1GDTA

Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords SITE I OF RES DNA
publication title Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gdtA03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gdtA02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gdtA01
4RBOA 5M3MJ 1OJLA 4M3BA 2R92J 1U9NA 3S16J 4M3FA 2DMNA 2X6OA 1WH7A 2LY9A 1B8IB 4QSHA 4A3LJ 2VI6A 4BXXJ 2JN6A 4Y52J 2LLKA 1VNDA 5IYDJ 3BTIA 3GBGA 1XS9A 3LHFA 2WB1N 1MBKA 1A5JA 1JTXA 2JA6J 2ID3A 5JLWA 4I76A 3HOUJ 3ILXA 4QTRA 4NDLA 4DYQA 1Z77A 2ECBA 2MSYA 1RESA 3HGYA 3F0CA 1AKHA 2O7OA 1ETYA 1LE8B 1JJ8C 3PKZA 4AYBN 1QVUA 3ZQGA 2XGEA 1HX7A 4JP0A 1HDPA 3IH3A 1FTTA 2L7FP 2EZHA 5FKNA 1GUUA 5F04A 3RKQA 1K61A 4XIDA 3TW6A 4BY1J 1PUFA 2YUSA 4FISA 3FIWA 3HDDA 1Y1WJ 5F08A 3HOYJ 1RETA 1NTCA 2E1OA 3O8GA 5IP6A 2O9LA 3FISA 5IPAA 4MFDA 4S0HB 4BKXA 4FCYA 3HM5A 2WV1A 2DMUA 2XRLA 5FKKA 3ZQIA 2FX0A 5M3FJ 2N8GA 3RQIA 3Q0UA 3IV5A 3HKZN 4MLOA 5J3LA 3RZOJ 1BL0A 5EYRA 1A6IA 2DN0A 4A3KJ 5EG0A 4CYCA 3SDGA 1B72A 2NS7A 1RPWA 2IAIA 2HYJA 5EZHA 4A3FJ 3MVPA 3VPRA 4XRSG 3M4OJ 2TCTA 9ANTA 2DMTA 1AU7A 4C3JJ 2YS9A 3S1RJ 5EZGA 5M5WJ 3UKGA 2JA7J 2RAEA 2E2IJ 3G13A 2CQQA 3GTQJ 4Y7NJ 2B63J 1IC8A 3HBLA 5EDNA 1MSFC 2AO9A 1ETQA 3CCYA 1ETKA 1MBFA 2JA5J 4A3BJ 5F0HA 2R5ZB 1G2HA 2XB5A 2HXOA 1EF4A 4C3IJ 5FLMJ 3W6VA 1FJLA 2JMWA 3WHCA 2M34A 3A02A 1T56A 2AHQA 2NVXJ 1BA5A 3JRDA 2DA5A 2Y9YA 5GP9A 1GHTA 2XB0X 1CQTA 1P7IA 4A93J 1RKTA 2O8KA 4W97A 1ZQ3P 5EGOB 5C4JJ 4D5FA 1X58A 2NS8A 2GBYA 4GFBA 2X9DA 4JX6A 4XRMA 3GTPJ 1JKQC 2DA3A 4LOCA 2H8RA 2LKXA 5M5YJ 3JR9A 4FTHA 4AUXA 3ZQFA 1W0UA 3E7LA 2LK2A 5F27A 4DYRA 2COBA 1IDYA 1UMQA 1F36A 3PO3J 5FKOA 2HQ5A 1JGGA 2EZKA 2G0EA 2L9RA 5J1RA 2FD5A 3TP0A 3S2DJ 2IEKA 4MO7A 1FIAA 1AKHB 4MIMA 1IDZA 4MFEA 3O8HA 4BBSJ 3RZDJ 1ITYA 3CMYA 3NARA 1GV5A 1POGA 3IH4A 2VPRA 4UUSB 2Y2ZA 5C32A 5IOZA 3JRCA 4IHVA 4RDUA 3BTJA 4M6VA 1FTZA 2JK3A 2WAQN 3K2AA 3S1NJ 3LSGA 1LFUP 1JJ6C 1SANA 2NVQJ 3BR1A 3QPSA 1PUFB 3A01B 3TEDA 5K7FA 3HOXJ 1FIPA 5FKLA 2E2JJ 1RKWA 5IP7J 1T33A 2DJNA 4ABZA 3BQZA 1K83J 2MW8A 3BR5A 1AHDP 2EQRA 2K9SA 3LSJA 2E19A 2CJJA 4C2MJ 3UJ3X 3C2BA 4JYKA 1WCMJ 3HB9A 1ETWA 2KDZA 1I3QJ 5J1UA 1Q1VA 1ENHA 3BR0A 3FKIJ 4D5CA 2DA7A 1DU0A 2CU7A 2JA8J 4A3GJ 2XPVA 5EG0B 4CYCB 2KT0A 2R93J 3H0GJ 2LFBA 1JUPA 3LOCA 1U9OA 2FQ4A 1ETXA 2DA4A 5F0CA 4FE7A 2XPUA 2ID6A 4A3IJ 1GDTA 3GTLJ 1F43A 2XGDA 3CQZJ 1XG1A 4B4CA 3ZOBA 2L7ZA 3PM1A 1MBHA 