1GDTA

Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
molecule keywords SITE I OF RES DNA
total genus 58
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gdtA03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gdtA02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gdtA01
1GV2A 4LOCA 4FISA 5FJ8J 3BTLA 1XG1A 4BXXJ 2L9RA 3PM1A 4QSHA 5J3LA 4M3GA 2HI3A 2HYJA 2YU9J 5F27A 5DS9A 1I3QJ 1FTZA 5F0CA 4HNVA 1Z77A 4DYCA 3BVPA 1BJZA 3BR0A 9ANTA 2EZIA 1JT6A 3BR6A 2JA7J 4IHYA 3WHBA 1JGGA 4A3BJ 3HGGA 1ZR2A 4IHVA 3GUVA 1S7EA 2X48A 1TWAJ 4X1EA 2E2IJ 5F08A 2ECCA 3C2BA 4IHXA 2HQ5A 5E3LA 5EZHA 2R5ZB 1NK3P 2GLOA 4C2MJ 3M3YJ 1QRYA 1E3OC 3S1QJ 4A69C 4M3FA 3IH4A 5M3MJ 4I6ZA 4X6AJ 4BBRJ 1MH3A 3BG9A 1MSFC 5IP7J 1ZQ3P 1IDZA 3TW6A 3W6VA 1AU7A 3E7LA 1B72A 2DA6A 5IOZA 3S1NJ 1OJLA 3B6AA 1OFCX 1ETKA 3RQIA 2DN0A 3JRFA 2AO9A 1ZR4A 2MGQA 3D1NI 1BW5A 2ID6A 3LHFA 1HX7A 5F0HA 2MHCA 3A01A 1MBHA 1JKOC 5FKMA 4AUXA 2ID3A 2DA1A 4ABZA 3I4MJ 3BTCA 2Y31A 4I76A 2LD5A 4Y7NJ 1WI3A 3BG5A 3UKGA 4A3IJ 3A02A 1IDYA 4S0HB 4QIWN 4J19A 3BQZA 3JRCA 3PO3J 4D7MA 1B8IB 4JX6A 1Z0XA 5C32A 2YUSA 2HXOA 2K40A 2R5YA 3GTPJ 1FEXA 1JUSA 3FKIJ 2FQ4A 1RKTA 3BR1A 1OCTC 1RPWA 2H1KA 5K7FA 1A6IA 2EZHA 3ZQLA 1XS9A 2H8RA 3A01B 4M3BA 3MVPA 4A3EJ 1YRNB 2XGDA 4MLOA 3SFIA 5E3OA 1H89C 1CQTA 2WAQN 2HDDA 3PO2J 3OIOA 3HOYJ 5IYDJ 1OCPA 2Y0SN 1APLC 2HOAA 3S2HJ 1VF9A 3A03A 1X2NA 1DU6A 3FK7A 2PMZN 3BT9A 1ZTRA 5IOYA 4UUSB 2RSLA 1MBJA 2TRTA 2DMNA 2DMQA 2DA4A 4BKXA 2JMWA 3CCYA 2FX0A 2DA7A 2G0EA 2CJJA 3PKZA 1I50J 1IJWC 1IRZA 3JRGA 3HKZN 1POGA 2ME0A 1HF0A 1T56A 2DTZA 2CU7A 5EYRA 1TC3C 2JK3A 1ZGWA 1ETQA 5M5WJ 1TWHJ 4FCYA 2CQQA 1G2HA 1QVTA 1GV5A 2LR8A 4A3CJ 4C3IJ 5C3EJ 2NS8A 3JRBA 4FE7A 2YS9A 4XRSA 1K61A 3IH3A 1JUMA 1NK2P 3HM5A 4A3JJ 1BW6A 1AKHB 2K9SA 2M2EA 3VPRA 2KT0A 1Y1VJ 4A3MJ 3S14J 2X6OA 5J1UA 1F43A 2EQRA 5K7ZA 4XICA 2EZLA 2XGCA 2L7ZA 2R93J 2LK2A 1Q1VA 1VI0A 4BY7J 4W97A 4UUSA 3SJMA 2GM4A 2MW8A 1MBGA 1UHSA 3RKQA 1JKQC 1ETWA 3BTJA 2CQXA 2FJ1A 2E2HJ 3BTIA 4A3LJ 1D5YA 2GBYA 2ZB9A 3JRIA 1GDTA 4NDLA 3ZOBA 4BBSJ 1ENHA 3ILXA 1WPKA 4M3EA 2DA5A 1FTTA 3GTKJ 1IV6A 2HXIA 4V2FA 2JWTA 5F04A 2HOSA 2IBDA 3CQZJ 4M3DA 4XK4A 4G12A 2XPVA 3G1OA 1JUPA 3M4OJ 1JTYA 4B1RA 2DA2A 4C3JJ 3BR3A 4XIDA 2DA3A 1IUFA 2XPWA 1FIPA 4C3HJ 4DZPA 1AKHA 1MNMC 3FK6A 3MN2A 4A3KJ 2JA8J 2N8GA 3O8HA 5FKOA 3JR9A 3BQYA 4CYCB 1GVDA 1RKWA 3HOUJ 4FTHA 2LY9A 1MSEC 3Q0VA 3TP0A 3K7AJ 1U8BA 4IHWA 5F0FA 2P81A 4MFDA 2LLKA 2OF7A 4IEJA 2ELKA 1TWFJ 3RZDJ 5FKKA 1BA5A 5EDNA 5EGOB 3NARA 5IPAA 2MSYA 3HOWJ 2E2JJ 5C44J 1IC8A 2L7FP 5IYCJ 1H8AC 1WH7A 2QF7A 2Y2ZA 1SANA 3QPLA 3HOXJ 4BY1J 2RAEA 1JTXA 1B72B 5BNGA 5GPCA 1JT0A 1HDDC 1K83J 2W48A 1LFUP 2D5VA 5EF6A 2M8GX 2XGEA 5K7HA 1GT0C 2FD5A 1FJLA 1U9NA 1P7IA 2QCOA 3BR2A 4JYKA 2CRGA 3JREA 1IG7A 2R5ZA 5C4XJ 4DYQA 2GM5A 3IH2A 5HODA 2COBA 3ZQHA 2L7MP 1MBKA 3JRDA 3TEDA 1QPIA 5EEAA 1NTCA 5FKNA 2B63J 2M34A 3OSFA 3S16J 1A5JA 2AHQA 3HOZJ 4DW6A 5M5YJ 1LE8B 3GTQJ 2K9QA 2XSDC 4AYBN 2NS7A 5E3MA 3Q0UA 1O4XA 1QVUA 4BQQA 2NVYJ 4JP0A 2KDZA 3H0GJ 2LTPA 3BR5A 1JJ6C 3HB9A 1H88C 1IGNA 3HBLA 2CUEA 4RBOA 1XC5A 2O8KA 1T33A 2VUMJ 3IV5A 3HEFA 3S17J 1RESA 3LOCA 1ZKGA 2E1OA 2NVQJ 1ETXA 1HCRA 2JJ7A 3F0CA 5EGOA 5C34B 2LKXA 4DZJA 3SDGA 3CMYA 3LSPA 5M3FJ 1VNDA 1WH5A 2JA5J 2JN6A 2NOGA 4D5CA 1JKRC 4MIMA 3GTLJ 1X2MA 2OPTA 3GTGJ 5JLXA 2M0CA 1ZK8A 2ECBA 5FLVA 4V2GA 1YRNA 4QTRA 4MO7A 1TWCJ 2DMUA 2MG4A 1U9OA 1PUFA 2XPUA 5EZGA 1LE8A 4M6VA 1F36A 1RR7A 3OSGA 3S15J 4A3FJ 1W0TA 2Y9ZA 3H3VK 1ORKA 2E19A 1FIAA 3S1MJ 4RDUA 1ETYA 2R5YB 2JA6J 3OOUA 3DCFA 1UG2A 2LVSA 1BL0A 2IEKA 2VKVA 1B8IA 4Y52J 4D5FA 3HGYA 2Y30A 2TCTA 5IP6A 3O8GA 2XB5A 3B6CA 1LFBA 3CDLA 3MKLA 4B4CA 2LFBA 5GPAA 5M5XJ 1SFOJ 3G1LA 3G13A 3S2DJ 1HLVA 1WGXA 2HOTA 3I4NJ 3ZQFA 1JKPC 4GFBA 4A3DJ 1MBEA 2NVXJ 4L5EA 1MBFA 5EG0B 1U78A 2EBIA 1DU0A 4A3GJ 2WB1N 5DTDA 2DMTA 3GTMJ 3FIWA 3LSJA 1RETA 4W1UA 1Y1WJ 3K2AA 3HDDA 3TW7A 2NVTJ 1VFCA 1GHTA 3HOVJ 3S1RJ 1ETVA 3GTJJ 3UJ3X 3ZQIA 2R92J 3BG3A 3L1PA 2XB0X 3LNQA 1AHDP 2O9LA 2R7ZJ 1TWGJ 5C4JJ 2X9DA 5JLWA 1ITYA 4D7NA 1MH4A 2K9NA 1EF4A 1HOMA 1WCMJ 1UMQA 2O7OA 2Y9YA 4CYCA 4JX4A 1ETOA 1P7JA 2DJNA 3G1MA 5J1YA 4AC0A 5F1JA 1GUUA 4DYRA 1HDPA 1JJ8C 3QPSA 3TP3A 2XRLA 3Q0WA 2I10A 3JRAA 1R9TJ 4FE4A 5IP9J 4UUTA 5FLMJ 4MFEA 3ZQCA 2R0QC 2VKEA 3GBGA 2ME6A 5C35A 5C31A 2CUFA 1PUFB 3NAUA 5GP9A 5IYBJ 3QQAA 2EH3A 1W0UA 4B3AA 3GTOJ 3FISA 5E3NA 5FKLA 2WV1A 4XRMA 4XRSG 3Q3SA 2DMPA 5J1RA 4JX5A 3WHCA 4EEFG 2VI6A 2IAIA 2LP0A 3LSRA 2VPRA 4A93J 3LSGA 3JRHA 2M9HA 2EZKA 2L0KA 1X58A 1I6HJ 3RZOJ 3LHKA 3ZQGA 3DEWA 5EG0A
chains in the Genus database with same CATH superfamily
