3RK2B

Truncated snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
59
structure length
59
Chain Sequence
SALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 26
structure length 59
sequence length 59
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk2B00
2WZ7A 3RK3D 1SFCA 1XTGB 3HTKB 4WY4C 1HVVA 1URQC 3VOPA 3RK2D 1N7SB 2HFED 3RL0C 3HD7C 3HD7A 4WY4B 1L4AD 5KJ7C 5KJ7D 5CCGC 3B5ND 1KILD 1SFCC 3PP5A 5KJ7A 3B5NA 5CCGA 3RK3C 1KILA 1JTHA 2XDJA 3RL0B 3HD7B 4W7YA 2H8PD 1GL2D 3RK2C 5CCHD 3B5NB 3KYQA 1JTHB 1GL2A 1SFCB 5CCHA 3RK3B 1L4AC 4W80A 3B5NC 1T3JA 4JF7A 1KILC 2KOGA 1GL2B 1L4AA 3RK2B 3M0DC 2N1TD 4N78E 2N1TA 2NPSC 2NPSD 1GL2C 2PP6A 5CCHC 1L4AB 2NPSA 1KILB 2HG5D 1N7SD 3TSIA 4OH8B 1N7SA 2M8RA 4LGDE 2NPSB 3P8CE 1NHLA 4WY4D 2N1TC 2YMYA 4WY4A 1URQD 4W7ZA 1URQA 3HD7D 3RL0D 1N7SC 5CCGD 2N1TB 1SFCD 1URQB
chains in the Genus database with same CATH superfamily
1HJBA 3GW6A 3CX5E 4Y28J 1SQQJ 2FYUK 2A06D 2WSSH 1SQXD 3IFMA 3S1KA 2QJPC 2OQQA 1S2EA 4N6JA 1JEKA 1JY3P 2YO2A 4H13B 3Q2YA 3USSA 2C9LY 3B4SA 2KIKA 1M90Q 2HYNA 3P7KA 3SSUA 3O8ZA 5CCHD 1G2CA 1MV8A 1OW8A 3NTNA 3L75G 4N3YB 1L4AC 2P67A 3O6QA 3ZDMA 1NTZK 2HODB 3M0AA 5TISH 1L4AA 3H1HE 1NAFA 4N78E 4YXDC 1OW7A 2IZ0A 3G3ZA 2K9YA 1ZP0C 5CBOA 2FYUD 4AUWA 1NTZJ 3A2AA 4RO0A 2QRXA 2ZT9B 3AE3C 1BSNA 4RESB 1IO4A 1J2JB 1RY3A 1NU1K 3FWNA 5AW9B 3L70D 5APXA 3HUSB 2QA4P 1FAVA 5GTHE 1S5LH 3AEAC 2OTJP 1CI6B 3MIWA 1XTGB 5KLVG 1X9VA 2KZIA 3CWBE 1NTZD 1KQSO 1AA0A 2O3JA 1URQC 3BRVB 1YITP 1K05A 1KQLA 1NTME 3Q5RA 2ZYGA 3MTUE 1BGYD 2W6BA 1LTSC 5KJ7D 3MP7B 3PP5A 1NAYA 1VQ7P 2M3BA 4D6TD 5GTIH 3H1JD 5AVQB 5AW0B 1AJYA 3MHVA 1GW4A 2JR8A 1OW6A 3CCSP 3CPWO 5DJTB 4H44C 1NU1D 4GODA 1N2DC 2Y0EA 2YMKA 2D2CD 2WPRA 4W80A 4JQ0D 2KOGA 2W27A 3TGUE 3AEEC 3M0DC 4PJ0H 1SQPK 1VQMP 2FYNC 2A06G 2HG5D 1SQXG 4U3FJ 2RH0A 1H8AA 1W2BO 1GU4A 3WUTA 3G9RA 3CCLP 2P58A 2I1KA 4ASWA 3L73E 1ZV8A 4BWNA 2GUVA 3JCUE 1URQB 3RK3D 1SFCA 2OYIC 3PLNA 4C7NB 1KC8Q 2HFED 4U3FD 5KLIB 2R32A 3BCCD 1GMJA 1SQPD 2FYUG 4WY4B 1PZQA 1QL2A 1X8YA 4IFDK 1EZVD 1JTHA 2M0BA 4HH2A 1NTKE 4Y99B 1N8RQ 2Y0CA 2H8PD 4IOIH 2QVAA 3RK2C 3A0BH 1K04A 1AQTA 2M3EA 1IFNA 1M1JC 3EFFK 3TDKA 4JF7A 1KILC 3L70G 5H2FE 2E75C 1IFPA 2FYNB 3L36A 2WSEJ 2NZ2A 1IFJA 1NTZG 2K3RA 3VMAA 1E79H 3PRJA 2QM8A 1N7SD 1P84E 1A02F 1H0TA 1BGYG 1AVYA 1KB9D 1BDDA 1LTAC 1PP9D 3II6A 1M56D 4D6TG 1S1CX 3P8CD 1IFMA 3CX5D 3EFGA 5AVWB 3H1JG 3CXHE 1KZUB 4JBZA 4H0LB 3H1HJ 1GU5A 1FZAA 5AW7B 4WBAA 1NU1G 1SQVK 4A7PA 2KLUA 1BCCD 2XV5A 5KKZB 2YXQB 2CPBA 3T97A 4IFMA 1T2KC 1EZVI 1LTJA 1FU1A 2BEQD 4JPZB 4EOTA 4ZKUA 2WPQA 1ZMEC 1YJ9P 4JYBA 1L0LE 1L4AD 1MUUA 5CJ4A 2W6AA 1KB9H 2JEEA 5B5EE 5APVA 1NKZB 1RQUA 4WWIA 1D7MA 1SS1A 3CX5H 1Y9BA 2E75B 2WITA 1FC2C 1USDA 3KZIH 1IJDB 1FZEA 4BRYA 1OFCX 2H43A 1SQVD 4C46A 5C39A 1NTMJ 2A45I 3TF5A 1AFOA 2R44A 1KB9I 2J59M 2Q3IA 1QVGO 1PGQA 2W90A 2WPVB 4BXLA 3M06A 1Q90D 4WVZA 4U3FG 4GOEA 2FXPA 3A5TA 3BCCG 4EDFA 1SQPG 3Q5SA 4HKZH 2N1TC 1J1DC 1URQD 1EZVG 1PPJD 1FJPA 3L71E 3CWBD 2KYVA 2KNCB 2Y0DA 3L72E 2HR3A 4JYCA 5AVXB 4PD4E 4XFJA 2WSFJ 3S9OA 3RBZA 2BCCE 2N9YB 2KLVA 2KS1B 2JKVA 3IF4A 3TGUJ 1JY2N 2JDIH 1EXIA 1DD4A 5B66H 1BDCA 3HTKB 3KPEA 2YIUC 3RL0C 5AW4B 2B88A 2I1JA 3QWOC 1VF5C 4H44D 3E1RA 3ITKA 1DEEG 1QL1A 2KXPB 1A02J 3VTPC 1LP1B 3FXDA 3SWYA 1RHZB 4TT3H 1RF0C 1S5LX 1ZOYC 1PP9G 3L73J 4KT0J 3KQGA 1HBWA 1KV4A 1M8OB 1R8EA 1HUCA 5BU5A 2OYHA 1NVOA 2MKVA 1YQ4C 3TNUA 2IBZE 1NTKK 2HPCB 1M7LA 2Q7CA 2XZRA 1BCCG 1M57D 2QJKB 1J1EB 2B87A 1AVOA 2Q1KA 1PGPA 2RKLA 1BE3D 1KYOD 4K3AA 2NPSB 1NYHA 1X22A 3IN6A 2BASA 2IPPA 3H1HG 5KTBA 2FFDC 1QLED 1L0NJ 4DT0A 1PGOA 1JB0J 3D70A 5CMZA 1RF1A 1X79B 3RK2D 1NTKD 1SQQK 4NPEA 2IYPA 1LGHB 1KORA 1GD2E 4XA4A 1VDFA 2K88A 2KZJA 4DOJA 3A0HH 4OVNF 3EQ2A 1KILD 1KYOH 2E75D 4UB8E 2E76C 1FJKA 4UB6H 2O01N 3GF7A 5CHXA 2E74C 5AW1B 4I1LA 4AQRD 1JY3N 3KYQA 1PPJG 5KAIH 3CWBG 3L74D 3RK3B 3CCEP 1L0LK 4L74A 2JWDA 1P84D 4EI2A 1VQPP 4GKGA 1S3JA 2FY8A 