2Y31A 3LSPA 1Z0XA 1E3OC 1P7JA 2OPTA 4C3HJ 1JUSA 3QPLA 2CUEA 3ZQLA 2HOSA 3WHBA 2R5YB 1YRNA 4BBRJ 2LTPA 5FKMA 2DA6A 5F1JA 3ZQHA 3L1PA 1OCPA 3BR3A 2LD5A 2QCOA 4X6AJ 1IRZA 4X1EA 4QIWN 2OF7A 2CUFA 2DMQA 2I10A 3CDLA 1ORKA 3BG3A 1TWCJ 4B3AA 3Q3SA 2R7ZJ 2CQXA 4IHWA 1ZR2A 1ZR4A 4IEJA 1MH3A 1S7EA 3SJMA 1JT6A 2XSDC 1IG7A 3SFIA 2W48A 1ZKGA 4V2GA 1W0TA 1U78A 1TWHJ 2X48A 4IHXA 4JX5A 5IYCJ 3S1MJ 1HCRA 3GTJJ 4DW6A 4BQQA 1JTYA 4L5EA 2MHCA 5EEAA 3HOZJ 1TWAJ 2NVTJ 3A03A 2Y0SN 2XGCA 1O4XA 2K9QA 1BJZA 3BTCA 4BY7J 4D7MA 5GPCA 3S15J 1ETVA 1SFOJ 5E3MA 3PO2J 2DA2A 2K9NA 3Q0WA 1HLVA 3BG9A 1HOMA 4A3CJ 4JX4A 3DCFA 2MG4A 3S2HJ 4M3DA 1X2NA 2HI3A 4I6ZA 2MGQA 5C4XJ 1BW5A 5F0FA 4A3EJ 1D5YA 5EGOA 3G1OA 5FJ8J 5K7ZA 2M2EA 3OSFA 5E3NA 5IP9J 2GM4A 1ZK8A 2ELKA 2LR8A 5C34B 3ZQCA 1H88C 2ECCA 1IGNA 3GTGJ 1U8BA 4AC0A 3FK6A 5GPAA 5DTDA 4J19A 1WH5A 3BG5A 2JJ7A 2NOGA 1NK2P 3HGGA 4B1RA 3QQAA 4EEFG 1X2MA 1ETOA 2VKVA 2QF7A 4DZPA 3S14J 1B8IA 4G12A 3GUVA 2HOAA 1XC5A 2NVYJ 3K7AJ 3Q0VA 3S17J 1OCTC 2L0KA 3BR6A 3I4NJ 3OOUA 3BTLA 1WGXA 2P81A 2Y9ZA 3HOVJ 5DS9A 3I4MJ 3LHKA 3FK7A 5C35A 1VFCA 3DEWA 1TC3C 1FEXA 2EH3A 2ME0A 3OIOA 1LFBA 5JLXA 2EZIA 1MBEA 3M3YJ 1IUFA 3LSRA 4DYCA 3JRBA 4UUSA 1LE8A 2HOTA 4UUTA 1MSEC 2HDDA 1JT0A 5J1YA 2M9HA 3NAUA 2H1KA 4D7NA 2GLOA 3A01A 2ME6A 3BVPA 2M0CA 5K7HA 1B72B 3JRAA 2TRTA 5FLVA 1IV6A 4XK4A 4HNVA 2DTZA 3GTKJ 1APLC 3H3VK 1UG2A 2EBIA 1OFCX 2XPWA 3JRHA 1MBJA 1ZGWA 1I6HJ 4XRSA 1YRNB 1JKRC 3G1MA 4A3JJ 1GVDA 1H89C 2M8GX 1R9TJ 3MN2A 5HODA 1MBGA 1I50J 3MKLA 1QPIA 2LVSA 1GV2A 1QRYA 5EF6A 3JRIA 2EZLA 1QVTA 2LP0A 2JWTA 3BQYA 2CRGA 4A3MJ 1H8AC 3OSGA 3TP3A 2HXIA 1IJWC 1DU6A 3HEFA 3JRGA 4M3EA 4DZJA 2IBDA 3D1NI 2RSLA 2VUMJ 3B6CA 1UHSA 2VKEA 3IH2A 5M5XJ 1RR7A 1ZTRA 1GT0C 4FE4A 5IYBJ 2R0QC 3BT9A 2R5YA 1JKOC 2PMZN 5C3EJ 4W1UA 2ZB9A 4A3DJ 3HOWJ 1Y1VJ 4XICA 1JUMA 1VF9A 4V2FA 1MNMC 3B6AA 2D5VA 5E3LA 2R5ZA 3LNQA 4IHYA 5E3OA 2DA1A 1JKPC 2K40A 4M3GA 1TWGJ 3S1QJ 3GTMJ 2FJ1A 5IOYA 1HF0A 1BW6A 2YU9J 2GM5A 2Y30A 3JREA 3JRFA 3G1LA 4A69C 1MH4A 5BNGA 2DMPA 2E2HJ 5C31A 3TW7A 1WI3A 1NK3P 1WPKA 2L7MP 1HDDC 5C44J 1VI0A 3BR2A 3GTOJ 1TWFJ
chains in the Genus database with same CATH superfamily
