3RK2B

Truncated snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
59
structure length
59
Chain Sequence
SALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 59
sequence length 59
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk2B00
4W80A 5CCHA 1KILB 3PP5A 2WZ7A 1GL2A 1T3JA 4WY4B 2HFED 3HD7B 2KOGA 1HVVA 3HTKB 1L4AA 1L4AB 1SFCB 5CCGD 3TSIA 4LGDE 1N7SD 1NHLA 5KJ7D 5CCGC 1GL2B 4N78E 1URQC 1N7SC 2NPSC 5KJ7C 1JTHA 2N1TD 3KYQA 2XDJA 3B5ND 3RK3C 4WY4D 2N1TC 2N1TA 3RK2D 3B5NC 1XTGB 3RL0D 1URQD 2NPSD 3P8CE 4WY4C 5CCGA 3HD7C 3M0DC 3RK2C 3RK3D 3RL0C 1URQA 1N7SA 2NPSA 4W7YA 5KJ7A 5CCHD 1JTHB 3VOPA 1KILD 2H8PD 2YMYA 4W7ZA 5CCHC 1KILC 2HG5D 2N1TB 1KILA 3HD7D 1GL2C 3B5NA 3B5NB 4WY4A 1L4AD 4JF7A 1SFCD 4OH8B 3HD7A 2M8RA 3RK2B 3RL0B 1URQB 1N7SB 2NPSB 2PP6A 1L4AC 1SFCC 1SFCA 1GL2D 3RK3B
chains in the Genus database with same CATH superfamily
5KAIH 1YTZI 2UWJE 1KN7A 4OWFA 1S9KD 1JY2O 4UB6E 1FOSE 1FZCC 1SQPD 2ZXEB 3VN0A 3L75E 3H1KD 4IFDK 1IK7A 1LWUC 1NAYA 1L0NJ 3RBZA 1SQPK 3RK3C 1FZCA 2PAJA 1J1DB 1FZEA 2ZYDA 3FX0A 2QJPB 2HODA 1JY3O 5EFWB 2N1TA 2HYNA 3B5NC 3CCUP 2OTJP 4R4LA 3Q5SA 3FWNA 3RL0C 1LTTC 3NTNA 1J1EC 4TT3H 4C7NB 1Q2NA 2E74C 2D2CD 2JO1A 3VYIA 4AQRD 1W2EA 3L4FA 4PJ0E 2KP8A 3B5NA 3VMXA 4D6TD 3I55P 2QA4P 3TGUG 1LP1B 1KC8Q 4OGQB 1DH3A 1S4XA 1NU1J 3H1HJ 5APXA 1USDA 1HH0A 1ZOYC 2YNYA 2OYHC 1S1CX 3BCCJ 2B9BA 1K9MQ 2ZYAA 1K73Q 3AE4C 2R44A 1P84E 3W68A 4H0LB 1FAVA 2IFNA 2Q1KA 1X8YA 3CC4P 3A0BE 4Y99B 3TSIA 1W2BO 1QL1A 2OYHA 2QJYC 1E5WA 2Z5IA 1S9KE 1DIPA 2G3AA 2QE7H 4H44D 1LJ2A 3HE4B 1BCCE 5TISH 1LGHB 3H1KE 1KQLA 1SQVD 2IBZG 4WY4D 1CSBA 1AV1A 2H7HA 1EDKA 3JCUH 1OW7A 5GTHE 3WU2H 4EI2A 2ZT9D 1FZGA 5APWA 1S2EA 3L36A 4W7YA 1BE3G 5H2FE 2O01J 2P1JA 3AE9C 1VQMP 2QM7A 2Y9YA 1K8AQ 1R5LA 4IFMA 1H89A 2FY8A 3CX5D 4U3FE 3RK2B 4XE5B 1CW5A 2FXMA 2AEMA 2YIUB 1MUUA 1FU1A 3BRTB 1R5SA 5CBOA 3GMAA 1NTZK 4ASVA 3GHGB 1IJDB 1CI6A 4WY4B 1QX8A 2L5GB 3KZIE 3H1JJ 4K3AA 4BWNA 3A0HE 2IZ0A 3HE5A 4WB4A 5K5GB 3S1KA 1KMIZ 1SFCB 2VRSA 2JEEA 2L91A 1H0TA 2QM8A 4ZMDA 3RGUA 4QMAA 3L37A 2LKMA 4IL6X 1NKZB 1AFOA 1BGYG 1KZUB 3AE7C 5CMZA 4RESB 2JJLA 2E5TA 1JB0J 1SQPJ 3EQ2A 5KAFE 1KB9D 4PD4H 2E76B 1GW4A 2OARA 3H1KJ 1VQ7P 1OX3A 3AEAC 1N7LA 3HD7C 4EIJA 2K3RA 2R3CA 1N73B 4LC1A 1AJYA 1EQ7A 1SQVE 4I7ZB 2Q7CA 2YMYA 1DD3A 1L2PA 1U57A 1J2JB 4C7RA 4C46A 1KFNA 1KYOD 1M56D 1Y47A 4GOFA 3CLQA 3TGUD 2ZVOB 2N9YB 3HD7A 3AEDC 1SVFA 1L4AC 4UB8E 1E79H 2LR2A 5E79E 4TLFA 1GL2D 1OVVA 5AW0B 5KLVE 1BDCA 3CX5E 5APSA 3U1AA 1PPJE 1OW6A 3TF5A 4D6TJ 3A5TA 1CZQA 1OZHA 2A06E 4IL6H 1TU3F 1YJWP 3S9OA 1L4AA 1QVFO 5CCGD 3JSVC 5AVWB 2O1KA 3BRVB 3O6QB 4L76A 1YHQP 4GDOA 2A45I 3CWBG 4HJGH 4BRYA 1JUNA 4PV1B 4YXDC 5AW8B 3AECC 4N6JA 1JY2P 2IBZD 3CXHD 1JCDA 3I5CA 3VMYA 3P8CE 1S3JA 3MIWA 1VL2A 1LWUB 1BE3D 3CC2P 2FYUG 2WSFJ 3NMDA 1PGQA 3H32B 1KB9E 4JQ0D 2MKVA 3L71D 1RH5B 2OGUA 2HG5D 1H8AA 1PL5A 5AVUB 1SQVJ 2V4HA 3B5NB 1YIJP 1AVOA 1JY3P 2KLUA 4HYTB 2ZYGA 4XFJA 1QGKB 2KS1A 3G9RA 3RL0B 3A3YB 2E75B 3TK1A 4U3FG 1ZP0C 1FDMA 3G6EP 5AVQB 3MD0A 1VQOP 3TGUE 3W67A 1UIXA 1Q81Q 1JMBA 2I1JA 1Z56A 3B8EB 4H44C 3IN6A 1PP9E 3WUUA 2POHA 1OW8A 2OYHB 2K1AA 3L75D 1BGYD 1N2DC 1A02F 5KJ7C 2OYIC 2ZT9C 2I8DA 1NTKG 2FXPA 2YXQB 3ITKA 4LLHA 5AW5B 2P7JA 3EWKA 4PD4I 1WT6A 5GTIH 4I6MC 1N8RQ 1SQQG 5APYA 2QJYB 2CK3H 5L8RJ 1YJ9P 2IBZE 5KJ7A 2OYIA 2YO2A 3D6YA 2H88C 1L0LE 5CCHC 1RQVA 1EZVI 1KILC 3MP7B 1IFJA 5AW3B 1BE3E 3WMM0 1IFNA 3B4SA 1SS1A 4R4MA 3KHUA 1IFIA 2HLOA 3HTKA 3VP9A 4ZKUA 4RKUJ 5CCHA 3CPWO 2YMKA 3CCJP 5KLVG 2FKWB 3HRNA 2PRRA 3GF3A 3SFDC 1GK4A 4A7PA 3TGUJ 2KOGA 1HVVA 1NYHA 1PPJG 1FZBA 2A06G 3ABVC 1NOHA 1PFIA 1H0TB 1GW3A 1SQBG 5C39A 1RY3A 3CWBD 1KD1Q 3V2QA 3QWOC 1S5LE 3AE3C 2WWWA 3MHVA 3WUVA 3G4SP 1IFMA 1JEKA 3L72G 4DT0A 2KZIA 5AW7B 1XTCC 2WSFH 1BCCD 2QVAA 2N1TC 5BVZA 1ZV8A 4B86A 4DZOA 2O01N 1BGYE 2B87A 4OGQD 1AVYA 3NXSA 2AEFA 2FYUD 4RJTA 2C0XA 3KDPB 3VOPA 5AVRB 3PHLA 1N86A 4WVZA 2WSEJ 1GL2C 1QEXA 