3HUSA 1KYOI 3TK1A 1FZBA 1L0LJ 3SWFA 2IX7C 3KDPB 1W5CE 2YKOA 3AE7C 1SQQD 4DZOA 3JC22 2WT7B 1USEA 2V7QJ 3PH0A 3RGUA 2YMYA 5AW8B 1QGKB 4EIJA 1LWUA 3H6PA 1NH4A 1T2KD 2ZJSE 1RE4A 1ZW0A 3CCQP 2CK3H 1NOHA 1IZNB 1NWQA 1HGZA 1L0LD 2Z5IA 2AEJA 2E43A 3LW5J 3H1LJ 1HH0A 1N7SB 3HD7C 1NGMB 2O01H 1ZR2A 1EQ7A 1IC2A 1PIXA 3HD7A 2JO1A 1FZCC 3CC7P 2R3CA 2Q5UA 2G8YA 1NKNA 1FZCA 3B5NA 3CCJP 1BE3G 3VN0A 3WU2H 1U57A 3L71J 2QIWA 2Q6QA 3V6IA 5E79E 3L72J 2AEMA 2QJPB 1YTZI 4EYYQ 2BCCJ 2AEFA 3KHUA 1GL2A 1KFMA 2Z4EA 3CC2P 1KQGB 5AW2B 2N1TD 2KB7P 1FDMA 5AVSB 2WTYA 1JM0A 5APQA 5AW3B 2NPSD 3OA7A 1L4AB 5AVUB 1Q81Q 3CMEP 3L71D 3L37A 1NTKG 1QX8A 4PD4D 1HJ0A 1Z56A 3B8EB 1RE3A 3L75E 4PV1C 5KAFE 4WY4A 5APUA 4U7JA 3RL0D 3GF3A 1VF5D 5EFWB 2QJYC 2K37A 1KTMA 1Y8AA 3L74G 3FGAD 1JMMA 2JWAA 4KJMA 1IFDA 4DCKA 3CLQA 2WMMA 1SFCC 2OYOA 1SQQG 4L73A 1LTGC 5AVZB 3VYIA 2IBZD 1MFTA 1LT9A 3NMDA 3BVHA 4IL6H 2FXOA 1WMKA 1K8AQ 4LC1A 4R4MA 4H44B 1XTCC 1L0LG 2KSEA 3Q3DA 1YBKA 1OX3A 3L4FA 3GHGC 1IFIA 1RQVA 3GHGA 4YPCA 1L0NE 2QJYB 4C7RA 2FXMA 1U7JA 3L35A 5TISE 1KFNA 3W67A 3UIAA 1FZFA 2E76D 1KN7A 1SQXE 5APTA 4ASVA 2W8ZA 2E74D 4AYCA 1LT1A 3AEGC 3D71A 2OYIB 3L71G 3VMYA 3B71A 3WUVA 1PL5A 1VQNP 1OXZA 2YXRB 5AW6B 4W7YA 1JMBA 3AE4C 1LTJC 1HGVA 1JTHB 2AXTH 1FDIA 3I55P 5CCHA 3AE8C 1S5LE 1VQ5P 3MUDA 3RK2B 1N7LA 2RMZA 4XE5B 1EDKA 3H1HD 1YJNP 2OARA 5BU8B 3ABVC 1M1JB 4N78D 1WT6A 3BASA 1KILB 1NTMK 3HTKA 2WPSA 1VQ6P 2YKQA 4RKUJ 2WSEH 2P10A 2E42A 5GTIE 4LGDE 2DW3A 3CCRP 2WSCJ 1JNMA 1VQKP 1H0TB 2IDBA 4L75A 1YQ3C 2C0XA 3HD7D 3SFDC 2IBZG 4DJGA 4K35A 3H1LE 3EWKA 3WMM0 4RJTA 2C9NY 1Q2NA 1UIXA 1AV1A 4PJ0E 2H7HA 3H32A 2R5BA 3CX5I 2ZVOB 1ZR4A 1NJIQ 3I56P 1PGJA 3AEDC 3IR9A 1CSBA 1PFIA 5KJ7C 5CCGC 3H1JE 2LKMA 1NTMD 2POHA 3T97B 3L75J 5KJ7A 5CCGA 1LTJB 1S4XA 2KUBA 1IK9A 1HWTC 4OGQC 1NU1E 1NO4A 4MN4C 1VL2A 3RL0g 3HE5A 1S9KE 1OVRA 3WUUA 1X0TA 4PV1D 2PGDA 2PAJA 5AVTB 3H1IE 5GTHH 3FWLA 1JY2O 3TGUD 5APYA 1T8ZA 4BRYB 3R4YA 2G3AA 2M5AA 1N73C 3HE4A 2OYHC 2OTKE 1N73A 1T6AA 3A0BE 4HYTB 4GIFA 5M1BA 1K73Q 2PFXA 3R2PA 3M9BA 1L2PA 4NPDA 2N1TB 1SFCD 2I8DA 1J1DB 2BEZF 3L73D 1BSHA 1SLQA 2WSFH 4H13C 1KD1Q 3BCCE 1HVVA 1L0NK 1SQPE 2XNXA 2B89A 1SP4A 2K9JB 3W68A 2H88C 1SVFA 4TLFA 1EZVE 2H89C 1SQBE 3H25A 4Z1MH 1Q86Q 3SWKA 2YIUB 2WVRA 1VQ4P 4GT1A 1RF1C 3RL0B 1GK4A 2O1KA 1VF5B 3G4SP 2JP3A 2HODA 3H1KE 1Q7YQ 4ZKPA 3GMAA 2XNDH 1SQXJ 1TU3F 2P7JA 2IYOA 2MJZA 3AE1C 5AW5B 3JCUH 2ZT9C 5CJ0A 1JO5A 3TNUB 1L0ND 3VP8A 1M1KQ 1YYCA 3LIEA 1PP9E 3GG2A 1N7SA 2P2UA 2B87B 3P8CE 3QH9A 2PRRA 1NTMG 1QVFO 3HUSC 1GK6A 4IL6X 4I6MC 5CBNA 1ZRTE 2IFNA 1CI6A 3KZIE 2ZXXA 1ZXGA 1BCCE 2R3SA 3CXHD 2FYUJ 3C9IA 1JY3O 3JSVC 1W2EA 1LWUC 5H2FH 2QEXP 3MD0A 3GLMA 1IK7A 1RE4C 2FFDB 3FXEA 3V2QA 4CPGA 2W83C 3RBXA 3TGUG 4YXWH 2C0WA 1RF1B 2YKPA 1G1IA 3LIDA 1OZHA 1P84H 2FBWC 3L70J 1EC5A 1YJWP 3D6ZA 1Y47A 2V4HA 2XKMA 1CZQA 1LNQA 3V4QA 1YIJP 3M9QA 2YO3A 2E76B 4GDOA 5B66E 1AQ5A 1OVVA 3B5NC 1SQVE 3CXHH 2LXCB 1BGYJ 2E74B 3V5BA 3AEFC 3L73G 3PTZA 5APWA 1GL2C 1EXJA 1CW5A 4D6TJ 1G1JA 1P84I 3H1JJ 3VMXA 3V2NA 2B9BA 2WQYC 1JCCA 1Q82Q 3H1LD 1PPJE 1NU1J 1VQ8P 1G2CB 2Q3EA 4OWFA 4O9BA 1ZLLA 5B5EH 3CXHI 3O6QB 1URQA 4YTPC 1JOCA 5AVRB 2V7QH 4C7NA 1DX7A 5CCGD 3L72D 3CI9A 5KLIC 1LWUB 2WZ7A 3H1IJ 2BCCD 1RE3C 3P8MC 4OGQD 3CCUP 4WY4C 4IFFA 1S72P 4Y99C 3C8VA 2HLOA 4WB4A 2GM4A 1L0NG 1OMIA 3LW5H 1S9KD 1MFZA 3N7NA 3HD7B 3M0DA 3HRNA 1N86A 1FZCB 3B5NB 2Q9IA 1DH3A 3H1ID 3CMAP 2RN0A 4R4LA 3AE6C 1H88A 3SFEC 1SQBK 2UWJE 1LTTC 4PD4H 2O1JA 3BCCJ 4GOFA 1GL2B 1SQPJ 5AVVB 2K1AA 3I5CA 1LT9C 1PV3A 2PP6A 1LTBC 1BE3E 1SQBJ 3A0HE 1KYOE 5KLVE 3FX0A 2QG4A 4UB6E 1GW3A 2J5UA 2M8RA 2J58A 4H0LC 1LJ2A 3M91A 4L76A 5AVYB 1DEBA 1E5WA 4H13D 1H89A 3H1KJ 5KAIE 2ZYDA 2OYIA 4PD4I 3S4RA 5KKZC 2KI7B 4NPFX 2CPSA 5BVZA 1QEXA 4PV1B 1SQBD 1YTZT 2ZYAA 3V2RA 1DD3A 2OTLP 2KP8A 1FZGA 1PP9J 1KILE 3KXDA 3CC4P 1U7MA 3H1KD 2AXCA 1RH5B 1M1JA 2A06E 1KILA 3AECC 2L91A 3G6EP 3NXSA 3H1LG 2ZT9D 1HTLC 3L74E 3A3YB 