5AXBA 1ISGA 2YH2A 3N7UA 1GJRA 3O2QB 4CT4B 1IN4A 3HNPA 2WA1A 3GFFA 5AFSA 2HA3A 4R1LA 1U8RA 3T3MB 5IJ0B 8AT1A 5G4KA 1LTBC 3VPSA 4B84A 2QRVB 5BWNA 1C7FA 1HEYA 1AKHA 1RQ2A 2EARA 4IH4A 2I6SA 2VXYA 4MNUA 1SCBA 4ETNA 4KLNA 1DAFA 5BQ3A 2X3FA 3IUNA 1NW9B 1RMQA 4QU0A 5FBWB 2WWVD 4NCXA 7MDHA 1XRQA 4W7HA 3VKGA 2V7QA 4ZT2A 1LB2A 1VXRA 2DM6A 4IZIA 1XQXA 1FX0A 4CPGA 3W1EA 3HM9A 1OGYA 4OSPA 3UJHA 2SCUA 3Q1LA 4JD5A 4CTJA 3CG0A 3I2JA 3ASVA 2VPYA 3U4HA 5I4CA 1BSHA 1JZTA 5IAJA 5A02A 1IC6A 1EGVB 2PFXA 5LD2B 3LWDA 2CJYA 2GJ9A 5B1EA 2AN9A 1SXJE 1LSJA 1FNNA 1KP9A 3EVBA 1QP7A 1HJ0A 4LYAA 2HXOA 4R6XA 3TL6A 1WKCA 4BH9A 3VZDA 2NVXJ 1ILEA 2QP9X 1W2HA 3K5IA 1CUYA 2P3SA 1TEXA 3AJAA 4A93J 3LX8A 4IQ0A 3NI2A 5LQJA 4YFVA 2LIVA 3OOWA 1KOFA 1YS2X 3BJEA 4DSNA 1CQJA 1ENZA 2P4QA 1A2BA 5CT5A 3PQ7A 4BKMA 1XE3A 1W4AA 2H88C 4HC4A 5JZSA 1Z3YA 2COBA 3P2JA 1RF1C 4S2EA 4KZPA 4XVUA 1TL7C 2PJDA 4A1OA 1M0EA 4UAVA 2IH5A 2ZXHA 5L45A 2CHEA 3NAZA 3OI7A 3B71A 4Y7DA 4M6YA 4H44D 1YQUA 1RPAA 2KHMA 3DXZA 3T1TA 1NVKA 2R84A 3F6OA 3B52X 3VQTA 3X2EA 2J8ZA 3TEDA 1ZGJA 4RK4A 4C04A 3PUFA 4DZRA 3I55P 4EECA 1FFXA 3OUUA 5ALSA 4HPQA 3LYAA 2QQ5A 4YR7A 1TVEA 2XRNA 3Q87B 1KILB 1SVKA 2J9ZB 2XWJI 4P4SA 2OBNA 1DWPA 2J85A 3CXUA 1ZXXA 4YI3A 4ENKA 3TNDA 1P44A 1U81A 1BE0A 4LDNA 1ZW6A 3D8UA 5D7NA 3UPDA 4O59O 1AKEA 1DPRA 4G9BA 4Z9YA 1II9A 4DPLA 2AXLA 2LNDA 3MK31 3GF7A 4CN9A 1SQXK 1U8TA 1IB0A 4UNNA 2WTUA 4ZC8A 4H0LB 4B34A 4OIQF 2K4JA 3CCMP 1Z3XA 3B4SA 4J0QA 4XMYA 3RI4A 4HLUC 1UP7A 4QPQA 1K06A 1TJ5A 2QSHX 3LXXA 3WLJA 2OARA 1FMFA 4F8JA 2CHGA 2BKEA 2ONJA 5DHSA 3OLQA 4QOJA 4OQEA 5LP1A 4IJMA 4A3EJ 2NLOA 1CXZA 1TMOA 2VRBA 4Q9DA 4YJFB 4V38A 4A0RA 3JW8A 3OMWA 3FOFC 4AY4A 3H84A 2FR1A 5SYNA 3DGEC 3H2GA 2WY2D 1L9XA 5AUPB 5IJ0A 1JTVA 3GOQA 4LVOA 2CLSA 3FZEA 1TEVA 2QRVA 1QL1A 3CWBG 4RD0A 1RT9A 3MCTA 3UB4A 1Z82A 5KTKA 3H1HG 4Y2PA 3SQXA 2X6XA 3QOWA 1FRVA 3B1YA 4CUKA 3UPTA 3E5QA 2AVNA 1ZESA 2OQVA 1II0A 1Z25A 2QEQA 3ML6A 1ZGWA 1M2VB 2JA1A 2PT9A 4HGNA 3BA1A 1ZUHA 3FVRA 2FN4A 1OW7A 1PS8A 1TZCA 3AE4C 1RHQA 3HBNA 3QSGA 2QNBA 3EASA 4G0WA 1CUIA 3ND6A 4ZV7A 3BTSA 2NQTA 4CI9A 1D1TA 4POAA 1YR3A 2C0XA 1G6KA 1NE7A 3QVMA 2N75A 1NLMA 5TT0A 3TTVA 1PP9G 3O21A 2O20A 4X1KB 1RRVA 3UJ6A 2R7NA 2PR2A 4M21A 3ZE1B 1V71A 2ZYVX 3GH1A 4M6WB 4JVOA 3ZQJA 1G8KA 4Q1EA 1L0NK 4OLAA 2PWPA 3MTGA 4ED9A 4BO3A 5EEHA 1X92A 3LLUA 2QYSA 3N58A 4OGWA 3BRQA 3BCRA 4MJXA 5CB4F 4LISA 2VQFB 1S29A 4CF3A 3AHDA 4I2LC 1Q19A 4EM2A 2PRZA 2HA6A 3M6FA 4D82A 1PNVA 3C8UA 4K9RA 2LLKA 1BHSA 1EDOA 4I3FA 4DCUA 1JR2A 3K1ZA 1MBKA 5K6RA 2C94A 4Y6SA 1Z56C 3VC1A 1JA9A 4Z8XA 2VWGA 4QHYA 5GZ3A 3D3QA 1VJ0A 3PQCA 4TMKA 3ND5A 4TT3A 2YXQB 