4H0LD 2G8YA 4DJGA 1EC5A 4Z1MH 2O1JA 2IDBA 2MJZA 3V6IA 1URQB 2E43A 4H13B 4U3FD 1IZNB 1BE3J 2K9JB 3R4YA 4AYCA 2E5YA 3PH0A 1P84I 1FE6A 5B5EE 2KZJA 3H1LG 3T97A 1GL2A 3L71J 1DEBA 2K37A 1AA0A 1DD4A 2CPBA 1NH4A 4JYBA 1KTMA 1IFDA 3D70A 1T6AA 1L4AB 1IK9A 4L73A 4LGDE 3A2AA 2AXCA 2B88A 3K5BA 4BRYB 3N4XA 1PP9G 4MN4C 1KORA 3SSUA 1N7SC 1MZ9A 3GW6A 2Q3IA 1HJBA 1JTHA 1VQLP 5KLIC 3CWBE 3D6ZA 4U7JA 1SQQD 3RK2D 2YO3A 2QJKC 1RF1C 1RQUA 3AE6C 1QL2A 1N7SA 3D71A 2A45H 1VDFA 3L75J 1BGYJ 1NO4A 1NTMG 1RHZB 4NPDA 3F89A 3V5BA 2AEJA 2FYUE 1JM0A 1NKNA 5CBNA 1L0LG 5DJTB 1RF1A 2M5AB 1R8EA 1SFCD 2W27A 2NPSB 1M1JC 1KYOH 2AXTH 2BASA 3LIDA 1SQVK 4OVNF 3RL0g 5CJ4A 4CPGA 1GDTA 1KQFB 3HUSB 5KLVD 1VQ5P 3L70G 1SQXG 4BXLA 2HPCA 1PPJD 2E76D 1M1JA 1VF5B 3GG2A 2A06D 2BCCG 1OWAA 1SQBD 1NHLA 1G1IA 5B66H 1RE3C 2JKVA 2C0WA 3TNUA 5KLVK 2C9LY 1GMJA 1HBWA 1YI2P 4XA4A 2OTKE 1NVOA 1VPCA 2RN0A 1YYCA 2QG4A 2P58A 3P8MC 1HJ0A 1RE3A 2QEXP 2WSEH 1T2KD 3CXHH 2IFMA 3CWBJ 1NTKE 3L74E 3P8CD 3JC22 4L74A 2KNCB 4JBZA 3V4WA 3E1IA 1SQQE 1MFZA 2OTLP 5AVTB 2J59M 1HTLC 1YQ4C 1BCCJ 3E1RA 1PZQA 3QH9A 5KAIE 5M1BA 1VQ8P 1LT9C 3BASA 2FYZA 1J1DC 3CX5I 2FYUJ 2QJPC 2R32A 4PV1D 2KXPB 1FZFA 1JO5A 1KILB 3AE1C 3PP5A 1W5CE 5AVYB 1PIXA 2HFED 2XKMA 2V7QJ 3AEBC 1LT9A 3GLMA 1JMMA 1VQ6P 1IFPA 1X79B 1H88A 4U3FJ 1Q82Q 3CCVP 2WSSH 5CJ0A 1MFTA 1PP9D 4UB6H 2PFXA 1ZLLA 3IAOA 3I56P 2K88A 1FJKA 5AVVB 4C7NA 3B5ND 3L73E 1SQBE 2PGDA 3IFMA 5AW2B 3RL0D 2GA1A 2WITA 1DX7A 2E75D 3H1JG 3L72E 1KB9I 3PJSK 4KHXA 1KILE 2W8ZA 1SLQA 2XZRA 5AVSB 4M3LA 3CCEP 1NGMB 1FZCB 1NTMD 2KUBA 1BDDA 5KKZC 4GOEA 4KJMA 2HODB 2N1TB 2O01H 2D2CC 1L0LD 2WSCJ 1AQ5A 1SQQJ 4DCKA 2P67A 1KYOI 1M90Q 1S72P 1SQPG 3RK3B 4PJ0H 2JDIH 3LIEA 4W80A 1L0LK 3L70D 2JR8A 5AW1B 1SQXD 3AEGC 4N78D 1KQSO 3CMAP 1M57D 1Q7YQ 2BCCD 2QSIA 1J1EB 3H1LE 1OVUA 1FBMA 5TISE 2E74B 1HWTC 3Q1MA 3Q2YA 2FYNC 3JCUE 1P84H 1SQXK 1ZXGA 5KLVJ 2YIUC 3WU2E 3KYQA 3OA7A 1ZR4A 3A0BH 4JPZB 2ZFCA 1T3UA 1XTGB 2IBZI 3GHGC 3BATA 1G2CA 3RK3E 3CXHI 3OJAB 3SWYA 4WY4C 1SQBJ 2Q3EA 3PLNA 2KB7P 3MGNA 2XNDH 3MUDA 1YITP 3L74G 3V2NA 5KLIB 3H1IG 5GTHH 1YBKA 3GHGA 4WY4A 3EFGA 5H2FH 1VQ9P 1NTME 2P10A 2PP6A 5AW4B 1SFCA 1L0NE 3FWLA 4WBAA 2W6BA 2J58A 2IX7C 3B71A 1N73C 1RF0C 3C1LA 2XV5A 3TDKA 3C9IA 4IOIH 3Q3DA 3WUTA 1ZRTD 3L70E 1Y8AA 2JWAA 1SQXE 3G3ZA 3KZIH 4N78E 4PD4E 3A0HH 1CI6B 2NRGA 1N73A 2BCCE 3SWKA 1RF0A 1RE4C 3HE5B 3Q5RA 4EOTA 4L75A 1NJIQ 5APQA 1URQD 3L73G 1FDIA 1QLED 3CL3D 4H13D 1NTZG 2M3EA 2O3JA 2P2UA 3M9BA 3ZDMA 3LW5J 3RBXA 3IF4A 1IC2A 1PGOA 1PP9J 2WSCH 1FZAA 1G1JA 3A7OA 1QVGO 2Z4EA 1ZMEC 2B89A 1RE4A 4NPEA 1PV3A 5KAFH 4W7ZA 2KSJA 2W90A 4PV1C 1PGPA 3L35A 4YPCA 1L4AD 4JF7A 1EXIA 4OH8B 1VQ4P 2K9YA 3M91A 2YKOA 2E42A 3Q5PA 1YTZT 3AE8C 4IL6E 3USSA 1OIPA 4EYYQ 1AQTA 1NTMJ 3O6QA 3CCSP 1GU4A 1T3JA 3BVHA 1Q86Q 2W83C 5KTBA 1L0LJ 2FYUK 2LXBA 5AW6B 4UB8H 3HD7B 2DW3A 4GKGA 4I2LC 2LXCB 5E79H 3G71P 1LT9B 4YTPC 3CX5H 2A45G 1ZW0A 3AE5C 5CCGC 2NZ2A 1LWUA 2GUVA 3F5HA 1JCCA 3SFEC 4ZNCA 1HGVA 3L70J 2E75C 1SQXJ 1ZRTE 3H32A 2M0BA 2BCCJ 2NPSD 2M3BA 2OYOA 1BSHA 5CCGA 4O9BA 2XU6A 1LTGC 1LTJC 1NTKD 3L74D 3H1ID 3VTPC 2H89C 3H1JE 1GD2E 1LNQA 3M06A 4KT0J 3FXDA 2IYOA 1FS0E 1VF5D 1GTWA 3PTZA 1FDOA 1KB9H 2C9NY 3NFQA 1NTKK 1LTJA 3H6PA 5KKZB 1FOSF 3CC7P 2N9BA 1SQQK 1LT1A 2J5UA 2D2CB 3P32A 2WPQA 2KIKA 1L0NG 1SQPE 2KS1B 1X0TA 2KLVA 2FFDC 1KV4A 3PRJA 5DJUB 1EDJA 5KJ7D 4JYCA 4AUWA 3FXEA 3M9HA 5GTIE 3IR9A 4DOJA 1Q90D 4N3YB 3LW5H 3TYYA 5APTA 2FFDA 1VQPP 3FGAD 4GODA 1EXJA 3CCRP 3L73D 5AVXB 3L71G 2SPZA 3AE2C 1NTZD 2WT7A 1G2CB 4ZKPA 4EDFA 1OMIA 2FYNB 2Q5UA 2JP3A 1SP4A 1M1KQ 1HUCA 1NU1G 3L72D 3H1HG 5CCHD 1KILD 4HKZH 1FC2C 1EZVG 2H8PD 1S5LX 1NWQA 3KXDA 4D6TE 4H44B 2WPSA 3BCCG 1SQBK 1YJNP 2ZAEB 1NAFA 3II6A 2W6JH 2M8RA 3UIAA 3H1IE 2OYIB 1GU5A 2Y0EA 2ZT9B 2ITAA 5AVZB 3M0AA 3KPEA 2WTYA 2QIWA 3L75G 3V2RA 1JY2N 2KYVA 3V2PA 1K05A 3E7KA 3HTKB 2IZ1A 2FBWC 3H1LD 4K35A 3OAKA 5CHXA 2IPPA 1URQC 3VMAA 1IO4A 4H13C 2N1TD 3AEEC 