2O1XA 4QPPA 3RK1A 3VMFA 1CE8B 1NXTA 3FGAD 3TQSA 3H1AA 4DMCA 1E62A 4UTXA 3I01A 4JT9A 1YTZT 1WMEA 4WDQA 5JJKA 1P91A 1ZBDA 5F08A 2OFOA 4B6QA 2V9VA 5GJBA 4BAZA 1H8EA 2RG1A 3RYPA 3EE6A 3CJNA 4X20A 1HEUA 1KTMA 3M2PA 4D4MA 1SVIA 4FNOA 2UZAA 5FDFA 5T57A 3T3DA 5D3ZA 4CTOA 3GLFA 3GHGA 3E70C 4YJFB 5HG0A 4AUXA 2HA5A 1LRLA 3L7OA 1Y6RA 3E2PA 3NTUA 2CMKA 4QIHA 1EE2A 4PX3A 2C77A 3KG2A 3RVSA 4RF2A 1RI5A 4J0JA 3PXBA 2YUSA 1WKBA 1CZRA 1N2JA 1A98A 2JGEA 1PV4A 2WT4A 4TXHA 2FQXA 3TMOA 1BS9A 1LGHB 2MSNA 3EDMA 2P4EA 2XWSA 7YASA 2VATA 4IIFA 3W6OA 3TGUE 4UOQA 3D9QX 1RRFA 1B6GA 2B78A 3QG1A 1XA3A 2G0EA 1RXVA 3L75G 2ZSBA 2RHWA 1O9GA 3PC2A 2FBKA 2E5WA 3RAGA 3MJFA 1C5KA 2AF4C 3C5CA 4MTDA 1HE2A 5CDTA 3FPSA 4DT0A 3ZCQA 4OKNA 4KSBA 1CUUA 1AHNA 1I4TD 3GJYA 2PSSA 3NTQA 2JI7A 4CCSA 1NKNA 1G0NA 4FYIA 3H1LE 2YQ4A 5AOVA 3ETCA 4C2BA 2AN5A 1U8FO 1T1IA 1V11A 4K2HA 1BXRB 3O4JA 1QQIA 2BMFA 4JBZA 4LJSA 2ANCA 4MCIA 3C0KA 2ZNYA 3O2QB 4MS3A 1VQNI 1VL2A 1AUOA 1G6OA 1FC3A 3HLTA 1X79B 5BRJA 3C5VA 1WEKA 1IDOA 4AAYA 4JF7A 4NBKA 2EFWA 4IILA 2HSWA 3RIYA 4PLYA 4XLPF 4YLEA 2VF4X 2XB6A 4KPUA 4P9NA 2OFWA 5BR4A 2FLWA 3EVBA 1SBHA 4F5ZA 2VDOB 1NXWA 2ACEA 1G3TA 3C3MA 2DKFA 1H6AA 3C1LA 4Z4QA 2GLTA 3LIPA 2CV0A 3OQ6A 4C76A 1B73A 2VHYA 5IK2A 4AVZA 3DTVA 3R8CA 4KQHA 1UAYA 4MR7A 3FTCA 3VFDA 2JIDA 4ZJYA 3JAMZ 1Y1TA 1E0KA 3E1IA 3OQPA 2M34A 4WXCA 2QE7H 4Z3OA 2PIAA 1Z4IA 3K6KA 3K09A 4NEHB 1JUNA 2JBAA 2Y1OA 3GMSA 2I1JA 1R6TA 4D9FA 1PO7A 3D4LA 2Q62A 4JI7B 1A4XA 1X94A 3DTVB 1Z4QA 3DC7A 1HYQA 3B9RA 2O8DB 3DO8A 1EXNA 4IR7A 2RHTA 4DCGA 1P7VA 5FFZA 2G7UA 3EVEA 1P5JA 3INGA 2VJMA 5DCMA 4DZJA 2ZVJA 5DYWA 2J30A 3KYBA 4HTFA 3IP9A 1KAEA 3T3HA 2RJNA 5HE8A 2ERCA 1X9GA 5IBCA 1S8NA 2P0EA 4V0LA 4LFBB 1YULA 1QRRA 1GAXA 3OWOA 2CLMB 1HTWA 5IFKA 1A36A 4UUAA 2J9ZB 3TIFA 1JKJB 3D5EA 3WIDA 3RK2D 4DB4A 3KV1A 1SQPK 3G6EI 3WNZA 3TLJA 4EMSA 4Z99A 3OEYA 2G36A 3TGPA 1T26A 4ZC1A 3GUZA 4ETWA 3F5FA 4MDEA 1T9BA 4X3PA 2JFNA 4OAYA 4BN0A 5I7UA 5EIWA 1XRRA 2Q41A 1V4VA 2HYFA 4R2JA 4U7JA 1ZS9A 2FYTA 4ZDOA 4WZ6A 2VJ5A 1DARA 4TV8B 4EHJA 2G76A 1U1EA 1Q1NA 1PFQA 3H3UA 1C1YA 4HDMB 2PH3A 1CUBA 4M6YA 2E87A 3TP3A 4LNUA 5E7JA 5E79C 4HNGA 4U8HA 1ZM3A 2I8DA 5JRJA 1XVUA 4BVKA 3G9RA 1NTMD 2DU9A 2FA9A 2CSXA 3R5XA 1SUIA 4P7KA 4LB6B 4ZTZB 3O2SB 5B12A 3DVRX 4IKPA 2BFFB 3KEQA 1D4FA 4EW6A 2DMPA 2CLEB 2B99A 1VLZA 1KYWA 5BVGB 2YU9J 3QPVA 2IBTA 3E58A 4GR5A 1JDVA 1VBFA 3EPKA 3TMAA 3EDQA 4IDFA 3WGUA 1FDTA 5KJ7D 4P31A 1YUBA 4DV4B 5DBGA 2OK7A 2XTMA 1DCTA 1P44A 3F4KA 1KNQA 2QSIA 3C24A 3F3YA 3VSCA 3ZDQA 3AEZA 4EM0B 5EZHA 4G1BA 1Z45A 2R5ZB 5EZ5A 2QQBA 3OA7A 5AVXB 4BBRJ 1ZREA 2OP0A 1L5SA 3LA8A 5HA5A 4ZYTA 2C3UA 1NU1J 3KWLA 2AQIA 1M8FA 3QRFF 1UJMA 1IRFA 1HE3A 1Y5NA 1R4NA 3GMIA 3I8SA 3SPXA 3CX3A 3KE2A 3H8JA 1DO0A 4KE6A 3EHEA 3QLUC 4Q16A 2X7JA 1YBMA 3CISA 3A1EA 4WZAE 1NYLA 1T9AA 4YNBA 1ODKA 1M8GA 2N75A 4JEUA 1JG6A 2X6YA 5KO2A 3TRHA 2NLOA 1JPJA 2GA2A 1D2AA 3A1NA 4ND8B 4OYHA 1H66A 2PSDA 2R86A 1LQTA 4Q01A 1T8YA 1AX9A 1V1RA 3ND9A 1CT9A 2HC9A 3KP4A 1S3FA 2Z0MA 1WXIA 1TBXA 1LW7A 1HG0A 2XYHA 3BGIA 4TL6A 4JIMA 2WUDA 2RSLA 1NTOA 1KXJA 1LTIC 1SQBD 3OZIA 2GERA 3OFVA 2C8VA 4UASA 4PGFA 5EXTA 4ND8A 3ILSA 2HDHA 1KK2A 2A92A 1GV5A 2W11A 3GEMA 4RHEA 1XN4A 3CR7A 2RDMA 4YRQA 1F7VA 1FJKA 4DXHA 1YTYA 3A14A 3DL2A 1RWBA 2AR7A 4D56A 1UWVA 1X1DA 3OE5A 4FHEA 2FUG1 4WY4B 2P9ZA 4Q4LA 2DUWA 2ENUA 3N3BC 4AG3A 3PE6A 3JQCA 1ZEJA 1M8KA 2VL7A 2A9VA 4I1VA 3H9JA 4IJ5A 1DT5A 1XMSA 5IYZB 3WTCA 1HYEA 4P7BA 4PZLA 1MABA 2IHKA 5KBYA 4DYHA 1RXUA 2GPAA 4QAJA 4XMYA 3PKJA 1A76A 3AP2A 4MKIA 3CLTC 1H0KA 5DLPA 4N65A 2P30A 1O96B 2VLAA 1KI2A 4TV9B 1USKA 3WUUA 2C2OA 2IYFA 1LBHA 3RFTA 3E48A 4MUGA 4HTAA 4ETSA 3DNFA 1I6LA 4UPDA 3EPHA 1V8DA 2XAJA 2HMAA 2QMHA 3L0BA 4GKKB 2Z3ZA 4Q4CA 4FLEA 2IIBA 5A1TA 4EJ0A 1EXDA 1NQUA 1S2EA 4X1YA 4C7RA 5BQFA 4KBGA 3U4AA 4L0DA 1VQLI 4Q4ZF 1UWCA 3L2RA 2EHDA 1NTCA 4WASA 3K9WA 3R9IA 6GPBA 1CR6A 5DV9A 1SKQA 4URVR 4NARA 3UT5B 2NXWA 4RANA 1S8FA 4R1NA 4GOEA 3QNMA 5L3ZA 4N0EA 4B81A 4QO8A 1ZHOA 3HKCB 4BYYA 4GXOA 1FDWA 3T9CA 1NWCA 2AG1A 4A8TA 1EDIA 1HNXB 3GEBA 1Y33E 2DWUA 2V1UA 4AVPA 1KDZA 3I56I 3RIEA 3H18A 2A5JA 1WMAA 1FP7A 1Y1LA 3V7UA 1TZJA 1SCUA 4F45A 4LMAA 2OCCH 2JWAA 3B1YA 1TWCJ 1Z16A 2WYWA 3NRBA 5CFZA 3AU9A 2EYQA 3B8HA 3HP7A 4HUQA 1GZ3A 4RDCA 2PL1A 3E5NA 4NU6A 2FGKA 4J4TA 4LTDA 4Q24A 2SKCA 2CLFB 2QRQA 3QVKA 1KV4A 1FEZA 2Z9BA 3KHKA 3F9IA 2WTNA 4W5QA 5ESDA 1J23A 3O0DA 3FDJA 2EBIA 4QOSA 1EG2A 1WTCA 4IJVA 5L45A 5EA2A 2K7LA 4P5DA 3B1VA 2RGVA 5AJHA 1L6RA 5CCGC 1ISHA 2O6GE 1ZSNA 1KO4A 2HQRA 3OQNA 2H6BA 4KO3S 3B3JA 4DMFA 1BJTA 2LY1A 3G1MA 3T0GA 2Q1UA 5HCUA 3DXZA 4KGVA 1DADA 2YYYA 3JD0A 3DDUA 4N5LA 3QYBA 5CCHA 1FJ2A 3PX3A 3LQ1A 1LJ2A 3IHWA 4G6ZA 3IP3A 3QQAA 2W2XA 3KU4A 5AKJA 3RO7A 5BN4A 2AUMA 4F8JA 2Z2SB 5KVCA 2FPUA 2JIPA 3MMPA 4HS9A 1BA2A 3EFGA 2WFZA 4CTMA 4EBFA 4OQXA 2O7NA 3ROTA 3C7CB 1GA1A 3VR5A 3P71T 4RKQA 2VVTA 3G0GA 4C1BA 2FKWB 4KDFA 1VE7A 4JQZA 2C8LA 5DX8A 4UHDA 3I2YX 3CX7A 2YNYA 3L7YA 2R2GA 3KKMA 1W2BO 3PRYA 4KOAA 2QW8A 5T67A 4RELA 2XAQA 3AWIA 1PVVA 3T95A 2PQ6A 4TKZA 4AO7A 1M34B 3QQ5A 2H00A 2RB4A 4FGJA 5EPUA 3MGKA 2DN0A 2D1HA 2YMPA 3CUSA 2FEKA 4OQNA 4ZVTA 1UPBA 4C4TA 3DHYA 1VLQA 1RM5A 3WLFA 3OQBA 1POWA 3WYBA 2OOKA 2C5FA 3Q2YA 3EGOA 2Z1NA 5FTMA 1X3WB 3TEMA 2RNGA 5AVUA 2H1KA 3TB6A 1H8AA 1SXHA 1BM9A 2DODA 1QRDA 3A03A 3ND5A 2QJYB 2OD7A 4CQMB 1CS4C 1P6QA 1KRHA 1I50J 1RFLA 4KWHA 1KL7A 3CMMA 4KA4A 3PD1A 3GJ8A 4GECA 1H9CA 4H17A 2OTJP 4R1MA 2MCFA 4RSMA 2M1XA 4Z86A 4MTEA 