2W6ZA 3S1AB 2ZAIA 5KYTA 3RT1A 3V7CA 2RG7A 2VYFA 3PIIA 2CB0A 1YJ9P 2KB7P 1LXCA 1X1QA 1SPBS 4ABYA 1YR1A 1M2NA 5DTMA 3HJRA 4DWOA 1BE1A 2POQX 5LQAA 3H2HA 4YIFA 2JJ8A 1GSIA 5BNWA 1KILA 2BMWA 1BL0A 4WK2B 4DMCA 3O8ZA 1O5IA 3V6LA 4GKGA 1P1IA 4WXEA 2DSTA 3U1CA 3H1KD 4INOA 3LD9A 3I04M 3K3PA 4G4IA 1ZL2A 1AUOA 5FL7A 1QV7A 4TQ9A 2Y93A 4G5QA 3CO6C 3OIFA 5BRJA 4IJUA 1KBQA 4ZVVA 3DR5A 3KKMA 4PX5A 2JRLA 1ZQ3P 4Q47A 1ZSYA 4J01A 2X0KA 4HGPA 1Z9BA 4HJGH 3W5SA 1K8XB 3W3AD 1HDGO 3QNWA 1A97A 4JQ0D 3JATB 3JR9A 1P8AA 4FINA 3UCXA 2GI4A 3R3ZA 1UOPA 3CVWA 4F04A 2EX4A 1P29A 3A6PC 2E9SA 3H9CA 1JNXX 1Q44A 5CUQA 3HZRA 3ABOB 2L9RA 4QEZA 4RHYA 2X58A 1EZVG 1OPCA 4F4HA 1U0OC 1SBIA 4C7OA 3MMNA 2VXCA 1XLWA 4YJFA 3AZQA 3UTDA 3GRAA 3HNRA 4MIKA 1GITA 1N7JA 3HYLA 1FWZA 4LDRA 3R7BA 1T3GA 3MRSA 3QPBA 1KIAA 3UXYA 1IXSB 4YP6A 3WTZA 1K4MA 3THOA 3MG9A 1J42A 2VLAA 2EKBA 4XDGA 5LRSA 1K27A 4HAVA 1RI7A 4LRXA 4A5SA 4EJMA 3KXPA 2BGGA 1YTZI 1K5PA 4NP6A 1GXPA 3OU6A 2QX4A 3PIOF 2EA2A 3Q2IA 2JPDA 4IRMA 2Z8ZA 4EJ0A 4O63O 4E3ZA 3X1WA 4GE0A 4OGQB 1EZZA 3U2RA 1BVRA 4BO9A 1XMPA 2X76A 5APXA 4WK4B 1H1LB 2WWRA 4IJQA 3HOTA 4OP1A 1RRGA 3HD7C 3DTKA 4FK8A 4OHYA 1JYFA 3RSOA 2XUDA 4J1TA 3I5YA 2H8KA 4GAEA 3EZNA 1FZQA 2RH9B 1E2PA 5DLEA 4MKGA 4PSAA 1L0LD 2CUZA 2QSZA 1HCRA 2VF5X 2EX1A 2WSYB 2ZIWB 4X1KA 2WSEH 5KQLA 5JD6A 2ZJRF 5CAEB 5L40A 1EDKA 4EA8A 4M6WA 4NF2A 4CZCA 2KS1B 4KWTA 1ELOA 3IEXA 1BN7A 2CQNA 3IQDB 1TUBB 1Y3CE 2KZGA 4ZCLA 4J19A 3WB2A 5AUNB 5DNWA 4IJ6A 4C7VA 1G6OA 4ND3A 4FGZA 1O7JA 3G8AA 3HL0A 3GGDA 4H6WA 2W6MA 2WIKA 2BBWA 2Z56A 2O03A 2ZAYA 2A78A 4ZPXA 4DLWA 2BBOA 3DC7A 1QRRA 4DCSA 1B1CA 2PKRA 1W4BA 4ACAA 4IOAF 3AFIA 1YRNB 3TZKA 4PZUA 5K2MA 1S9HA 4N78D 3U3OA 3BAZA 3RYHB 4CEHA 2DFEA 3RH0A 1A71A 2IW1A 3VFDA 3R9IA 2FWAA 1XJWA 3EQZA 3UAGA 2R48A 2P68A 1YGPA 1GVNB 1PP8F 2XDAA 3TM5A 3VX3A 2J6BA 1EE2A 1NATA 3VTPC 1C7JA 4OKSA 4REMA 1UPXA 2O01N 2JLZA 4AWBA 3DFIA 3CO0S 4RCYA 3GOHA 2KSEA 2CL7X 5AVVA 1I8TA 2KS6A 2WF5A 1YAJA 1MOZA 3NG1A 3MKWB 3J81Z 5KYWB 4B6PA 2V74B 2JFZA 2OP1A 4CJXA 2CEAA 3CF5F 4KHPB 1YQGA 4RPJA 1K6YA 1IBCA 1N5MA 3JATA 4RVCA 5AJWA 3DLAA 2MDTA 4CTNA 3FAKA 2IV7A 4XA4A 2Z9OA 1O77A 2F1OA 3U1TA 5IDQA 2WZDA 1R4MA 2Z1NA 3PNPA 1BXGA 1NPDA 4I1UA 4GMXA 2V6EA 1S6LA 4YP5A 4XKVA 4H3KB 3W0LB 1NYRA 5EJGA 2ZE8A 4AYBN 3IUSA 4XLEA 1T4BA 3CONA 1FQWA 5EJCA 3BYZA 1DGQA 2EZHA 3MMZA 4B79A 4R2HA 2B7BA 3AEQB 2BCJQ 2V5VA 5F08A 2R1ZA 3B2EA 