5APUA 3SWFA 4ASWA 1PGJA 1JY3N 3EFFK 1GK6A 1ZN5A 1BSNA 1S5LH 1EDLA 2FXOA 2YKQA 4HH2A 3M0DC 3RK3D 3VMZA 1URQA 4OGQC 2OQQA 2K9JA 3U59A 3M9QA 1NTZE 1GZLA 2B87B 1FJPA 4GT1A 4Y28J 1LP1A 3M0DA 2E74D 4H0LC 2Y0DA 3AEFC 1LTAC 1U7JA 1WMKA 4Y99C 3P7KA 5TJHA 1NTKJ 3L74J 3CCLP 1MKMA 3H1IJ 1OXZA 2YXRB 3KQGA 1L0ND 1WRGA 4IFFA 2GM4A 1JOCA 1KFMA 2RH0A 5BU5A 1DEEG 1UIIA 2QRXA 1NTMK 1M7LA 1U7MA 5B5EH 3C8VA 1BCCG 1N7SD 2W6AA 2YKPA 3H1KG 3T97B 1L0NK 1GL2B 2NPSC 3MTUE 1Y9BA 4PD4D 2KK7A 3HE4A 2ZVNB 2GUSA 2Q9IA 3CCMP 2WPVB 2XNXA 1T8ZA 3HUSC 2I1KA 4NPFX 3H25A 2M5AA 3RK2C 1NU1D 2NPSA 3H1HD 1VF5C 2R5BA 1JTHB 1EZVD 3MUDC 1VQNP 4WWIA 1KYOE 3BCCD 1OVRA 2AXTE 3CCQP 3HUSA 2CPSA 3L73J 4D6TG 1NTZJ 1NU1K 1A02J 1MV8A 1N7SB 1X9VA 2RKLA 1KQGB 1SFCC 2KSEA 1LTJB 3L72J 3R2PA 2Z5HA 2RMZA 2KI7B 3CMEP 4YXWH 2WZ7A 2ZJSE 3CD6P 2BEZF 3GF7A 1K04A 2QJKB 5B66E 1RF1B 2BEQD 1HF9A 4I1LA 3O8ZA 2V7QH 1EDIA 3VP8A 2E76C 2WPRA 3CI9A 5APVA 1HGZA 1M8OB 5AW9B 1VQKP 3CXHE 2HPCB 4I7ZC 2KNCA 3N7NA 2XDJA 1M1JB 3OW2O 2FFDB 1JNMA 2H43A 1X22A 5BU8B 1SQVG 2IYPA 1LTIC 2WT7B 2R5DA 2Y0CA 2Y9ZA 3TNUB 2WMMA 1LTSC 3H1LJ 3MZWB 2WVRA 1D7MA 2ZXXA 4GIFA 3S4RA 1LTBC 3L71E 1T2KC 2WQYC 1USEA 2R3SA 4RO0A 1KILA 3HD7D 3U1CA 3V4QA 3H1JD 1NU1E 3H1HE 1OFCX 1YQ3C 1EZVE 3BCCE 1P84D 2HR3A 2Q6QA 4HB1A 2JWDA 1ZR2A
chains in the Genus database with same CATH topology
3MD0A 1FOSF 2N9BA 1FZFA 1SQQK 1JO5A 1KILB 3PP5A 1YTZI 3P32A 2WPQA 5AVYB 2HFED 1S9KD 1JY2O 2XKMA 1FOSE 2I1JA 1FZCC 1LT9A 2KLVA 1Z56A 2FFDC 1JMMA 3B8EB 2ZXEB 1X79B 3VN0A 1H88A 2POHA 5KJ7D 4JYCA 5CJ0A 2OYHB 4AUWA 4IFDK 3M9HA 3IR9A 4DOJA 1LWUC 1N2DC 1ZLLA 1A02F 5KJ7C 4N3YB 2OYIC 1FJKA 3LW5H 5AVVB 1SQPK 4C7NA 3RK3C 3B5ND 2PAJA 3TYYA 1FZCA 5APTA 1J1DB 1FZEA 2FFDA 4LLHA 5AW5B 2P7JA 2HODA 1JY3O 5AVXB 2N1TA 3IFMA 1WT6A 2HYNA 3B5NC 5AW2B 3RL0D 2WT7A 4I6MC 1G2CB 5APYA 2WITA 1DX7A 4ZKPA 4KHXA 2Q5UA 3RL0C 1LTTC 1SP4A 3NTNA 5KJ7A 1HUCA 2OYIA 1SLQA 5CCHD 2XZRA 1J1EC 1KILD 4M3LA 5AVSB 2YO2A 4C7NB 1FZCB 2H8PD 1NWQA 3VYIA 2HODB 5CCHC 2WPSA 4AQRD 1W2EA 1SQBK 1KILC 3L4FA 2N1TB 2KP8A 2O01H 1IFJA 3B5NA 5AW3B 3VMXA 1NAFA 1AQ5A 3WMM0 3II6A 1IFNA 2P67A 2M8RA 3UIAA 2OYIB 1DH3A 1GU5A 1IFIA 2HLOA 3HTKA 3VP9A 4ZKUA 3RK3B 5AVZB 5APXA 3LIEA 1HH0A 2YNYA 4W80A 5CCHA 2OYHC 3M0AA 3KPEA 1L0LK 2WTYA 5AW1B 3V2RA 1JY2N 2FKWB 3HRNA 2KYVA 1GK4A 4N78D 3V2PA 2KOGA 1FAVA 2IFNA 1HVVA 1X8YA 3HTKB 1J1EB 1FBMA 1FZBA 1HWTC 1NOHA 1PFIA 4Y99B 3TSIA 1QL1A 1GW3A 1RY3A 2OYHA 3V2QA 1E5WA 3OAKA 5CHXA 2Z5IA 1S9KE 2WWWA 1SQXK 2IPPA 1URQC 1IFMA 1IO4A 3HE4B 2N1TD 3KYQA 3OA7A 5APUA 1LGHB 1ZR4A 3SWFA 1KQLA 1JY3N 1XTCC 2WSFH 5AW7B 4WY4D 1CSBA 1GK6A 2ZFCA 2N1TC 1ZN5A 5BVZA 1T3UA 1ZV8A 2H7HA 4B86A 1XTGB 3GHGC 3BATA 4DZOA 1G2CA 3OJAB 3SWYA 4WY4C 3NXSA 2YKQA 4HH2A 3M0DC 3RK3D 1FZGA 5APWA 3VMZA 1URQA 2C0XA 3L36A 3KDPB 4W7YA 2KB7P 3VOPA 5AVRB 3MGNA 3U59A 3M9QA 3MUDA 2P1JA 1N86A 3V2NA 1GZLA 2QM7A 1GL2C 4IFMA 3GHGA 1FJPA 1H89A 4GT1A 4WY4A 3EFGA 2O1JA 3M0DA 3RK2B 2MJZA 1URQB 4XE5B 1LTAC 1CW5A 2E43A 2PP6A 2FXMA 5AW4B 1MUUA 1FU1A 1SFCA 4AYCA 4Y99C 3P7KA 3BRTB 4WBAA 2W6BA 1NTZK 1OXZA 2J58A 3T97A 2IX7C 3KQGA 1GL2A 1IJDB 3GHGB 1DEBA 1CI6A 1N73C 4WY4B 2CPBA 1WRGA 4IFFA 2L5GB 1RF0C 2GM4A 1JOCA 1KFMA 3HE5A 1NH4A 5BU5A 4WB4A 4JYBA 1IFDA 2XV5A 3C9IA 1L4AB 1IK9A 1NTMK 1M7LA 1SFCB 2VRSA 2JEEA 4LGDE 3A2AA 1N7SD 2QM8A 2W6AA 2YKPA 3G3ZA 1L0NK 1GL2B 3L37A 3N4XA 4N78E 2LKMA 1NKZB 1N7SC 1MZ9A 1CI6B 2NPSC 3MTUE 1AFOA 1N73A 1KZUB 2Q3IA 1HJBA 1JTHA 1RF0A 1RE4C 3HE4A 3HE5B 5CMZA 4RESB 2JJLA 4EOTA 2GUSA 2Q9IA 3EQ2A 5APQA 2XNXA 3RK2D 2YO3A 1T8ZA 1URQD 2I1KA 3HUSC 3CL3D 1RF1C 1GW4A 2OARA 2P2UA 3M9BA 1N7LA 3HD7C 1QL2A 3RK2C 4EIJA 1IC2A 1N7SA 2NPSA 2R3CA 1FZAA 1G1JA 2A45H 1VDFA 2WSCH 3A7OA 4LC1A 1N73B 2Z4EA 1EQ7A 2R5BA 1JTHB 1RE4A 1NO4A 2Q7CA 2YMYA 4W7ZA 2KSJA 1J2JB 4C7RA 4C46A 1KFNA 3V5BA 3HUSA 3CLQA 1NKNA 3L35A 2CPSA 1RF1A 1L4AD 4JF7A 1SFCD 4OH8B 2W27A 1NU1K 3HD7A 3M91A 1A02J 1MV8A 2YKOA 1N7SB 