1GDTA

Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
b'MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE I OF RES DNA
publication title Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 58
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gdtA03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gdtA02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gdtA01
1W0TA 2LR8A 4UUTA 2WB1N 1BJZA 1ETQA 2YUSA 3S1RJ 1RPWA 4M3EA 5EEAA 1HDPA 5J1RA 4JP0A 3ZQLA 1JT6A 3JRBA 5E3MA 4A3MJ 1LFBA 1A6IA 3BTLA 5C4XJ 3LNQA 1MBHA 2N8GA 4CYCA 1QVUA 3GTMJ 3BR0A 1B72B 5GPAA 3IH2A 2H8RA 1RETA 1IJWC 4AUXA 4ABZA 3BQYA 2RAEA 5C31A 2CQXA 5F0HA 1IG7A 1R9TJ 9ANTA 3FKIJ 3GTJJ 4DYCA 3BTCA 3JRHA 2JJ7A 2XB0X 1F43A 5F08A 2E1OA 4RBOA 1JKQC 4A69C 1BW5A 3B6AA 2M9HA 2XPWA 2DMUA 2JMWA 1IRZA 2CU7A 2DA3A 1HCRA 2MHCA 4V2FA 2DJNA 4C2MJ 1JKRC 1BL0A 2DA6A 1VNDA 2TCTA 2R5YA 5C32A 1JJ6C 3BTJA 2E19A 3HKZN 1RKTA 3OIOA 1DU0A 1HLVA 3S17J 1TWCJ 2XPVA 4JYKA 1AU7A 3PM1A 2H1KA 5K7ZA 3H0GJ 2R93J 3I4NJ 3SDGA 3RKQA 2ID6A 5DS9A 3DEWA 1Y1VJ 2Y0SN 1ETOA 1ZK8A 5E3LA 4I6ZA 3JRCA 3CDLA 3BG5A 1X58A 2YS9A 4XRSA 3HDDA 3O8HA 1U8BA 1FTZA 5EYRA 3LSGA 4BY7J 1QRYA 2GM4A 5FLMJ 1TWAJ 2LK2A 2R5ZB 1LE8A 2EBIA 3Q0UA 1ETYA 1P7JA 1K61A 1ZQ3P 3SFIA 3HOVJ 2RSLA 3FK7A 1ETXA 4A93J 1Y1WJ 1ZR4A 3BR6A 1T56A 3GTPJ 3H3VK 1SANA 2R0QC 5IYBJ 4D7NA 2FD5A 1JUPA 3MKLA 1OCPA 5F0CA 2HOTA 4IHWA 1MBEA 4FCYA 2DA7A 2I10A 1YRNA 2HXOA 3IV5A 3S14J 1WCMJ 3HGGA 2LTPA 3HGYA 1Q1VA 3OSGA 1WPKA 3DCFA 1Z0XA 2L0KA 1FIPA 2HQ5A 4IHXA 2PMZN 1IV6A 4XRSG 4CYCB 2DN0A 4A3EJ 4A3IJ 2XGCA 1MSEC 4BY1J 3I4MJ 4S0HB 3S16J 1LFUP 1ORKA 2NS8A 3IH3A 5EF6A 1UG2A 1OFCX 3BG9A 1X2NA 5IP6A 1I3QJ 1O4XA 4BXXJ 1X2MA 2OF7A 5HODA 5IOZA 4XIDA 4UUSA 5C3EJ 4DZPA 2L9RA 4A3DJ 4BBRJ 1MNMC 4MLOA 2DA2A 2NVXJ 2R92J 3QPLA 3PO2J 2NVQJ 1BA5A 2QCOA 1B8IA 4IHVA 3ILXA 1K83J 1WI3A 4A3KJ 3PKZA 3MN2A 1TWGJ 2EZLA 4M3FA 2LP0A 5K7FA 3JR9A 1TC3C 3OSFA 2R5YB 5JLWA 3MVPA 4V2GA 2YU9J 2WAQN 4D5CA 1GDTA 2R7ZJ 1DU6A 1MBKA 4MFDA 3GTOJ 1I6HJ 5F1JA 5IP7J 3S2DJ 4A3GJ 1NK2P 1NTCA 3S1NJ 3LSPA 4L5EA 4XRMA 2E2IJ 2O7OA 4C3HJ 1HOMA 2LLKA 1D5YA 2MSYA 1TWHJ 5C4JJ 2E2HJ 2Y9ZA 1AKHA 5EZGA 3ZQGA 4HNVA 4A3FJ 5C34B 2EZKA 3B6CA 1IDYA 3CCYA 2K9QA 4A3JJ 2K40A 1QPIA 3PO3J 1CQTA 2TRTA 1S7EA 2E2JJ 1LE8B 2B63J 4B4CA 5FKNA 3TW7A 5F04A 3NAUA 1JJ8C 3F0CA 3GTLJ 1VF9A 3LOCA 4AYBN 2LKXA 3GTGJ 1ETKA 3JRAA 2HYJA 3BR3A 1P7IA 3IH4A 1W0UA 1FIAA 2JWTA 4GFBA 4XICA 1JGGA 3NARA 4G12A 2VKVA 1RKWA 1MBFA 2O9LA 1YRNB 4B1RA 2K9NA 3VPRA 1ENHA 1GUUA 1ETVA 5IYDJ 4BBSJ 3TP3A 4W97A 1BW6A 2FQ4A 5GP9A 2JA5J 1IGNA 2KDZA 4Y7NJ 4JX4A 1ITYA 5F27A 3S1QJ 2X9DA 4EEFG 3S1MJ 3TW6A 2DMTA 4M6VA 2XB5A 4I76A 2KT0A 4IEJA 2FJ1A 1A5JA 4UUSB 3LSRA 2X48A 3FISA 1FJLA 3M3YJ 2VUMJ 4D5FA 2XRLA 3QPSA 2L7MP 1H8AC 1EF4A 1GV5A 5EDNA 1B8IB 4J19A 2CUEA 3GTKJ 3G1LA 3ZQIA 5M3MJ 2DMNA 2VI6A 3CMYA 3JRDA 3A01A 3UKGA 5F0FA 1HX7A 1ETWA 2VKEA 2NVYJ 3S15J 3G1MA 4FE7A 2HXIA 3HEFA 1RR7A 5FKLA 4DYRA 5M5WJ 1U9OA 3BT9A 3GTQJ 3WHCA 2HOSA 2NVTJ 3BG3A 2DA5A 5IYCJ 5M5YJ 4FTHA 1JKOC 3ZQHA 1IC8A 2M34A 3C2BA 5M5XJ 2OPTA 3RZDJ 5EGOA 1JUSA 1AKHB 2K9SA 3BR5A 2Y30A 4M3DA 3M4OJ 5J3LA 2X6OA 2ID3A 3K2AA 4AC0A 4X6AJ 2L7FP 3JREA 1F36A 2NOGA 4NDLA 2D5VA 4MO7A 1PUFA 2JA7J 2ECCA 4B3AA 5E3NA 1GV2A 2JN6A 1POGA 2CUFA 2M2EA 5DTDA 5E3OA 3ZQCA 3A02A 4MIMA 3LHFA 4D7MA 3CQZJ 1IUFA 2IBDA 2MGQA 3TEDA 2EZIA 2EQRA 3JRIA 1MH4A 2Y9YA 4Y52J 2VPRA 1FTTA 1E3OC 3HOWJ 1JTYA 3Q0WA 4QIWN 5FKKA 2ME0A 1Z77A 3FK6A 2O8KA 2LFBA 4DYQA 2QF7A 1SFOJ 3BVPA 2JA8J 2HI3A 2XPUA 1ZKGA 4BQQA 3JRFA 4DW6A 2EH3A 2IEKA 2MG4A 4X1EA 2DA4A 2XSDC 3ZOBA 2FX0A 2JA6J 2COBA 1NK3P 2LD5A 2DA1A 4W1UA 5FJ8J 4MFEA 5EG0A 4M3GA 2CRGA 3JRGA 3GBGA 2MW8A 3LHKA 1MBJA 2LVSA 2LY9A 3BTIA 3E7LA 4RDUA 3G13A 3D1NI 3HOUJ 1HF0A 3A01B 4BKXA 5FKMA 1IDZA 1GVDA 2ECBA 1GT0C 4A3LJ 3Q0VA 3L1PA 3HM5A 5J1UA 5BNGA 3UJ3X 2Y31A 4M3BA 2JK3A 1WGXA 2ZB9A 5EGOB 4C3IJ 2XGDA 1MBGA 1XC5A 5IP9J 5IPAA 2Y2ZA 3HB9A 1QVTA 3WHBA 3HOXJ 5M3FJ 1RESA 2AHQA 1B72A 4LOCA 3OOUA 3K7AJ 5IOYA 2L7ZA 4XK4A 5FKOA 1AHDP 4A3CJ 1PUFB 1UHSA 1XG1A 2NS7A 5J1YA 1UMQA 1JTXA 3BR2A 2IAIA 5EZHA 3RZOJ 2GBYA 3Q3SA 3HOZJ 1WH7A 2HDDA 3TP0A 4JX5A 2DMQA 3BR1A 5C35A 2CQQA 5C44J 1MSFC 4DZJA 1JKPC 4QSHA 1HDDC 1OJLA 2AO9A 1U9NA 2M0CA 3FIWA 1H89C 1VI0A 4QTRA 3O8GA 4FISA 2HOAA 3A03A 4JX6A 1ZTRA 2WV1A 5K7HA 2GM5A 2G0EA 4A3BJ 1GHTA 2CJJA 3BQZA 2M8GX 5GPCA 2DMPA 2DTZA 2ELKA 1VFCA 1MH3A 1JUMA 2W48A 1FEXA 1ZR2A 5FLVA 4FE4A 1APLC 1U78A 3SJMA 2ME6A 1I50J 3RQIA 4C3JJ 5EG0B 2XGEA 3GUVA 3W6VA 2P81A 2R5ZA 3G1OA 1XS9A 4IHYA 1OCTC 2GLOA 1G2HA 3QQAA 1JT0A 3LSJA 1TWFJ 2EZHA 5JLXA 1T33A 3HOYJ 1ZGWA 1WH5A 3S2HJ 1H88C 3HBLA 3ZQFA
chains in the Genus database with same CATH superfamily