1L7RA 3MC1A 2ATIA 1NQWA 1SRRA 2IDKA 1GCOA 5SY9A 2N8GA 1X1CA 1OV6A 3ANMA 3CR8A 4EGQA 1AMUA 1KYYA 2ZTSA 3SPXA 2ZIVB 1OAAA 3PEFA 1M10A 3CNQS 5ILUA 1NQOA 1OKKA 1W9MA 4PYJA 2YVKA 1HDZA 5HZGA 4ARBA 1V8DA 1H1LA 1I1QB 2V5AA 3STWA 3L2VA 2ZXJA 5CCHD 1EJ2A 2XMSA 4I4TA 1VPVA 4S0ZA 1VDMA 5EGNA 3MT7A 3SQLA 4PBRA 3L2RA 3GCWA 1LEAA 2YJ3A 3BWGA 2CF6A 2EDCA 2R7DA 1EFTA 1B1BA 3AAFA 4XXHA 5JNRA 3AG1H 5JCOA 2FKWB 2KS1A 7YASA 4G5HA 3LM8A 5COQA 3BXGA 3S2GA 3EG5A 4MIEA 4IFEA 2Q9UA 3H1IG 4KNYA 1DLJA 2W8ZA 3I32A 3EW7A 5E7JA 3WDKA 1RKWA 3LYLA 4N7JA 5FJJA 4BCDA 3ZHOA 2Z3WA 3ORYA 1EWTA 2RMKA 1HTWA 4DLKA 1DKPA 3BMOB 4GYYA 3PDWA 4PSCA 2PIDA 1YMVA 3D5TA 5CIWA 3AXTA 4L0QA 5IVHA 5BU8B 1U6GA 5FL3A 4M9ZA 4X0EA 4UHTA 1OFIA 1Z35A 2PD3A 1YRNA 4K9LA 3WK8A 3LT5A 4XI9A 5KWVA 2X5XA 2H7YA 3RYHA 2Q50A 5B37A 1KZHA 1P7YA 4ZARA 4YXWA 3IBFA 3KXLA 4QDKA 4EG5A 3LRTA 2LV8A 2AJBA 1JV2B 1HQDA 4IHXA 5IYCJ 2GF9A 3CLQA 1ITZA 3CGWA 2H43A 4MVCA 4EKEA 4KR7A 4ASWA 1X14A 2AYXA 2P2UA 2OAGA 2FPXA 2H06A 4M38A 1QVZA 6ADHA 5TMPA 4UUBA 5FUMA 4A3CJ 3C3YA 2F8SA 2C5FA 2ZI6A 5T4EA 3FXMA 4AYBA 1HR0B 3ILYA 1K5DA 3PA8A 4NULA 3RNOA 5B1BH 1Z2OX 1XGMA 1L0LK 2IUUA 3IODA 2WFZA 3LY5A 4DGQA 2VKVA 2HFJA 2D7CA 3TX6A 5FD8A 3LC1O 5EHIA 4HV5A 4N8SA 3LSIA 2EBHX 4LHXA 4F9FA 5F7JA 4J00A 2ME0A 2VL7A 2C07A 3RSSA 2YWRA 1K9MQ 5AWFC 1BCCE 1DIOB 3ZQ7A 1MD0A 3EMVA 3UG6A 1R6RA 2BWJA 1X2EA 2JFFA 2QE7D 1YIJP 1SQ6A 1A9YA 3UJDA 3H2KA 3GF4A 5CVCA 5FWYA 2HU8A 1XTSA 3PNVA 3OYLA 4OSEA 1NVUQ 3BULA 2Z99A 2WHPA 1Z6TA 4E1BA 1DU6A 1E7SA 1EUCB 3BK1A 1KSGA 4RFVA 1NOKA 3R2PA 1EHYA 4CNQA 3E7FA 5F7XA 2VI5A 3KOMA 3REOA 4K9DA 4LUCA 3W77A 2E34A 1YRQA 5LZ5A 2EZ8A 1N7SB 3OIGA 1ZBQA 1JEAA 4KN7X 1ZIYA 3RC1A 2HPAA 1E5QA 4X6UA 4JBGA 2HKIA 4B40A 1I1SA 4CMCA 3EWIA 4WB4A 1NJ5A 2AQIA 1I10A 5CJ2A 5MN4A 2WOJA 3L73D 1QYRA 3QVTA 2PJRB 2WIAA 5IAOA 2B89A 1VL5A 3B82A 3H6KA 4PV7A 4ZRMA 1C0LA 3PF9A 1XZEA 2LOOA 1SUAA 4A8JC 2H2IA 2J5OA 2KIUA 3OYIA 2ZSEA 2L9NA 4TV7A 4C9YA 3QTTA 4EQZA 2YVUA 2Y0MA 1NX9A 3R0IA 3Q7SA 3WMGA 3GDGA 1Y39A 3FISA 1DJNA 1YWGO 3QKSB 2DBZA 2RGYA 1QE5A 1BJAA 1W46A 5JSZB 4BFZA 1L3CA 3G9RA 4MWGA 1P5JA 2ECKA 2H85A 2GA9A 4BIIA 3CC7I 4Y1GA 2QRMA 2GWHA 2HU9A 4FTWA 3RTRA 3D4PA 2E4AA 4Q9KA 2ACJA 1KJJA 3WLRA 2QAIA 2J32A 1YI1A 1W8DA 3OTGA 3MQ4A 1K79A 4Q4DA 1NAIA 4RPGA 3E15A 3QYBA 4MDYA 4QNNA 2M7BA 1SH7A 4X7BA 5I8ZA 1ADFA 4MVJF 3KWMA 1YU6A 3B5ND 1Q57A 1KEWA 3WFJA 2OZVA 1VTNC 4D79A 