2NPSB 1X9VA 1M1JC 2E42A 1SVFA 1YTZT 1L4AC 1SFCC 1LTJB 2BASA 1GL2D 3LIDA 1SQVK 5AW0B 5CJ4A 3R2PA 2Z5HA 1GDTA 2WZ7A 1GU4A 1T3JA 3HUSB 3BVHA 5APSA 3U1AA 1RF1B 5KTBA 2FYUK 4I1LA 5AW6B 3A5TA 1CZQA 3HD7B 3O8ZA 4GKGA 2HPCA 4I2LC 1LT9B 1M1JA 1L4AA 5CCGD 3VP8A 1OWAA 5AVWB 2O1KA 3BRVB 2A45G 2WPRA 1NHLA 1G1IA 1RE3C 3CI9A 5APVA 2C0WA 1HGZA 5CCGC 2A45I 3TNUA 5KLVK 1JUNA 2C9LY 1HBWA 1LWUA 2GUVA 4XA4A 5AW9B 1JCCA 1HGVA 1VPCA 2HPCB 5AW8B 3N7NA 1YYCA 2XDJA 4N6JA 1JY2P 1M1JB 3H32A 2FFDB 1JNMA 2H43A 1JCDA 3I5CA 5BU8B 1LTIC 3P8MC 2WT7B 2NPSD 2M3BA 2R5DA 3VMYA 3P8CE 1RE3A 3MIWA 3TNUB 5CCGA 4O9BA 1LTSC 2WSEH 1T2KD 2IFMA 1LWUB 3P8CD 2XU6A 4GIFA 1LTGC 1LTBC 1LTJC 3NMDA 3V4WA 1T2KC 3E1IA 3H32B 3VTPC 1MFZA 5AVTB 1GD2E 2J59M 3M06A 2HG5D 1HTLC 1H8AA 1KILA 3HD7D 5AVUB 3B5NB 3U1CA 3V4QA 1JY3P 4HYTB 1GTWA 3RL0B 1LT9C 3BASA 2FYZA 3A3YB 1J1DC 2C9NY 3NFQA 1NTKK 3TK1A 2R32A 1LTJA 3H6PA 1FDMA 1ZR2A 5AVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W80 A;  5CCH A;  1KIL B;  3PP5 A;  2WZ7 A;  1GL2 A;  1T3J A;  4WY4 B;  2HFE D;  3HD7 B;  2KOG A;  1HVV A;  3HTK B;  1L4A A;  1L4A B;  1SFC B;  5CCG D;  3TSI A;  4LGD E;  1N7S D;  1NHL A;  5KJ7 D;  5CCG C;  1GL2 B;  4N78 E;  1URQ C;  1N7S C;  2NPS C;  5KJ7 C;  1JTH A;  2N1T D;  3KYQ A;  2XDJ A;  3B5N D;  3RK3 C;  4WY4 D;  2N1T C;  2N1T A;  3RK2 D;  3B5N C;  1XTG B;  3RL0 D;  1URQ D;  2NPS D;  3P8C E;  4WY4 C;  5CCG A;  3HD7 C;  3M0D C;  3RK2 C;  3RK3 D;  3RL0 C;  1URQ A;  1N7S A;  2NPS A;  4W7Y A;  5KJ7 A;  5CCH D;  1JTH B;  3VOP A;  1KIL D;  2H8P D;  2YMY A;  4W7Z A;  5CCH C;  1KIL C;  2HG5 D;  2N1T B;  1KIL A;  3HD7 D;  1GL2 C;  3B5N A;  3B5N B;  4WY4 A;  1L4A D;  4JF7 A;  1SFC D;  4OH8 B;  3HD7 A;  2M8R A;  3RK2 B;  3RL0 B;  1URQ B;  1N7S B;  2NPS B;  2PP6 A;  1L4A C;  1SFC C;  1SFC A;  1GL2 D;  3RK3 B; 
#chains in the Genus database with same CATH topology
 5KAI H;  1YTZ I;  2UWJ E;  1KN7 A;  4OWF A;  1S9K D;  1JY2 O;  4UB6 E;  1FOS E;  1FZC C;  1SQP D;  2ZXE B;  3VN0 A;  3L75 E;  3H1K D;  4IFD K;  1IK7 A;  1LWU C;  1NAY A;  1L0N J;  3RBZ A;  1SQP K;  3RK3 C;  1FZC A;  2PAJ A;  1J1D B;  1FZE A;  2ZYD A;  3FX0 A;  2QJP B;  2HOD A;  1JY3 O;  5EFW B;  2N1T A;  2HYN A;  3B5N C;  3CCU P;  2OTJ P;  4R4L A;  3Q5S A;  3FWN A;  3RL0 C;  1LTT C;  3NTN A;  1J1E C;  4TT3 H;  4C7N B;  1Q2N A;  2E74 C;  2D2C D;  2JO1 A;  3VYI A;  4AQR D;  1W2E A;  3L4F A;  4PJ0 E;  2KP8 A;  3B5N A;  3VMX A;  4D6T D;  3I55 P;  2QA4 P;  3TGU G;  1LP1 B;  1KC8 Q;  4OGQ B;  1DH3 A;  1S4X A;  1NU1 J;  3H1H J;  5APX A;  1USD A;  1HH0 A;  1ZOY C;  2YNY A;  2OYH C;  1S1C X;  3BCC J;  2B9B A;  1K9M Q;  2ZYA A;  1K73 Q;  3AE4 C;  2R44 A;  1P84 E;  3W68 A;  4H0L B;  1FAV A;  2IFN A;  2Q1K A;  1X8Y A;  3CC4 P;  3A0B E;  4Y99 B;  3TSI A;  1W2B O;  1QL1 A;  2OYH A;  2QJY C;  1E5W A;  2Z5I A;  1S9K E;  1DIP A;  2G3A A;  2QE7 H;  4H44 D;  1LJ2 A;  3HE4 B;  1BCC E;  5TIS H;  1LGH B;  3H1K E;  1KQL A;  1SQV D;  2IBZ G;  4WY4 D;  1CSB A;  1AV1 A;  2H7H A;  1EDK A;  3JCU H;  1OW7 A;  5GTH E;  3WU2 H;  4EI2 A;  2ZT9 D;  1FZG A;  5APW A;  1S2E A;  3L36 A;  4W7Y A;  1BE3 G;  5H2F E;  2O01 J;  2P1J A;  3AE9 C;  1VQM P;  2QM7 A;  2Y9Y A;  1K8A Q;  1R5L A;  4IFM A;  1H89 A;  2FY8 A;  3CX5 D;  4U3F E;  3RK2 B;  4XE5 B;  1CW5 A;  2FXM A;  2AEM A;  2YIU B;  1MUU A;  1FU1 A;  3BRT B;  1R5S A;  5CBO A;  3GMA A;  1NTZ K;  4ASV A;  3GHG B;  1IJD B;  1CI6 A;  4WY4 B;  1QX8 A;  2L5G B;  3KZI E;  3H1J J;  4K3A A;  4BWN A;  3A0H E;  2IZ0 A;  3HE5 A;  4WB4 A;  5K5G B;  3S1K A;  1KMI Z;  1SFC B;  2VRS A;  2JEE A;  2L91 A;  1H0T A;  2QM8 A;  4ZMD A;  3RGU A;  4QMA A;  3L37 A;  2LKM A;  4IL6 X;  1NKZ B;  1AFO A;  1BGY G;  1KZU B;  3AE7 C;  5CMZ A;  4RES B;  2JJL A;  2E5T A;  1JB0 J;  1SQP J;  3EQ2 A;  5KAF E;  1KB9 D;  4PD4 H;  2E76 B;  1GW4 A;  2OAR A;  3H1K J;  1VQ7 P;  1OX3 A;  3AEA C;  1N7L A;  3HD7 C;  4EIJ A;  2K3R A;  2R3C