1XQ1A 4PJ0C 3OH8A 5HUHA 2FUEA 1T3SA 3K94A 4AMYA 4CLEA 4CICA 3PQ4A 5KAIC 3GT0A 1YQUA 2L17A 3S27A 4XPZA 2Z83A 3RD5A 3J7YJ 5AK4A 4WKOA 4IUBS 4JL5A 3C6YA 3UH0A 1KARA 3HCFA 4QOEA 4BOYA 4P22A 4M9RA 1JKJA 4WJKB 1P9OA 3K4NA 4BO6A 3OPQA 3TGLA 4RVFA 3GJ3A 2ENWA 2QNBA 3K6SA 3LBFA 1YBFA 1LKZA 3VNQA 1M2OB 1E79H 4PZPA 3B8EA 1IXZA 3LVRE 4KDEA 2LVBA 2P6MA 1NFQA 1TZCA 3VHXB 4Z1OA 2V7GA 3ABVC 2A4MA 1D0ZA 5IP5A 1TZBA 2XV4S 1U2TA 4RO0A 1E1RA 3CVOA 2PUVA 4WY4A 3BJIC 1ECPA 4WQMA 4OFBA 2B1IA 3TYXA 2IBZE 3F22A 3OS0A 3NBXX 4BFZA 3UN1A 3UTDA 2AG0A 1CR2A 3D2CA 5FO5A 4M74A 3R6GA 5AOCA 2KE5A 4WGGA 2NS7A 2XJ4A 4F60A 2XIQA 2KLBA 4UU8A 1HR0B 2V9KA 3WYCA 1COWA 3MKWB 2LTPA 4OK3A 2I34A 4TT3D 1TQIA 2LBFA 4IXWA 4TYYA 2I1WA 3TSOA 1XJWA 2BCCD 2ODTX 2XVXA 2J85A 3GDFA 1E5WA 1K98A 4G41A 1FSHA 2G9NA 1NR5A 2DM6A 5AICA 1W0KA 2PMHA 3RFVA 4V2GA 1LBQA 2BFEA 1NPTO 3KAKA 5EJ4A 5YASA 3NFQA 2DR2A 1UM9A 2Z5LA 2RAVA 5JT1A 2DP4E 3LPCA 4QFBA 3MAGA 4G8CA 1RU3A 2F4OB 1NBHA 2X6XA 1LBIA 5L3EA 5M5XJ 1ZK3A 2MU1A 5B53A 4PX5A 3K8ZA 3LYUA 2PT7A 4NKRA 5FUYA 1NUTA 3ABQB 1RZ4A 1SQQG 3EEOA 5HJ5A 1SWWA 3DKYA 5E6UB 4PANA 3SZPA 4O4JF 3OJCA 3OL4A 1W0KD 2O48X 1A6QA 1TAGA 2CEAA 3WGHA 3LDGA 4YAKA 1HOMA 1JNMA 2FY8A 2CJYA 4KJZA 2WVJA 4ZI2A 3I55I 4AJOA 1D4ZA 1VQ7P 3ISPA 1DBVO 3L75J 4FJ0A 1AKMA 1SQXK 5C31A 3HYSA 4U7BA 3VKFA 3BC1A 2Q9AA 4XPIB 5E3NA 3NIBA 3JW8A 1JG7A 1HV8A 1WPQA 1P0IA 3R5FA 2XHZA 2ZRCA 4IG4A 3N0TA 1W1UA 1W35A 3IMGA 1FL9A 4OATA 2QUKA 2QN1A 3LQQA 2G5CA 4F6RA 2CW5A 3W5IA 5JQGA 2O05A 4L72A 2VL8A 2K86A 3KOYA 3AY7A 1E2LA 1MX3A 2Z8XA 1NP7A 2MMGA 1FF9A 4OQYA 2Q5FA 5HCNA 1B23P 2D7JA 3M4NA 1SU6A 5JV5A 4ZYEA 5KC8A 4LZZA 1WDMA 1G6KA 3JZDA 1S7EA 3ND8A 1XRQA 5D7NA 4CIDA 3SG0A 2H5IA 1UIMA 2FRHA 3DDZX 5MN6A 1XT6A 2BZTA 2YWBA 1ZXGA 5KOHA 5CGZA 1H2EA 2LSOA 3A9RA 1B72A 2BKUA 3DE1X 4B75A 3A1TA 4KI7A 4DVGA 3M89A 3Q5GA 1JFLA 2ID6A 3I59A 1NKVA 3MTQA 1EM8B 2ONZA 1JECA 4HGNA 3D4OA 3LA2A 3TCKA 2R79A 3WLKX 2JEYA 5EP4A 2V55B 1E6WA 5E9WA 3G82C 2RHHA 2PI0A 3NUZA 1Z21A 5EL0A 4HYYA 5K2MA 2V26A 3BCSA 2HPHA 4KNWA 2KB0A 4HC4A 5DNWA 2HI0A 3V7WA 3RREA 2GOXB 2M4KA 2R11A 3D64A 3FMIA 4UOEA 4MVXA 3RRBA 2NTEA 4IDCA 4YBRA 5CT4A 2W24A 3DAOA 4U2BA 4RB3C 2PLYA 5JFTA 4D79A 3AR9A 4D6TD 5AW6B 2VPTA 4D42A 3P8CD 1V45E 3ZMVA 1NVXQ 4J9UE 4FDAA 5C8YF 4PY2A 1H2YA 3BA1A 2LR8A 4A2UA 1RXYA 1UPFA 3EARA 2QL6A 2WVAA 4QPDA 1Q1EA 3H2SA 2YMLA 4B0OA 4X7MA 2B37A 1K73Q 4F0JA 3DTEA 2QN6A 3A6DA 3N8HA 3EF3A 4G7ZF 2LK2A 3BQMB 3F4BA 1YR2A 3Q2KA 3PNQA 1SHUX 3RGWS 1KFMA 3A6ZA 2C4TA 1EK2A 1F2UB 4Y18A 1WWKA 1W88A 1J24A 3OZUA 1WR8A 2FSVC 3ULKA 4QFCA 4GI7A 1AKHA 2A3RA 1KDTA 4UE3S 3PYMA 2QXUA 2WB2A 1EFPB 4Y9RA 1FYWA 5HKLA 4KFRA 2WIAA 4Q3DA 2NW6A 1RHRA 4IDEA 5CH5A 5JJ5A 1T5SA 4XEUA 1CUFA 2A9QA 2E5LB 3VTAA 4DAOA 2DE0X 4G4SO 5CU7A 3CO6C 3SZGA 3W6JB 4ESOA 3TX6A 4NJMA 2Q3DA 2C3OA 1G3WA 4RXTA 3FF1A 3A3KA 1N2OA 4MDFA 3MYYA 5DCUA 1U6JA 3R0JA 4IO9F 4HAOA 2EB7A 3L7LA 2L7MP 2C9CA 1P1FA 3RK3C 1Q7RA 2J87A 2WJAA 4EGYA 5HYVA 4GXTA 4L9AA 1KJNA 3N6RA 5M1BA 3UGKA 2L9NA 4JP0A 3PNSA 5FOSA 4DCNA 1IWBB 1MEJA 1P2VA 1MJFA 3R3VA 1UKAA 1LLUA 1N7LA 1EUYA 2M3AA 2HK7A 2ZBRA 3RWOA 4H13D 4XE5B 3R5JA 2WR8A 4IXNA 2BXZA 3C1AA 1UBRS 4JMPA 2GK7A 4RZSA 1I2MA 1PZHA 3T5CA 1CR0A 3H9UA 3BE8A 4AROA 3JAMA 3OF3A 5AKKA 3R4YA 4MCHA 3UCEA 4UD6A 2Z30A 3QBVA 4M7WA 1ZN2A 2K4BA 3HLYA 2H63A 2WT8A 5DNEA 3FDYA 1B43A 1BL0A 3D7KA 4JMLA 2HTJA 2ZIUB 1S3SA 3O8GA 3LCRA 5FFFA 1AKNA 1YW9A 2LFBA 3QOXA 4PJMA 2WE8A 1VDMA 1ZIPA 5KJ1A 1QVAA 3HVIA 4QJ4A 4GPD1 1CDOA 1EI9A 3REGA 4QNRA 2H57A 4WOBA 4BWVA 3K0CA 4P34A 1G21E 3B7WA 4DNPA 2WYVA 5FWAA 5EMJA 4J3JA 2C9NY 2MH9A 4HDOB 4N41A 3M5CA 3DEFA 4ND5A 1Q3HA 1B2LA 3UT5A 3KP2A 3TVTA 1G8GA 1Y3IA 5LHHA 3CDHA 2VOJA 1LEHA 1QF9A 2D5AA 3UJ7A 5C35A 5K7SA 5TMDA 3KL4A 3MINA 1JR3D 1Z8FA 8AT1A 4PXAA 3TSAA 2QM3A 5FQOA 1E7MA 1TI7A 2ODAA 1UBEA 3WBKA 4YCSA 1KTIA 2QR2A 4Y2VA 1SIBE 5IXSA 3OTHA 1X86B 3E7FA 5DB4A 5A5VA 2IDMA 3VOAA 3WYNA 1GGFA 1U0OC 5F2OA 1NVMB 4B2PA 1DG9A 4U7HA 4M0MA 5E79E 2YHUA 2WQZA 3TQFA 1ULYA 4BJ1A 5AVSB 3S7TA 4BCDA 3DYBA 3BMNA 5TVGA 3GHGC 4PFPA 1HDEA 1XU7A 4OIPF 1NNI1 3VVCA 1YIJI 1BA3A 4NCHA 4X20B 1BKSB 5ED4A 1MH1A 1BC8C 1FDVA 2BSXA 3UHFA 4N0DA 3CINA 4JB2A 5DGIA 2C5BA 3L74D 1RWNA 3MJVA 1TZ2A 1SCIA 1RDFA 4HK4A 2JHGA 1GGEA 3V8PA 2GWRA 3ZHZA 1G19A 2O07A 2E74D 1K8RA 1FEXA 4CNBA 2IEIA 1PD1A 5JO9A 4F86A 4P9FA 4J2HA 4D0NA 1QKJA 2G7MC 1DXYA 3IFMA 2X8JB 3ZHCA 1XDWA 4MYSA 5FBRB 1NSYA 5E8JA 1RYHA 4JB3A 1GQYA 1G18A 2I3ZA 4EF5A 3K5PA 5D3KA 5TRTA 3VYIA 4IVPA 3AUTA 4R7ZA 2PUJA 2FOIA 3EIOA 1JSXA 3D8HA 4Y9DA 1KVQA 1GUZA 4IRUB 1ZGWA 3IT2A 2NU7A 1DGWY 2VJ4A 3QU6A 1X19A 1AKYA 3P9NA 1QGPA 2W93A 5E0OA 3DNPA 3A05A 3QHAA 2CMDA 1YJCA 4I7HA 3MJDA 2J1LA 3FYTA 4CKWB 1VB5A 4B8YA 3NHWA 5KINB 2WJHA 3EY9A 3G2KA 1RIIA 4S1OA 4W1QA 4EM1A 1YS1X 4ROTA 3PT9A 1BE0A 1D2HA 2NQ8A 1K5GA 4Y1GA 2BRUA 2OD2A 2H4JA 1LI5A 4N8SA 3PXCX 1O2DA 2CLHB 3F6CA 4RVNA 2PU5A 4CDRA 4WA8A 4X71A 2VPWA 4IAOA 2HO5A 3BRWD 4RHXA 5EXEA 3MWEB 5APQA 5KYUA 5B7NA 2JA8J 4D9EA 1XMAA 2K6GA 1L0NJ 1UPAA 1NJ8A 5GY7A 3U37A 3M83A 1CUYA 