2Q3EA 2NTNA 3E61A 3SJZA 1UXIA 1WUTA 2F2EA 2HEGA 2NMVA 2ODPA 5IKPA 1W0UA 4RF5A 3BF7A 4FFWA 1NGMB 2HEIA 2IBZI 3GJQA 3FVQA 3KZOA 3TP0A 1CPYA 1X94A 2PA3A 2UUZA 1W5FA 1G5RA 1DINA 2FQ3A 5F98A 2HU7A 2W6JH 1ZD2P 2WA2A 1HQCA 3M06A 3LP6A 1FSSA 3GA0A 3ANLA 1G5QA 3FB4A 3NWSA 1EUDA 5I8WA 2CJJA 3KP7A 3WTSC 3TQFA 2F4IA 2I34A 1PUXA 4YUYA 5BOVA 1M2OB 3OF2A 2G17A 3PT9A 2H89C 2BEUB 5LA6A 1JR4A 3AESA 2IE0A 5IXJA 2H1IA 5APUA 2JEEA 2HMAA 5T4BA 4MHSA 4UUOA 1Z7WA 3FVTA 1FLAA 3GLGB 1JUSA 2A88A 2LTPA 3R3HA 4HQKA 1E3IA 4QIWN 2AFHB 3F1LA 4G1FA 1Q83A 3WLOA 1COWD 2QMQA 5ADHA 4ZEOA 2QJYC 1XKLA 3I1YA 1G63A 2AXTH 3N1UA 4G86A 1EUCA 5ENVA 4D43A 4G9GA 3REGA 1Z4MA 3P45A 2XTNA 5J4HA 3Q7PA 1FDUA 2GYWA 5E4JA 3FBGA 4F45A 2Z33A 2WR8A 5A2QK 1J00A 2GZAA 3KOZA 5EUBA 4JV5B 3ZGKA 3GRPA 3T1YB 4C1BA 2VXZA 3RG2A 2XBUA 2NO0A 4YMHA 3OX1A 1G17A 2CUJA 4RB2C 4FFDA 1HF9A 5KJ7D 4YAIA 1XKTA 1X7DA 5GPAA 2UUCB 4EF4A 3H1JD 3I2IA 3P52A 5FBKA 4KFUA 4EEFG 2ZIZA 1MPXA 5JVDF 2J0EA 2J9GA 1T39A 2PJRA 5AXCA 5F5LA 4H3HB 4B9EA 3DT9A 3I4MJ 1VFCA 2V7BA 3UAOA 3ACCA 3ICOA 1E66A 4RLFA 3C0KA 3JRWA 2NU8A 3K4LA 1XMJA 4FB5A 1A5AB 4MQMA 4M37A 3ETHA 3T9EA 4GMGA 2J3JA 2JS7A 4AF7A 1RIOH 1LWOA 1NW8A 1NTZE 2H5IA 3GLIB 3NEAA 2YIDA 1FMVA 4NMMA 3QKSA 2H6CA 3DB1A 5CU7A 4NJMB 1OXUA 3NOVA 2RJNA 1U4SA 1NZDA 3CH7A 2JLSA 3JQGB 2IF0A 5JSZA 4FNGA 1KVRA 1YVUA 3WBKA 5LM3A 4PAMA 2R7XA 2R47A 2QJKC 1LDYA 2Q5JA 3V4GA 3T99A 1B0ZA 3DNFA 1DKUA 4LOLA 1LKZA 3L70G 1PIXA 2ONZA 2VHYA 1FA9A 1TVKB 3GELA 5AW4A 3UT0A 4UE3S 4BDZA 2WSBA 1RQRA 3WLNA 1U11A 4RPHA 2IU6A 2WHXA 5E4TA 3KYJB 1HTLC 4QWWA 3NMDA 2B2XA 4JKOA 3L49A 3WMRA 1ESZA 1J24A 3ZE6A 2XD4A 2ZZKA 3BXFA 3C43A 1FYFA 2XB6A 2NYXA 4LJ9A 3NHBA 5EZ6B 2XUBA 1PJLA 4LOAA 3K8OE 4FUQA 2FRXA 2ONKA 2BI8A 3GYHX 1KJYA 1X8KA 3CQ9A 1IK7A 5AW3B 3DONA 1MFPA 2OCIA 1ULSA 5H16A 4RIGA 4P0PB 1V3VA 4HF7A 1JB9A 4KL8S 4H7IA 2H1CA 5HDBB 3NDIA 2H8GA 1O94D 3H7AA 2DTXA 1M1JB 2E2WA 1M8GA 4JP5A 3VVCA 2FPPB 5DPMA 1UMDB 1GQRA 2ZIUB 3K0FA 3DE7X 1X1BA 2PM8A 5F04A 2SHKA 3PCRB 1CUXA 5FA6A 3ESAA 4MQ4A 4BMZA 1D6SA 4JT2A 1XRMA 3O4RA 3VR2A 4OQ4A 4KQHA 5DTIA 3N75A 3N5CA 3L75G 5C7IO 5LYJB 5DHAA 4DJGA 4OQYA 4DR5B 1M2OA 2H6EA 2P2NA 5CLQA 2FR8A 2PLWA 3TO7A 1M2GA 4UKDA 2X22A 4Z86A 1NF2A 2BEUA 3CC4P 3QF4B 2GZHA 3ZLVA 4JDUA 4P81A 4KACA 2YRXA 2ORWA 4E4RA 2X86A 3AQIA 3BGVA 4DWWA 4Q4LA 3DEUA 4EY3A 3H1LD 1AKYA 3IAXA 1W0JA 1G9SA 1KYXA 3GLGA 1IC8A 1EX6A 4GWGA 5CMZA 