1COWA 1PJAA 3HZZA 1DAPA 2L9NA 4B47A 2DUJA 1HDPA 4BJ1A 2KQUA 3DZ8A 1ISPA 2KZVA 3MD0A 3USES 3I32A 1GRNA 4JXZA 1NJFA 1SN7A 3JTHA 2AQFA 2O6LA 4R0VA 1TQ2A 4B86A 2OVFA 4B4KA 4REQB 3VR1A 5K8CA 1DC7A 1O94D 4G94A 1X7WA 2BGCA 4GX1A 4Z4GA 3LX4A 1AQYA 1J25A 4JYKA 4ZRMA 2FOKA 4UCFA 1I39A 2HMVA 5BSFA 4IHJA 3U62A 2AFRA 2WJJA 2B35A 3B73A 621PA 4KRXA 2ES4A 2AXEA 1XYYA 4XSXF 3RK3D 1P17A 3PQ2A 1CQWA 4JOQA 4D45A 3UWSA 2LG4A 2P9BA 5JNTA 4W5RA 5ILGA 2P41A 1WPKA 2W6OA 4OH7A 1XZBA 3QI2A 4PO8A 1UG0A 5FBHA 4CYCB 3CH4B 2IYWA 2JRMA 1UFKA 4XQCA 2PSHA 4J75A 4OU0A 2AC7A 4DTCA 5BNFA 3A6JA 1O4XA 2CFSA 3FN4A 4E7IA 3ZHYA 3Q5SA 5E8GA 1UAYA 3D6FA 2JAPA 3PEUA 4P5DA 3E5QA 5CB4F 5BR1A 3QVGB 3CW2A 5FA6A 1KB9D 3HUTA 2QBYA 2PJRB 2INGX 4HXYA 4O2BB 3P45A 3V6MA 1Z9CA 4AXXA 3VR6H 4RQBA 2EBHX 4I81A 3J7TA 3ZQGA 2CLMB 4NMHA 4JCOA 5U4XA 2V6JA 2NAFA 2F8LA 1NO4A 2DOFA 3KT0A 3L37A 4PRZA 4YMGA 1ZCJA 3BFVA 3TYXA 1GG9A 1ZP0C 3C9IA 2OQRA 1SQBE 3DTTA 3UMFA 1E0JA 1NMQA 3KOWA 4QXMA 1GUFA 2O9LA 4OUDB 5DBGA 2EIHA 4JJAA 3SHTA 2WIGA 3FVRA 1XDBA 4M4SA 1NKNA 4MVJM 3L0CA 1RBZA 3V46A 5IEBA 1NOKA 2W6QA 3GVHA 5BSMA 1EVZA 2NO4A 4J1TA 2NUBA 4L9TA 1FDVA 1DIOB 1H65A 2PV0A 5AVWA 4ZCLA 1KQGB 2VI6A 2I4NA 3CN9A 5BR4A 2Q3BA 2FPKA 1XN7A 1GZ3A 2YFKA 1OB2A 4G9GA 2CL7X 3WHCA 3R9KA 2QI9F 5FUVA 4RFLA 2A30A 5FPHA 1LLUA 5J2TA 2C04A 3VAYA 1VHQA 2I4MA 4AY2A 2J3JA 4TYPA 1TYZA 4RJKA 4UTVA 3RPUD 1OMIA 4UVGA 2A67A 2H52A 1VRVA 2H1WA 3IDZA 4YFVA 4AIRA 1I0LA 3EEQA 2YWDA 2NT3A 4XUCA 1E79H 3DTVA 4HOBA 1SUCA 1WP9A 1SQPK 3QBTA 1JEDA 4AKEA 1NBME 3Q7QA 4IFEA 2HI3A 4Q93A 1FP2A 1CUAA 1SFEA 4OXXA 2VJCA 1K89A 1KAHA 4LI0A 4MARA 3SIWA 2V5VA 4AM3A 2F1KA 1RI3A 1BI1A 2EFEB 2YJ4A 3SLKA 4B73A 5AW4B 2IELA 4P9NA 3QPUA 4INZA 2WVRA 2V3WA 3WE2A 2EFOA 4E5MA 4BVEA 4TVKA 3HD7D 3LLUA 1XC5A 4LOCA 2D5BA 4B3DA 1EM8A 2POHA 3PQ3A 4D3XA 3FHTA 1IPHA 3PRYA 2C96A 4ZEOA 4AZ3B 1WUJS 3A1SA 1XXHA 4CM9A 4L0DA 3LC7O 2AO9A 1JJBA 1IWOA 3KLMX 5JSZA 2H7HA 3PGVA 5B4UA 3N28A 4EJFA 3LTNC 4QDZA 3M0DA 4ZJYA 2EYUA 1GUDA 1PFKA 2W85A 1HFJA 3WO0A 1Y3HA 4CKYA 2YOGA 3H1KG 1PCXA 3QMMA 4EUSA 3U09A 4GEKA 2HHJA 3JWEA 3T1YB 5EP2A 3I3OA 4JGIA 5E6RA 1BAPA 5EJ4A 1CB0A 4H6WA 2XD9A 5K4GA 3LBFA 4FSXA 2GPAA 4BFZA 4WA7A 5GQSA 2D2CD 3PX2A 3TEJA 2J59M 2Q2OA 2R84A 4OO3A 1TUIA 2AFHE 2VBCA 5TXGA 4BFUA 3E1IA 4DNCA 4BIIA 2GEDA 3T9EA 2WJPA 1GHCA 1JG4A 1PVDA 2YVQA 2PUDA 5HRCA 2KLUA 3M5WA 1P84D 1KILC 5HG0A 2WT8A 1N5KA 3RV4A 4AJ2A 3DB1A 5HQJA 4Y7CA 1OBHA 3DFMA 5D3ZA 3IUQA 4FHFA 3ASNH 1A4IA 3RGGA 1W96A 3ANSA 4Z3OA 4KGDA 3J7AC 1Q7RA 1WXXA 2A06G 5CAEB 4ZAVA 1HK7A 3Q9NA 2ANCA 2UZIR 2COKA 3R5HA 4ON0A 2FH5B 1ZN9A 4R1OA 1DELA 3HOVJ 4JX9A 3LYUA 4L4YA 2R6JA 3H3VK 4OM8A 2P6NA 4JVMA 4RPIA 5LZ7A 2X2EA 5JAPA 3PD7A 3RK2C 1JCCA 3ED1A 1K7YA 2KBEA 1VSVA 2DHQA 4DL9A 1FJ2A 2IJLA 4MW9A 3I0NA 1HT3A 1DRJA 3QTTA 5C8DA 1Z4KA 1ZAOA 1URQD 3FDIA 2ZJZA 1QS0A 4BUCA 1H88A 2IHTA 3N53A 3GG9A 4DJ5X 2BBWA 4FM9A 2IW3A 4JPZB 4P86A 3D5QA 3FXQA 1RE0A 1B8NA 2EP8A 4J9UE 4TYQA 4MRNA 1K8ZB 4WLUA 3V34A 2TSYB 4YQZA 4D6YA 1N1GA 4ZAXA 1T0BA 4L4XA 1PWHA 1NTZD 1PRYA 1DAGA 3RT7A 3A4YA 2GQQA 2AKEA 5BSKA 2XW6A 2JD1A 2RREA 1Z12A 2HA3A 4YQFA 3A0RB 4JLDA 4KOAA 5CYGA 2ZWVA 4L3OA 3F0CA 1QBKC 1PD0A 2YC4C 5AKZA 2DOEA 5LQRA 3K70B 1P7IA 1G21A 2QQFA 4BEWA 4MGEA 3AY3A 4GF5A 3KS9A 4OF4A 4MP6A 2GVNA 1ETVA 3H9BA 3G6KA 3TBHA 4F9GA 3ZHRA 2GAUA 4HA8A 3OY9A 1Z74A 3OTGA 3R8FA 2VBWA 3QEMB 1L0LG 1EJBA 4R7ZA 2H89C 2BH9A 4UKDA 3RS2A 3WJ2A 2WIDA 4Q4JB 3DBLA 2Y93A 1OBOA 5AHKA 5JI3E 3B7GA 2YNMA 1SAXA 1IM8A 4R68A 3DNFA 3DU5A 1SXJD 3PP8A 5FKLA 2JIDA 2HDCA 3KZKA 3ZQHA 1IC8A 2AR7A 3C2QA 1G5QA 2YIDA 2HF2A 3RPEA 2PKYX 3CNNA 3DBIA 3GFRA 4MO7A 5K4AA 2BMJA 4DWOA 1XNHA 2LC2A 1Y0UA 1NJ1A 1AB6A 1NF9A 5FULA 4DLWA 2K3RA 3WV5A 3ZQCA 2QZPA 1Q91A 5C1IA 5APYA 1SKYE 1T9CA 3Q7SA 3AB7A 4DDKA 5CDSA 5SY4A 1EXMA 2ZFCA 2JIMA 3V8EA 3THWA 3OO1A 4PLCA 3DOCA 4RZ3A 1I4EB 1NZDA 5LR6A 3BKXA 5JSYA 1PNOA 4FFWA 3SC4A 3AHIA 1YQUA 3E0QA 1NN1A 1SQBK 2VAPA 3EAGA 3H8JA 2Q4OA 3T35A 2C2KA 5AVRA 4DZZA 5H4GA 2WJ6A 4L9AA 5T57A 1SCKA 5DSZA 2DZDA 4PLZA 1H42A 3A1UA 4MLDA 4CIAA 2K5UA 1ZM2A 1SXQA 2H9YA 3X1DA 3WA6A 4GX2A 3HWX1 1U31A 3DT9A 5K01A 3A6DA 3PGLA 3L70J 2R5BA 2Q9UA 4PY2A 1ZJJA 3DYVA 1K6JA 1JFTA 1G5RA 4FYPA 1V2HE 3VNVA 2C7QA 4MW2A 1P7YA 3V1KA 3GJRA 5C8YF 3K1MA 4H7JA 5DTMA 2VJ4A 4PV7A 2QEXI 4IHQA 4UXJA 4V1CI 2ZO4A 1H1DA 5ABPA 1WKCA 4JWTA 3CBQA 3G1OA 3ROZA 1R6DA 3LYAA 1OXKB 3GGSA 1DO0A 2HN9A 3CM0A 2UWJE 4BGVA 5WRFA 4ZYDA 3X43A 3ZQJA 2PIAA 3ANMA 4L9RA 4Q3NA 1QLHA 4YAEA 4GPAA 3S1RJ 2CG4A 1E2JA 4F52A 3VTAA 3Q9VA 1HE3A 3EDYA 4LTMA 3NT5A 2OAZA 4NQWB 4G1UC 4CL3A 1ZVMA 3U2QA 1OZFA 1RJGA 3LSIA 2B5WA 3BQMB 3HI6A 2VKDA 4IJAA 4OK6A 2HJ9A 1Q77A 1LSSA 1VQ4P 4RMIA 2LCFA 1R4MA 1LC0A 2FMTA 2QX6A 1I80A 3KP1A 3KKEA 3OEWA 4FGUA 1ONOA 5EJ7A 1XMKA 2G4LA 4XLNF 2IX3A 4ITUA 2GCOB 1EWVA 3EG9A 3MGCA 1RRMA 4RHUA 1N34B 3C3EA 1IN6A 2LK2A 5DNYB 4X0GA 2R25B 2QVAA 5EWLA 4DCUA 3P1JA 1A9TA 4EUKA 1G4HA 1FU1A 4M9ZA 3D3JA 1X2EA 4GOXA 4Y8VA 3HGYA 4H13B 3JCUE 1NXQA 5IC5A 1FFXB 1W6UA 4NYMR 1EP2B 3L09A 2G40A 2YFQA 5G2OA 3DMPA 2M3AA 2KE5A 1JLRA 4I3HA 1JI8A 4CLRA 2FYZA 1Q7BA 4LQ4A 4Z7QB 3KQYA 3WUVA 1BMFD 1DC5A 1DS6A 4YRLA 3IAM1 2NVQJ 2WSIA 3DO6A 2A3NA 5KWEA 3BIOA 1TBXA 4JGBA 3WIDA 3IVMA 4ZEMA 2NZJA 1GDTA 4R8MA 1U3GA 4O4JF 3C0KA 3LHIA 4HGZA 2NXJA 1HRDA 4UREA 1V1RB 4P53A 2X0LA 3VMAA 3HWRA 2SKDA 3ZDQA 4IIEA 1CI6A 4IF4A 4K6CA 5CA1F 2GASA 2QRZA 3G8YA 3JYOA 