3BATA 1BCCJ 1VQLP 1SFCB 2ZVNB 3Q1MA 3CCVP 1T3JA 5K5GB 5L8RJ 1LT9B 3A7OA 2IBZI 3L72G 3OW2O 3U1AA 3E1IA 2BCCG 2ZAEB 1SQQE 5CCHC 1OWAA 5TJHA 3WU2E 1ZRTD 3MUDC 1JCDA 1WRGA 2QM7A 4B86A 2KNCA 1KQFB 1R5SA 2GA1A 3MGNA 2FYUE 2KS1A 3VMZA 4UB8H 4W7ZA 3U59A 3PHLA 1SQVJ 2IFMA 3GHGB 3AE9C 2N9BA 2A45H 3H1IG 3AEBC 2Y9ZA 2ZFCA 4I2LC 4I7ZC 3P32A 3V4WA 1LTIC 3E7KA 3VP9A 3VOPA 2LXBA 3L70E 4ZNCA 2YNYA 1LP1A 3IAOA 3U1CA 3CWBJ 3B5ND 1NTZE 1FOSE 2XDJA 2Y9YA 1R5LA 4KHXA 1BGYE 1GL2D 2R5DA 2OGUA 3F5HA 2E5TA 2HPCA 2QJKC 1J1EC 4D6TE 3V2PA 2QE7H 1KMIZ 4M3LA 3Q5PA 2NRGA 1SQBG 2SPZA 1YI2P 2N1TA 2NPSC 1DIPA 2NPSA 3D6YA 3BRTB 5APSA 3TSIA 1UIIA 2D2CC 1MZ9A 2K9JA 3CCMP 3H1KG 4WY4D 1HF9A 1JY2P 1FBMA 3C1LA 2WWWA 3M9HA 4I7ZB 5DJUB 5E79H 4ZMDA 5KLVK 3L75D 4IL6E 3AE5C 4LLHA 3N4XA 2WSCH 2Z5HA 4HB1A 2FYZA 3OAKA 2A45G 1VQ9P 2VRSA 2LR2A 1BE3J 3TYYA 5KLVJ 2FKWB 3H32B 1EDLA 1RF0A 1FOSF 2L5GB 2P1JA 2W6JH 3RK3E 1FS0E 2IZ1A 3RK3C 2QSIA 3NFQA 1EDIA 4U3FE 1EDJA 3CD6P 3F89A 5KAFH 2KSJA 3OJAB 4OGQB 1NTKJ 1FE6A 5KLVD 4H0LD 3K5BA 2JJLA 1YHQP 3AE2C 1OVUA 2ZXEB 1MKMA 1OIPA 1T3UA 3HE5B 1SQXK 4HJGH 3MZWB 3G71P 2WT7A 2E5YA 2ITAA 1VPCA 2D2CB 1GTWA 1K9MQ 3CL3D 1FDOA 4OH8B 1VQOP 2FFDA 1ZN5A 3L74J 1NHLA 2M5AB 1JUNA 3HE4B 2AXTE 2XU6A 3PJSK 1SQVG 1N73B 1GZLA 2GUSA 2OYHB 1KB9E 1N7SC 2KK7A 4QMAA 2O01J 1GDTA
chains in the Genus database with same CATH topology
2WZ7A 1FZFA 1RE3C 3P8MC 1HJBA 3HTKB 4WY4C 3KPEA 4IFFA 2FYUK 5APTA 4AYCA 3RL0C 4Y99C 3IFMA 5AW4B 2I1JA 2HLOA 4N6JA 4WB4A 2GM4A 2OYIB 1JY3P 1QL1A 2YO2A 3VMYA 1A02J 3LW5H 3VTPC 2C9LY 1S9KD 1MFZA 1OXZA 3N7NA 3HD7B 3SWYA 5AW6B 4W7YA 3M0DA 2HYNA 1RF0C 3P7KA 3HRNA 3O8ZA 1LTJC 1N86A 1FZCB 1HGVA 5CCHD 3B5NB 2Q9IA 1JTHB 3KQGA 1DH3A 1HBWA 1G2CA 5CCHA 1MV8A 1H88A 3NTNA 1SQBK 4N3YB 1LTTC 1L4AC 2P67A 1NTZK 1HUCA 2O1JA 5BU5A 2HODB 2OYHA 3M0AA 1GL2B 1L4AA 5AVVB 3MUDA 1NAFA 1N7LA 3RK2B 3TNUA 4XE5B 1NTKK 2HPCB 3I5CA 4N78E 1M7LA 2Q7CA 2XZRA 1LT9C 3G3ZA 2PP6A 1LTBC 1J1EB 2OARA 5BU8B 1M1JB 4N78D 1WT6A 3BASA 1KILB 1NTMK 4AUWA 3HTKA 2WPSA 3A2AA 2YKQA 2WSEH 2E42A 1GW3A 2M8RA 2J58A 4LGDE 3M91A 2NPSB 5AVYB 1DEBA 1E5WA 4RESB 1JNMA 1H89A 1IO4A 1J2JB 1RY3A 1NU1K 2OYIA 2BASA 2C0XA 3HD7D 2IPPA 2CPSA 5AW9B 5APXA 3WMM0 5KTBA 5BVZA 3HUSB 2C9NY 2FFDC 2H7HA 1FAVA 3H32A 2R5BA 1ZR4A 1CI6B 3MIWA 1XTGB 1YTZT 1X9VA 5CMZA 1RF1A 1X79B 3V2RA 1URQC 3RK2D 3BRVB 2KP8A 1SQQK 1FZGA 1KQLA 3IR9A 1CSBA 1LGHB 3MTUE 2W6BA 1LTSC 1GD2E 4XA4A 1VDFA 1PFIA 4DOJA 5KJ7C 5KJ7D 5CCGC 3EQ2A 2LKMA 1KILD 2POHA 3PP5A 1M1JA 5KJ7A 2M3BA 5CCGA 1LTJB 1KILA 1IK9A 1HWTC 1FJKA 3NXSA 5AVQB 5AW0B 1HTLC 1NO4A 1GW4A 5CHXA 5AW1B 3A3YB 4I1LA 3BATA 4AQRD 1JY3N 3KYQA 1SFCB 1N2DC 3HE5A 3RK3B 1L0LK 1S9KE 2WPRA 4W80A 1T3JA 1LT9B 3A7OA 2KOGA 2W27A 3U1AA 3M0DC 3E1IA 4GKGA 2PAJA 5AVTB 3HUSA 1SQPK 1JY2O 3TK1A 5APYA 5CCHC 1FZBA 1OWAA 1T8ZA 3SWFA 2HG5D 2IX7C 3KDPB 1N73C 2YKOA 3HE4A 4DZOA 2OYHC 2WT7B 1JCDA 1N73A 1WRGA 2QM7A 4B86A 1H8AA 1GU4A 3MGNA 4HYTB 2YMYA 5AW8B 3VMZA 4GIFA 4EIJA 4W7ZA 1LWUA 3H6PA 1NH4A 3U59A 1T2KD 2I1KA 3R2PA 1RE4A 3M9BA 2IFMA 3GHGB 2N9BA 2A45H 1ZV8A 1NOHA 2N1TB 2ZFCA 1SFCD 4I2LC 2GUVA 3P32A 1J1DB 1URQB 1NWQA 3RK3D 1HGZA 1SFCA 3V4WA 1LTIC 1SLQA 2WSFH 2Z5IA 2OYIC 4C7NB 3VP9A 1HVVA 1L0NK 2E43A 2XNXA 3VOPA 1SP4A 1HH0A 1N7SB 2HFED 3HD7C 2O01H 1SVFA 2YNYA 1EQ7A 1ZR2A 2R32A 1IC2A 3HD7A 1FZCC 3U1CA 2R3CA 4WY4B 3B5ND 2Q5UA 1QL2A 1NKNA 1X8YA 1FZCA 1FOSE 3B5NA 4GT1A 4IFDK 3VN0A 1JTHA 4HH2A 1RF1C 2XDJA 3RL0B 4Y99B 1GK4A 2O1KA 2H8PD 4KHXA 1YTZI 2R5DA 1GL2D 3RK2C 2HODA 4ZKPA 1GL2A 2HPCA 1KFMA 1J1EC 1IFNA 3V2PA 1M1JC 1GDTA 4JF7A 2Z4EA 1KILC 2P7JA 5AW2B 4M3LA 2MJZA 2N1TD 2KB7P 3L36A 1FDMA 5AW5B 5AVSB 2WTYA 5APQA 5AW3B 2N1TA 2NPSC 2NPSD 5CJ0A 1IFJA 3OA7A 1L4AB 1JO5A 5AVUB 3TNUB 2NPSA 3VP8A 3L37A 2QM8A 3BRTB 5APSA 1N7SD 1YYCA 1A02F 3LIEA 3TSIA 1N7SA 2P2UA 1MZ9A 3P8CE 1LTAC 4WY4D 3HUSC 1Z56A 1GK6A 3B8EB 1JY2P 1RE3A 4I6MC 3II6A 4WY4A 1FBMA 3M9HA 2WWWA 3P8CD 1IFMA 3EFGA 5APUA 