2R3CA 3ISPA 3NHJA 4UUAA 3RDIA 2X1LA 4MVJH 2VDMB 4DM7A 1S2NA 1NVFA 1EUYA 2E36A 4A12A 1AGXA 1VJRA 3JRDA 1JFTA 4IV8A 3ZD8A 4DG5A 3GMTA 3K1AB 1TRKA 5B30A 4M98A 3URMA 1JTHB 1FNSA 4J3FA 2UXCB 3IT0A 2HX1A 3CLOA 5JSFA 1IG3A 2GBCA 1R58A 2WF7A 4DNQA 1X13A 2QEXP 3HSKA 2XCTB 1VE6A 3BWXA 3GGOA 5ILOA 3AF6A 2IEKA 1Z4LA 2O1EA 4OI2A 3VKHA 3TTUA 1UP6A 2WWXA 3CX4A 4ER3A 4JP3A 5M2QA 3QMMA 2X0NA 4AVPA 1LRLA 1YZNA 5HLIA 4Y18A 4AC9A 4D8XA 2WBLC 3BQZA 1EXMA 2DHDA 5PNTA 3LVRE 1K6MA 3KRTA 5DDGA 4C2MJ 2BASA 1GWNA 3BP8A 3BZUA 2OUKA 2OHFA 3NBAA 2CEKA 3RIGA 2KLVA 4DJTA 1STZA 3IVAA 6YASA 2WMYA 4UDNA 1ECPA 2XPUA 3ZVMA 5CITA 2FMIA 3EXHB 5JYCA 3R3SA 3GLIA 4OXQA 3LFTA 2PUWA 3I5AA 4NJMA 1T3HA 4J7XA 4XIGS 3L2QA 2BISA 3JQGA 2G4VA 4AUWA 4PHFA 1G6NA 3P0RA 2OVBA 3ERMA 4HEQA 1E1RA 2PGNA 4WX9A 1BQEA 1XZBA 2ZE7A 5B58C 4OI0A 1TVKA 5AKHA 1SD6A 2XMGA 3QK7A 4CL2A 4E7JA 4S1PA 3OQ1A 2CVQA 3CNEA 4MVXA 1FP6A 1KZ4A 4LJAA 4L0ZB 2ZYAA 3BTUA 2AG6A 2XCIA 2FP4A 5AHRA 2Q5LA 3QU5A 2ST1A 2V3WA 2FXIA 2IBTA 3NTVA 1IH8A 1KH2A 1QCDA 4BP3A 1JSRA 1YYVA 4QVKA 2H1HA 3NWJA 1IJKA 2VKTA 3AETB 4DIQA 5IKXA 1N0VC 5AW3A 3SFDC 1UCFA 3EUHC 3K7AJ 3PZRA 3BR6A 3I4NJ 3TF5A 1WZ2A 3MGKA 3EYIA 3LFHA 2CHUA 5LFAA 1M1JA 2V4JC 4O5OA 4LY3A 2HW8A 4UU7A 1I2BA 1OLTA 2FPPA 3VZPA 1UMDA 3QXHA 5F3DA 1RC8A 1VL2A 3OBBA 3A37A 5E1ZB 3OZGA 3QVWA 2R4QA 3GPIA 2MJZA 4KSCA 1E5DA 2FPMA 4DBQA 4MWZA 4XJTA 1S4QA 3FLEA 2ZT7A 4HAZA 4AYXA 3ZY6A 2EJBA 4DMKA 3SZPA 1A1SA 1AQIA 1JBQA 3GRYA 1JPUA 5KWIA 4HDMB 2FUG6 5HKAA 2P58A 2Y3IA 4HTFA 3QF4A 1ZK2A 3E3OA 3R75A 4YV7A 2ZI5A 3JTEA 2LC2A 4F06A 3FTCA 4LQDA 4QGHA 4IBOA 5BWCA 3QX9A 2NTJA 1YI8A 4X92A 5I7SA 3K5BA 1UWVA 1OLOA 3NTOA 3VBCA 5CVVA 4IDGA 4IOKA 4DQKA 3AKZA 3AG6A 1MJ9A 4BTVA 2AJ8A 4DILA 4JI0B 2VEDA 3K1AA 1QPGA 3FSGD 5C44J 2Q6OA 1ISFA 1JTHA 2P4SA 5CCDA 2P75A 3ELUA 4JQYA 3CUOA 4G5FA 2VPIA 2B35A 2GS9A 1FB5A 1E98A 1R0XA 3O8DA 3I42A 2VA8A 5B12A 4H0EA 2C2GA 4CEJB 1UC8A 1B8UA 2WD8A 3BHMA 4KJXA 3SJ7A 2J3QA 3HGYA 4M0KA 4RY8A 1SVFA 1CUSA 3AE2C 1HFEL 4N7RA 3WLSA 1P0MA 4IMPA 1P5HA 5KJFA 1IMJA 2MR6A 2EGHA 3ZCRA 4FLFA 1USSA 2AEMA 4Y9SA 1QIMA 4L85A 4QGFA 5K0NA 3QVKA 4CCYA 2WNSA 3E6CC 1LP1A 5EP4A 2JCYA 1EDLA 5B64A 2STTA 3NT4A 4CR7A 5IKOA 3WQHA 2ENWA 3TH5A 5B1YA 3TNYA 3P5JA 3FHJA 2G9UA 3H6GA 4XB1A 2ZVJA 1ZUIA 2QTFA 5AVTB 3EZLA 1ETQA 1G2QA 2F67A 1Y47A 4TTJA 2NOAA 5F9FA 3HP7A 2HIHA 4HX4A 1BSNA 2QVZX 4U87A 4ZJZA 3FGPA 4NHOA 5ALLA 2OCXA 