3V8PA 1KO1A 3KJNA 3L71D 1MMFB 3QVKA 2PMUA 4LY0A 5B36A 3F3XA 1YITI 3AT1A 5AW7B 3L7YA 1VBMA 4C4TA 5FV7A 2OESA 1G9TA 1GRRA 3KYBA 3TUJC 3TNFA 3NANA 4TKLA 1ZSVA 3ENWA 1LI7A 4PONA 2BZSA 4MW7A 3FR8A 1E8NA 3IP4B 2CJWA 4OQXA 2VP3A 1EA5A 5E6UB 1ZDMA 4C7NB 1UELB 4URYR 2ZJBA 4C22A 1N5LA 1ZYUA 3C3DA 5FUMA 5GTHE 2LNBA 1N4AA 4DIKA 3E23A 2ECCA 2C5SA 3HG7A 2JN6A 4YFYA 5AVUB 4CCJA 2MKVA 1OLXA 4CUKA 4LJSA 3P9XA 3HEAA 2R9VA 2AXCA 4D0SA 5C1OA 4DY4A 5T4HA 1Y7TA 3H2ZA 4P55A 4R71A 1DIAA 2Y77A 4D5GA 1GNPA 3LGXA 4ZI7B 2J9FB 2FX0A 5CT5A 3DXJF 5LGUA 2YL2A 3G2HA 4DSNA 3FIUA 4ESBA 4YRZA 2IITA 2IH2A 1QLWA 1XTKA 5A4MS 2ZYSA 2JBAB 4IXAA 1P4GA 3L8GA 6Q21A 5I7HA 3UW1A 4LJ4A 1RQVA 3REOA 3QBVA 1SCNE 2F4MB 1JEQA 2LCIA 3MRTA 3DF7A 1KKMA 3GRYA 2O4UX 2XWSA 3NAZA 4F6RB 5DCMA 5A06A 3JASA 1REQA 2VDLB 4C7RA 3PP5A 3ABVC 2FP4A 3N0TA 3A1YA 4LJLA 2V0NA 3RVRA 1V5EA 1B4DA 5P8WA 2WD9A 2JLYA 1G8YA 5A4AA 3UGQA 2BFDA 4RD4A 5L8RJ 2PGXA 4R3UC 2JIRA 3F6EX 1FZQA 2IE8A 1J22A 4N3NA 3QVMA 3OT1B 4OQDA 1SFKA 4LFUA 3A03A 3FUUA 1LK7A 4XDZA 3EYWA 4CRWB 1VCMA 3IKTA 2IOFA 1YHQI 1VMDA 1X8JA 4TKMA 1T9DA 2C9DA 5DP1A 2P4WA 3F4KA 1EXIA 5C52B 5LYJB 4IWXA 1P2GA 4ALIA 4H9GA 5B1HA 5LA6A 2OCIA 3JCZA 1T2VA 3UHFA 3MCTA 2B0LA 2W98A 5AVZA 1E0DA 3CG4A 5E6SA 2JTVA 2CLEB 2FMHA 3KD3A 5CG1A 2B34A 1Z4NA 3EGOA 4N82A 5G0VA 2AJLI 1DJOA 2CFIA 2TS1A 4JT8A 3T3MB 4NPAA 2E55A 3L72D 2PBLA 5JD6A 1JUDA 2H8WA 3BQ9A 2W7NA 2V9CA 3OLZA 1CFJA 5ALPA 4UNRA 2GD6A 1HCRA 2Z5GA 1KI3A 3E18A 1WV1A 3VOAA 1HETA 1IO2A 4R79A 4H2DA 1DZ3A 3SX2A 4KMMA 1KIMA 2VNJA 2UV8A 5EJ2A 5JRJA 3I04M 2AS0A 2MA3A 4C2AA 5ER9A 2LKSA 2A5JA 2X51A 4NOKA 5FOVA 1XZQA 1ML4A 1N7IA 1O5TA 2ERXA 2ZVJA 3OR1C 1P0FA 3GZ5A 1Y8QA 4I55B 2PZFA 1GFZA 1LI4A 3WDLA 2P65A 4V3CA 4W9RA 4I7ZB 2YKQA 1MLDA 1VJ1A 4PTLA 2ZRNA 5JHUA 3SX4A 5CK4A 2X4HA 1IZ8A 3PWZA 1UL1X 4GOKA 2PXCA 4S24A 4D4KA 5GZ3A 4IL6X 4GLLA 1W7PD 1XXHE 2K7ZA 1U0HC 3AIOA 2AXTE 3E84A 4NATA 1VA4A 3UHOA 4B6OA 4WY4D 3I9KA 1GV0A 1MNMC 1FE6A 3PKIA 4B3JA 3A1VA 3VZBA 5AVOA 4WD3A 2P0YA 2P67A 3A26A 2YXPX 3GBVA 2QNBA 2EGUA 3TZBA 4BX8A 3MMYB 4RM3A 1DJNA 4N6GA 2NPOA 4OLAA 1SMKA 3RCOA 4N9HA 1VG9B 3FCSB 1ZIOA 2V0CA 4QDUA 2LLKA 3S70A 2AG0A 2ATIA 4ENRA 1GUAA 1EVJA 3RREA 4UC0A 1A4RA 3H7IA 2P9EA 4JI2B 4L9JA 3VC2A 1TM1E 1VMAA 2VTKA 1ECPA 1QMPA 2FJUA 1K73Q 4HLNA 1Z6XA 3OQIA 2OCKA 1CYDA 1V48A 1FNNA 2AV6A 1LD3A 1N2XA 2ZRHA 2X4DA 2HRZA 3GDOA 2VK8A 2C84A 1LF0A 5CCDA 1ZOYC 5AUQA 4WVZA 4N1AA 1WPGA 1HORA 4QRHA 4J76A 3RU2A 4J90A 3DDHA 1KDYA 4IEJA 2V7FA 2BCGY 2N1TD 3ZK9A 3WR5A 4GPZA 1NL3A 4J0IA 2J9GA 1IY2A 4P4TA 5I9IA 5H2FH 2O7RA 3CCLI 4FTHA 2XUGA 2YHIB 4K6MA 1SUAA 2PSFA 2EJBA 2H2IA 3QUQA 5CU7A 1H2AS 2W82A 1G3QA 1H23A 2RI0A 2QJTA 2YHUA 3FM5A 1KMIZ 1C81A 3AY0A 1Q2XA 4KTTE 2AVDA 1BCCD 1TIKA 3HCWA 3ILYA 4F56A 1S6YA 2PKXA 4QIWN 5D7NA 4K6HA 4LXTA 1EG7A 2FUNB 1N7SD 5FGMA 4QTUB 5REQB 3I6MA 4HFRA 4M22A 2ATVA 3RKSA 2WHYA 3ENKA 4YQYA 4HNQA 2BYTA 1ZNZA 2OYHA 5K5EA 2XVAA 5G3ZA 1JCDA 5IVHA 1S2EA 4LHZA 5KLIB 1RKBA 3OLXA 3OVMA 2IY8A 1S02A 2J5PA 4G26A 4JROA 3FHCB 2BVMA 4DJTA 4KXWA 5KNDH 5DWQA 1PYVA 1YJQA 1XJ5A 3TSWA 4H7KA 2XV5A 1GITA 2ZS8A 4CEJB 1VSUA 1Q95A 5IT4A 1AQJA 1ZITA 2GOMA 2FSIA 2FK7A 2QZJA 1ZK0A 4RGUA 4LDNA 2C4MA 5I7RA 3JWPA 2R1VA 2UU9B 2XB6A 3H75A 4ROSA 5COBA 2E76D 2LDBA 2L5QA 2D8MA 2YC2C 2CSXA 4BGDA 3SSUA 3HRNA 2HOAA 2EFCB 2P79A 5IAAA 2AX3A 2NXEA 3NP7A 1UKZA 2UV1A 3W78A 1T2EA 1DHTA 4ML3A 4L74A 3SS9X 3CF2A 5AVKA 3Q9SA 2EZHA 4LYYA 1VQKP 1EP3B 3OOEA 5BPFA 1HLVA 1BVHA 4HZGA 4XR4A 1HYQA 1G2IA 2WWYA 2B8WA 1KZ9A 3O90A 3WYNA 1AVYA 1E96A 1HJBA 2J5UA 3NQ41 3KLNA 3GJ0A 4DC1A 5K8LA 3CU5A 4KSCA 4C43A 1HUQA 2AA3A 4B48A 1JKQC 2KSJA 1ZXGA 2I4RA 3O8OA 2CU7A 2I2XB 3N3AC 1JJAA 1MXFA 4FCVA 1MENA 3ULQB 3NFYA 4X95A 2IUSA 1NMZA 1XK7A 4V03A 2R87A 5A4DA 2QAGB 4DRZA 4L6CA 4EB3A 2BHYA 3CVOA 3EDCA 4UHBA 4K9MA 3A3YA 2HADA 4CTOA 3W8EA 1NOHA 4I5FA 1E4OA 4R1UA 2DK8A 2HBYA 4HSRA 5H6RA 1ETYA 4GUAA 1XMVA 2HU8A 1RQLA 3GJQA 4BQEA 1VQ9I 5SYMA 2OXTA 5EJIA 4KNYA 2FPIA 3JZIA 3M9WA 1HYGA 3P4YA 5JWHA 1E2GA 5DYMA 1V4BA 2VK2A 2E7WA 4WOKA 1E6MA 5B5EE 3SN6A 4NU5A 1NVVQ 4A9AA 4DB4A 1DQNA 3F1LA 3FGPA 2VXYA 3SZMA 2EKDA 1AMNA 3BTSA 1ESZA 3LP6A 4DV1B 2Q1XA 2FBKA 1NTKG 3SZOA 3LF2A 2KZIA 3N0VA 2OECA 4O59O 2QGZA 5BOVA 1ARZA 4JUBA 5KMGB 2DFTA 5DHQA 1E3IA 3IEMA 2FFDC 3HYTA 4TTQA 3GEMA 1K5GA 5B1SA 3UF0A 2XGSA 4QVIA 4KI0A 3UT0A 3ROMA 3BPVA 1E2NA 4DIQA 4U2BA 5JS1A 2EX4A 3PEEA 4PJ0H 3EXEB 4WACA 3V9PA 5IUJC 3R3WA 2WWWA 4I0WB 3KBBA 1E2QA 2QRQA 3T7DA 1C1XB 3PJDA 1G8XA 2HRQA 5K99A 3PSHA 1BH6A 2FCAA 1U98A 3AEZA 4D46A 5AHOA 4LGVA 2XQKA 1B0PA 1E2IA 2K6GA 3CH5A 3BGIA 3LW5H 2NVUB 2E5TA 1FOYA 5IKOA 4CM8A 1L2PA 5B2FA 2PN1A 4WBSA 4YXWA 1F2TB 1X3LA 1OX6A 3OMLA 1IC2A 1JQJC 1M3SA 2RD2A 1GSHA 1QTRA 3LMMA 3WQQA 3IHUA 3A01A 3OE5A 3GBPA 3EG5A 1BDBA 4TSFD 1O94C 9ATCA 5CD1A 2R8EA 3EUEA 4JI1B 1E6UA 1GG8A 2NUPB 4YO7A 1P8JA 1M1XB 4HDQB 2GO7A 1S2IA 1BMDA 3PQ7A 1EUYA 1HXDA 1E2MA 4JC5A 3VR3D 1T35A 3LOPA 1FFHA 4RA9A 4JVOA 4YBRA 1XCLA 3A02A 3N5CA 4FMCB 4PVCA 1VIVA 5AWFC 2C0WA 1OH6A 3SC3A 3O8QB 1P9LA 3B5JA 5J4KA 4TS4A 4Q82A 