5AVWB 3RL0D 1KZUB 5KLVK 2IFNA 1CI6A 4LLHA 3N4XA 1GU5A 1FZAA 2WSCH 2Z5HA 5AW7B 4WBAA 1SQVK 2FYZA 3OAKA 2A45G 3C9IA 1JY3O 2VRSA 1W2EA 1JMMA 2XV5A 3TYYA 1IFDA 1LWUC 2FKWB 3H32B 3MD0A 2CPBA 3T97A 1RE4C 1RF0A 1FOSF 2L5GB 2FFDB 4IFMA 1T2KC 3CLQA 1LTJA 1FU1A 2P1JA 3V2QA 4EOTA 4ZKUA 2C0WA 2WPQA 1RF1B 2YKPA 4JYBA 1G1IA 1L4AD 1MUUA 5CJ4A 1SFCC 3LIDA 2W6AA 2JEEA 3RK3C 5APVA 1NKZB 3NFQA 1LTGC 5AVZB 3VYIA 1LT9A 2XKMA 1CZQA 2WITA 3V4QA 2KSJA 3M9QA 3OJAB 2YO3A 3NMDA 1AQ5A 3BVHA 3B5NC 2JJLA 2ZXEB 1IJDB 1FZEA 1T3UA 3HE5B 3V5BA 2H43A 4LC1A 1SQXK 4C46A 1XTCC 2A45I 5APWA 2WT7A 1AFOA 1GL2C 1VPCA 1CW5A 1G1JA 1GTWA 2J59M 2Q3IA 3VMXA 3M06A 3V2NA 3L4FA 3A5TA 3CL3D 4OH8B 1JCCA 2FFDA 1ZN5A 3GHGC 1IFIA 1NHLA 1G2CB 4O9BA 2N1TC 3GHGA 1JUNA 1J1DC 3HE4B 1URQD 1ZLLA 2XU6A 1FJPA 1N73B 4C7RA 1GZLA 2KYVA 2GUSA 1URQA 2OYHB 2FXMA 4JYCA 5AVXB 1JOCA 5AVRB 3L35A 1KFNA 1N7SC 2KLVA 4C7NA 1DX7A 5CCGD 1JY2N 3CI9A 1LWUB 3UIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZ7 A;  3RK3 D;  1SFC A;  1XTG B;  3HTK B;  4WY4 C;  1HVV A;  1URQ C;  3VOP A;  3RK2 D;  1N7S B;  2HFE D;  3RL0 C;  3HD7 C;  3HD7 A;  4WY4 B;  1L4A D;  5KJ7 C;  5KJ7 D;  5CCG C;  3B5N D;  1KIL D;  1SFC C;  3PP5 A;  5KJ7 A;  3B5N A;  5CCG A;  3RK3 C;  1KIL A;  1JTH A;  2XDJ A;  3RL0 B;  3HD7 B;  4W7Y A;  2H8P D;  1GL2 D;  3RK2 C;  5CCH D;  3B5N B;  3KYQ A;  1JTH B;  1GL2 A;  1SFC B;  5CCH A;  3RK3 B;  1L4A C;  4W80 A;  3B5N C;  1T3J A;  4JF7 A;  1KIL C;  2KOG A;  1GL2 B;  1L4A A;  3RK2 B;  3M0D C;  2N1T D;  4N78 E;  2N1T A;  2NPS C;  2NPS D;  1GL2 C;  2PP6 A;  5CCH C;  1L4A B;  2NPS A;  1KIL B;  2HG5 D;  1N7S D;  3TSI A;  4OH8 B;  1N7S A;  2M8R A;  4LGD E;  2NPS B;  3P8C E;  1NHL A;  4WY4 D;  2N1T C;  2YMY A;  4WY4 A;  1URQ D;  4W7Z A;  1URQ A;  3HD7 D;  3RL0 D;  1N7S C;  5CCG D;  2N1T B;  1SFC D;  1URQ B; 
#chains in the Genus database with same CATH topology
 1HJB A;  3GW6 A;  3CX5 E;  4Y28 J;  1SQQ J;  2FYU K;  2A06 D;  2WSS H;  1SQX D;  3IFM A;  3S1K A;  2QJP C;  2OQQ A;  1S2E A;  4N6J A;  1JEK A;  1JY3 P;  2YO2 A;  4H13 B;  3Q2Y A;  3USS A;  2C9L Y;  3B4S A;  2KIK A;  1M90 Q;  2HYN A;  3P7K A;  3SSU A;  3O8Z A;  5CCH D;  1G2C A;  1MV8 A;  1OW8 A;  3NTN A;  3L75 G;  4N3Y B;  1L4A C;  2P67 A;  3O6Q A;  3ZDM A;  1NTZ K;  2HOD B;  3M0A A;  5TIS H;  1L4A A;  3H1H E;  1NAF A;  4N78 E;  4YXD C;  1OW7 A;  2IZ0 A;  3G3Z A;  2K9Y A;  1ZP0 C;  5CBO A;  2FYU D;  4AUW A;  1NTZ J;  3A2A A;  4RO0 A;  2QRX A;  2ZT9 B;  3AE3 C;  1BSN A;  4RES B;  1IO4 A;  1J2J B;  1RY3 A;  1NU1 K;  3FWN A;  5AW9 B;  3L70 D;  5APX A;  3HUS B;  2QA4 P;  1FAV A;  5GTH E;  1S5L H;  3AEA C;  2OTJ P;  1CI6 B;  3MIW A;  1XTG B;  5KLV G;  1X9V A;  2KZI A;  3CWB E;  1NTZ D;  1KQS O;  1AA0 A;  2O3J A;  1URQ C;  3BRV B;  1YIT P;  1K05 A;  1KQL A;  1NTM E;  3Q5R A;  2ZYG A;  3MTU E;  1BGY D;  2W6B A;  1LTS C;  5KJ7 D;  3MP7 B;  3PP5 A;  1NAY A;  1VQ7 P;  2M3B A;  4D6T D;  5GTI H;  3H1J D;  5AVQ B;  5AW0 B;  1AJY A;  3MHV A;  1GW4 A;  2JR8 A;  1OW6 A;  3CCS P;  3CPW O;  5DJT B;  4H44 C;  1NU1 D;  4GOD A;  1N2D C;  2Y0E A;  2YMK A;  2D2C D;  2WPR A;  4W80 A;  4JQ0 D;  2KOG A;  2W27 A;  3TGU E;  3AEE C;  3M0D C;  4PJ0 H;  1SQP K;  1VQM P;  2FYN C;  2A06 G;  2HG5 D;  1SQX G;  4U3F J;  2RH0 A;  1H8A A;  1W2B O;  1GU4 A;  3WUT A;  3G9R A;  3CCL P;  2P58 A;  2I1K A;  4ASW A;  3L73 E;  1ZV8 A;  4BWN A;  2GUV A;  3JCU E;  1URQ B;  3RK3 D;  1SFC A;  2OYI C;  3PLN A;  4C7N B;  1KC8 Q;  2HFE D;  4U3F D;  5KLI B;  2R32 A;  3BCC D;  1GMJ A;  1SQP D;  2FYU G;  4WY4 B;  1PZQ A;  1QL2 A;  1X8Y A;  4IFD K;  1EZV D;  1JTH A;  2M0B A;  4HH2 A;  1NTK E;  4Y99 B;  1N8R Q;  2Y0C A;  2H8P D;  4IOI H;  2QVA A;  3RK2 C;  3A0B H;  1K04 A;  1AQT A;  2M3E A;  1IFN A;  1M1J C;  3EFF K;  3TDK A;  4JF7 A;  1KIL C;  3L70 G;  5H2F E;  2E75 C;  1IFP A;  2FYN B;  3L36 A;  2WSE J;  2NZ2 A;  1IFJ A;  1NTZ G;  2K3R A;  3VMA A;  1E79 