A;  1N73 B;  4LC1 A;  1AJY A;  1EQ7 A;  1SQV E;  4I7Z B;  2Q7C A;  2YMY A;  1DD3 A;  1L2P A;  1U57 A;  1J2J B;  4C7R A;  4C46 A;  1KFN A;  1KYO D;  1M56 D;  1Y47 A;  4GOF A;  3CLQ A;  3TGU D;  2ZVO B;  2N9Y B;  3HD7 A;  3AED C;  1SVF A;  1L4A C;  4UB8 E;  1E79 H;  2LR2 A;  5E79 E;  4TLF A;  1GL2 D;  1OVV A;  5AW0 B;  5KLV E;  1BDC A;  3CX5 E;  5APS A;  3U1A A;  1PPJ E;  1OW6 A;  3TF5 A;  4D6T J;  3A5T A;  1CZQ A;  1OZH A;  2A06 E;  4IL6 H;  1TU3 F;  1YJW P;  3S9O A;  1L4A A;  1QVF O;  5CCG D;  3JSV C;  5AVW B;  2O1K A;  3BRV B;  3O6Q B;  4L76 A;  1YHQ P;  4GDO A;  2A45 I;  3CWB G;  4HJG H;  4BRY A;  1JUN A;  4PV1 B;  4YXD C;  5AW8 B;  3AEC C;  4N6J A;  1JY2 P;  2IBZ D;  3CXH D;  1JCD A;  3I5C A;  3VMY A;  3P8C E;  1S3J A;  3MIW A;  1VL2 A;  1LWU B;  1BE3 D;  3CC2 P;  2FYU G;  2WSF J;  3NMD A;  1PGQ A;  3H32 B;  1KB9 E;  4JQ0 D;  2MKV A;  3L71 D;  1RH5 B;  2OGU A;  2HG5 D;  1H8A A;  1PL5 A;  5AVU B;  1SQV J;  2V4H A;  3B5N B;  1YIJ P;  1AVO A;  1JY3 P;  2KLU A;  4HYT B;  2ZYG A;  4XFJ A;  1QGK B;  2KS1 A;  3G9R A;  3RL0 B;  3A3Y B;  2E75 B;  3TK1 A;  4U3F G;  1ZP0 C;  1FDM A;  3G6E P;  5AVQ B;  3MD0 A;  1VQO P;  3TGU E;  3W67 A;  1UIX A;  1Q81 Q;  1JMB A;  2I1J A;  1Z56 A;  3B8E B;  4H44 C;  3IN6 A;  1PP9 E;  3WUU A;  2POH A;  1OW8 A;  2OYH B;  2K1A A;  3L75 D;  1BGY D;  1N2D C;  1A02 F;  5KJ7 C;  2OYI C;  2ZT9 C;  2I8D A;  1NTK G;  2FXP A;  2YXQ B;  3ITK A;  4LLH A;  5AW5 B;  2P7J A;  3EWK A;  4PD4 I;  1WT6 A;  5GTI H;  4I6M C;  1N8R Q;  1SQQ G;  5APY A;  2QJY B;  2CK3 H;  5L8R J;  1YJ9 P;  2IBZ E;  5KJ7 A;  2OYI A;  2YO2 A;  3D6Y A;  2H88 C;  1L0L E;  5CCH C;  1RQV A;  1EZV I;  1KIL C;  3MP7 B;  1IFJ A;  5AW3 B;  1BE3 E;  3WMM 0;  1IFN A;  3B4S A;  1SS1 A;  4R4M A;  3KHU A;  1IFI A;  2HLO A;  3HTK A;  3VP9 A;  4ZKU A;  4RKU J;  5CCH A;  3CPW O;  2YMK A;  3CCJ P;  5KLV G;  2FKW B;  3HRN A;  2PRR A;  3GF3 A;  3SFD C;  1GK4 A;  4A7P A;  3TGU J;  2KOG A;  1HVV A;  1NYH A;  1PPJ G;  1FZB A;  2A06 G;  3ABV C;  1NOH A;  1PFI A;  1H0T B;  1GW3 A;  1SQB G;  5C39 A;  1RY3 A;  3CWB D;  1KD1 Q;  3V2Q A;  3QWO C;  1S5L E;  3AE3 C;  2WWW A;  3MHV A;  3WUV A;  3G4S P;  1IFM A;  1JEK A;  3L72 G;  4DT0 A;  2KZI A;  5AW7 B;  1XTC C;  2WSF H;  1BCC D;  2QVA A;  2N1T C;  5BVZ A;  1ZV8 A;  4B86 A;  4DZO A;  2O01 N;  1BGY E;  2B87 A;  4OGQ D;  1AVY A;  3NXS A;  2AEF A;  2FYU D;  4RJT A;  2C0X A;  3KDP B;  3VOP A;  5AVR B;  3PHL A;  1N86 A;  4WVZ A;  2WSE J;  1GL2 C;  1QEX A;  4H0L D;  2G8Y A;  4DJG A;  1EC5 A;  4Z1M H;  2O1J A;  2IDB A;  2MJZ A;  3V6I A;  1URQ B;  2E43 A;  4H13 B;  4U3F D;  1IZN B;  1BE3 J;  2K9J B;  3R4Y A;  4AYC A;  2E5Y A;  3PH0 A;  1P84 I;  1FE6 A;  5B5E E;  2KZJ A;  3H1L G;  3T97 A;  1GL2 A;  3L71 J;  1DEB A;  2K37 A;  1AA0 A;  1DD4 A;  2CPB A;  1NH4 A;  4JYB A;  1KTM A;  1IFD A;  3D70 A;  1T6A A;  1L4A B;  1IK9 A;  4L73 A;  4LGD E;  3A2A A;  2AXC A;  2B88 A;  3K5B A;  4BRY B;  3N4X A;  1PP9 G;  4MN4 C;  1KOR A;  3SSU A;  1N7S C;  1MZ9 A;  3GW6 A;  2Q3I A;  1HJB A;  1JTH A;  1VQL P;  5KLI C;  3CWB E;  3D6Z A;  4U7J A;  1SQQ D;  3RK2 D;  2YO3 A;  2QJK C;  1RF1 C;  1RQU A;  3AE6 C;  1QL2 A;  1N7S A;  3D71 A;  2A45 H;  1VDF A;  3L75 J;  1BGY J;  1NO4 A;  1NTM G;  1RHZ B;  4NPD A;  3F89 A;  3V5B A;  2AEJ A;  2FYU E;  1JM0 A;  1NKN A;  5CBN A;  1L0L G;  5DJT B;  1RF1 A;  2M5A B;  1R8E A;  1SFC D;  2W27 A;  2NPS B;  1M1J C;  1KYO H;  2AXT H;  2BAS A;  3LID A;  1SQV K;  4OVN F;  3RL0 g;  5CJ4 A;  4CPG A;  1GDT A;  1KQF B;  3HUS B;  5KLV D;  1VQ5 P;  3L70 G;  1SQX G;  4BXL A;  2HPC A;  1PPJ D;  2E76 D;  1M1J A;  1VF5 B;  3GG2 A;  2A06 D;  2BCC G;  1OWA A;  1SQB D;  1NHL A;  1G1I A;  5B66 H;  1RE3 C;  2JKV A;  2C0W A;  3TNU A;  5KLV K;  2C9L Y;  1GMJ A;  1HBW A;  1YI2 P;  4XA4 A;  2OTK E;  1NVO A;  1VPC A;  2RN0 A;  1YYC A;  2QG4 A;  2P58 A;  3P8M C;  1HJ0 A;  1RE3 A;  2QEX P;  2WSE