4FT4A 3NZEA 3SZRA 2Z5HA 4J0CA 4RAYA 5L3SA 2L3DA 3TG8A 3K69A 2IK8A 5MN5A 1PP9E 4LISA 5DN6A 1CUIA 4KGVA 4DNFA 5H81A 3Q8XB 3SD7A 3B1JA 1M74A 2X8JA 4YGYA 2B61A 1X2BA 4ARCA 4TQGA 2C29D 3HBFA 1GU7A 1TYEB 4DCVA 2QN9A 1WW3A 4LKRA 5BMVA 3ONQA 3C6QA 3JRXA 5TF0A 3VYTB 1TD9A 3PGXA 2OV2A 1EGQA 4OXNA 4BNLA 4O2BF 5E79E 3H3XA 3HO6A 1WUIS 2F5VA 1DAKA 3RUEA 4ZCIA 2D1TA 4E5YA 4JT2A 5J40A 1ZJWA 1LU9A 3N8HA 4A2UA 5DXFA 4YRTA 4C6TB 3Q8MA 4G4SO 3MD2A 1EA7A 2AZDA 4CBVA 2QKLB 3NBZC 1IFXA 1CT9A 1J09A 1K7FB 1SKUA 1OW7A 1NYHA 5H16A 1P31A 1RYNA 1TUGA 4R3WA 1P2SA 1G17A 5JVGF 1BHSA 3OUTA 2X4LA 3O2JA 2OKGA 1NSYA 2WHEA 3FOCA 3UO8B 1SVMA 3KP4A 3PX3A 1L2TA 1NW6A 2WB1N 4HDKA 4KDCA 1NBMA 3WY9A 5IJZA 5E1WA 2JJQA 2WU1A 4RY9A 2GZSA 3DXYA 5B1BH 1GFIA 1WZCA 3K2IA 4QD3A 3EVZA 3AE5C 1T34A 5F0HA 4XR9A 5B3JA 1S72P 1ZD1A 2I2FA 2IGTA 3H2IA 4MEBA 1NUQA 1RYMA 4ZYLA 1WT6A 3SS8A 3UMMA 4V2FA 2BM9A 2QZ9A 4MGKR 3T4PA 1PW7A 5IC6A 2JBHA 4BV2A 1YG2A 3KDPA 2OBNA 4YT8A 4CMEA 1XCJA 1ULTA 3GLFB 5HWSA 3LF1A 2YS9A 3CP2A 3QY0A 3ZD6A 1T43A 1J0AA 2ZMEC 1JZTA 2O1WA 3T5BA 3KP7A 4B79A 4D9NA 5I45A 1PR2A 3KXKA 1X7HA 4DWJA 2OZUA 3QWIA 5AHXA 1CS0B 4WN9A 2IKSA 1VA5A 3CDHA 4P36A 2R48A 4LE2A 2QRKA 3AWIA 3D6HA 3B51X 1Z0SA 3CT4A 3UT5A 4E15A 3GJ5A 1UJBA 2NVXJ 3OEYA 4EABA 2QORA 3T7AA 5IDXA 2I7CA 4S1TA 3AJAA 3PSAA 4N5DA 1VE9A 1MDFA 2ZXWH 2BUAA 4V2GA 2JLZA 2AFHA 2VUTA 1Y5LA 4HOYA 5LD2C 2DODA 1B93A 2BLLA 1NU6A 5KPDA 4P83A 1R8QA 4LV6A 1VL2A 4EPVA 4G23A 3M1IA 4FSHA 3K94A 2EZKA 4FKZA 3G2LA 2ZTUA 2C0QA 4WY2A 5F76A 5CVJA 3B5IA 3HHGA 2X7HA 5K3FA 3RGWS 3JWGA 3LOCA 3EW7A 1YAJA 1BSVA 1OYOA 1UIRA 3M33A 1T0FC 4BNMA 1NG7A 1T91A 3HS3A 1NG6A 2BHTA 5F3WB 1U7WA 3TP3A 3U37A 1U1IA 2O8NA 3H8SA 4WNAA 3UANA 2GIZA 2XITA 3G8BA 1OVUA 1XVIA 2XB5A 4I76A 3V4OA 1N77A 1LWUA 4MQMA 1Z6YA 1T4CB 4PG6A 2D2CC 1DBIA 4TYWA 1UC5B 2WVJA 2W4QA 5EDNA 4KGZA 5AVQB 4XLPF 4DIBA 3GRUA 4BVGA 2ZSHA 3A0BC 1NULA 1NDHA 1BDJA 3HQ4O 2WWGA 3KQKA 4MRMA 4WLEA 3TQQA 5KYUA 3FUWA 3Q6IA 3LC1O 1B6GA 5E3NA 1H0TB 1IK6A 1XEWX 3JARA 3DUFB 1XLVA 4E51A 5HFJA 3GQBB 3KETA 3UB3A 3IUBA 4B3TB 3WL8A 4RD1A 4PX9A 4DIMA 2BXZA 4CFZA 4YCDA 3IR7A 3RJ9A 1PBTA 4M83A 1SWVA 2QSIA 2F43B 4QQNA 3DE0X 1V47A 4ZDPA 4QC2A 5EVJA 2Y1WA 4PZ9A 4OIOF 1E7QA 2JKYA 2NNLD 2EWMA 1UB9A 3FAKA 3QRWA 1K6EA 4EL5A 1W2EA 2CYBA 1TXGA 3TZQA 1B1BA 2RIRA 4U3FG 1Q0LA 2XH8A 4IVQA 3AE3C 4X20A 1SCUB 1L0ND 1PYOA 4O4IA 5KJ7C 4YJHB 2QM7A 3DFFA 4ARZA 3JD3A 1UIMA 1URQC 1YT5A 5IJAA 3DVQX 1R1DA 5T6BA 3SICE 5TJHA 1I2ZA 4NC9A 1LRLA 3VZSA 2F62A 5IPAA 4B75A 3NHSA 3I54A 1RQUA 1S29A 3TL3A 5U9CA 5JEEA 1XPOA 2FJPA 4DBRA 3BL5A 3OJCA 2H17A 4DAOA 2GBYA 1U81A 4Y17A 1SU8A 5ES4B 1LLCA 1FYMA 1XA3A 3HE4B 4F7WA 4L8GA 4M7WA 2B1QA 2NTEA 4JLNA 3Q8LA 1PP9J 1P5HA 3RFXA 2VYQA 2EV9A 1LW7A 4NCKA 1OASA 1J1EC 3HN2A 3BFPA 1AURA 4W7ZA 4PWZA 2J6CA 3HU5A 2R86A 3M2TA 4W1QA 4XL9A 1P3Y1 1Q0RA 3ILVA 1K8RA 2YJ5A 4CQMD 4L7VA 5D3KA 1NURA 3B6MA 3VSKA 2ISCA 2I4TA 1I7PA 1HEYA 3L4FA 2I1QA 3RS0A 3H1PA 1OWNA 1SQPE 1SXJC 2PU5A 1NQ5A 4FFDA 3O3CA 2I1WA 3F21A 2WYUA 5ALOA 1SOUA 5CCBA 3E15A 3GNQA 2NXNB 2ZYAA 5CYVA 3OP4A 2FZ4A 4LW8A 3M5CA 5F9HA 1UJMA 2CLIB 3O73A 2HMUA 3WKBA 3BGVA 4MVJP 4OXYA 4MI9A 4CL2A 5E3JA 4FYVA 1OR7C 1KDPA 3TVTA 2HK7A 4WI1A 1GM5A 3VR0A 2OAEA 2WV7A 1TRHA 4CIDA 3O7WA 1V6AA 2J9YB 2ZYDA 1T56A 3VR6A 2R0QC 4BAYA 2WJ3A 5J4VA 4ND1A 1H8HD 3HA3A 2GZRA 3WHPA 4HX5A 2W6NA 3OX1A 1ZGZA 4MPDA 3UGTA 1NP3A 2FWNA 3HUDA 3KQOA 3H2YA 1XQ1A 1TW3A 1FSZA 4YRGA 2OCDA 4G2TA 2WM9B 2A84A 1UPXA 2BKVA 1E6WA 4ASNA 4M3LA 4LZOA 1SZCA 3H0KA 5TQ0A 2BHLA 2GBLA 1GG2A 4L4RA 3A9SA 2XDJA 1ZP6A 2YWJA 1QQIA 4PD4I 4GKKB 5AK5A 4A0XA 2A68F 1JXSA 2FBWC 2P5TB 3LUJA 4LC0A 3OE4A 1EZ4A 4ZVTA 1FC2C 1Y81A 1RD4A 3O74A 2O0YA 2WB4A 5JFOA 2C83A 1L0BA 1GEEA 4U8HA 2Y75A 3QE3A 1PIWA 4CETA 3MUDC 2D2EA 1Z3IX 4HFNA 1DX7A 4BNNA 1FIAA 3BFKA 3R2JA 5FFNA 4UJ5A 3UMSA 3MOSA 1L5FA 2VEDA 3LJKA 4AWXA 3F98A 1PYGA 4NJMB 3QBEA 2O6GE 2JHAA 5JXWA 4E33A 3DMFA 2XAQA 2XYQA 4EJ0A 3LIIA 1JY3O 3MMNA 5JD4A 5KYXB 2BP7B 1ZRFA 5ADUS 2IDJA 2P6OA 1JMBA 1RHJA 4EPTA 1N7JA 3PIOF 2ZRJA 2J4CA 4QULA 5K1ZA 1YI2I 1E79A 2MSNA 3IA7A 3C5VA 4TTVA 3HYRA 3ZU6A 3A9TA 1EX7A 3QKTA 5JRZA 5B7QA 3OWTA 3F8SA 3NIFB 4KOEC 3MS4A 4I6GA 5BSVA 3CFYA 2Q3HA 4JWKA 1S8OA 2V5AA 4UBLA 2F55A 2BASA 3DM5A 2RC5A 1AKMA 3AERB 5HVQC 2EW2A 4BLQA 3DAGA 1WBJB 4NCNA 5IFLA 3LCCA 4GWKA 1OYWA 3CUEF 3LI2A 5CVUA 5CJ9A 4WKPA 4A6EA 3P71T 3N1UA 2O52A 4CKBA 3HYSA 3TXYA 3AF1A 2MOKA 4KWHA 3GP5A 2AXPA 3HABA 3JVDA 4XX0B 4Z86A 1CSEE 1LT1A 4BNWA 3A0HE 1XTRA 2QTZA 1KZUB 2X9QA 4O0MA 2COBA 5DYYA 2CHUA 2XBUA 5EZ5A 5KOIA 1IRXA 1IBLB 2ZCJA 2VC1A 3ZTWA 5KAIH 3NAGA 1J9GA 1GCAA 1GAWA 2RK4A 3L6EA 4DXHA 3GOQA 1ZKMA 1WMBA 1WCIB 4AKTA 3PC7A 1VQNP 2GD0A 5KAFE 5HK8A 4IO9F 2LBFB 4FHCA 2GILA 3EC1A 4BO5A 3JAKB 1OF1A 3E05A 3QYAA 3CUTA 1FRQA 5FI0B 3FF1A 4E13A 3VYRB 1UMQA 4ZZLA 2UXBB 2MYTA 4PINA 1J9ZA 2XWJI 4PN3A 3NASA 3GP3A 3ODGA 1KGDA 3RCBA 1W48A 4MV6A 1A04A 4G81A 4ZIRA 3TP0A 1SQFA 3EUFA 3ADKA 4G1EB 3K0AA 2B8JA 5A02A 4TLCA 5J47A 3EBOA 1O3TA 3GLGE 3D5TA 3VVBA 1FLVA 3FFWA 3O8GA 1C30B 2PM8A 1VZ0A 