H;  3PRJ A;  2QM8 A;  1N7S D;  1P84 E;  1A02 F;  1H0T A;  1BGY G;  1AVY A;  1KB9 D;  1BDD A;  1LTA C;  1PP9 D;  3II6 A;  1M56 D;  4D6T G;  1S1C X;  3P8C D;  1IFM A;  3CX5 D;  3EFG A;  5AVW B;  3H1J G;  3CXH E;  1KZU B;  4JBZ A;  4H0L B;  3H1H J;  1GU5 A;  1FZA A;  5AW7 B;  4WBA A;  1NU1 G;  1SQV K;  4A7P A;  2KLU A;  1BCC D;  2XV5 A;  5KKZ B;  2YXQ B;  2CPB A;  3T97 A;  4IFM A;  1T2K C;  1EZV I;  1LTJ A;  1FU1 A;  2BEQ D;  4JPZ B;  4EOT A;  4ZKU A;  2WPQ A;  1ZME C;  1YJ9 P;  4JYB A;  1L0L E;  1L4A D;  1MUU A;  5CJ4 A;  2W6A A;  1KB9 H;  2JEE A;  5B5E E;  5APV A;  1NKZ B;  1RQU A;  4WWI A;  1D7M A;  1SS1 A;  3CX5 H;  1Y9B A;  2E75 B;  2WIT A;  1FC2 C;  1USD A;  3KZI H;  1IJD B;  1FZE A;  4BRY A;  1OFC X;  2H43 A;  1SQV D;  4C46 A;  5C39 A;  1NTM J;  2A45 I;  3TF5 A;  1AFO A;  2R44 A;  1KB9 I;  2J59 M;  2Q3I A;  1QVG O;  1PGQ A;  2W90 A;  2WPV B;  4BXL A;  3M06 A;  1Q90 D;  4WVZ A;  4U3F G;  4GOE A;  2FXP A;  3A5T A;  3BCC G;  4EDF A;  1SQP G;  3Q5S A;  4HKZ H;  2N1T C;  1J1D C;  1URQ D;  1EZV G;  1PPJ D;  1FJP A;  3L71 E;  3CWB D;  2KYV A;  2KNC B;  2Y0D A;  3L72 E;  2HR3 A;  4JYC A;  5AVX B;  4PD4 E;  4XFJ A;  2WSF J;  3S9O A;  3RBZ A;  2BCC E;  2N9Y B;  2KLV A;  2KS1 B;  2JKV A;  3IF4 A;  3TGU J;  1JY2 N;  2JDI H;  1EXI A;  1DD4 A;  5B66 H;  1BDC A;  3HTK B;  3KPE A;  2YIU C;  3RL0 C;  5AW4 B;  2B88 A;  2I1J A;  3QWO C;  1VF5 C;  4H44 D;  3E1R A;  3ITK A;  1DEE G;  1QL1 A;  2KXP B;  1A02 J;  3VTP C;  1LP1 B;  3FXD A;  3SWY A;  1RHZ B;  4TT3 H;  1RF0 C;  1S5L X;  1ZOY C;  1PP9 G;  3L73 J;  4KT0 J;  3KQG A;  1HBW A;  1KV4 A;  1M8O B;  1R8E A;  1HUC A;  5BU5 A;  2OYH A;  1NVO A;  2MKV A;  1YQ4 C;  3TNU A;  2IBZ E;  1NTK K;  2HPC B;  1M7L A;  2Q7C A;  2XZR A;  1BCC G;  1M57 D;  2QJK B;  1J1E B;  2B87 A;  1AVO A;  2Q1K A;  1PGP A;  2RKL A;  1BE3 D;  1KYO D;  4K3A A;  2NPS B;  1NYH A;  1X22 A;  3IN6 A;  2BAS A;  2IPP A;  3H1H G;  5KTB A;  2FFD C;  1QLE D;  1L0N J;  4DT0 A;  1PGO A;  1JB0 J;  3D70 A;  5CMZ A;  1RF1 A;  1X79 B;  3RK2 D;  1NTK D;  1SQQ K;  4NPE A;  2IYP A;  1LGH B;  1KOR A;  1GD2 E;  4XA4 A;  1VDF A;  2K88 A;  2KZJ A;  4DOJ A;  3A0H H;  4OVN F;  3EQ2 A;  1KIL D;  1KYO H;  2E75 D;  4UB8 E;  2E76 C;  1FJK A;  4UB6 H;  2O01 N;  3GF7 A;  5CHX A;  2E74 C;  5AW1 B;  4I1L A;  4AQR D;  1JY3 N;  3KYQ A;  1PPJ G;  5KAI H;  3CWB G;  3L74 D;  3RK3 B;  3CCE P;  1L0L K;  4L74 A;  2JWD A;  1P84 D;  4EI2 A;  1VQP P;  4GKG A;  1S3J A;  2FY8 A;  3HUS A;  1KYO I;  3TK1 A;  1FZB A;  1L0L J;  3SWF A;  2IX7 C;  3KDP B;  1W5C E;  2YKO A;  3AE7 C;  1SQQ D;  4DZO A;  3JC2 2;  2WT7 B;  1USE A;  2V7Q J;  3PH0 A;  3RGU A;  2YMY A;  5AW8 B;  1QGK B;  4EIJ A;  1LWU A;  3H6P A;  1NH4 A;  1T2K D;  2ZJS E;  1RE4 A;  1ZW0 A;  3CCQ P;  2CK3 H;  1NOH A;  1IZN B;  1NWQ A;  1HGZ A;  1L0L D;  2Z5I A;  2AEJ A;  2E43 A;  3LW5 J;  3H1L J;  1HH0 A;  1N7S B;  3HD7 C;  1NGM B;  2O01 H;  1ZR2 A;  1EQ7 A;  1IC2 A;  1PIX A;  3HD7 A;  2JO1 A;  1FZC C;  3CC7 P;  2R3C A;  2Q5U A;  2G8Y A;  1NKN A;  1FZC A;  3B5N A;  3CCJ P;  1BE3 G;  3VN0 A;  3WU2 H;  1U57 A;  3L71 J;  2QIW A;  2Q6Q A;  3V6I A;  5E79 E;  3L72 J;  2AEM A;  2QJP B;  1YTZ I;  4EYY Q;  2BCC J;  2AEF A;  3KHU A;  1GL2 A;  1KFM A;  2Z4E A;  3CC2 P;  1KQG B;  5AW2 B;  2N1T D;  2KB7 P;  1FDM A;  5AVS B;  2WTY A;  1JM0 A;  5APQ A;  5AW3 B;  2NPS D;  3OA7 A;  1L4A B;  5AVU B;  1Q81 Q;  3CME P;  3L71 D;  3L37 A;  1NTK G;  1QX8 A;  4PD4 D;  1HJ0 A;  1Z56 A;  3B8E B;  1RE3 A;  3L75 E;  4PV1 C;  5KAF E;  4WY4 A;  5APU A;  4U7J A;  3RL0 D;  3GF3 A;  1VF5 D;  5EFW B;  2QJY C;  2K37 A;  1KTM A;  1Y8A A;  3L74 G;  3FGA D;  1JMM A;  2JWA A;  4KJM A;  1IFD A;  4DCK A;  3CLQ A;  2WMM A;  1SFC C;  2OYO A;  1SQQ G;  4L73 A;  1LTG C;  5AVZ B;  3VYI A;  2IBZ D;  1MFT A;  1LT9 A;  3NMD A;  3BVH A;  4IL6 H;  2FXO A;  1WMK A;  1K8A Q;  4LC1 A;  4R4M A;  4H44 B;  1XTC C;  1L0L