H;  1T2K D;  3CXH H;  2IFM A;  3CWB J;  1NTK E;  3L74 E;  3P8C D;  3JC2 2;  4L74 A;  2KNC B;  4JBZ A;  3V4W A;  3E1I A;  1SQQ E;  1MFZ A;  2OTL P;  5AVT B;  2J59 M;  1HTL C;  1YQ4 C;  1BCC J;  3E1R A;  1PZQ A;  3QH9 A;  5KAI E;  5M1B A;  1VQ8 P;  1LT9 C;  3BAS A;  2FYZ A;  1J1D C;  3CX5 I;  2FYU J;  2QJP C;  2R32 A;  4PV1 D;  2KXP B;  1FZF A;  1JO5 A;  1KIL B;  3AE1 C;  3PP5 A;  1W5C E;  5AVY B;  1PIX A;  2HFE D;  2XKM A;  2V7Q J;  3AEB C;  1LT9 A;  3GLM A;  1JMM A;  1VQ6 P;  1IFP A;  1X79 B;  1H88 A;  4U3F J;  1Q82 Q;  3CCV P;  2WSS H;  5CJ0 A;  1MFT A;  1PP9 D;  4UB6 H;  2PFX A;  1ZLL A;  3IAO A;  3I56 P;  2K88 A;  1FJK A;  5AVV B;  4C7N A;  3B5N D;  3L73 E;  1SQB E;  2PGD A;  3IFM A;  5AW2 B;  3RL0 D;  2GA1 A;  2WIT A;  1DX7 A;  2E75 D;  3H1J G;  3L72 E;  1KB9 I;  3PJS K;  4KHX A;  1KIL E;  2W8Z A;  1SLQ A;  2XZR A;  5AVS B;  4M3L A;  3CCE P;  1NGM B;  1FZC B;  1NTM D;  2KUB A;  1BDD A;  5KKZ C;  4GOE A;  4KJM A;  2HOD B;  2N1T B;  2O01 H;  2D2C C;  1L0L D;  2WSC J;  1AQ5 A;  1SQQ J;  4DCK A;  2P67 A;  1KYO I;  1M90 Q;  1S72 P;  1SQP G;  3RK3 B;  4PJ0 H;  2JDI H;  3LIE A;  4W80 A;  1L0L K;  3L70 D;  2JR8 A;  5AW1 B;  1SQX D;  3AEG C;  4N78 D;  1KQS O;  3CMA P;  1M57 D;  1Q7Y Q;  2BCC D;  2QSI A;  1J1E B;  3H1L E;  1OVU A;  1FBM A;  5TIS E;  2E74 B;  1HWT C;  3Q1M A;  3Q2Y A;  2FYN C;  3JCU E;  1P84 H;  1SQX K;  1ZXG A;  5KLV J;  2YIU C;  3WU2 E;  3KYQ A;  3OA7 A;  1ZR4 A;  3A0B H;  4JPZ B;  2ZFC A;  1T3U A;  1XTG B;  2IBZ I;  3GHG C;  3BAT A;  1G2C A;  3RK3 E;  3CXH I;  3OJA B;  3SWY A;  4WY4 C;  1SQB J;  2Q3E A;  3PLN A;  2KB7 P;  3MGN A;  2XND H;  3MUD A;  1YIT P;  3L74 G;  3V2N A;  5KLI B;  3H1I G;  5GTH H;  1YBK A;  3GHG A;  4WY4 A;  3EFG A;  5H2F H;  1VQ9 P;  1NTM E;  2P10 A;  2PP6 A;  5AW4 B;  1SFC A;  1L0N E;  3FWL A;  4WBA A;  2W6B A;  2J58 A;  2IX7 C;  3B71 A;  1N73 C;  1RF0 C;  3C1L A;  2XV5 A;  3TDK A;  3C9I A;  4IOI H;  3Q3D A;  3WUT A;  1ZRT D;  3L70 E;  1Y8A A;  2JWA A;  1SQX E;  3G3Z A;  3KZI H;  4N78 E;  4PD4 E;  3A0H H;  1CI6 B;  2NRG A;  1N73 A;  2BCC E;  3SWK A;  1RF0 A;  1RE4 C;  3HE5 B;  3Q5R A;  4EOT A;  4L75 A;  1NJI Q;  5APQ A;  1URQ D;  3L73 G;  1FDI A;  1QLE D;  3CL3 D;  4H13 D;  1NTZ G;  2M3E A;  2O3J A;  2P2U A;  3M9B A;  3ZDM A;  3LW5 J;  3RBX A;  3IF4 A;  1IC2 A;  1PGO A;  1PP9 J;  2WSC H;  1FZA A;  1G1J A;  3A7O A;  1QVG O;  2Z4E A;  1ZME C;  2B89 A;  1RE4 A;  4NPE A;  1PV3 A;  5KAF H;  4W7Z A;  2KSJ A;  2W90 A;  4PV1 C;  1PGP A;  3L35 A;  4YPC A;  1L4A D;  4JF7 A;  1EXI A;  4OH8 B;  1VQ4 P;  2K9Y A;  3M91 A;  2YKO A;  2E42 A;  3Q5P A;  1YTZ T;  3AE8 C;  4IL6 E;  3USS A;  1OIP A;  4EYY Q;  1AQT A;  1NTM J;  3O6Q A;  3CCS P;  1GU4 A;  1T3J A;  3BVH A;  1Q86 Q;  2W83 C;  5KTB A;  1L0L J;  2FYU K;  2LXB A;  5AW6 B;  4UB8 H;  3HD7 B;  2DW3 A;  4GKG A;  4I2L C;  2LXC B;  5E79 H;  3G71 P;  1LT9 B;  4YTP C;  3CX5 H;  2A45 G;  1ZW0 A;  3AE5 C;  5CCG C;  2NZ2 A;  1LWU A;  2GUV A;  3F5H A;  1JCC A;  3SFE C;  4ZNC A;  1HGV A;  3L70 J;  2E75 C;  1SQX J;  1ZRT E;  3H32 A;  2M0B A;  2BCC J;  2NPS D;  2M3B A;  2OYO A;  1BSH A;  5CCG A;  4O9B A;  2XU6 A;  1LTG C;  1LTJ C;  1NTK D;  3L74 D;  3H1I D;  3VTP C;  2H89 C;  3H1J E;  1GD2 E;  1LNQ A;  3M06 A;  4KT0 J;  3FXD A;  2IYO A;  1FS0 E;  1VF5 D;  1GTW A;  3PTZ A;  1FDO A;  1KB9 H;  2C9N Y;  3NFQ A;  1NTK K;  1LTJ A;  3H6P A;  5KKZ B;  1FOS F;  3CC7 P;  2N9B A;  1SQQ K;  1LT1 A;  2J5U A;  2D2C B;  3P32 A;  2WPQ A;  2KIK A;  1L0N G;  1SQP E;  2KS1 B;  1X0T A;  2KLV A;  2FFD C;  1KV4 A;  3PRJ A;  5DJU B;  1EDJ A;  5KJ7 D;  4JYC A;  4AUW A;  3FXE A;  3M9H A;  5GTI E;  3IR9 A;  4DOJ A;  1Q90 D;  4N3Y B;  3LW5 H;  3TYY A;  5APT A;  2FFD A;  1VQP P;  3FGA D;  4GOD A;  1EXJ A;  3CCR P;  3L73 D;  5AVX B;  3L71 G;  2SPZ A;  3AE2 C;  1NTZ D;  2WT7 A;  1G2C B;  4ZKP A;  4EDF A;  1OMI A;  2FYN B;  2Q5U A;  2JP3 A;  