4EARA 5JYDA 1NC1A 3NYIA 2W7NA 2PWBA 1HT2E 3NVMB 3QELB 3GO5A 3PFYA 3T8TA 3MCVA 3AB7A 3DQPA 3SIRA 3DFMA 2ZE5A 4K9OA 3QX7A 2X6RA 2PBRA 1YCDA 2XQIA 1N9GB 1GU0A 3HUUA 2PT6A 3S16J 3IEUA 1SQQK 1IB6A 5SYAA 1M1YB 3WNBA 4RMJA 2GLXA 2Q1TA 3Q0UA 1YKFA 1BN5A 1MO3A 5K8VA 4DR7B 1NQXA 1MNQA 2XB2A 2HEOA 3QVGA 4KAAA 5CLSA 5DV5A 4PQEA 6AT1A 1RESA 4MS1B 1NYRA 2F9FA 1ORTA 1CERA 1SD7A 3GLKA 4N3AA 1YSCA 2AC4A 1T8WA 4MQFB 2YZ2A 3LT2A 3QKRB 1UKBA 1C3LA 4XR9A 1JBKA 3NP7A 5J4HA 4UUNA 3DOEA 4IHKA 1K6IA 1KSGA 3KE9A 2OORC 1HM5A 2B6NA 2Q5IA 3CUWA 4ISBA 5BSWA 3BMNB 3VGJA 3WIUA 4A2CA 2D2CC 1ETYA 4K0KB 1HE4A 3GZJA 3ZS9A 3RC8A 1GQRA 3TN7A 1EFAA 2OYHB 4IJMA 4YT5A 3W90A 1B93A 4E11A 3L8MA 5AVQB 3I4NJ 5H81A 2ZB2A 4CCWA 1JKPC 4AZTA 1WUTA 1EIZA 1TYBE 3ZWCA 3OLZA 3UXMA 2OBNA 4DW8A 1CEYA 1NJFA 1Z6AA 5ECDA 3X1JA 3GPIA 2ZI7A 2K9MA 2J48A 4DM3A 1UMBA 1LT1A 4V3CA 3V00A 4TQ9A 4RSRA 5AVJA 1R8SA 3H13A 1AOYA 2I54A 3CXUA 1RE0A 1A5ZA 5CCGD 4L15A 4ITVA 4WXPA 3H19A 3K8OE 4BDZA 1ACJA 1WUJS 2VKEA 3QFSA 1FOKA 2J3LA 3PQDA 1NRWA 5KLVG 3WNCA 2XDYA 2FNAA 3FISA 2MTBA 2QP3A 3AF0A 1AGPA 1EDJA 1OD6A 3RUDA 4BUZA 3DWGA 3DMTC 3GLRA 3A2NA 3DLIA 4UNIA 3DEWA 4PR0A 1FUEA 1W2EA 4OMFG 4RMGA 1Z77A 2BFMA 1V8ZA 1NTKD 3HU1A 4GPIB 3QQPA 1ZSYA 4CV0A 1Z5WA 4RFVA 1J9ZA 1UKVY 5AM3A 4EY7A 1NLYA 1UBLS 1VL8A 1VG8A 3ROEA 5TS2A 3BE5A 1U28A 3Q0IA 4Q18A 1ZD1A 5IS2A 3V5BA 5E20A 3PX7A 3FMQA 1OOEA 2OCDA 4H0CA 3WV5A 4G81A 3K0BA 5IDWA 1NZJA 2HWWA 4E5PA 2HRBA 3V80A 4G6TB 2HBZA 2NNWB 4RH3A 3ZV6A 2HFKA 3A3NA 5HRAA 4BB0A 2H08A 3OJ0A 3QJ5A 2R25B 1LDEA 4MCJA 1EYZA 4O2BF 1DQYA 3DVQX 3D2BA 1DWPA 1Z0AA 1LZLA 2L02A 1FJHA 4PPNA 2FEXA 3NKVA 4CMHA 5I7WA 2JZCA 3V4WA 1USDA 1TQ2A 1K75A 2PPLA 1N1EA 3LIEA 5I6DA 3RSCA 3K8YA 4R6XA 3HN7A 4ZDIA 2H43A 2F7SA 5EXPA 3RS9A 1DD4A 3K0LA 4KTVE 1G9TA 1ODTC 3CD6I 3JRGA 1E2DA 1G9SA 1ENYA 4LMRA 4CEJA 1YRQA 4LF8B 4CEIA 2XIGA 2XGMA 1E1RD 2JA1A 2VA9A 4P32A 4RZQA 4J7AA 5HGXA 3OX1A 1QVZA 2P7JA 2V7EA 3OOEA 2HF2A 1HRDA 1YB1A 5D6EA 4IOMA 2VK8A 3T34A 4J90A 3H75A 4EM6A 1UMKA 4KQEA 5KTTA 2ID4A 2VNJA 1SXJB 2ZYVX 1QB8A 2GZWA 4XRGA 1RFGE 2BIFA 1OZHA 2QNRA 4L8GA 1JKQC 4ZVPA 4DRYA 3WTTC 2WMMA 3AEEC 5D3MB 4GR9A 5M04A 3S9OA 2YOFA 3BJMA 1QG0A 4PONA 4KVZA 4FGSA 1T6SA 1EESA 1I6WA 2V6IA 2G1JA 2HV9A 3C3WA 3NH9A 3RK2B 5AMXA 4C3ZA 5KTSA 4I5FA 3FK6A 3F46A 1ENPA 1GK4A 2HQSA 2PRKA 4JGIA 1W7AA 3K7AJ 4MIEA 4PLHA 4FJ1A 4YGYA 3F3XA 4QYMA 1KYVA 1M74A 1XNJA 3NARA 3EG9B 1L4HA 3DXFA 1QDEA 3CX5E 3W2IA 1YX5A 4H35A 1D1TA 1Q6ZA 5TC4A 2BDUA 2CXXA 2VLBA 2BFFA 3QW2A 4QD3A 2R65A 4OYRA 4UCWA 3HWRA 4QOIA 3MNFA 1QQBA 3MF4A 1XGKA 4G0QA 4DW6A 2FW9A 1A04A 1ZVMA 1EXWA 4QPJC 1UOQA 2DPMA 1GGNA 2DX7A 2R7DA 1X14A 2YL2A 2RGEA 3I3LA 4R2WA 5F78A 5KKAA 1WB9A 2YJ5A 1F8UA 1WV1A 1WMKA 5G40A 2UUZA 3KOXA 2FZVA 3UAGA 5JHFA 1QIMA 1LPAB 3CMYA 2JA5J 1WMDA 2PO7A 3B71A 3GGPA 5JLXA 2QT1A 3VOSA 3T8YA 4L78A 3F6OA 5C8ZA 4O4HF 4QQNA 1IK4A 2QB5A 3TQCA 3H25A 3UAZA 2JFWA 1JYEA 2C58A 3WTBA 5KNDA 3MWKA 5K3OA 5LR6A 1GIAA 1P8AA 3PWKA 4KXFB 1E3IA 3VYRB 3SXUB 3R9XB 2E75C 3D4IA 4FZ5A 1D2CA 1H8HD 2C5LA 4QLBA 2WJVA 3H5NA 3WHIA 4GXRA 3H1CA 1WPRA 5KNLA 1OLXB 4L75A 1T5TA 2J31A 3K2AA 3H6PA 4EJ6A 5DDIP 4HSTA 4ERNA 1U11A 2XE8A 4LY6A 3RJ9A 2AOXA 3K2EA 3LLSA 4ZCSA 4Y3OA 1L7DA 1PG5A 2E85A 1FZAA 4LG3A 1DWUA 3IOMA 3DPUA 3QP6A 3GBGA 1N86A 1PS0A 3U7FB 3UUFA 3SF0A 5IPFA 2V0GA 2ZTUA 4Q7LA 3HFRA 3AI2A 4NC6A 1BYIA 3G85A 4BGIA 3BIWA 3V5NA 3DE4X 2Y1WA 3UAOA 4GZ5A 2XQKA 2VC1A 1R23A 2A6PA 2EJRA 2AS5F 2P2YA 1NJSA 1Q91A 2QL7A 1XG1A 1O0SA 3CUEF 2Y68A 4MI1A 1FBUA 3QPDA 3UWPA 4CU2A 1XQ6A 3LX5A 2GSWA 1L4AC 1VIYA 2ODQA 5TJ9A 2WSMA 4LC9A 3D59A 4CUGA 3TQNA 4HLNA 4PNEA 3C2BA 1JJ7A 4PJLA 5M3MJ 2FOWA 3OPMA 1MSFC 1B1AA 3FPEA 4C4XA 2F1KA 3RBVA 4R01A 1X7DA 3I55P 4BFTA 2OSVA 2P0YA 4CKEA 1YH3A 3PQ2A 5E18F 5K5QA 3P4XA 2DU8A 2QLTA 3G2JA 1WDWB 3DBIA 1SG9A 1H05A 5GTHC 2M2IA 1VPWA 2WRZA 3UQYS 1GNRA 1IZ8A 1DBIA 1BMQA 4GH5A 4ND1A 3X2SA 2V6CA 1ZRSA 1JB1A 3T5XA 1ST2A 5BYBA 3MWEA 2ZJPF 1QIDA 1XPUA 2MIIA 1EX1A 1X39A 4K9LA 3AOEC 1DPRA 4H7IA 2JBWA 1WCXA 2VJIA 2QEXI 5HDQA 3FCEA 1XVAA 3V2RA 3KTDA 5CAEA 4NPEA 3DFFA 1G4AE 3JYLA 3BT9A 2VCHA 4A8PA 1ECJA 3EIEA 4BNYA 1CGPA 5C4IA 4GOFA 2P7VB 3ABUA 3QA9A 1RBYA 5EWMB 3LQFA 2ZRIA 1L4KA 2SNIE 4JLOA 2A88A 4OYLA 1RPAA 4C0LA 3CT4A 3UA3A 4GX1A 3IH3A 4GC5A 1UXKA 3R3JA 2A1UB 2X0IA 1ADGA 2R97A 5L7WA 2PSFA 3WDMA 4V19K 3RABA 1TLFA 5CVJA 2GAUA 1LDBA 2A1TS 4YAJA 4NOJA 1Z2DA 3R1IA 3BTJA 4LV5B 2NMVA 1KU0A 1JY2P 1NQVA 3VNAA 4M8SA 4HWRA 2X4HA 1UIIA 3UJ6A 2I7DA 4R0NA 5CLLA 1T0JB 3K35A 1AY0A 3TGWA 1PNRA 3CVVA 4HYQA 3X44A 4GP9A 2NYUA 4KN6A 5ALMA 3VDMA 4HD8A 4PLFA 2CFRA 4TS3A 3OZDA 3DDNA 2O4UX 4N54A 3USSA 2GASA 4LZPA 3K0FA 1UMBB 4YP9A 1XCJA 2A0FA 3P9XA 4HF7A 3PH0A 1QU2A 3EGCA 1KSJA 1SC3A 4KNYA 5I9MA 3N7AA 4BP9A 5DHAA 1HETA 1XNHA 4OL0A 2QQ8A 1OE0A 1QYCA 2LWIA 4HEA1 3AI3A 3Q8MA 2XBMA 3C7KA 3O1LA 2VRCD 2OPHA 1QPIA 4H3SA 1E8MA 2ZRAA 5B4TA 3WGNA 4KN7X 4D5EA 4PJJA 4X1OA 2D2CD 4TRNA 4BQQA 4BYMA 2FZGA 3NEPX 2YV1A 3C8HA 4J49A 2QN3A 3G49A 3W2FA 3V8LA 5LB4A 1LDNA 3HEFA 2DCEA 2FYNC 3GC6A 4UM9B 