3IFMA 3SHWA 2I91A 3VHLB 3SDZA 3FBIB 1JR6A 5BQ5A 1TZKA 5CGZA 1PZFA 3C1DA 1XS9A 3R7WB 2RBKA 3I6ZA 1X8XA 3I34X 2H7XA 1UT8A 1NYRA 1S5PA 4RZHA 1JU9A 2XUZA 2XSZA 5DXJA 1WH5A 3VSEA 1XNGA 4QICA 1ZEJA 3L05A 1WUTA 4JBIA 4PG4A 1E77A 1T6BY 3Q40A 3FPHA 4EP1A 4QYSA 3EH2A 4PC3A 3LNQA 2EJTA 1JIIA 1J23A 8ADHA 3EXIA 3FKIJ 1NSFA 2WABA 4LJYA 3B1XA 3GFVA 3CLRD 1IK9A 3BPXA 4R6XA 3JQ7A 4D3SA 1HF3A 2ODPA 4DIOA 4JBLA 3G9TA 3IAM6 4C2MJ 4HP8A 3ZPXA 3ZXSA 1CE8A 2WWFA 3QOXA 3LQ2A 5DYTA 3BSSA 3C2HA 2C7PA 2E43A 1ZLJA 3ZH9B 1L5HA 4Q3CA 5L51A 5ESDA 3N2KB 2MINA 3SXYA 4RHFA 1X58A 3G0CA 3H18A 1Z2EA 1MD9A 2FX3A 1FFDA 3LKVA 1IHPA 1BIBA 4Y2YA 3JQFA 4AZTA 4A23A 3D43A 4ZI7F 5EPEA 1NXSA 1OVVA 3V48A 4A93J 1S2NA 3FVTA 3NCTA 3OLQA 5GM2A 1JV2B 1RCTE 2D1QA 1C3LA 3ITNA 4DA6A 2J67A 1SQPJ 2LTPA 1XLWA 4RH1A 4TZ0A 5JSKA 5HSGA 2QLZA 3DL0A 1Z35A 1YQEA 4S05A 4EF5A 3NBKA 2CL6X 3WTSC 2COEA 1YBVA 1JR2A 1BH2A 4RA6B 2ODEA 5LQUA 1PGQA 2HA2A 4HYTA 4XM0A 2HRBA 3UWDA 4DIFA 4H44B 1CR1A 3FB1A 5COQA 4FHGA 1SUDA 2CZCA 5DFAA 1NTMK 1JEEA 3TOXA 5CLFA 1VQPI 5FLYA 2WA1A 5AW3B 5JBNA 4RW0A 1U0SY 4MUAA 5JAZA 1JH9A 4WL0A 4ZDJA 1EXWA 1M34E 5IS2A 5J4YA 4QLOA 1XEFA 3PL1A 2FKNA 3AYZB 3WGJA 1JA9A 3L18A 3F8BA 2JCGA 2QJFA 1XZFA 4B3SB 1B42A 5A2QK 5BQXA 4DV5B 1YE3A 3OLVA 3LL7A 2A69F 3QOPA 2VLAA 3AB3A 3VAAA 3VPCA 3EDQA 3CCJP 1UC9A 2UVDA 3WGTA 2E82A 1PLKA 1AGNA 4H1WA 1QE5A 3U49A 3EULA 4HSEA 1KYIA 1J0CA 3AGQA 1JIKA 1CY1A 3H1LG 2E71A 3KPJA 3OOSA 2WP8J 4BGUA 1FSEA 2WKSA 5FQOA 2PWPA 4J43A 3HFRA 4W5NA 2O0MA 1E2FA 2LV8A 4AXBA 4ZT2A 1NMSA 2DR3A 4DXAA 2J5BA 1ILEA 1OB5A 2OD9A 1T5OA 3FDXA 1M73E 3LBHA 3ZE1B 4O5AA 5ADWA 1IRGA 1BKYA 3A5TA 1FZBA 4CLEA 2RHJA 1E9RA 2V5UA 4G5GA 2IFNA 4NE2A 4AB1A 1VIMA 3WTVC 5F4BA 1Z2NX 1D07A 4JN6B 2JCYA 2RCNA 4I55F 3DTIA 2ZT9B 4E21A 1R74A 2X6QA 4K9RA 3L1VA 1N7LA 3E3OA 4OVKA 3OFJA 4UUVA 1Z75A 1XZNA 4LLNA 4WCFC 5IJ9B 3D6AA 4JU8A 2HTJA 4ZOBA 4TWIA 4BX9A 3WYEA 3S1AA 2H1OA 4NG4A 4FT2A 1AWCA 3I30X 2C03A 2LY9A 3O8RA 4FZRA 5DLPA 1S2OA 4K9QA 2EJCA 3IX7A 2OYIC 1RQGA 5B3SH 1P7CA 4WY4C 4AK9A 2W6JD 4EG6A 3B12A 2WSMA 5DWDA 3FNQA 4LGMA 2F6RA 4MV1A 4JUCA 5KX5B 5AK0A 3PE4A 4BHBA 4CMAA 1UWCA 4B46A 2FG6C 2QP9X 3SHQA 1F2DA 1GTWA 5EZHA 3KTDA 3MVEA 1WPXA 4P4SA 3N4XA 1P4AA 3H1ID 3K1PA 5H5JA 2GZWA 3QXHA 2IP2A 4A7PA 2XT0A 4XPZA 1XZLA 5K7HA 4BLPA 1UJCA 4TQUS 1UOOA 2QSUA 4URWR 2HLHA 3FDYA 5TISC 1X1TA 4BE4A 5DJ5A 2GEKA 1BFDA 3JTMA 2R60A 4OAQA 3AI2A 4NESA 1L5GB 1EPUA 4OHFA 1T6ZA 1ND6A 1QFXA 3ZU3A 5ILSA 2G1KA 4LVOA 2CLCX 5TR9A 4C7XA 2D1RA 2D4HA 2CHGA 1G6NA 3M1LA 1PPJD 3UAWA 2GZDA 1RHQA 4OFXA 3C6KA 3R9XB 1XGSA 2NUAB 2F5CA 4GWLA 3RC1A 4V1CA 3DE3X 2C1XA 4DYCA 4JKIA 4L27A 4LE1A 1PEAA 3IKMB 5G0TA 2ODTX 2UZ4A 3M9LA 3BTJA 4MJ3A 2Z1DA 1DKMA 2CDAA 3OIVA 3L7MA 1M2JA 1DKRA 3CD6I 3P9KA 5E3LA 3K71B 1H2FA 4PD4E 3F90A 1W44A 3AHEA 3WSWA 1JU3A 2QQBA 3L4BC 4MPPA 4G7HF 4KBGA 4IKFA 4RO0A 1N7SC 1SCQA 3I2JA 2XCOA 1TVKA 3PFKA 3NH6A 4YP0A 1NV8A 2WYOA 2PYIA 1ZN5A 3HKEB 4TXJA 4EPYA 1F06A 2Y4NA 1CQJA 4PHCA 1RW4A 5CDYA 3TKYA 4BXXJ 3P32A 1FYKA 4XD2A 1SQBJ 3HCRA 1W2BO 3UUWA 3C1TA 2X8AA 4JI6B 4C9BA 1CY0A 3OQOA 1WXIA 3NDRA 2G5TA 2YYSA 1HDEA 1FJGB 2W6AA 4LA4A 1U3VA 2HMWA 2VWGA 3RKWA 4M46A 4E7LA 3AKDA 1MW8X 4ZC8A 4RYDA 5C34B 1XFAA 3U44B 2E76C 1PR3A 3GLTA 1U2DA 4XLFA 1ZCAA 4MWOA 1PGPA 5JS8A 2NO9A 4Q1BA 1KETA 1USVA 3U3DA 3ZD7A 1WULS 4DV2B 2V1UA 1Z18A 3NHKA 1OOEA 3GTLJ 1VBFA 1QOPB 4QNNA 3K10A 3Q0EA 1AV1A 2GJ9A 4K7JA 1C9EA 4ZV4A 1TT0A 3R61A 1PSWA 1RHRA 3IVGA 1SAUA 1SBCA 2XBLA 1K7CA 4EEFG 3GYHX 4RPKA 1V35A 1YI0A 1PVEA 4XJVA 4Z9YA 4RPJA 1TX4B 4MKIA 1KJ8A 2WT4A 4KX5A 3RHTA 1WDWB 5C4GB 4BGEA 5GONA 4UULA 4EHIA 3EFGA 4BB5A 4FE7A 3RYCA 3CX3A 3HEFA 1TJ5A 4CODB 2SHKA 5D6OA 3OU2A 2JGDB 1PJSA 4LMPA 3MMSA 5EJGA 3RFFA 1KEWA 5EMNA 4PSKA 1PFQA 1JJIA 2F1JA 2X58A 2FUCA 1O9GA 2L7FP 1VLMA 3JS5A 2FGKA 1ETHA 4X63A 5ALKA 2QSGX 4E5SA 3T38A 4KN6A 4ZU6X 4MQVA 4PX2A 5ENVA 3CTPA 2YWBA 3O9VA 1NH4A 2Q6LA 4C1NA 5JDCA 2OV1A 3OQBA 3Q0WA 4CDRA 2W25A 1YRQA 4RB1A 3E61A 2LIPA 3DO8A 2HKOA 1TYCA 4BQQA 2Z1MA 3NKLA 3WTYC 3L6BA 3BRWD 3HZJA 1AMUA 3D6VA 2QXYA 4UDYX 1EQAA 5AW6B 1C4XA 2XAFA 4LYJA 2C8VA 3P2EA 2FUG1 1FLNA 3H5TA 5DXAA 5BSTA 2JRCA 2HSEA 3GHGA 3S3MA 2ZSIA 5DCLA 3NWOA 3UWMA 3JYLA 4MVJG 4YP9A 2YZMA 1XZKA 2SBTA 5CLIA 1MAUA 5LLQA 3AEFC 5A4KA 3W8NA 2ZJ6A 5CEJA 1VYHA 1P29A 3VMXA 1KC1A 4ATNA 4C0SA 4KO2S 1K92A 4IIGA 2X0KA 3OYCA 4AQYB 3RL0C 3I01A 5KDOA 1FJPA 1G8JA 1E4YA 5BMOA 1F8FA 3JU3A 3OPYB 4UBNA 3REQB 4QXPA 4CIWA 3I56I 5KK1A 4XLAA 3AE7C 2YWFA 3SHOA 2CY0A 4CR8A 1W5CE 1U2PA 1P2DA 1H8EA 2O3UA 1E0AA 1G42A 2W2PA 4Q03A 3DE4X 1VE5A 3KEGA 1MVOA 5ICGA 4K3AA 2VZEA 2B5OA 3DMYA 4HNRA 2K7FA 1F7UA 3KQPA 4C7VA 2PLRA 5K45A 3DAFA 3K6GA 1SH7A 3ZX5A 1IEWA 1WCYA 1T4MA 5ITWA 1Y1RA 3OTOB 1W1UA 1RZ3A 3GJZA 4KRFA 3ZWPA 4BX3A 3N9IA 1PGJA 3BWMA 4U2EA 3EQ2A 1WY7A 2CNNA 4II2A 5AKJA 1C14A 1BHQ1 2ENUA 1XROA 1HKSA 1KEEA 3WB9A 1AUXA 4KYWA 4OXRA 2NOJB 1UXHA 2E74B 3R77A 5E3HA 2M9HA 3I8XA 2QU8A 3VZDA 2DA3A 1XGKA 2K02A 5B1YA 4L7QA 2PMWB 3TQCA 2WRZA 2FOLA 4ZYYA 1SFXA 1P2BA 4FMCF 5PNTA 1ECJA 1UDBA 4J0DA 5BN1A 4IFDK 