1SP4 A;  1M1K Q;  1HUC A;  1NU1 G;  3L72 D;  3H1H G;  5CCH D;  1KIL D;  4HKZ H;  1FC2 C;  1EZV G;  2H8P D;  1S5L X;  1NWQ A;  3KXD A;  4D6T E;  4H44 B;  2WPS A;  3BCC G;  1SQB K;  1YJN P;  2ZAE B;  1NAF A;  3II6 A;  2W6J H;  2M8R A;  3UIA A;  3H1I E;  2OYI B;  1GU5 A;  2Y0E A;  2ZT9 B;  2ITA A;  5AVZ B;  3M0A A;  3KPE A;  2WTY A;  2QIW A;  3L75 G;  3V2R A;  1JY2 N;  2KYV A;  3V2P A;  1K05 A;  3E7K A;  3HTK B;  2IZ1 A;  2FBW C;  3H1L D;  4K35 A;  3OAK A;  5CHX A;  2IPP A;  1URQ C;  3VMA A;  1IO4 A;  4H13 C;  2N1T D;  3AEE C;  5APU A;  3SWF A;  4ASW A;  1PGJ A;  1JY3 N;  3EFF K;  1GK6 A;  1ZN5 A;  1BSN A;  1S5L H;  1EDL A;  2FXO A;  2YKQ A;  4HH2 A;  3M0D C;  3RK3 D;  3VMZ A;  1URQ A;  4OGQ C;  2OQQ A;  2K9J A;  3U59 A;  3M9Q A;  1NTZ E;  1GZL A;  2B87 B;  1FJP A;  4GT1 A;  4Y28 J;  1LP1 A;  3M0D A;  2E74 D;  4H0L C;  2Y0D A;  3AEF C;  1LTA C;  1U7J A;  1WMK A;  4Y99 C;  3P7K A;  5TJH A;  1NTK J;  3L74 J;  3CCL P;  1MKM A;  3H1I J;  1OXZ A;  2YXR B;  3KQG A;  1L0N D;  1WRG A;  4IFF A;  2GM4 A;  1JOC A;  1KFM A;  2RH0 A;  5BU5 A;  1DEE G;  1UII A;  2QRX A;  1NTM K;  1M7L A;  1U7M A;  5B5E H;  3C8V A;  1BCC G;  1N7S D;  2W6A A;  2YKP A;  3H1K G;  3T97 B;  1L0N K;  1GL2 B;  2NPS C;  3MTU E;  1Y9B A;  4PD4 D;  2KK7 A;  3HE4 A;  2ZVN B;  2GUS A;  2Q9I A;  3CCM P;  2WPV B;  2XNX A;  1T8Z A;  3HUS C;  2I1K A;  4NPF X;  3H25 A;  2M5A A;  3RK2 C;  1NU1 D;  2NPS A;  3H1H D;  1VF5 C;  2R5B A;  1JTH B;  1EZV D;  3MUD C;  1VQN P;  4WWI A;  1KYO E;  3BCC D;  1OVR A;  2AXT E;  3CCQ P;  3HUS A;  2CPS A;  3L73 J;  4D6T G;  1NTZ J;  1NU1 K;  1A02 J;  1MV8 A;  1N7S B;  1X9V A;  2RKL A;  1KQG B;  1SFC C;  2KSE A;  1LTJ B;  3L72 J;  3R2P A;  2Z5H A;  2RMZ A;  2KI7 B;  3CME P;  4YXW H;  2WZ7 A;  2ZJS E;  3CD6 P;  2BEZ F;  3GF7 A;  1K04 A;  2QJK B;  5B66 E;  1RF1 B;  2BEQ D;  1HF9 A;  4I1L A;  3O8Z A;  2V7Q H;  1EDI A;  3VP8 A;  2E76 C;  2WPR A;  3CI9 A;  5APV A;  1HGZ A;  1M8O B;  5AW9 B;  1VQK P;  3CXH E;  2HPC B;  4I7Z C;  2KNC A;  3N7N A;  2XDJ A;  1M1J B;  3OW2 O;  2FFD B;  1JNM A;  2H43 A;  1X22 A;  5BU8 B;  1SQV G;  2IYP A;  1LTI C;  2WT7 B;  2R5D A;  2Y0C A;  2Y9Z A;  3TNU B;  2WMM A;  1LTS C;  3H1L J;  3MZW B;  2WVR A;  1D7M A;  2ZXX A;  4GIF A;  3S4R A;  1LTB C;  3L71 E;  1T2K C;  2WQY C;  1USE A;  2R3S A;  4RO0 A;  1KIL A;  3HD7 D;  3U1C A;  3V4Q A;  3H1J D;  1NU1 E;  3H1H E;  1OFC X;  1YQ3 C;  1EZV E;  3BCC E;  1P84 D;  2HR3 A;  2Q6Q A;  4HB1 A;  2JWD A;  1ZR2 A; 
#chains in the Genus database with same CATH homology
 3MD0 A;  1FOS F;  2N9B A;  1FZF A;  1SQQ K;  1JO5 A;  1KIL B;  3PP5 A;  1YTZ I;  3P32 A;  2WPQ A;  5AVY B;  2HFE D;  1S9K D;  1JY2 O;  2XKM A;  1FOS E;  2I1J A;  1FZC C;  1LT9 A;  2KLV A;  1Z56 A;  2FFD C;  1JMM A;  3B8E B;  2ZXE B;  1X79 B;  3VN0 A;  1H88 A;  2POH A;  5KJ7 D;  4JYC A;  5CJ0 A;  2OYH B;  4AUW A;  4IFD K;  3M9H A;  3IR9 A;  4DOJ A;  1LWU C;  1N2D C;  1ZLL A;  1A02 F;  5KJ7 C;  4N3Y B;  2OYI C;  1FJK A;  3LW5 H;  5AVV B;  1SQP K;  4C7N A;  3RK3 C;  3B5N D;  2PAJ A;  3TYY A;  1FZC A;  5APT A;  1J1D B;  1FZE A;  2FFD A;  4LLH A;  5AW5 B;  2P7J A;  2HOD A;  1JY3 O;  5AVX B;  2N1T A;  3IFM A;  1WT6 A;  2HYN A;  3B5N C;  5AW2 B;  3RL0 D;  2WT7 A;  4I6M C;  1G2C B;  5APY A;  2WIT A;  1DX7 A;  4ZKP A;  4KHX A;  2Q5U A;  3RL0 C;  1LTT C;  1SP4 A;  3NTN A;  5KJ7 A;  1HUC A;  2OYI A;  1SLQ A;  5CCH D;  2XZR A;  1J1E C;  1KIL D;  4M3L A;  5AVS B;  2YO2 A;  4C7N B;  1FZC B;  2H8P D;  1NWQ A;  3VYI A;  2HOD B;  5CCH C;  2WPS A;  4AQR D;  1W2E A;  1SQB K;  1KIL C;  3L4F A;  2N1T B;  2KP8 A;  2O01 H;  1IFJ A;  3B5N A;  5AW3 B;  3VMX A;  1NAF A;  1AQ5 A;  3WMM 0;  3II6 A;  1IFN A;  2P67 A;  2M8R A;  3UIA A;  2OYI B;  1DH3 A;  1GU5 A;  1IFI A;  2HLO A;  3HTK A;  3VP9 A;  4ZKU A;  3RK3 B;  5AVZ B;  5APX A;  3LIE A;  1HH0 A;  2YNY A;  4W80 A;  5CCH A;  2OYH C;  3M0A A;  3KPE