3CNNA 5F2NA 1VSUA 2AVNA 1KJ9A 2GO1A 1QPBA 1W8IA 4TKVA 1MKYA 1I2ZA 3TCXB 1PJRA 4Q4JA 2J5PA 3DOIA 3R24A 3BDVA 4KQ9A 4QXMA 2PMFA 2B9BA 3F4LA 2I4MA 3USES 2YZGA 3S1MJ 4CCMA 4X24A 3PQ3A 4WY2A 3A6KA 4R5HA 3DEJA 3I2IA 3PP8A 3FDZA 1ENZA 4B4CA 4X66B 1YONA 2DR3A 4OU4A 4A3DJ 2BLLA 2WWGA 3GZTB 1ZVVA 1MHTA 1FW8A 1E6LA 3JWIA 2QZ8A 3NM4A 1ZG5A 4ZCRA 4GOJA 1TAQA 4DLSA 3EIFA 2XT6A 2PXAA 1VA5A 1T3HA 3G7NA 1X7ZB 2KX7A 1E69A 2VBXA 4YQZA 1DGRM 4OK6A 2BGKA 5LEJA 1Y7IA 3VDNB 1SKYB 1RR6A 1KYIA 2O20A 4O29A 3GGGA 3DMGA 4JVMA 3IHKA 3H9QA 2FKAA 1LB2A 1R6BX 4JA2A 2QD1A 4HH4A 3M6AA 2FYUK 4HQOA 4M55A 4Z3KA 4ZI7A 3SQMA 3S5UA 4FIDA 1L7MA 3ABLH 2L0KA 1IM8A 5FA8A 2W43A 2O8EA 1M5TA 1H2HA 2HA6A 1IXKA 2GOMA 5EIHA 3KD3A 5DMHA 1IULA 2HI3A 2AZTA 1CQJA 1JTFA 2OTLP 3OJWA 5EIBC 3KVRA 4JYPA 2JVIA 2J3MA 1H1TA 3BMOA 3GUVA 3VPXA 2WNIA 1N5OX 1F0KA 2ZSHA 2QXTA 4N7RA 3O21A 3RV3A 1MH3A 3HV2A 3K92A 2EW2A 4ZAYA 3P2IA 5KOHB 1VFPA 4E21A 2JTVA 4K6OA 1T24A 5IM4A 3A0BC 5F0HA 1DB3A 3CMEP 1IONA 2GBCA 1U3FA 3AHEA 2A6TA 5IN5A 4G94A 1KJZA 2MMCA 3R3SA 4EKEA 3WHPA 1IJDB 1L5RA 1PT5A 2INGX 1KJIA 5AI8A 3F8TA 1M8OB 3CUQB 1YB5A 3JTEA 3E7WA 1XS9A 4JYAB 2PWPA 1ZGAA 4QQRA 2KLUA 1ID8A 1KERA 2AI2A 3FAKA 1DDGA 3ZE0B 1UK9A 3IBSA 4HWOA 4M2LA 2IYZA 3ZLUA 2FEOA 5JD6A 1TK9A 4XIFA 4I0AA 4PWYA 5JDCC 2NPOA 3ZR4B 4YP7A 1YCFA 3LVQE 3KAPA 5KQGA 4B4UA 1B4DA 3R0ZA 1ABFA 4ESVA 3EVAA 2CSUA 1AN0A 1B1CA 2KT0A 3L0OA 2IOQA 2FE1A 3X1WA 2WKRA 4GX2A 4EYQA 3WB1A 1S7CA 2QQ9A 4ARIA 2ZWOA 3P2OA 1UC4B 3JQQA 4QXQA 1Z91A 1L5GB 3L8YA 4U6NA 1ZA1A 3DE7X 4Y2QA 3R2PA 2OCLA 1K66A 3OJXA 4GNKA 5EP2A 3OCVA 2ZIAA 3BH7A 3RPEA 1AXEA 2P9EA 2VQHA 2FR0A 1L0NG 1WZIA 2QDXA 1GKKA 2FF4A 2ZRKA 4MP6A 1XJ5A 1BJKA 4FBLA 2VNAA 4Q47A 2G8LA 2VJKA 1UL1X 1Z3YA 5AIAA 2JARA 3L04A 5DXFA 1CNMA 2I6UA 4ZT2A 3QVJA 4RS3A 3GCGA 3RYFB 4LI3X 4R1PA 1RWVA 2A1TR 4MDYA 4A23A 4HVCA 3WB0A 3GY0A 1THGA 5C44J 3RRMA 1NNEA 3OPNA 1R74A 3LUHA 5F4ZA 4EG3A 5MN4A 1FMTA 3HIFA 4XIIA 2ZO4A 3WHKA 1GPAA 4D1QA 3BPSA 3NDJA 1P6XA 3UYLA 4OQZA 1M1YE 1JOCA 1HBJA 4RYLA 5JECA 2Q1YA 1W4RA 3L75D 3HGMA 4MV6A 2QGUA 3GOQA 5DN9A 4C43A 2P62A 3BERA 1QVUA 1DEHA 3EZLA 3L75E 1OLSB 2ECKA 1NBME 2K5CA 3K0KA 3STYA 2MJLA 2DEUA 3JSXA 1H8ED 4Z1MD 1A1SA 4ZCPA 5JH7A 2FWNA 3EA5A 4KIJA 5KSZA 1CUWA 4QICA 3QK7A 1WBBA 5CA1F 1X0XA 4I4TA 5LIRA 4H16A 3V2NA 1MC8A 4EBBA 1RHMA 2OPTA 3EW9A 3QE9Y 4WESA 4UM7A 4DSOA 3M4ZA 4AX4A 1NW7A 3GNLA 2ZRHA 3V2QA 3K6JA 3A11A 2V7UA 3O1JC 5EUQB 1WSWA 1E20A 5KJCA 5AW0A 3CC8A 2Q28A 4LY0A 2W2QA 5BR1A 4AD8A 4HFNA 1MC5A 4W4TA 1GTWA 4OBEA 1H42A 1PBNA 5CHYA 2PXCA 1SA0A 4H13B 4HYTA 1DU0A 3NGXA 2LR0A 4JFRA 2GKGA 3OCZA 3UKOA 3BEOA 4RA6A 4HSEA 3VPCA 2YCLA 3HOVJ 4DMMA 2H8GA 1P84H 3WHLA 3B51X 1PZNA 3SIXA 3MINB 1RI7A 1P7JA 1OCZH 1LPNA 1QV7A 1VTKA 4PN7A 1N0IA 4NQWB 4RGQA 2Z08A 3U4QA 3SLRA 4OUKX 1U8RA 1IFXA 4TWZA 3RJTA 1MXFA 5JJCA 4G1MB 1NF3A 4RZUA 3R3WA 4TLDA 4C05A 4D3DA 1IEWA 1DDIA 1B2RA 2Z2YA 3NT4A 3RYCA 4INOA 5GV7A 4GIFA 1A0OA 1D9XA 2CNBA 1CG6A 1WI9A 4UB8E 4ID3A 2OHXA 1SVSA 1Z7BA 2LP0A 3JVVA 4TSFD 4L7QA 5L3RA 2Q3FA 4WK0B 1W73A 3X1DA 3MS7A 1W5FA 4D3YA 2BFPA 3DTTA 3B20A 1UELB 4WAUA 1XZDA 3T1VA 4A5SA 3CJTB 1TVKB 4DAEA 4PR3A 5K3FB 1EQ7A 3I2KA 3N87A 2IHNA 3O2PE 2SKEA 2I78A 1K05A 2OCPA 1SBNE 3DXXA 4C5AA 1RWMA 1VQMP 5FO1A 1DIAA 1TFUA 2XMZA 2B36A 3I1YA 5EGNA 1V2GA 5BYKA 5CJ4A 4MV8A 4D6YA 1OXTA 3TLKA 1FOYA 5HFJA 2BC9A 4J94A 5JEEA 1FQKA 3NV9A 1JR2A 1ZR4A 1H4SA 4B7CA 4BMVA 1D4OA 2FF7A 1Z5GA 2ODEA 3VJMA 5K6AA 4EOGA 3SJZA 3DDOA 3CHYA 1ABBA 3Q6IA 5JS1A 3DLHA 4UD2A 3GZ5A 2V7QJ 5IG2A 2QD5A 2Z8YM 1JFRA 4RZ3A 4FQ8A 2FSFA 4HZIA 2FQ3A 2XCLA 4EG6A 3N7UA 5KB3A 2QA4P 4LOKA 5APUA 1T8TA 2VHJA 3ROPA 2BI8A 2ZVNB 4OBXA 5FWDA 4X94A 1RF1B 1TNDA 4L51A 5DRYA 3BCBA 3CUVA 2HODB 1BSHA 3O73A 2IGKA 5EE5B 3IAAA 2KHMA 3K0CC 2PMKA 4D99A 4EYOA 3RH0A 4TWIA 1ECCA 2GZSA 1D7AA 4TT3A 1LSSA 1Y4DE 5JTTA 1NE7A 2F8SA 3HE5B 2IX3A 1I2CA 5DTRA 3BRVB 1M1JB 3ZX5A 4BFCA 4YCMA 4RV4A 1FDIA 3H1JJ 5CXSA 2DHCA 3NC0C 4NC8A 5A6VA 1LNSA 4J4BA 3CF0A 1G4DA 3H04A 1KO5A 4P2GA 1F2VA 2M30A 1FSFA 4TTVA 3WGMA 5NLLA 1FBTA 4ER5A 1D09A 4D3FA 4IPAA 1CRLA 4BLUA 1EQ2A 3BR3A 1W85B 3H6HA 4B7AA 3HCNA 4RKEA 5A5DA 3K9LA 4FETA 4FXOA 3H1PA 2X0KA 4I7EA 3HOUJ 5AVTB 4PFJA 3T0YA 3C1OA 4WZBA 3L2WA 4IHWA 1LTBC 3K70C 3KDPB 4IDGA 3TL4X 4UULA 2MKVA 1XCOA 4BNGA 2QVXX 2GXSA 4IKFA 3LT4A 3O1HB 3BWMA 2P3QA 4K6CA 4UBMA 1NRJB 5EF6A 2JFHA 4GFDA 1ZP6A 1J9EA 3IJEB 2FXPA 1HFJA 1RAGA 3HB4X 2GYWA 4RA2A 1YACA 1Z22A 3HYLA 1VKHA 4TMFA 2Q3BA 2AKAB 4IOIH 4K87A 3BZ6A 2EDAA 1W0JD 2GCNA 1QNFA 1G98A 3E15A 2JFPA 2D5CA 1UWKA 4OKIA 1QHNA 1I3MA 4F3NA 1G4UR 4LY9A 4DCJA 2VEOA 2BGRA 3CW9A 3MTUE 2NAFA 3CVXA 3EGEA 3PTAA 3FOAA 3HEBA 5LZ9A 3LTEA 5IHPA 3SS9X 1A82A 1GG2A 2AW3A 1V3QE 1H85A 2H8WA 5C3UA 5K0NA 1OWLA 4KPUB 3GPLA 3HTKA 1IY0A 3GW8A 1RI4A 3Q9NA 3NAMA 4X93A 3I0TA 2HHLA 5BV8A 4GVLA 1G42A 4N18A 5ALNA 3AKCA 1Z8HA 2RQQA 1BU5A 4FZ3A 2X9NA 2PQ0A 1B0PA 2XRMA 1DJPA 3LOPA 3BZKA 5IP6A 4NS4A 3SVTA 4XM1A 4ZPXA 5CYVA 1K78B 2HOTA 4YAWA 2FVYA 3EXHC 3HM9A 3AJEA 3IODA 4L85A 4A10A 1YI8A 4OI1A 2YXRB 3GLTA 4J75A 