G;  2KSE A;  3Q3D A;  1YBK A;  1OX3 A;  3L4F A;  3GHG C;  1IFI A;  1RQV A;  3GHG A;  4YPC A;  1L0N E;  2QJY B;  4C7R A;  2FXM A;  1U7J A;  3L35 A;  5TIS E;  1KFN A;  3W67 A;  3UIA A;  1FZF A;  2E76 D;  1KN7 A;  1SQX E;  5APT A;  4ASV A;  2W8Z A;  2E74 D;  4AYC A;  1LT1 A;  3AEG C;  3D71 A;  2OYI B;  3L71 G;  3VMY A;  3B71 A;  3WUV A;  1PL5 A;  1VQN P;  1OXZ A;  2YXR B;  5AW6 B;  4W7Y A;  1JMB A;  3AE4 C;  1LTJ C;  1HGV A;  1JTH B;  2AXT H;  1FDI A;  3I55 P;  5CCH A;  3AE8 C;  1S5L E;  1VQ5 P;  3MUD A;  3RK2 B;  1N7L A;  2RMZ A;  4XE5 B;  1EDK A;  3H1H D;  1YJN P;  2OAR A;  5BU8 B;  3ABV C;  1M1J B;  4N78 D;  1WT6 A;  3BAS A;  1KIL B;  1NTM K;  3HTK A;  2WPS A;  1VQ6 P;  2YKQ A;  4RKU J;  2WSE H;  2P10 A;  2E42 A;  5GTI E;  4LGD E;  2DW3 A;  3CCR P;  2WSC J;  1JNM A;  1VQK P;  1H0T B;  2IDB A;  4L75 A;  1YQ3 C;  2C0X A;  3HD7 D;  3SFD C;  2IBZ G;  4DJG A;  4K35 A;  3H1L E;  3EWK A;  3WMM 0;  4RJT A;  2C9N Y;  1Q2N A;  1UIX A;  1AV1 A;  4PJ0 E;  2H7H A;  3H32 A;  2R5B A;  3CX5 I;  2ZVO B;  1ZR4 A;  1NJI Q;  3I56 P;  1PGJ A;  3AED C;  3IR9 A;  1CSB A;  1PFI A;  5KJ7 C;  5CCG C;  3H1J E;  2LKM A;  1NTM D;  2POH A;  3T97 B;  3L75 J;  5KJ7 A;  5CCG A;  1LTJ B;  1S4X A;  2KUB A;  1IK9 A;  1HWT C;  4OGQ C;  1NU1 E;  1NO4 A;  4MN4 C;  1VL2 A;  3RL0 g;  3HE5 A;  1S9K E;  1OVR A;  3WUU A;  1X0T A;  4PV1 D;  2PGD A;  2PAJ A;  5AVT B;  3H1I E;  5GTH H;  3FWL A;  1JY2 O;  3TGU D;  5APY A;  1T8Z A;  4BRY B;  3R4Y A;  2G3A A;  2M5A A;  1N73 C;  3HE4 A;  2OYH C;  2OTK E;  1N73 A;  1T6A A;  3A0B E;  4HYT B;  4GIF A;  5M1B A;  1K73 Q;  2PFX A;  3R2P A;  3M9B A;  1L2P A;  4NPD A;  2N1T B;  1SFC D;  2I8D A;  1J1D B;  2BEZ F;  3L73 D;  1BSH A;  1SLQ A;  2WSF H;  4H13 C;  1KD1 Q;  3BCC E;  1HVV A;  1L0N K;  1SQP E;  2XNX A;  2B89 A;  1SP4 A;  2K9J B;  3W68 A;  2H88 C;  1SVF A;  4TLF A;  1EZV E;  2H89 C;  1SQB E;  3H25 A;  4Z1M H;  1Q86 Q;  3SWK A;  2YIU B;  2WVR A;  1VQ4 P;  4GT1 A;  1RF1 C;  3RL0 B;  1GK4 A;  2O1K A;  1VF5 B;  3G4S P;  2JP3 A;  2HOD A;  3H1K E;  1Q7Y Q;  4ZKP A;  3GMA A;  2XND H;  1SQX J;  1TU3 F;  2P7J A;  2IYO A;  2MJZ A;  3AE1 C;  5AW5 B;  3JCU H;  2ZT9 C;  5CJ0 A;  1JO5 A;  3TNU B;  1L0N D;  3VP8 A;  1M1K Q;  1YYC A;  3LIE A;  1PP9 E;  3GG2 A;  1N7S A;  2P2U A;  2B87 B;  3P8C E;  3QH9 A;  2PRR A;  1NTM G;  1QVF O;  3HUS C;  1GK6 A;  4IL6 X;  4I6M C;  5CBN A;  1ZRT E;  2IFN A;  1CI6 A;  3KZI E;  2ZXX A;  1ZXG A;  1BCC E;  2R3S A;  3CXH D;  2FYU J;  3C9I A;  1JY3 O;  3JSV C;  1W2E A;  1LWU C;  5H2F H;  2QEX P;  3MD0 A;  3GLM A;  1IK7 A;  1RE4 C;  2FFD B;  3FXE A;  3V2Q A;  4CPG A;  2W83 C;  3RBX A;  3TGU G;  4YXW H;  2C0W A;  1RF1 B;  2YKP A;  1G1I A;  3LID A;  1OZH A;  1P84 H;  2FBW C;  3L70 J;  1EC5 A;  1YJW P;  3D6Z A;  1Y47 A;  2V4H A;  2XKM A;  1CZQ A;  1LNQ A;  3V4Q A;  1YIJ P;  3M9Q A;  2YO3 A;  2E76 B;  4GDO A;  5B66 E;  1AQ5 A;  1OVV A;  3B5N C;  1SQV E;  3CXH H;  2LXC B;  1BGY J;  2E74 B;  3V5B A;  3AEF C;  3L73 G;  3PTZ A;  5APW A;  1GL2 C;  1EXJ A;  1CW5 A;  4D6T J;  1G1J A;  1P84 I;  3H1J J;  3VMX A;  3V2N A;  2B9B A;  2WQY C;  1JCC A;  1Q82 Q;  3H1L D;  1PPJ E;  1NU1 J;  1VQ8 P;  1G2C B;  2Q3E A;  4OWF A;  4O9B A;  1ZLL A;  5B5E H;  3CXH I;  3O6Q B;  1URQ A;  4YTP C;  1JOC A;  5AVR B;  2V7Q H;  4C7N A;  1DX7 A;  5CCG D;  3L72 D;  3CI9 A;  5KLI C;  1LWU B;  2WZ7 A;  3H1I J;  2BCC D;  1RE3 C;  3P8M C;  4OGQ D;  3CCU P;  4WY4 C;  4IFF A;  1S72 P;  4Y99 C;  3C8V A;  2HLO A;  4WB4 A;  2GM4 A;  1L0N G;  1OMI A;  3LW5 H;  1S9K D;  1MFZ A;  3N7N A;  3HD7 B;  3M0D A;  3HRN A;  1N86 A;  1FZC B;  3B5N B;  2Q9I A;  1DH3 A;  3H1I D;  3CMA P;  2RN0 A;  4R4L A;  3AE6 C;  1H88 A;  3SFE C;  1SQB K;  2UWJ E;  1LTT C;  4PD4 H;  2O1J A;  3BCC J;  4GOF A;  1GL2 B;  1SQP J;  5AVV B;  2K1A A;  3I5C A;  1LT9 C;  1PV3 A;  2PP6 A;  1LTB C;  1BE3 E;  1SQB J;  3A0H E;  1KYO E;  5KLV E;  3FX0 