A;  1L0L K;  2WTY A;  5AW1 B;  3V2R A;  1JY2 N;  2FKW B;  3HRN A;  2KYV A;  1GK4 A;  4N78 D;  3V2P A;  2KOG A;  1FAV A;  2IFN A;  1HVV A;  1X8Y A;  3HTK B;  1J1E B;  1FBM A;  1FZB A;  1HWT C;  1NOH A;  1PFI A;  4Y99 B;  3TSI A;  1QL1 A;  1GW3 A;  1RY3 A;  2OYH A;  3V2Q A;  1E5W A;  3OAK A;  5CHX A;  2Z5I A;  1S9K E;  2WWW A;  1SQX K;  2IPP A;  1URQ C;  1IFM A;  1IO4 A;  3HE4 B;  2N1T D;  3KYQ A;  3OA7 A;  5APU A;  1LGH B;  1ZR4 A;  3SWF A;  1KQL A;  1JY3 N;  1XTC C;  2WSF H;  5AW7 B;  4WY4 D;  1CSB A;  1GK6 A;  2ZFC A;  2N1T C;  1ZN5 A;  5BVZ A;  1T3U A;  1ZV8 A;  2H7H A;  4B86 A;  1XTG B;  3GHG C;  3BAT A;  4DZO A;  1G2C A;  3OJA B;  3SWY A;  4WY4 C;  3NXS A;  2YKQ A;  4HH2 A;  3M0D C;  3RK3 D;  1FZG A;  5APW A;  3VMZ A;  1URQ A;  2C0X A;  3L36 A;  3KDP B;  4W7Y A;  2KB7 P;  3VOP A;  5AVR B;  3MGN A;  3U59 A;  3M9Q A;  3MUD A;  2P1J A;  1N86 A;  3V2N A;  1GZL A;  2QM7 A;  1GL2 C;  4IFM A;  3GHG A;  1FJP A;  1H89 A;  4GT1 A;  4WY4 A;  3EFG A;  2O1J A;  3M0D A;  3RK2 B;  2MJZ A;  1URQ B;  4XE5 B;  1LTA C;  1CW5 A;  2E43 A;  2PP6 A;  2FXM A;  5AW4 B;  1MUU A;  1FU1 A;  1SFC A;  4AYC A;  4Y99 C;  3P7K A;  3BRT B;  4WBA A;  2W6B A;  1NTZ K;  1OXZ A;  2J58 A;  3T97 A;  2IX7 C;  3KQG A;  1GL2 A;  1IJD B;  3GHG B;  1DEB A;  1CI6 A;  1N73 C;  4WY4 B;  2CPB A;  1WRG A;  4IFF A;  2L5G B;  1RF0 C;  2GM4 A;  1JOC A;  1KFM A;  3HE5 A;  1NH4 A;  5BU5 A;  4WB4 A;  4JYB A;  1IFD A;  2XV5 A;  3C9I A;  1L4A B;  1IK9 A;  1NTM K;  1M7L A;  1SFC B;  2VRS A;  2JEE A;  4LGD E;  3A2A A;  1N7S D;  2QM8 A;  2W6A A;  2YKP A;  3G3Z A;  1L0N K;  1GL2 B;  3L37 A;  3N4X A;  4N78 E;  2LKM A;  1NKZ B;  1N7S C;  1MZ9 A;  1CI6 B;  2NPS C;  3MTU E;  1AFO A;  1N73 A;  1KZU B;  2Q3I A;  1HJB A;  1JTH A;  1RF0 A;  1RE4 C;  3HE4 A;  3HE5 B;  5CMZ A;  4RES B;  2JJL A;  4EOT A;  2GUS A;  2Q9I A;  3EQ2 A;  5APQ A;  2XNX A;  3RK2 D;  2YO3 A;  1T8Z A;  1URQ D;  2I1K A;  3HUS C;  3CL3 D;  1RF1 C;  1GW4 A;  2OAR A;  2P2U A;  3M9B A;  1N7L A;  3HD7 C;  1QL2 A;  3RK2 C;  4EIJ A;  1IC2 A;  1N7S A;  2NPS A;  2R3C A;  1FZA A;  1G1J A;  2A45 H;  1VDF A;  2WSC H;  3A7O A;  4LC1 A;  1N73 B;  2Z4E A;  1EQ7 A;  2R5B A;  1JTH B;  1RE4 A;  1NO4 A;  2Q7C A;  2YMY A;  4W7Z A;  2KSJ A;  1J2J B;  4C7R A;  4C46 A;  1KFN A;  3V5B A;  3HUS A;  3CLQ A;  1NKN A;  3L35 A;  2CPS A;  1RF1 A;  1L4A D;  4JF7 A;  1SFC D;  4OH8 B;  2W27 A;  1NU1 K;  3HD7 A;  3M91 A;  1A02 J;  1MV8 A;  2YKO A;  1N7S B;  2NPS B;  1X9V A;  1M1J C;  2E42 A;  1SVF A;  1YTZ T;  1L4A C;  1SFC C;  1LTJ B;  2BAS A;  1GL2 D;  3LID A;  1SQV K;  5AW0 B;  5CJ4 A;  3R2P A;  2Z5H A;  1GDT A;  2WZ7 A;  1GU4 A;  1T3J A;  3HUS B;  3BVH A;  5APS A;  3U1A A;  1RF1 B;  5KTB A;  2FYU K;  4I1L A;  5AW6 B;  3A5T A;  1CZQ A;  3HD7 B;  3O8Z A;  4GKG A;  2HPC A;  4I2L C;  1LT9 B;  1M1J A;  1L4A A;  5CCG D;  3VP8 A;  1OWA A;  5AVW B;  2O1K A;  3BRV B;  2A45 G;  2WPR A;  1NHL A;  1G1I A;  1RE3 C;  3CI9 A;  5APV A;  2C0W A;  1HGZ A;  5CCG C;  2A45 I;  3TNU A;  5KLV K;  1JUN A;  2C9L Y;  1HBW A;  1LWU A;  2GUV A;  4XA4 A;  5AW9 B;  1JCC A;  1HGV A;  1VPC A;  2HPC B;  5AW8 B;  3N7N A;  1YYC A;  2XDJ A;  4N6J A;  1JY2 P;  1M1J B;  3H32 A;  2FFD B;  1JNM A;  2H43 A;  1JCD A;  3I5C A;  5BU8 B;  1LTI C;  3P8M C;  2WT7 B;  2NPS D;  2M3B A;  2R5D A;  3VMY A;  3P8C E;  1RE3 A;  3MIW A;  3TNU B;  5CCG A;  4O9B A;  1LTS C;  2WSE H;  1T2K D;  2IFM A;  1LWU B;  3P8C D;  2XU6 A;  4GIF A;  1LTG C;  1LTB C;  1LTJ C;  3NMD A;  3V4W A;  1T2K C;  3E1I A;  3H32 B;  3VTP C;  1MFZ A;  5AVT B;  1GD2 E;  2J59 M;  3M06 A;  2HG5 D;  1HTL C;  1H8A A;  1KIL A;  3HD7 D;  5AVU B;  3B5N B;  3U1C A;  3V4Q A;  1JY3 P;  4HYT B;  1GTW A;  3RL0 B;  1LT9 C;  3BAS A;  2FYZ A;  3A3Y B;  1J1D C;  2C9N Y;  3NFQ A;  1NTK K;  3TK1 A;  2R32 A;  1LTJ A;  3H6P A;  1FDM A;  1ZR2 A;  5AVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...