4MYRA 4MULA 1ND5A 3WTSC 4KG7A 5IYZF 1YHNA 2KS6A 4HDRB 2ONJA 4AN4A 4LHXA 1AVTA 5H3LA 4AK9A 2R7TA 4ZD6A 4H4KC 4B6RA 4LB5A 1YR7A 1KMHB 1OLUA 4A26A 1E7YA 3OY2A 3IDAA 1F5TA 4N82A 1N2DC 4PICA 1AMOA 4YCDA 5KVQA 4PUSA 3F5HA 1Z2EA 4CFYA 3U39A 3E5UA 3GUCA 1FFDA 1QZUA 2EFNA 3BJRA 1US8B 1U8YA 1FYEA 4NECA 2A0UA 4JX5A 5JS8A 2FDXA 3JASB 4ZEOA 4BX8A 3EG9A 4CDMA 2E6KA 5DI3B 5FB3A 4NNOA 4LVCA 3VOTA 4JXXA 1Z6GA 4A2WA 1L1RA 4FUQA 3NDBB 4XD7A 3K1NA 1A9OA 3CRW1 5EXSA 3TG2A 4QM7A 1EC5A 4REQA 4G5HA 4F11A 3S2GA 4EG4A 2FSPA 1X4OA 1AM4D 2KS1B 3B2EA 2IY7A 1W4LA 4R2KA 1T2FA 2WYHA 1EFVA 2GAFA 3DFGA 2PP6A 1GYPA 2EFDB 1R5OA 1Y9ZA 5MFPA 2IEAA 3LKBA 1GWNA 5HHTA 1SC4A 2ZXJA 1AZLA 4J0KA 2AUNA 4A5OA 1A9XA 4B3IA 1T8SA 2XCIA 3TLYA 1FUUA 2I4LA 1RM3A 2JFOA 2PMBA 4JJIA 4QAQA 1MT0A 2IPXA 4AJ2A 2PGJA 3KYQA 1F38A 1MRNA 5CVTA 1KFCB 1MOPA 4K3UA 1ELOA 2WSSA 3OPYA 2MD5A 1J2YA 1OAOC 2HV8A 4U00A 4DQ2A 1JG1A 1M66A 2Y1CA 1OHHA 1W2HA 2NPSC 1E9BA 2A3NA 1YZYA 4INZA 4GE0A 3B5IA 2XADA 1P1CA 3ZPLA 4OAZA 4FYVA 1J8VA 2Y0SN 4QBKA 4BNIA 1X2NA 1JWLA 1K0FA 1S9HA 4OSPA 3UWDA 1T56A 2CU7A 2XNXA 1U7ZA 4G4GA 4UFOA 2QTZA 1FU7A 1C7RA 3V6LA 2AI3A 2JHFA 2Z56A 1EUDA 4M0EA 2QUHA 3COSA 2VBCA 4L8LA 4XASA 1UJ4A 4ZP1A 5KMGA 1VQ4P 3H42B 3GFVA 2DKNA 1DH3A 1HO3A 2OO3A 4DZOA 1BFDA 1ODIA 3CWBJ 1JHPA 4DIQA 5EIOA 2E21A 3KETA 2LXCB 2AEMA 3VH1A 4B3GA 3F71A 1ZPDA 2VO1A 4NNJA 4P4LA 1OXUA 5K4HA 2P27A 2WAFA 4P4SB 4YMTA 1LSUA 1RBQA 2R8PA 2ZUCA 1C7QA 3NHFA 3NHLA 2JRTA 1G0OA 3VB2A 3GR6A 4YA6A 3O3OB 5CG2A 4MPJA 3BA6A 3HSFA 1Z36A 3UMCA 1FVOA 4LBYA 3T3IA 4KP7A 4CHUA 3OIUA 4WEQA 3EQ6A 5ILSA 1BOFA 5ALFA 3RF6A 1M2VA 3KYLA 3EGWA 4IG9A 2OQVA 3JD4A 4YJ2B 3OLQA 4Z4GA 4AN0A 2CNNA 1C3JA 2M5AB 2ZTMA 4MR9B 5CT6A 3TSCA 2CMGA 3RTBA 3FFTA 4X5OA 1U1DA 3JVEA 1N5IA 1J39A 2E5YA 4R8MA 1T35A 4I6GA 4D4IA 2L91A 4MV5A 1DHRA 5HNFA 3QH4A 4CM8B 3P2YA 1HH4A 3F21A 3FTQA 4I50F 1R10A 2GA8A 4N6GA 1ZQ9A 4BXOB 4G89A 3ICPA 2ZC2A 3CH5A 4XCQA 3VV2A 1OILA 3N74A 2FDRA 3S1SA 1ZLJA 4G1VA 2WYIA 2JKVA 3SDGA 4E7HA 5KQSA 4D0GA 5LGUA 2J5OA 4U6SA 2EWVA 1K6YA 5E3JA 4TLCA 2XZPA 2I2AA 2Y9ZA 2BMEA 3IAS6 3Q0EA 2ZRNA 5H68A 2QTMA 4TPKA 2VC0A 3EPJA 5CT5A 1YTUA 3RE1A 5K05A 1KTVA 1PV3A 4KYWA 1G6Q1 2HJWA 1XKXA 3VVLA 3D1LA 4LMPA 3S0JA 3LSJA 1T3ZA 1KMCA 4JPZB 1WLSA 3BCCG 3SWFA 2E76C 1NT4A 1DC6A 2PD4A 4PLGA 2OBBA 1IN7A 1M76A 5C4JJ 3QVGB 1ILEA 3I62A 1UXHA 1WCMJ 2I6TA 4KYUA 3L4FA 2QLFA 3SNHA 4YDSA 3OCXA 4QPQA 1M6VB 2BCGY 3AHGA 3ZQCA 3OX3A 1JQBA 1KZUB 5JMPA 3IP4B 3TUZC 2OUMA 2Z4SA 5EINA 1L7NA 1MQ8B 3EGDA 2E4AA 2D2XA 2Y3IA 3I5UA 5JTUA 3WTZA 2IS6A 5KJ7A 1IFDA 1Q0PA 4J1TC 4WKNA 3WLNA 1ULZA 2AMFA 4EEFG 1O1YA 1OFIA 2HHCA 5B1AH 2BPOA 2J45A 4C22A 3ZQKA 4IIXA 3D43A 1NU1K 3U3RA 4Q1BA 4BLPA 1W4MA 5J3LA 1N7JA 1V26A 2QY9A 3N2GA 4AC9A 1W8DA 1GU5A 4AN1A 1TZKA 3N58A 3HY6A 1RYYA 5EIBD 4KLCA 1XXHA 5DGXA 2Q2QA 3V97A 2W8ZA 2ZI4A 1D3AA 1ZQ3P 2WMNB 1RAFA 4DTCA 3IDZA 2OTCA 3L1IA 4CLHA 3R7NA 4YT8A 4DNQA 4ISCA 2IDKA 1I8TA 4PD4D 1IQRA 1PGQA 3ZWOA 2V8OA 2JFUA 5F7OA 2FZLA 3NH6A 2EWNA 3PQ7A 3GCXA 3RRNA 4YUYA 4F3TA 4O4IB 1AQIA 1T9ZA 1IBKB 4OFZA 3HNRA 4S0HB 3O92A 3BGDA 3GNTA 4GGMX 2BFAA 3HHPA 3CCFA 4M1YA 2D13A 2M0MA 1OBFO 1USSA 1NVWQ 3OM0A 1YRWA 1LBSA 4RABA 1EP1B 4XVUA 2V54A 3MS4A 5FBWB 2QA4I 2I2DA 3PFCA 1MD0A 3P9KA 2P6TA 4J0DA 2V6JA 1FTWA 1PEKE 2R6AA 4WWIA 2P3OA 2B8TA 5IYDJ 2DETA 4PHTA 4ALNA 4J3NA 3AESA 1M54A 5LP6B 2PL3A 2IH4A 3LNTA 1EDBA 3B82A 3G8BA 4Q21A 2FXIA 3LW5H 1U8ZA 1RPNA 4RZHA 2VN8A 5DDGA 5A3QA 3GZNA 5LOVF 2Q0OA 5LYJA 4E6KG 4RKFA 1LUAA 4H6PA 3JRBA 4MV7A 1LS6A 2J7PA 3WJ1A 5ILUA 4A8JA 1NV9A 4TTPA 2W6ID 3W6UA 1HQCA 4YJ2F 4X0EA 4WDRA 5IF3A 2ZJ5A 4RD1A 1JDPA 3EYAA 2CDNA 2F4VB 1IK7A 3TIXB 5HZMA 3GLGB 2ZBPA 2X77A 1EVEA 2X4IA 4DVJA 2Z3YA 1VMEA 5EZSA 3SZUA 2FFDA 3T1HB 4HTFB 3ASNH 2JQ7A 2HQOA 4YEDA 5CFOA 3GBPA 1VQPP 5F04A 4UNQA 5G41A 1JRLA 4M9UA 1U1FA 1RRCA 3VVBA 1KYXA 3QNWA 3T4PA 3ZGOA 4PZEA 4PS0A 3EBPA 2JSPA 3HPGA 3P7NA 2XASA 3OJAB 5C4MA 5IT5A 2YWFA 3NOVA 4IJ6A 4XCVA 1USTA 1L8OA 3QP5A 1Z1DA 4YJKA 1RI3A 3W67A 2C5GA 1GXSB 2AV6A 4MLCA 2F3UA 4KIBA 5DGTA 3AVYA 2IP1A 1A9SA 4RUKA 4CLRB 3GUDA 4IO1A 4KQXA 4Y17A 3SJAA 4JIGA 3J7AY 2QYTA 2J3EA 2EA4A 3AGPA 2H4YA 4XOIA 1HZZC 4ALKA 1APBA 5E6SA 1KJYA 2B0CA 5DCFA 3HOZJ 4BJTA 4NXMB 3ESZA 2O2EA 1JMYA 4XVHA 4XH9B 3IERA 2IFTA 5LP6C 3LUKA 3TS1A 1AQTA 3RHTA 4ZICA 1RKVA 3RTCA 4CL0A 1RE4C 2EEPA 5L51A 3RS7A 3KTOA 5CA1A 1XX5A 1ZKGA 2JJ7A 1WBJB 4UAVA 2OZLB 1DGQA 1MIHA 1SBYA 3OUZA 4F7WA 4YV2A 2QLZA 1L5QA 5AM2A 2CWWA 5A02A 1CD5A 1IN5A 2IQ5A 2LOOA 1I6KA 2J6HA 1RKXA 4CF6A 5I7AA 4JBWA 1WHTA 2HA2A 3E8XA 4XOTA 5EZGA 4L1KA 4CQLB 4FDTA 1DT3A 4RHUA 1YI0A 1ZJYA 3DM5A 1F14A 4O8CA 3ZXXA 1FYDA 1U5AA 3O9MA 4M71A 2CBZA 3SDSA 3OZ7A 2QX7A 3KYDB 4Q4AA 1T9KA 1XRMA 2GBLA 2PH7A 1UBOS 5CM8B 4M8KA 4FCWA 3WC4A 3CESA 2AK3A 3L2VA 3FM5A 3AE1C 1AGNA 2NSLA 5B1HA 2YVLA 2PT9A 3LO8A 1VIAA 4JJ7A 2PT5A 4EJMA 1JFVA 3DBOB 2WLTA 2AXLA 3PK0A 3HXLA 2JJYA 3LA6A 1GQQA 4ZZIA 2DJIA 1AUVA 3F9KA 4DSUA 4D82A 3NAUA 4NFSA 3ED1A 1DEOA 4LFUA 1XRLA 5LP6A 4KWEA 2KSEA 3DTKA 1EP3B 4IM7A 4HKZH 2FPRA 3ORHA 