A;  2QG4 A;  4UB6 E;  1GW3 A;  2J5U A;  2M8R A;  2J58 A;  4H0L C;  1LJ2 A;  3M91 A;  4L76 A;  5AVY B;  1DEB A;  1E5W A;  4H13 D;  1H89 A;  3H1K J;  5KAI E;  2ZYD A;  2OYI A;  4PD4 I;  3S4R A;  5KKZ C;  2KI7 B;  4NPF X;  2CPS A;  5BVZ A;  1QEX A;  4PV1 B;  1SQB D;  1YTZ T;  2ZYA A;  3V2R A;  1DD3 A;  2OTL P;  2KP8 A;  1FZG A;  1PP9 J;  1KIL E;  3KXD A;  3CC4 P;  1U7M A;  3H1K D;  2AXC A;  1RH5 B;  1M1J A;  2A06 E;  1KIL A;  3AEC C;  2L91 A;  3G6E P;  3NXS A;  3H1L G;  2ZT9 D;  1HTL C;  3L74 E;  3A3Y B;  3BAT A;  1BCC J;  1VQL P;  1SFC B;  2ZVN B;  3Q1M A;  3CCV P;  1T3J A;  5K5G B;  5L8R J;  1LT9 B;  3A7O A;  2IBZ I;  3L72 G;  3OW2 O;  3U1A A;  3E1I A;  2BCC G;  2ZAE B;  1SQQ E;  5CCH C;  1OWA A;  5TJH A;  3WU2 E;  1ZRT D;  3MUD C;  1JCD A;  1WRG A;  2QM7 A;  4B86 A;  2KNC A;  1KQF B;  1R5S A;  2GA1 A;  3MGN A;  2FYU E;  2KS1 A;  3VMZ A;  4UB8 H;  4W7Z A;  3U59 A;  3PHL A;  1SQV J;  2IFM A;  3GHG B;  3AE9 C;  2N9B A;  2A45 H;  3H1I G;  3AEB C;  2Y9Z A;  2ZFC A;  4I2L C;  4I7Z C;  3P32 A;  3V4W A;  1LTI C;  3E7K A;  3VP9 A;  3VOP A;  2LXB A;  3L70 E;  4ZNC A;  2YNY A;  1LP1 A;  3IAO A;  3U1C A;  3CWB J;  3B5N D;  1NTZ E;  1FOS E;  2XDJ A;  2Y9Y A;  1R5L A;  4KHX A;  1BGY E;  1GL2 D;  2R5D A;  2OGU A;  3F5H A;  2E5T A;  2HPC A;  2QJK C;  1J1E C;  4D6T E;  3V2P A;  2QE7 H;  1KMI Z;  4M3L A;  3Q5P A;  2NRG A;  1SQB G;  2SPZ A;  1YI2 P;  2N1T A;  2NPS C;  1DIP A;  2NPS A;  3D6Y A;  3BRT B;  5APS A;  3TSI A;  1UII A;  2D2C C;  1MZ9 A;  2K9J A;  3CCM P;  3H1K G;  4WY4 D;  1HF9 A;  1JY2 P;  1FBM A;  3C1L A;  2WWW A;  3M9H A;  4I7Z B;  5DJU B;  5E79 H;  4ZMD A;  5KLV K;  3L75 D;  4IL6 E;  3AE5 C;  4LLH A;  3N4X A;  2WSC H;  2Z5H A;  4HB1 A;  2FYZ A;  3OAK A;  2A45 G;  1VQ9 P;  2VRS A;  2LR2 A;  1BE3 J;  3TYY A;  5KLV J;  2FKW B;  3H32 B;  1EDL A;  1RF0 A;  1FOS F;  2L5G B;  2P1J A;  2W6J H;  3RK3 E;  1FS0 E;  2IZ1 A;  3RK3 C;  2QSI A;  3NFQ A;  1EDI A;  4U3F E;  1EDJ A;  3CD6 P;  3F89 A;  5KAF H;  2KSJ A;  3OJA B;  4OGQ B;  1NTK J;  1FE6 A;  5KLV D;  4H0L D;  3K5B A;  2JJL A;  1YHQ P;  3AE2 C;  1OVU A;  2ZXE B;  1MKM A;  1OIP A;  1T3U A;  3HE5 B;  1SQX K;  4HJG H;  3MZW B;  3G71 P;  2WT7 A;  2E5Y A;  2ITA A;  1VPC A;  2D2C B;  1GTW A;  1K9M Q;  3CL3 D;  1FDO A;  4OH8 B;  1VQO P;  2FFD A;  1ZN5 A;  3L74 J;  1NHL A;  2M5A B;  1JUN A;  3HE4 B;  2AXT E;  2XU6 A;  3PJS K;  1SQV G;  1N73 B;  1GZL A;  2GUS A;  2OYH B;  1KB9 E;  1N7S C;  2KK7 A;  4QMA A;  2O01 J;  1GDT A; 
#chains in the Genus database with same CATH homology
 2WZ7 A;  1FZF A;  1RE3 C;  3P8M C;  1HJB A;  3HTK B;  4WY4 C;  3KPE A;  4IFF A;  2FYU K;  5APT A;  4AYC A;  3RL0 C;  4Y99 C;  3IFM A;  5AW4 B;  2I1J A;  2HLO A;  4N6J A;  4WB4 A;  2GM4 A;  2OYI B;  1JY3 P;  1QL1 A;  2YO2 A;  3VMY A;  1A02 J;  3LW5 H;  3VTP C;  2C9L Y;  1S9K D;  1MFZ A;  1OXZ A;  3N7N A;  3HD7 B;  3SWY A;  5AW6 B;  4W7Y A;  3M0D A;  2HYN A;  1RF0 C;  3P7K A;  3HRN A;  3O8Z A;  1LTJ C;  1N86 A;  1FZC B;  1HGV A;  5CCH D;  3B5N B;  2Q9I A;  1JTH B;  3KQG A;  1DH3 A;  1HBW A;  1G2C A;  5CCH A;  1MV8 A;  1H88 A;  3NTN A;  1SQB K;  4N3Y B;  1LTT C;  1L4A C;  2P67 A;  1NTZ K;  1HUC A;  2O1J A;  5BU5 A;  2HOD B;  2OYH A;  3M0A A;  1GL2 B;  1L4A A;  5AVV B;  3MUD A;  1NAF A;  1N7L A;  3RK2 B;  3TNU A;  4XE5 B;  1NTK K;  2HPC B;  3I5C A;  4N78 E;  1M7L A;  2Q7C A;  2XZR A;  1LT9 C;  3G3Z A;  2PP6 A;  1LTB C;  1J1E B;  2OAR A;  5BU8 B;  1M1J B;  4N78 D;  1WT6 A;  3BAS A;  1KIL B;  1NTM K;  4AUW A;  3HTK A;  2WPS A;  3A2A A;  2YKQ A;  2WSE H;  2E42 A;  1GW3 A;  2M8R A;  2J58 A;  4LGD E;  3M91 A;  2NPS B;  5AVY B;  1DEB A;  1E5W A;  4RES B;  1JNM A;  1H89 A;  1IO4 A;  1J2J B;  1RY3 A;  1NU1 K;  2OYI A;  2BAS A;  2C0X A;  3HD7 D;  2IPP A;  2CPS A;  5AW9 B;  5APX A;  3WMM 0;  5KTB A;  5BVZ A;  3HUS B;  2C9N Y;  2FFD C;  2H7H A;  1FAV A;  3H32 A;  2R5B A;  1ZR4 A;  1CI6 