2X7XA 3AHHA 4D0RA 4LYGA 3SWFA 3TL2A 1CRPA 2ZSUA 3AC0A 5H70A 1UXIA 5KQLA 4CMBA 1QTIA 1HM5A 3GFJA 4PHFA 3DUWA 2H7YA 5D86A 2EA4A 1H89A 4OEHA 4Y9UA 1K78A 2VRNA 3AVOA 2YV4A 3E97A 4PRLA 4TGLA 1HSOA 1Z2OX 4E94A 5L3RA 1A8PA 3VBEA 1SZDA 4LGYA 1CR2A 2BFWA 4AMVA 3O2PE 1SG6A 1YOVA 1EDOA 5FJJA 1M7GA 5DDGA 5FBKA 3ZVLA 4HPXB 3S2YA 2HZDA 5LP6C 5DNCA 3JAWB 1XJWA 3DM9B 4CIBA 3MJDA 1NIJA 1FDWA 4REOA 1I27A 2WNSA 2AX4A 4ZCSA 2KMUA 1YQXA 3SQXA 3WGLA 3HFJA 2X5JO 4CNBA 2QVXX 1RY3A 4IOKA 5BWMA 3AM3A 4JLJA 1VQ7I 1U2RA 1ZJ5A 1J00A 1WWKA 5M04A 3KQNA 2VPIA 2KIFA 2W00A 3R7BA 2ZIAA 3I9MA 4Y0AA 3WKAA 4CG2A 1M2FA 1SAYA 4G5HA 2O2YA 4ACAA 2XI4A 4J0QA 4ESFA 4OCZA 4C14A 2OY0A 3FTPA 1BW6A 2JJ8A 1I94B 3FMGA 1R1VA 2GAJA 2X9DA 3WGHA 2PMFA 3WKEA 4G07A 2YN4A 2WYVA 2X76A 1NVOA 3V4ZA 3WLJA 1AU9A 1QQTA 3ZQIA 5K2MA 3K96A 3SHVA 1IM2A 1ETWA 4TKVB 3KXIA 1H1TA 2Q3DA 1PFYA 4TRNA 1KJZA 4IG9A 1X86B 4RTNA 4N78E 3OKFA 2IDBA 1U7PA 3VR2D 1QBJA 1UBGA 3WK4A 3S1LA 3H2JA 3OCXA 1NW9B 1O95D 5B7GA 1L4KA 4JVNA 3WK5A 2HFKA 3U4CA 4CW7A 5KNDA 4PZUA 1RF1C 1FRFS 4KVFA 4RCVA 2IBDA 4DLZA 4RGYA 1UMBB 4DNQA 3CCFA 1EDKA 1RZRA 2QE7H 1MABA 1UPAA 2HLDD 4BMYA 3HUGA 2ECOA 4JK1X 2A6HF 1ECBA 3BULA 4QEDA 1ZINA 4XA8A 3HLTA 1O77A 5FH9A 1YL7A 1ZH2A 4KAJA 3OAAD 4Q66C 4FLFA 2DTEA 2OCCH 4UU1A 1O96B 2R00A 3PA6A 2H08A 4BWNA 2PO7A 1QVZA 5EPOA 4PCVA 4QATA 4Y30A 1FUIA 3HOUJ 4IZZA 4DNXA 5A3VA 2PLYA 1J8QA 4QFMA 3MLAA 3RVQA 2D13A 4TLLB 2MH2A 4EVIA 3COPA 1QIMA 5KBYA 1UP7A 2CBXA 3Q2YA 1X8KA 3ETJA 3KYIB 1K4TA 3GK3A 1GZHB 2X23A 1KOJA 4Q7LA 1JE1A 1TLTA 2HMTA 4UXNA 3I4FA 3OEED 3ASUA 1KI2A 2AD1A 3QKSA 1NI5A 3WL6A 3SIRA 2O5CA 5CDUA 4KQJA 4CQJA 1QZUA 1QPZA 3ZDFA 4WXHA 2NSDA 1IFNA 2PZGA 3RASA 1CBUA 4EX6A 1FP4B 3QENA 4M0DA 2PLNA 4PLFA 3UXHA 1ILWA 3CZMA 4UVDA 2OL4A 5HKKA 1E98A 1QK4A 2GH1A 3HOYJ 3ITEA 5IKEA 4F3KA 2YUSA 5KVRA 1G3IA 1M1NA 3ZQLA 2XDQA 2VZLA 3R8XA 2AK3A 3A6ZA 4MTLA 4ZO4A 3PUBA 3W6JB 2IXDA 4NU0A 2OLJA 1ONPA 5A2GA 3KVVA 2DKOA 5CXQA 2HU9A 3KFLA 3M3DA 1T0UA 2V0GA 3AF6A 1A0OA 1D6MA 1E99A 2NQ8A 2R5YA 4HDMA 4XKCA 1S7GA 2ZJAA 4HL6A 1KEUA 1NUPA 2B8EA 4LG1A 3ADBA 2XNDA 4IV0A 3OEHA 1I1QB 3QU5A 4NMWA 4BNXA 2YV2A 4IFTA 1LRKA 2HK9A 3F6RA 4E7KA 3HGMA 3KCNA 2BRUC 1ZIYA 5AW2B 3OS2A 4MWBA 3ZIAA 2IYSA 4M0UA 2RKWA 3C5WP 1TJYA 4C2TA 2ZAMA 2HXOA 5TT1A 4XQGA 5JATA 4U8GA 4QLCU 3E3NA 4MVXA 4GC5A 4O08A 2D2WA 2LZ0A 1M1YA 4BNZA 1JVBA 4A16A 4LSZA 5LHHA 4FJ0A 1GR0A 4KUHA 4CTMA 4JFAA 1IATA 2VDWA 2VJNA 2PZEA 1M2EA 4BASA 9LDBA 2FWRA 4BZQA 3FXDA 3E6BA 3RUFA 4C2BA 1QGYA 2VP5A 2K9MA 5K0EA 4KIWA 4BEHA 2R7ZJ 2Z2YA 4DABA 3EXFB 2E5YA 3CE6A 1TECE 1VG1A 1W25A 4NYJQ 1B9MA 2J0VA 1QMGA 4Q4DA 1P74A 2VB6A 3L70G 3PQ6A 2BY0A 1N5IA 3K2EA 2P6PA 2WSSH 3HHEA 2CCKA 4K35A 5A2QA 1LB2A 3NEYA 1CR0A 1QTNA 5E18F 3G9XA 2QRPA 3ICPA 3OKAA 1SUEA 3QW4B 2Z5IA 5HNKA 3DKWA 4PFOA 4BMOB 2FLKA 1Z56A 8OHMA 3HK2A 3FGNA 4CXFA 3O93A 8LDHA 2KT0A 4MRPA 2NAZA 4G1FA 4RS8A 2IWHA 1H9GA 3DWFA 1RC1A 2XLCA 1H2BA 2QB5A 1GV5A 4RDXA 3SSNA 4LRQA 2GF0A 1H9TA 5JO9A 4LNUB 3M1YA 3TJRA 5IUKC 2XB9A 4QPDA 1M0SA 2QI9C 1FAVA 2X15A 4FDUA 1N92A 3OX2A 2B99A 2VUUA 5EGOA 3F49S 1U7JA 4UOZA 3HE3A 1X7WB 2TMDA 2I66A 3MMPA 3P9IA 3O9MA 1BS2A 2TMGA 4KFTA 1O58A 1BXGA 1FOEB 4K28A 1MPTA 4Y2RA 2FMLA 5KHDA 1RAHA 5CX1A 1FJXA 1MZVA 4M7RA 1T5BA 3A7DA 4BQIA 1HQKA 4WINA 2Y9YA 4GE0A 3AEYA 1S9HA 3K09C 3IE2A 2O01N 2HJVA 3M6WA 2HF7A 5FKKA 4G0UA 1U2TA 4QL3A 3BGDA 2YRWA 4UB8H 2FFHA 1GSOA 1NK3P 2P7IA 1S5LC 5HXAA 5EVCA 2BGTA 4GQBA 2OC9A 3V2PA 1ZRHA 3I0TA 2DPHA 1KA9H 2QU7A 2Y0SA 2ZIEA 1IDZA 1JJVA 1LTJB 1TT5B 2A4MA 4QE3A 5IZ4A 4ZO7A 1MAHA 3BRQA 2QEXP 2FZCA 2VDNB 3CEJA 2ADOA 1M8JA 4PSDA 1RQNA 1LZLA 4A3CJ 4KVGA 4BRWA 2YMMA 3Q3SA 1GNSA 1DUIA 1T8UA 4TUYA 3E5NA 5I7AA 3ZK7A 3BCCD 1N8SA 3WJ7A 1RAEA 2XMSA 3UATA 2DMPA 3T9CA 2QSYA 2BFFA 1O5IA 1WXWA 3UG7A 1MMGA 4YTPC 4WX2B 2J4FA 2VUIB 2IZ0A 2VAMA 4OHVA 2SPZA 2G9RA 3MCUA 1JHQA 5CVDA 2HUPA 1BVRA 2B83A 3OICA 3QJ5A 1SOMA 3A11A 3V97A 4XYGA 4DA4A 4RENA 2QPLA 3JW8A 4FDTA 4Y1RA 2HU2A 4ICIA 3WU2C 1GL7A 1JDZA 3E48A 5F35A 4YIFA 4NXMB 5JASA 1N2HA 1MAAA 1SELA 1IAVA 1LV8A 1DIRA 4BAZA 4UTXA 1M57D 2IW5A 1Z1DA 4RY2A 3ZZNA 3E6MA 16PKA 4WK6A 4DR7B 4FYXA 4POOA 4O29A 3CC8A 1Y89A 3E4DA 1X1BA 1F20A 4B34A 5EZ6B 5JD3A 5BXYA 5KNCH 2ZXHA 2OORC 4LF9B 1I36A 4E5NA 3NBQA 3ERED 3BD9A 3FK7A 2QUAA 3I0ZA 1F1ZA 3GLGA 2JHFA 1NBIA 3ML1A 1RWVA 3U7IA 2A6TA 2PQ0A 4PFQA 2AB0A 3ED5A 2NQTA 2F5EA 4AZWA 4D8TA 2DO7A 2QA4I 3PF9A 4KMUX 4ZYZA 5EIWA 1O8BA 3SJ7A 1G66A 4AVPA 2A0KA 2JZNA 3PUJA 4O2AA 4Y4RA 4F4IA 4UE6A 1YITP 4KO4S 3W6NA 1BEEA 3P9RA 1T6NA 4TMXA 4EYSA 1NYQA 2E2HJ 3RK3C 1YNSA 3M81A 3CQ9A 3QVTA 3H1JD 2R7RA 2WSEH 3NDPA 3BWEA 1XLTA 3K70D 4BJTA 2I62A 2PVSA 1UMDB 1ZMOA 3VDMA 3JQPA 3ZI0A 4HLYA 4M0EA 1T6YA 3GVPA 2ZFWA 4AN1A 1H2ZA 3VPRA 2Q8NA 1GUUA 1GNVA 2UUAB 2PWZA 4EITA 4MEYF 3PD0A 1MOPA 2XMDA 2I5PO 1EHCA 4ZI5A 2EWVA 3IH5A 3INNA 1Y63A 5A7HA 4LKOA 3B8EA 3NGXA 4BJHB 4UUOA 5HE8A 1BDCA 4WBNA 1NUTA 1PSZA 3OZXA 1QQAA 1ZHOA 2L69A 2P6MA 4LQDA 3HCEA 3GR6A 1KYOI 1X94A 1X38A 3PWSA 1L7OA 1IC6A 1KS9A 2ZE6A 4P4LA 1E7YA 1YFHA 2Q8KA 2G9WA 1XJ0A 