4JV5B 2W57A 4W5OA 2ZI3A 3LU1A 2QYOA 3LHKA 2P8SA 4KVGA 3NR2A 3QYAA 1QP0A 2CL0X 3CUYA 4YAGA 3SXUA 4OXRA 4I1RA 3EGXB 4PXSA 3PHIA 5GTIH 1GZ5A 4IJQA 5DLYA 1UJBA 3CB4A 1A27A 2O0HA 2EZIA 5DM1A 1JLMA 2BY1A 4XKBA 3V1UA 2D5LA 4DA4A 5D51S 3RVPA 1KK0A 1TYEB 2C0CA 3TLXA 4FSDA 4BNWA 4YMUA 1KDOA 2ZI6A 5AO9A 5FR1A 8ADHA 1GU4A 4FS8A 1LGYA 4Z4HA 4H3HB 3BTVA 4B3TB 1KDYA 3TG8A 4QHTA 2H7YA 2UZIR 4YCCA 4MYTA 1M1ZA 3MFQA 2AJLI 3OCJA 1XRJA 3CEPB 3W2HA 3RVJA 2ZS8A 3A0BE 4MV1A 4NCKA 1DWQA 4QXRA 5LJIA 3WTUC 1AQUA 3LUCA 2XAFA 1HE5A 4UAJA 3WLTA 3GVIA 3MJ4A 3EWKA 5BN5A 4PV1B 4DQUA 4BFLA 1PGOA 3Q0TA 3UHOA 1GD1O 4HO1X 1H0MA 3A7EA 5IU6A 1ND6A 1WWXA 3T6KA 5H82A 3H1LJ 3FZEA 1VB3A 3NWPA 2UXDB 1BGVA 3W34A 2X0DA 3AHHA 4PFOA 1M2FA 1EIWA 4JBAA 1YDHA 3HKCA 2W2KB 3TE7A 1VBMA 4NK5A 4ZAGA 2OYIB 2WFLB 2YHIA 4ZDKA 3HGTA 5B58T 3OOJA 4B7UA 3KP1A 5AIQA 1J22A 5J63A 1SQXE 1R0ZA 1K68A 2FV8A 3AR4A 3FLAA 3RI4A 1J1EC 3TXXA 2KIUA 4NZPA 3ZU2A 2R93J 1IPEA 2ZLBA 1PEAA 4U3FE 4J00A 3UWOA 2VT7A 3EH1A 2BP7A 2XNHA 3OTWA 4YDRA 3D6JA 5FPKA 2XA9A 5BN3A 3CLVA 3MGAA 5CCXA 3K31A 1FTTA 2Y75A 2VRBA 1CVIA 3HUTA 4ZYWA 3SFTA 2QG4A 2DFEA 1XLTA 2SCUA 1YDMA 2BD0A 1ABEA 1OI7A 1P92A 4AM3A 3KPEA 5B1EA 2XXBA 5F1PA 1IBCA 5FNVB 4MW1A 4QPOA 1IUOA 3ZW8A 4UJ5A 5CDUA 2V6FA 3K4BA 2R7LA 1JHZA 2OV7A 1GKIA 1JQJC 1UINA 4W6ZA 4Q12A 1XNRB 5KOJA 2WTBA 1ARZA 3EY4A 5KJ7C 1L0NK 5BQTA 3K70D 2YKPA 3I5MA 2WF8A 1CETA 3ENZA 3P32A 3I9MA 3ONDA 2AXTH 2HSDA 2DAPA 1ESCA 4BIIA 2ZRDA 4LIVA 5HRCA 3AE3C 3TEDA 3LUDA 3EG5A 2QTAA 4JOSA 2L9SA 2JLQA 4AG6A 1OKRA 1GO2A 3ZE2B 1YA6A 4RVDA 4UVCA 4JP2A 4UHBA 2PUBA 1HDOA 4GI3A 3E9DA 3BR5A 1Z6PA 3EMBA 2WPSA 4WLNA 5K4AA 4BMYA 2XGXA 4RSGA 2IJLA 4LWQA 2R1UA 4M8IA 3L2CA 3EFFK 1WPXA 4WE3A 4BNJA 4JLAA 1LT9C 1GSIA 3UW3A 1JKRC 5G4LA 1JHMA 2Q3IA 1TTQB 1Z26A 1QGYA 1UT6A 2EA2A 4BUPA 5CB0A 3FYHA 1TOAA 3Q1MA 2CPBA 4NENA 2PNJA 1E9RA 3PQEA 1FU4A 1VHLA 1IHPA 1MFZA 4B43A 3TBFA 3SE7A 1B16A 3N6XA 3ZDRA 1MBEA 3O6VA 5B6PA 1Z25A 4I36A 2JGNA 2BASA 2CPSA 3FIWA 2H92A 3KNZA 1MOZA 3CLSD 1RLMA 4IHAA 4KPGA 4L6CA 1CJKC 1AUQA 2AZMA 2G04A 1HG1A 3S68A 1NU8A 3DPIA 1IB0A 1DTWB 1ORHA 2GKOA 1L7OA 1W5CE 1AV1A 2WJZB 1NJIQ 2ZXWH 1UHMA 1YJNI 4P58A 2ADOA 2ISQA 1HA8A 1R58A 4RMNA 1JG2A 4RKUJ 2B20A 4H44C 2PMWB 5JH7F 4K86A 3Q3SA 4E30A 1L3BA 3WHCA 2EBWA 2ODWA 2IAIA 3WWDA 1LEAA 1NAIA 3EDPA 3L8DA 2VZ9A 3NEAA 4ZN6A 5ERXA 3H1HD 1XTJA 2CNLA 4S12A 4A8JB 2VQ6A 2B82A 1D2MA 3B12A 3PDIB 4C9YA 2J9FB 4EO4A 2B5WA 1XWWA 5ALWA 1JT6A 4W9NA 1SCDA 1WVIA 4YCNA 1PGJA 4OGWA 1JB0J 1UT8A 2ALJA 2BM0A 1BC5A 5KDLA 4CZZA 4KO2S 1OCEA 1YI2I 3S1QJ 2JIRA 2QVLA 1EJBA 2PX2A 1YL7A 2I2XB 5BU5A 4JQOA 5FEUA 1CJVC 5LBIA 2JVJA 3NX4A 2PUAA 4WK2B 4MWBA 3GRCA 3K7EA 2DJ5A 4XVCA 1KYOD 3Q5SA 4E07A 4FQGA 2ZEJA 2BFOA 4C21A 4EA8A 5F5XA 1HSJA 1AA7A 2Y93A 1V9CA 2K40A 3QJYA 4MP3A 4KOEC 4JODA 3L2QA 1P5HA 4OLAA 1NUSA 4H0LD 4IDDA 5K51A 3A01B 4A3EJ 2YW2A 1JDTA 2BM8A 2H2HA 1KZGB 1M7HA 4ND3A 1FSZA 1H2XA 3BM5A 1P0MA 2BW3B 2EGUA 4AQDA 4OAQA 5BW5A 3P9PA 1POGA 5U4QA 4LV6A 4KV9A 4OI0A 1CUIA 3L79A 2V59A 1M2HA 1G16A 1YIOA 3DB2A 1NAHA 2FMKA 4OQMA 4QREA 5EPEA 4E1AA 4HS4A 3KFWX 3COWA 3S2WA 1TB4A 4V24A 1CYDA 2GTIA 3KLMX 3MCUA 2ZKLA 4R54A 2KYRA 2NXNB 1T10A 1SH7A 3MBIA 4ZKPA 1TX4B 3IEMA 1E5VA 1XZPA 2XXAA 1PL0A 1QGUA 2CO5A 2PLFA 3L00A 1YZFA 1V4BA 5EKUA 2IBSA 3B52X 4M86A 3EEIA 2FWRA 2FPOA 4MYDA 2AF3C 4FNGA 3ZQUA 3W8FA 3C9IA 4U3JA 1E0EA 2Q1KA 1MSEC 2WWRA 3KHTA 2I1KA 1NXPA 5K3EA 4AZSA 3ZHRA 4AUNA 3OUTA 4G5QA 2LLKA 1QB7A 2IUSA 1G8YA 4K9DA 2BEWA 2H1OA 3U4DA 4AIIA 3GJ7A 4M0CA 3UKJA 1Q77A 1Y98A 3S29A 2E1RA 3KEMA 2M8GX 3IV7A 3M0DA 2ZSIA 2ELHA 4JYKA 3QU5A 2BY3A 2H16A 3HHEA 1QNTA 1DP4A 5IZCC 4CMAA 2AG5A 1C30A 1DJNA 3W68A 1MP0A 4EAQA 3F6PA 3TRFA 3CC2P 1NVAA 1PLKA 1DVRA 3RQ4A 1C0IA 1MGOA 3OQMA 4PCQA 4E08A 3AXSA 1E2IA 4NCIA 3H0GJ 1ISPA 5BV1A 5KPDA 1KAHA 2FW1A 4U7WA 3VR5D 3TDZC 2BFNA 1S2LA 2ONKA 4QDTA 3M3PA 4IZ6A 4B3JA 5CDHA 4EK9A 5DBEX 1NU1E 1FLNA 3CJQB 3ZXSA 2FJ0A 4IS2A 2G5GX 2LKXA 1C2TA 5CRIA 3AF3A 3ER8A 1CY0A 3LDHA 1LBTA 4E1VA 3A4VA 2M0CA 4IEFB 2NWQA 2PGXA 5ELXA 3HGQA 4M6VA 3JY6A 3S15J 4I81A 3UUEA 3JV7A 4Y6RA 3N3AC 1QBKC 3N8KA 3QE3A 3ZW7A 1UBGA 2O1KA 1DO2A 4EG5A 3JATB 3N0WA 3LH5A 1Y1PA 2VNSA 1WQ1R 5EG0B 3ZTWA 3L46A 2DT6A 3HABA 1NUQA 4JYBA 1FYVA 2V96A 4BMSA 5GQSA 2DLNA 4JQSA 2H54A 3L2OB 3FX2A 2YVQA 3AG1H 3L4BC 1PWEA 4JGBA 1ITYA 2K9NA 2IXEA 4M38A 2QSJA 1TCCA 4ETNA 4XGRA 2QV7A 1U2EA 5LP1A 2P69A 1FBNA 2MOKA 2PZLA 4CL8A 2R0QC 3ON5A 4S0ZA 4OXYA 5DSXA 4BVLA 1P1HA 1SBIA 2EKPA 3PEWA 2FW7A 2GZRA 1SXJC 1G21A 1PD0A 1NWHA 4F8EA 2OC4A 2ZWIA 5T4EA 2XLBA 3H1KG 1A9ZA 1KEKA 3QMWA 4KKVA 2YU3A 2QSHX 1FFAA 3X1ZA 3M6XA 2FR1A 2VSXA 3RZOJ 4CKEB 3KR9A 4Y1RA 1O96A 1JGTA 2HPCA 1Z7EA 2ZYAA 4WGFA 4G0NA 5JCPA 1E2JA 5JO0A 4YRAA 2HMVA 1U0LA 2BJWA 3KKNA 3RC2A 1V95A 3AP3A 4P4NA 3G89A 4LG1A 2D1FA 2KS1A 4G7OF 4C7OA 4RX1A 2JGDB 3E81A 2ZM6B 4XSZF 3LS2A 2M5AA 1MTZA 1CJCA 3P94A 3DB1A 1W5SA 4L4YA 1D8TA 2ZT7A 2PN6A 1H5NA 3CC7P 5B3KA 3DW3X 1Q2XA 4UC0A 2L9VA 3MFKA 4PINA 1GAWA 3A3OA 3UH1A 5CEEA 4IHTA 1X13A 2BM1A 3KJHA 3LYLA 4KR6A 