZKP A;  3RK3 B;  5AVU B;  1SQV K;  1FZG A;  2YMY A;  5KJ7 C;  3U1C A;  1IFN A;  3O8Z A;  2WWW A;  1T2K D;  3NTN A;  2H7H A;  1J1D B;  3NMD A;  1RF0 A;  2Z4E A;  1HGZ A;  3M0D A;  1H88 A;  3EQ2 A;  1FZF A;  1VDF A;  1YTZ I;  1GL2 C;  2FYZ A;  2WT7 B;  1NWQ A;  4IFM A;  2HOD B;  5APW A;  1OWA A;  2MJZ A;  3HUS C;  3N4X A;  1URQ A;  1YTZ T;  5AVS B;  4HH2 A;  1YYC A;  2FFD B;  3N7N A;  2CPB A;  3TNU A;  1L4A D;  3P8C D;  2Z5H A;  5CCH C;  2YO3 A;  1L4A B;  1LWU A;  1FZC B;  1LTJ C;  1SQX K;  1SVF A;  3B5N C;  5AW5 B;  2H43 A;  2A45 G;  4LLH A;  3IFM A;  5CCG A;  2GM4 A;  3M91 A;  2Q3I A;  1NO4 A;  1IK9 A;  1JY2 O;  3KPE A;  2P2U A;  2Q9I A;  5KJ7 D;  1FZE A;  1HJB A;  5AW0 B;  1NKN A;  5AW8 B;  3P8M C;  1FBM A;  1GL2 D;  1N86 A;  2CPS A;  1GL2 B;  2O01 H;  4RES B;  1N73 C;  1G1J A;  3C9I A;  1X79 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...