B;  3MIW A;  1XTG B;  1YTZ T;  1X9V A;  5CMZ A;  1RF1 A;  1X79 B;  3V2R A;  1URQ C;  3RK2 D;  3BRV B;  2KP8 A;  1SQQ K;  1FZG A;  1KQL A;  3IR9 A;  1CSB A;  1LGH B;  3MTU E;  2W6B A;  1LTS C;  1GD2 E;  4XA4 A;  1VDF A;  1PFI A;  4DOJ A;  5KJ7 C;  5KJ7 D;  5CCG C;  3EQ2 A;  2LKM A;  1KIL D;  2POH A;  3PP5 A;  1M1J A;  5KJ7 A;  2M3B A;  5CCG A;  1LTJ B;  1KIL A;  1IK9 A;  1HWT C;  1FJK A;  3NXS A;  5AVQ B;  5AW0 B;  1HTL C;  1NO4 A;  1GW4 A;  5CHX A;  5AW1 B;  3A3Y B;  4I1L A;  3BAT A;  4AQR D;  1JY3 N;  3KYQ A;  1SFC B;  1N2D C;  3HE5 A;  3RK3 B;  1L0L K;  1S9K E;  2WPR A;  4W80 A;  1T3J A;  1LT9 B;  3A7O A;  2KOG A;  2W27 A;  3U1A A;  3M0D C;  3E1I A;  4GKG A;  2PAJ A;  5AVT B;  3HUS A;  1SQP K;  1JY2 O;  3TK1 A;  5APY A;  5CCH C;  1FZB A;  1OWA A;  1T8Z A;  3SWF A;  2HG5 D;  2IX7 C;  3KDP B;  1N73 C;  2YKO A;  3HE4 A;  4DZO A;  2OYH C;  2WT7 B;  1JCD A;  1N73 A;  1WRG A;  2QM7 A;  4B86 A;  1H8A A;  1GU4 A;  3MGN A;  4HYT B;  2YMY A;  5AW8 B;  3VMZ A;  4GIF A;  4EIJ A;  4W7Z A;  1LWU A;  3H6P A;  1NH4 A;  3U59 A;  1T2K D;  2I1K A;  3R2P A;  1RE4 A;  3M9B A;  2IFM A;  3GHG B;  2N9B A;  2A45 H;  1ZV8 A;  1NOH A;  2N1T B;  2ZFC A;  1SFC D;  4I2L C;  2GUV A;  3P32 A;  1J1D B;  1URQ B;  1NWQ A;  3RK3 D;  1HGZ A;  1SFC A;  3V4W A;  1LTI C;  1SLQ A;  2WSF H;  2Z5I A;  2OYI C;  4C7N B;  3VP9 A;  1HVV A;  1L0N K;  2E43 A;  2XNX A;  3VOP A;  1SP4 A;  1HH0 A;  1N7S B;  2HFE D;  3HD7 C;  2O01 H;  1SVF A;  2YNY A;  1EQ7 A;  1ZR2 A;  2R32 A;  1IC2 A;  3HD7 A;  1FZC C;  3U1C A;  2R3C A;  4WY4 B;  3B5N D;  2Q5U A;  1QL2 A;  1NKN A;  1X8Y A;  1FZC A;  1FOS E;  3B5N A;  4GT1 A;  4IFD K;  3VN0 A;  1JTH A;  4HH2 A;  1RF1 C;  2XDJ A;  3RL0 B;  4Y99 B;  1GK4 A;  2O1K A;  2H8P D;  4KHX A;  1YTZ I;  2R5D A;  1GL2 D;  3RK2 C;  2HOD A;  4ZKP A;  1GL2 A;  2HPC A;  1KFM A;  1J1E C;  1IFN A;  3V2P A;  1M1J C;  1GDT A;  4JF7 A;  2Z4E A;  1KIL C;  2P7J A;  5AW2 B;  4M3L A;  2MJZ A;  2N1T D;  2KB7 P;  3L36 A;  1FDM A;  5AW5 B;  5AVS B;  2WTY A;  5APQ A;  5AW3 B;  2N1T A;  2NPS C;  2NPS D;  5CJ0 A;  1IFJ A;  3OA7 A;  1L4A B;  1JO5 A;  5AVU B;  3TNU B;  2NPS A;  3VP8 A;  3L37 A;  2QM8 A;  3BRT B;  5APS A;  1N7S D;  1YYC A;  1A02 F;  3LIE A;  3TSI A;  1N7S A;  2P2U A;  1MZ9 A;  3P8C E;  1LTA C;  4WY4 D;  3HUS C;  1Z56 A;  1GK6 A;  3B8E B;  1JY2 P;  1RE3 A;  4I6M C;  3II6 A;  4WY4 A;  1FBM A;  3M9H A;  2WWW A;  3P8C D;  1IFM A;  3EFG A;  5APU A;  5AVW B;  3RL0 D;  1KZU B;  5KLV K;  2IFN A;  1CI6 A;  4LLH A;  3N4X A;  1GU5 A;  1FZA A;  2WSC H;  2Z5H A;  5AW7 B;  4WBA A;  1SQV K;  2FYZ A;  3OAK A;  2A45 G;  3C9I A;  1JY3 O;  2VRS A;  1W2E A;  1JMM A;  2XV5 A;  3TYY A;  1IFD A;  1LWU C;  2FKW B;  3H32 B;  3MD0 A;  2CPB A;  3T97 A;  1RE4 C;  1RF0 A;  1FOS F;  2L5G B;  2FFD B;  4IFM A;  1T2K C;  3CLQ A;  1LTJ A;  1FU1 A;  2P1J A;  3V2Q A;  4EOT A;  4ZKU A;  2C0W A;  2WPQ A;  1RF1 B;  2YKP A;  4JYB A;  1G1I A;  1L4A D;  1MUU A;  5CJ4 A;  1SFC C;  3LID A;  2W6A A;  2JEE A;  3RK3 C;  5APV A;  1NKZ B;  3NFQ A;  1LTG C;  5AVZ B;  3VYI A;  1LT9 A;  2XKM A;  1CZQ A;  2WIT A;  3V4Q A;  2KSJ A;  3M9Q A;  3OJA B;  2YO3 A;  3NMD A;  1AQ5 A;  3BVH A;  3B5N C;  2JJL A;  2ZXE B;  1IJD B;  1FZE A;  1T3U A;  3HE5 B;  3V5B A;  2H43 A;  4LC1 A;  1SQX K;  4C46 A;  1XTC C;  2A45 I;  5APW A;  2WT7 A;  1AFO A;  1GL2 C;  1VPC A;  1CW5 A;  1G1J A;  1GTW A;  2J59 M;  2Q3I A;  3VMX A;  3M06 A;  3V2N A;  3L4F A;  3A5T A;  3CL3 D;  4OH8 B;  1JCC A;  2FFD A;  1ZN5 A;  3GHG C;  1IFI A;  1NHL A;  1G2C B;  4O9B A;  2N1T C;  3GHG A;  1JUN A;  1J1D C;  3HE4 B;  1URQ D;  1ZLL A;  2XU6 A;  1FJP A;  1N73 B;  4C7R A;  1GZL A;  2KYV A;  2GUS A;  1URQ A;  2OYH B;  2FXM A;  4JYC A;  5AVX B;  1JOC A;  5AVR B;  3L35 A;  1KFN A;  1N7S C;  2KLV A;  4C7N A;  1DX7 A;  5CCG D;  1JY2 N;  3CI9 A;  1LWU B;  3UIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...