3CLRC 3MRVA 2M34A 2PGAA 4P5OA 2Q6QA 4MUGA 5EJFA 2PKRA 1D4FA 4KVAA 3LX5A 3K2AA 4OMYA 4PPGA 2J3IA 5KJ6A 5EWMA 4XPIA 2X6YA 1Z16A 3OQ6A 1ODLA 2O19A 3DLPX 3WDMA 3UNXA 3ETLA 5E3OA 2FUEA 3FPAA 4PR3A 2QZZA 3EJ6A 2O0KA 1T6XA 4UTPA 4LZNA 2J9XB 2B92A 2GNAA 1F6DA 1M34A 2ACWA 5SY9A 3L79A 4C7BA 1A9SA 1KK2A 4C4PA 1QZTA 2ZT6A 3V5BA 3J80K 1UDWA 2VHWA 1KH1A 4PZJA 4X0EA 2WINI 1FT9A 3CJRB 3ENQA 2GDJA 3UENA 4BJ5A 4J0HA 4QXQA 4FKBA 4FX4A 1IOWA 5H2FE 2WU4A 1X42A 1MMSA 1KYOH 4F8YA 3T15A 3A4CA 4C87A 1SQ0A 1YKSA 2XVCA 4YJFA 1SS1A 1YHQP 3OOUA 2XMQA 4B4VA 4FKMA 1L5WA 1QS0B 1YW9A 1GGFA 5KYGA 1WIWA 2BSQA 2PUGA 2A59A 2EJVA 4YCLA 2QUKA 4LZWA 1LPOA 4ASUD 1IDOA 2YXLA 2P0WA 1YDHA 4X6LA 2UYHA 4I0AA 1N2ZA 2ZJFA 3RTRA 3DCJA 1OFGA 3AU9A 1FNDA 1J2YA 4G9EA 2XVXA 3IBYA 2PKQP 2ZWIA 4WK2B 5BYBA 4AJEA 2ZJ8A 1MJBA 4HX4A 3E53A 4HPQA 1J5XA 1SBIA 3IMFA 4BQRA 4LK1F 3VO9A 4HKZH 1G21B 4KODA 3W5AA 2WAYA 3USCS 4XIGS 3EWKA 4B84A 4AS1A 3HD7C 3UKJA 4LBZA 1GY8A 2IGBA 1EDLA 5B58T 3IV7A 3L84A 2BI4A 4WDRA 1XZHA 5BWBA 3MHTA 1MPXA 3QKIA 3ZXUB 2VYVA 4HEA1 4DM7A 2CO5A 3HSSA 2BV3A 2IS2A 3DDOA 1VXOA 4XE5A 3V8KA 3IVXA 3PXEA 5HJ2A 4CM1A 2G77B 1OX4B 1WVGA 3KQWA 4CM5A 4KFCA 1F5SA 3ZU4A 1FDOA 2C2BA 3BROA 3MTGA 3H32B 2CUTA 4UFNA 2QD4A 3FOEC 4IDQA 3RABA 5C1PA 2P5LC 1PR1A 3I39X 3QMVA 1Z13A 4Q3EA 1II0A 1CW2B 2HQAA 2ZTVA 2XTMA 4P81A 1PK8A 3GZTB 3ZY2A 4EVQA 3TPCA 1CY4A 1WB6A 3CN7A 4LFAB 4H13D 1Q0UA 1MTZA 3S5UA 1CEXA 1QVWA 2DT7B 3NEAA 1Q3TA 2HOTA 3IPYA 4N9WA 2HJSA 2DC1A 4RK6A 4NH0A 3IT2A 5K0NA 2PS0A 3PI7A 1A9RA 3D8UA 5JBIA 2UZ3A 4HTAA 1Q21A 1PL6A 2C54A 2D3TA 4I4TA 4P3XA 1ABFA 5LLTA 4FIZA 2Q49A 4LOLA 2O2EA 4EHHA 1IE3A 3FJOA 1X2MA 4HCJA 4Q5SF 1HURA 3OESA 2YW9A 1PJ2A 5KX5F 1LPAB 4BUPA 1TP4A 4K2HA 4KNVA 1WFXA 3Q3VA 4CF5A 1K83J 3ZS8A 3GT4A 3NHUA 1YJ8A 1W36B 2V6BA 4R2HA 2VJIA 3RROA 2ZSAA 4J0FA 4XEHA 4PX5A 3KAPA 1BX1A 3Q2KA 3LAPA 3UWKA 4OLHA 1E59A 1OHHD 2W2KB 3F8CA 4QRDA 3WLNA 1WJBA 2IUTA 3H5OA 4ZCQA 2OBLA 1CYEA 1RXYA 1NVBA 3I9V1 2IUYA 3QZUA 3CCLP 2AOVA 2EFYA 4PCLA 1WY5A 3G23A 2EK5A 1RSZA 4I2OA 1Y1PA 1R3UA 4CF6A 1E92A 1P77A 1OBVA 5FBQB 1K75A 2H4HA 4QQFA 1XZEA 3RO7A 3S6JA 3WQBA 2Z5FA 2QNRA 2OCXA 2I9PA 5HIJA 3GTKJ 4RTKA 3J7AY 1X3ZB 2BGKA 2WJ4A 3O3OB 5BUZA 3F8MA 4CZ2A 5KOJB 1IMJA 2P75A 2IY7A 1U9OA 3FZQA 3A4VA 2HNBA 1BC5A 1GXSA 1OH8A 2V26A 5LC1A 2M1BA 4H7FA 1ORIA 4ENWA 1AKHB 1HL3A 5DLQC 4PJ0E 3JREA 2AFIB 3B2QA 2X2FA 4LZLA 4L5YA 1CZKA 5YASA 1AQIA 2R7MA 2IEDA 3I01M 2VA9A 2V7QH 2ZIXB 3NHYA 2IU0A 1HDXA 1M1YE 2OCAA 2ZIZA 4A0ZA 3DXXA 3I3SR 1C2TA 1YIOA 2XB2A 2RN7A 1O3YA 3U9LA 1Y8RA 4FGLA 2VA8A 4YRRA 2AG8A 2OCYC 2H1FA 1X0VA 5JAIA 3EG9B 3F8TA 3QAHA 4HGOA 1IK7A 5TQJA 1NTME 1NTKD 1ID8A 1YONA 3TOSA 5EJAA 4PYNA 2BAGA 4KCGA 2XJ4A 2R7WA 2C6YA 3ZXXA 2RK6A 1CUDA 1HTLC 3NPAA 4DBLC 1V4NA 3SIXA 2FPPA 3TMKA 2FAXA 1L4MA 1LKZA 5D5XB 5IYZB 4FYYA 2O2SA 3TE7A 1P39A 3WICA 1VDFA 3WLMA 2O03A 4LCEA 4C3IJ 3E7PA 2XGDA 3PNMA 3C3MA 2JG3A 5LZ8A 4P93A 4IEEA 2RQPA 1EFUA 4PFKA 4R4LA 2GYWA 4DUGD 4LF4B 1D2NA 4X00A 4DMHA 4RM2A 4L8WB 3FMRA 1SD6A 4OAOA 2ZLBA 3KM0A 1X9VA 1NQTA 1JHHA 3F9CA 2ZXXA 2AR9A 5TNXA 4DFDA 5IM5A 1QAQA 4FIDA 4BRUA 1FZTA 3BOSA 3E22A 4JX6A 2L9VA 3MUFA 3TXXA 3K9WA 2KLHA 3KSMA 2VAVA 3H9JA 1C1HA 4FE4A 4L18B 3MRXA 4LQLA 3PFIA 1QIDA 3AKCA 3O6BB 2WMOB 5NLLA 3C39A 1EWTA 3RFCA 3CUYA 2XTAA 1EVKA 4UUBA 5JCJA 1KMHB 5D5VB 2YXBA 5CT9A 1T1EA 1KO7A 4QBHA 1N2DC 2JO1A 1RACA 4Z6YA 1U2GC 4MR7A 1YS2X 1QL2A 5AIPA 3HR4A 3O8BA 3VTFA 5JROA 3K9NA 5LJIA 3SF8A 3BJMA 1V3FA 1J75A 1VQ9P 3O95A 3P7NA 1VLJA 4ZZ2A 2JH3A 3IO5A 3FSGA 3E8MA 4X9XA 3CESA 1GCOA 5C32A 3AR5A 2EB7A 4AO8A 2BFBA 4AKIA 2YWGA 1TWCJ 2BEWB 4Q3BA 2ZDGA 3PRJA 2W71A 2FUKA 1HW2A 1BIFA 1WF6A 3EH1A 1FS0E 2GVZC 3ZCVA 2JGMA 1P0CA 2XBMA 2Q1WA 1U3UA 3K9QO 3FHLA 4DQ2A 4NNJA 2VP4A 2G63A 1Y1WJ 3MKLA 3STHA 3CVYA 1KHHA 1R1TA 2V59A 3ONDA 2GXAA 3H6GA 3FF4A 1P2VA 5K5OA 1DEKA 4GM4A 3JQRA 2HZBA 4MHOA 4IYJA 1CZLA 1GR1A 1JEOA 1GU1A 3GLQA 1Z34A 1OX3A 4XIFA 1NZFA 4GR9A 4EK9A 3BH0A 1U1GA 5T6MA 1JE8A 1SUFA 1QKKA 4F5EA 3N8NA 3BZWA 3WYGA 1ANKA 4F71A 4JJFA 2A9VA 5TX7A 3JASB 4XVQA 3FFXA 3LW8A 5F1YA 2IXSA 4KPFC 4DHWA 4Y1GA 4D97A 2I55A 3NTQA 3MJ4A 3EVDA 1AO3A 3EETA 5GOZA 3WK7A 3HBJA 5IX8A 3A4MA 3AEKB 3SZGA 1ZSNA 2WTXA 4IUCS 2HGCA 5DD8A 4BL5A 4U7GA 1QGED 1E3LA 2O8BB 1NGSA 4OB6A 2ZZNA 3BKWA 3M91A 2HCRA 2QRXA 2DKFA 1SHLA 3O5AA 3HU1A 5AOAA 4CCWA 1UC4B 1NN5A 3HVJA 4HH3C 3H83A 5E8RA 1YJWI 4GHWA 2DBZA 3DKVA 4I5DA 1WKBA 2BN4A 3F8FA 5LQKA 3DE6X 4C4OA 1UPCA 4YG2F 4NFSA 3TCNA 5EJCA 4CCKA 1G38A 5IZCC 1A69A 4ZGGA 2A7XA 4XM3A 4DV3B 2WV0A 3L73E 4G7OF 2JRLA 2FUG6 1Y80A 1ZJZA 1J9EA 2WWIA 2UYOA 5I7SA 5AI8A 2GJKA 3UFXA 2JFBA 3PHHA 1R5OA 3DZFA 4ENMA 4LC9A 2Y1GA 3SS7X 4I0BA 2ZZMA 4P96A 2CEKA 1MO2A 3HPQA 3TD6A 1RM4A 1DFGA 3FTQA 3TIFA 3QUSA 4CCLA 3N05A 1LNWA 3FNBA 4UOEA 1AKYA 5FLEX 4J01A 3GVAA 2RN0A 4C5BA 5FI1B 4EB0A 4IQ8A 4JBYA 2J87A 2DF8A 4B2YA 3PQ8A 4Y52J 1LDYA 4JMLA 3E0XA 1DU4A 1NR1A 3TGUD 5AONA 3SZ3A 3BX1A 1BO6A 2WLSA 2WTMA 3U61B 3EFFK 5CVEA 3KELA 4O4HA 2JDIH 3HWSA 2KBFA 3GVIA 4NC6A 2Y1DA 3PB3A 1SVUA 3P9PA 3MJCA 3AHDA 1PV1A 