4ARZB 4Q4HB 2CEKA 1W44A 3H92A 4PSVA 1FOXA 5FD8A 1YDFA 3H4TA 4B6EA 3FCCA 3I04M 3DOJA 3AYXB 2GJKA 2VSNA 1U7XA 3ZE7A 1HKTA 4U0JA 3HU5A 2QVBA 4BX2A 2F59A 3PVSA 5ENZA 4OB7A 3AKEA 1PR1A 2H29A 3KPWA 3RC7A 3D6ZA 1X7WB 1C3XA 1ULUA 1XWIA 4WLFA 4PQRA 1VA4A 2LCQA 2GRUA 4FFPA 5HZKA 1JSLA 1IOWA 3DFKA 3JZIA 1JF8A 5KWVA 2NYRA 3HUSA 2WUEA 4IFDK 3UMMA 3GRYA 4U3FJ 4LVUA 1VP3A 2ZT9D 1I32A 3HKDB 3U3OA 1MG5A 2FEPA 1BVYF 2OM2A 3R23A 2RHGB 5JCXA 1IF1A 5E17F 3R3ZA 1E2HA 1NVOA 2QN2A 4UTZA 1LTGC 1NAFA 1I33A 4IXDA 3P8ZA 4NONA 3LBHA 2I3GA 2G09A 1JLLA 2ZFUA 4YXWA 3CKYA 1R49A 1GCIA 2DPHA 1CHDA 4PSCA 3IUOA 4PYRA 1GZSA 1DFIA 4ZDWA 4GUDA 1KVSA 1C0KA 3A4YA 2CDCA 5DTMA 2L7FP 3ETEA 4LQDA 4YJHA 3T61A 3CNOA 2XT9A 1Q1HA 1C81A 4DJ5X 5LP6F 3LHDA 4CLOB 3TZQA 1M1JA 3RKWA 3LBNA 4FR5A 3MC1A 1O3SA 2OHJA 4C7BA 3ZIDA 1O4XA 5LA6B 4IICA 3TR5A 4G0PA 3J81K 2NUTA 1G20A 4KWTA 1Q0LA 4KIGA 3RKRA 4XWYA 4CVNA 5AHOA 2ACVA 1YFLA 3T5DA 2NVQJ 4E5NA 2JJ2A 4PPGA 4DGSA 2Y1KA 2J46A 5J8CA 3Q9VA 1E9VA 4MSUA 3GYBA 4MEXF 4L9JA 1J1DC 1RF1C 2IHTA 4QU8A 1GLGA 3ZU4A 4TL9A 4HLDA 1E66A 3ENWA 1GFZA 5IEJA 4G6QA 4QBIA 4ZQEA 1G2IA 3JQ7A 1JP7A 5BRNA 2N3ZA 5IT9K 4BHTA 3QVUA 2FSUA 5K0ZA 4DB2A 5G4KB 3ROXA 4YXWH 2IEZA 2XB5A 2ZQYA 3V1KA 4NFYA 4FR0A 4HI0E 3WDLA 3G1UA 3HCPA 3VRHA 5T6BA 3WFIA 5KTBA 5BVGA 3KFLA 3GN1A 5EJCA 3EFOB 3L92A 4ZANA 1CW2B 4G5RA 4BPBA 2HD4A 1H0HA 3UJ3X 2JHCA 3E1KA 1X8KA 1YZQA 2A2ZA 3WK8A 1R9JA 4KXMA 3HVRA 1J5XA 3GFSA 5BNFA 1GVHA 5KJ6A 3OKAA 3UG7A 1J1IA 2ZCUA 1X7WA 1ZAKA 3INNA 1RJGA 3BTUA 1U0FA 5CB4B 4W6QA 1K9SA 1HC7A 4P53A 3H36A 3UJPA 2X85A 3NTOA 2D1VA 1NMQA 2FFBA 2QUFA 3C3XA 4ZT3A 2LR2A 1KH2A 3N0VA 4TL8A 2WBMA 4A0YA 1JIQA 1JCDA 4I8IA 2P9CA 4LCJA 4UVAA 3LPMA 1GV2A 2NU9B 2H1LA 4MP8A 4FGZA 2DYRH 9ABPA 2ORWA 1YMVA 3HKEB 5TARA 3PVCA 3OO0A 1GRQA 3UAXA 1B41A 3A1SA 4GOLD 1QUEA 2BEQD 1CQWA 4TXMA 2G1AA 4LHEA 2E2IJ 2QLBA 3UF0A 3DWLE 1I5RA 3H11A 5PNTA 5TQ2B 2ZZMA 2RKBA 1SQPG 1UCRA 3GFOA 2I6QA 3GRPA 3QM1A 4Q66C 1DP7P 5LC1A 1V5GA 3SQXA 3TQIA 3FFWA 2Z2IA 3ZEAA 2KKOA 2E42A 2XCQA 4UCXA 1B0UA 4RMHA 5IC5A 4N9HA 4ZYHA 1CRPA 1OBHA 2FFHA 3H84A 1IDYA 1NFRA 1SD1A 5CBOA 1OYOA 1Z34A 3Q5PA 2IBZG 3EK2A 4M8LA 4C29A 4B3DA 1M0SA 3B53X 1XZGA 1SKMA 1HWYA 3FNIA 4DV6B 3CX8A 2I8LA 1CJSA 4OLBA 2CF6A 1BFUA 3AM5A 3TTVA 2QG9A 5JQGF 2P6UA 3RVBA 4URWR 1I1HA 3A9VA 4BE0A 3HB0A 2AKEA 3TK1A 1X7YA 3FXOA 2X5KO 1JU3A 1TC3C 4OI4A 5DBFA 3EPLA 3AQIA 1VFNA 5JY1A 3KYDA 5HJ2A 1XPJA 1BIAA 2ERXA 5LBQA 1EDZA 2QN7A 5IFLA 2OYIA 2WFLA 2YHIB 5DYTA 3NTVA 4OB6A 3CH6A 1RYMA 1BCSB 1QLWA 5TQVA 3ZMSA 3HSRA 5GAEJ 4AW9A 3KT0A 3AM3A 4MGEA 3C6QA 4ARBA 4BP1A 1JLKA 1D5YA 3WYDA 1UDXA 2E4WA 4QPZA 4Y2RA 4M87A 3IB6A 3SBEA 3ZZ0A 3GCZA 2K85A 1YF3A 1GXSA 4IX9A 4IL6H 1SEUA 2CK3D 2K1AA 2E1NA 1VGQA 4LXXA 5ALVA 3BQYA 5EPOA 3T4EA 4DQXA 1GW3A 1EXMA 3KM0A 2FQWA 5FGMA 3GJ4A 3WRXC 4FYWA 3OIPA 2IYWA 4WV3A 1R16A 4J0QA 4BLTA 1C9JA 3SC2B 2KZJA 2NADA 2X0FA 1P29A 4B40A 1RXWA 1LH0A 2Q6IA 4GEGA 1XQ9A 4BFVA 4QYXA 3JRDA 1HYBA 3P1JA 4Z9FA 2GR9A 3DD1A 1S2OA 4W7ZA 4CIBA 4HDUA 3T8RA 1LTSC 2Q8NA 4R7TA 5J2UA 3KKKA 2KQUA 1DQUA 3B5NB 3F8NA 3QTLA 5DXAA 4QHSA 2VJLA 3BSYA 1WNTA 1HZJA 2ZMEA 3DGFC 3ACDA 2RH4A 4XW2A 3EEBA 1ZO8A 4CTKA 2Z6VA 4NAHA 1RRPA 1M2EA 2WHRA 2A68F 2WAYA 5AXCA 2LDUA 3DA8A 3BAZA 4TQAA 1KFBB 3MZ8A 1FOEB 2NZJA 4WT7A 2QAGB 4H31A 2QMYA 2P8TA 1YW7A 3C15C 3EBOA 2OFFA 3B6CA 3C6MA 2B83A 4KUMA 4NBVA 2WZCA 4AO6A 3H65A 3ODPA 3L8GA 1YBKA 1PIWA 2QR5A 2VBYA 5EEGA 4A6PA 1IN8A 1DXHA 4YHHB 4L8WB 3O8QB 2I9PA 1M2JA 4I50A 3R7WB 4KMMA 4BBJA 2OUKA 4B3XA 1V37A 4CYMA 5HM6A 2W6JA 2JDID 2FI1A 5FFMA 1EJ6A 2YOGA 3LGAA 4TXJA 1DBPA 2PKQO 3MIIA 4BJ5A 4QKQA 1TO2E 4PC6A 3F7OA 4WBXC 2GHRA 1M6EX 4EQZA 2O59A 2QTRA 2ZPAA 1TA9A 1FRNA 3CS3A 2NV2B 4KXNA 1O6FA 2WWXA 4G8DA 3ORQA 4U5XA 4BMXA 2JDIA 4I4IA 1IDN1 5H6QA 1FS6A 3O31A 1LTKA 2JBHA 4M0PA 2VAMA 5A7GA 4CDNA 3CKLA 1BR1A 1BQ3A 1FMJA 4ZIRB 3ULQB 4IHVA 2DFIA 2X48A 3MHVA 1PFYA 2C4KA 1TWAJ 1GILA 3DV0A 1A5BB 2E36A 1E5TA 3VR3D 1G60A 2VWHA 2ZCJA 1CQJB 2NAPA 4QGBA 1LY1A 1LS1A 5CITA 4OAOA 2WPNA 2F17A 5CNKA 1PR3A 1EZ1A 3L41A 3NGMA 2I7XA 2EYUA 2AO9A 2FUKA 1S5PA 1GQSA 3MK31 2ONYA 2DULA 1I5OA 2DA1A 5T8KC 3I6MA 4NBUA 4LZNA 4UVIA 2E43A 2FW8A 1AHIA 4HNHA 3LA7A 3I6IA 2BYTA 5ALPA 1Q21A 2F5EA 1MJAA 2WD9A 2PJRB 1H2FA 5DNAA 1ZARA 2R5YA 2C83A 2HVQA 2F67A 5FL7D 5HMLA 2OHOA 4HF0A 1T15A 2G6BA 4P4SA 2MYUA 3SS7X 4HMOA 2DLDA 1J1ZA 2Q4RA 1QPMA 4H4DA 4EPYA 2KP6A 1E3EA 5KX5A 1DU6A 4QJBA 5E1BA 3UMJA 3E6CC 4EZIA 1IRZA 4UZSA 4NVRA 1NNUA 1KQPA 4ER0A 1AS3A 5LCXA 4H15A 3EJ6A 1EFHA 1G2PA 2G9WA 1QKIA 4KZPA 1IAQA 1DTWA 3HM5A 1TA4A 1XU4A 5KKZC 5KVVA 1TF2A 2D6FA 1FCJA 3NRCA 4E70A 3LLUA 5C7OO 3PPIA 3QYPA 2VYND 4KMOA 3E61A 4E32A 2H7XA 4FJ2A 4LDZA 1R5HA 2OHFA 5BQXA 2HYGD 3C6BA 4P4UA 4GP7A 4RA9B 1VDZA 4K9QA 2OAZA 4CKYA 1KOGA 1D6NA 2JWTA 2B4KA 2AI1A 3UHJA 3E2MA 5FRDA 2R84A 4HV4A 1SZJG 4P83A 1E0AA 4Z1MH 1RHKA 5B5SA 1ADBA 4HAUA 4K81B 3I5CA 4R81A 4M1ZA 1WB5A 3ICEA 3I9FA 1RKWA 5CJ9A 1PSWA 3UGTA 3S2ZA 1JY2N 1SXIA 3N97A 5CVRA 4JBLA 1Z28A 2WIBA 4E7SA 5DEIA 4JT4A 4FM9A 1FTSA 1AQLA 4LIPD 2E2JJ