1U5AA 3QLUA 1JHXA 5IHPA 1NHGA 5EJEA 1YR6A 1BXKA 3E9QA 4FQGA 4LHVA 3WRWA 5J1TB 1QVTA 2FOXA 3AF3A 4G6TB 2IYAA 4QOEA 4DRXB 1K05A 1U11A 1E9EA 4FBLA 3IQHX 1POWA 1C2YA 1SG9A 1A7JA 3IF4A 2A45H 3HR7A 4RPGA 3IDOA 3KUDA 4ISBA 2JZOA 1OBFO 2ADMA 4JLSA 3HGQA 4TYYA 1PTJA 5LU8A 1NTMJ 3ELUA 3UVEA 2DI3A 3EODA 1U1FA 1G8PA 3AL3A 1TJNA 2Z33A 1EFRA 2LMDA 4B8ZA 2R5NA 4ASVA 4TYNA 1U2SA 2W48A 3VMYA 3SFZA 1LT9A 1TKBA 2FWBA 2H54A 2XZDA 3K0LA 1KU0A 2WI8A 2L19A 3DMNA 3OQIB 5B4VA 3CO5A 2VXBA 3KQVA 1MORA 2GXQA 1BHO1 3TW8A 5A9RA 3KHSA 1TGYA 2QJPC 2GESA 5K7SA 5J1RA 4ZEXA 2OXEA 3D4NA 2A33A 4IHTA 3ZE0B 3SR0A 2J8ZA 2IYTA 1C0KA 1SXHA 2EQ5A 2PI0A 4FS3A 1IG7A 4JQOA 5IK2A 3NYWA 4KQCA 2HU7A 3FWNA 4EG4A 5CVVA 2F59A 2PEXA 3HYCA 1OX5A 2BCJQ 3H9CA 1NLUA 3QPWA 4YCBA 2NOAA 5CLQA 4G5SA 4V0OA 4PV1B 1O95C 2YZ2A 2WPQA 2Y69H 1I9CA 4H0LB 3CWBE 4XFJA 2R93J 2FPSA 1XE3A 4GL2A 1SQ6A 4TS1A 3JRCA 1OAOC 2L2QA 5LYJF 3L4SO 5FOSA 1Z4JA 4WAUA 4P2GA 1GQYA 4WF2A 1FTZA 2LKCA 3WLLA 1Q5PA 4RVGA 4Q3AA 2FEZA 1K88A 4ZP1A 5C9ZA 1EVYA 3VNUA 1MFPA 3CVJA 3UAGA 3MTUE 3JD0A 5L4LA 1VE7A 4FDVA 5IXSA 4R8SA 4DRYA 2GXBA 2AQHA 2QUZA 3L8FA 4J2HA 1HKHA 3K6KA 1CSBA 1NU1D 3M7GA 3KT6A 1D6NA 2CNWD 3V8LA 2CXNA 2MMGA 4C20A 1A36A 2YH2A 5DNWA 4KH0A 1K08A 1Z5UA 1Q1QA 3ZHQA 4ON9A 3A6FA 2NYRA 3NBYC 1ZOLA 4GOJA 3NTUA 5JBQA 1JJ7A 1MB9A 5FCDA 3G1TA 3GCXA 1NASA 4FOOA 1Q90D 4E6EA 4EZEA 4IH9A 4FYKA 4IRHA 1RR6A 1A50B 1CPYA 2ZTMA 3JVIA 2FWAA 4R3NA 4X62B 2UZAA 2KNCB 4DJFC 3DONA 1RIIA 5DUIA 4N9QA 3A4LA 3KV1A 4UEKA 3GGOA 2IBZD 4LLHA 4BO9A 1PP9G 3P7KA 4QUKA 4DLUA 4DSZA 3JD2A 4AIJA 5LQAA 3IQDB 1DPUA 1EP1B 4KWCA 1Y8AA 1JRLA 1QV9A 2W6IA 3FVWA 1VSBA 3VHXA 4AUNA 1CUSA 2G7ZA 1QYIA 4XN0A 1B8IB 4G0WA 4P7GA 2FSVA 3HRSA 4IS2A 3BL6A 3LUFA 4ZFNA 1FZFA 1NSTA 3WWOA 3PL5A 2UVPA 2PH5A 4YPFA 1GGNA 3U4AA 1M7LA 1X14A 3WFZA 5J3LA 3WVNA 2Y27A 1S1MA 3R23A 1IZ1A 4E4YA 4HLQB 2J7KA 2WZQA 4DKXA 1UMCB 2FRDC 2QIPA 1XAGA 4ZMBA 4RUKA 5EXEA 1XPJA 3OY2A 2HIMA 3RT1A 2H4WA 3ZZUA 1NY5A 4MS1B 5IN5A 2VPRA 1ISRA 4FYHA 4B6FA 1GL9B 3HCFA 4PZPA 1K4YA 2ME0A 1Z0IA 2RJNA 3WNQA 2Y1CA 2N0SA 5FUYA 2JW5A 2N1TC 1AKVA 3L73J 3J80A 5HGXA 1M6VA 5DM6F 3IUPA 1JDTA 3G8CA 2F00A 5H4HA 3VN0A 4HVAA 5FJ8J 4EX7A 4JC0A 4QDKA 2NN3C 4LOJA 5K0JA 3TOAA 3N6VA 2CNLA 4BKXA 2MABA 3F5SA 3RF6A 1L1FA 4ZGWA 4Y2SA 1YA6A 4PO1A 5K0SA 3GVXA 3MGAA 3RB8A 2RGAA 5KYWA 5LOVA 1X1PA 1GL2B 1KWGA 5CDTA 3AQIA 2JK3A 4N0BA 1LBTA 3ORQA 3UH1A 3RAFC 3T3DA 3GUCA 4JODA 1QNFA 3LCRA 2E6UX 2O07A 1DC6A 1H8AA 3VU9A 4H7IA 4EY4A 1XX5A 2X13A 3WAKA 2ZRFA 3T1HB 1E8DA 2QDKA 2IOYA 4CCYB 2YKPA 1RRCA 3GJ3A 4Y2JA 3EZ7A 4BO2A 2X9VA 3ODPA 3U1CA 3L3BA 3ZGXA 1NC1A 2I87A 3OV8A 3RE1A 4LBWA 3ZJYA 2G5GX 4HNUA 1R5NA 4IICA 4UDXX 1W49A 2I0FA 4BKUA 1P4XA 2HO5A 3MPUA 3D5EA 1MVLA 1I9GA 2Z5UA 3TLGA 3PIIA 1ZUNA 3EC7A 3H9UA 4WRRA 3UBTA 5KAIE 1NF8A 4JI8B 3LWFA 3FMPB 2XGOA 4GDMA 1JT0A 2R6HA 2ZBPA 4ENVA 5BRNA 1JB9A 4FFMA 1MB4A 1AV7A 4X66B 2CW0F 3AUUA 4CMKA 4PFPA 1LDJA 1K4SA 1JEYB 1AQ5A 5BVGA 2ZIFA 1E9VA 1FE8A 5EHGA 3C6XA 4PHTA 1W76A 4OHWA 4YT4A 2IYLD 2I7TA 1R00A 3P8CE 1XMQB 5BYJA 1JN0A 2MSDB 1D1PA 3HB7A 2PSEA 3QYJA 4FOPA 4I1VA 2XOKD 3STYA 3DFIA 3PFCA 1CERA 2ILVA 3F1KA 4K6KA 1M72A 1ICEA 4IZHA 2VT6A 4BWGA 1G7TA 2XPCA 2KM1A 1DWOA 2W24A 4ETNA 3OIOA 5IN4A 4N40A 4WUTA 1XDZA 1AGXA 5DT9A 5GTIH 4BFTA 3M49A 2Y92A 2R6GA 1HG0A 2D1VA 1JE0A 3G9QA 2ZBVA 3LSGA 1GOTA 2IHZA 5MF6A 1P6XA 1M66A 4E2FA 2PR2A 4NPEA 2PN6A 5JD5A 3WU0A 2NZWA 2AOXA 2OHGA 5B6IA 1PZQA 1Q1VA 4M2LA 3TL6A 1P44A 1XD2A 2FDCA 1JIXA 3U4DA 4CMJA 5HKAA 3KJFA 4CSWA 2V6MA 4GGOA 3TSAA 1Y4UA 3HB5X 1V6SA 3L7OA 1Z62A 1H4VB 5JJKA 4PPQA 1VMKA 4R8LA 2X8JB 3NP9A 5CCHA 4POAA 1MIOB 4K03A 3GNTA 2YBDA 1KDVA 1VLLA 1IG0A 3CWBJ 5LPNA 2IJGX 3R20A 3RLIA 2M5AA 4WKBA 4A3KJ 2UZ0A 4AROA 2ZBGA 4M8KA 2IZ1A 4HDSA 3CR3C 4MW5A 2YMQA 1AHHA 2QX9A 1D5YA 4RHCA 3AEUA 4L8LA 5EZGA 3M6LA 1CVIA 3IKJA 3EIXA 1NATA 1XG5A 3V5NA 5JAUA 2K3PA 1YI2P 1J8VA 1D1CA 4XLTA 1E1DA 3EXHA 2LKXA 3BZUA 3ST7A 4QYIA 1MBFA 5KDLA 1QO7A 5EA2A 4JP3A 3DW1X 2KDZA 4HJRA 4G0YA 3S99A 2I3ZA 1OQYA 3I83A 1C3OA 2HWYA 3GT0A 5AK4A 4IG4A 4L85A 1RXUA 1GZVA 4UUSB 3KQLA 3K1JA 5AW0B 4HN9A 1H0MA 2QE7A 3QELB 4L8VA 5J2UB 3UXMA 3HUSC 5FB2A 4HDKB 2XRMA 2HDNB 2RQQA 1NG9A 1R4NA 1YVUA 4ALMA 2P58A 2XMPA 3M9BA 3TX2A 2AWOA 2A1IA 3R0JA 3JQEA 1RE1A 3PRKE 4YCAA 3BXEA 1ACLA 3U17A 5AQ1A 5JNLA 4QT0A 1E4VA 4D3YA 4K3VA 4D8XA 5K0BA 1KN7A 3OPXA 4I50A 1SBHA 1DTSA 1CY8A 3BJ6A 3ZZ1A 3VNAA 4CVNA 1OTHA 3N2EA 2W83C 3M70A 5CCEA 3V4PB 4BRYB 4X44A 2J09A 3HDQA 3E3VA 1BKDR 4CG0A 3R6GA 1NG1A 4TWAA 4Q00A 4UUQA 2WWRA 2BIFA 2X5XA 1MH4A 2F4OB 1QRAA 4L9WA 3AETB 2I3GA 1AKRA 1IZ9A 3I09A 2X19A 1D4AA 1TCBA 3KD2A 1U7HA 1HQCA 4XDGA 3H4MA 1IWPB 2YOFA 3O0DA 4PE5B 1GD2E 3OA7A 4NX2A 1ZONA 4MZXA 1TADA 4QPCA 3MT8A 4ZT3A 1EFVB 1VB3A 3D3NA 2JQ7A 4L3WA 2IPPA 1GPAA 4CE6A 3FJYA 1SQPG 1J5EB 1KEZA 4OLFA 3C1UA 4Y7DA 5IDYA 4WXMA 5LGNA 1C9JA 2NZYA 3ND5A 2HPCB 4GPD1 4X7MA 4Y18A 4YJKA 2J33A 3LSYA 5KWVA 3ZEAA 1YVRA 1SBNE 3FX2A 3HBNA 1VCHA 1F1BA 1Q7YQ 1CP2A 1FOKA 1DAOA 2XWBF 3FX3A 4ZYAA 1G291 3M8KA 2LD4A 4O63O 3PJFA 1H05A 5HS6A 2O54A