4QFCA 1CJCA 3SSOA 4DNOA 5FOVA 3K0CC 1OX4B 1MENA 3GLHE 2XX3A 2ZYUX 2BW0A 3IQWA 2DYRH 1W5SA 2EZ4A 5CCXA 2PKYX 4PZDA 3RV3A 2R96A 4O2LA 1AS2A 3O1JC 1AA6A 2VQ6A 5T41A 3RS8A 1IXZA 2Q6KA 2EKPA 2C0PA 1UKYA 4K3AA 3N6VA 3AF5A 2I7VA 1ZYRF 3EPRA 1EFRA 1GV5A 4Z4EA 1R5HA 3AETA 2GDZA 4PBSA 4HDQB 3RSLA 2RD2A 3HCBA 2RK4A 1OF1A 2X8JB 2DI3A 2XITA 4GOJA 2IT1A 4GXRA 3O03A 4H9GA 1PI3A 3U3RA 5KYUA 4BNLA 2GPWA 4EJUA 2Q07A 2FJPA 2GA8A 2QENA 3HUDA 4AO8A 5A4IS 2H1SA 4XRFA 1O8CA 4MUNA 4GI5A 3UFXB 1ENHA 1EK5A 1EH6A 4LYGA 3GVCA 1YTLA 1KD1Q 2Q3HA 3M34A 1J2RA 3L74E 1R8YA 4JL6A 5AJZA 2J87A 1S9KE 3UHFA 3OOPA 1LDGA 5AESA 4B4VA 3DDSA 4KQ2A 3AI2A 3I58A 2ZUVA 4ZA2A 2XE7A 4BBRJ 3ROTA 2RI0A 4JH0A 4OIRF 3JCZA 5BP7A 2W43A 3G7SA 4LWPA 4HDMA 4C6RA 3U1KA 2HG5D 3O9VA 5TVKA 1GNRA 1WMBA 3STVA 1HKUA 2HCFA 4FDVA 4L28A 2Y6VA 2YR2A 1IVYA 4ZV4A 3VWBA 1XTVA 4BJ5C 1MOSA 3H7IA 3HCPA 4RA6B 1P80A 5D1HA 4HN2A 2GEUA 2A9RA 3HJCA 4JA2A 2WAEA 3CUQB 2O2IA 1JQ3A 5CMLA 2UUBB 4UE2A 1WM1A 4BLTA 3JWEA 4E14A 2HYFA 5FD5A 4OXKA 1M8KA 5HR5A 1K7FB 2X8WA 2BF4A 3A1CA 4BHBA 3WV4A 1L4AD 2PZLA 1SQXE 1KL7A 4CEJA 1BTOA 1RI5A 1EU1A 1P5RA 1YMQA 4OHOA 1R27A 1R0LA 1ZM4A 2ZYRA 1G3WA 2A33A 3WADA 1T5HX 2GIVA 4U0KA 1T6SA 3I0MA 4YCBA 4M1OA 4PC1A 4RTJA 4EB6B 4FD3A 5JJCA 1OIWA 4HQLA 2AZMA 1H42A 3T7CA 4FS3A 3KIOA 4CM1A 4HRAA 4AIDA 1XMXA 1ZREA 5IJ9A 1C30B 4F2WA 1UC4B 1HE2A 1W1UA 4LZAA 4UZEA 1EXIA 2E74D 2ZRCA 5HJ2A 2FBHA 2VUMJ 1EVIA 2AI2A 3HVHA 2H7CA 3PUZA 1VQ5P 4QTUB 4UB8E 5AVTA 4K40A 5E3LA 4GYJA 4I50F 4PNPA 2DA1A 1ATZA 4GRIA 3JRFA 3PUYA 5JATA 4BO7A 3L82B 4BLVA 1DQPA 5HRUA 5FF9A 1WWXA 1LWUC 1OX4A 4I4TF 4OA5A 3TZLA 5J2TA 2F59A 2BFPA 4R9RA 3NW9A 4HNUA 2WJ4A 2B87B 1LPSA 5E1OA 2JZNA 1IYZA 1U3WA 4ERNA 1LWNA 1W4ZA 1V43A 5HDKA 1RI2A 2COMA 3AYZB 4M7OA 4YYEA 2OYRA 3AHHA 1W5EA 2BE9A 2YN2A 2XT0A 3DDZX 3IT1A 3KZNA 3A1TA 3VP8A 2GUWA 3UVEA 4PYRA 2JGMA 3C15C 5KKZC 2VFAA 2X8JA 3L04A 3O8GA 2A1UB 1KEZA 2R7RA 3LCUA 2XTMA 1N5IA 4DIDA 3JD0A 1GAJA 1P1RA 2W6CX 4F85A 3AR3A 5DGHA 3UFXA 3N8KA 4I4NA 4I2NA 2ZEJA 4F9GA 1DP4A 4CV0A 1U90A 2WITA 3KQHA 3CJRB 4F86A 5I9TA 2I2AA 1BO6A 3UW1A 3EVFA 3GFBA 1OW8A 1M8FA 2O0JA 1W36C 3N3AC 2VPQA 3AM4A 3BPVA 2BHRA 4LQCA 1YR7A 3ITEA 1G2HA 5LBTA 4UAUA 4RXMA 2BY0A 2A7XA 5CVEA 2Q2QA 4MV0A 4RZHA 1VHWA 1LDKB 5C0OE 4FFOA 3JX9A 4NPFX 1OXZA 4TYPA 3DLIA 4HF1A 1G16A 4RTLA 5IFLA 1OIPA 5FULA 1JVBA 4NHJA 1AKMA 1SU6A 4JIGA 4C7XA 4BDTA 3W4KA 1QC5B 3B6MA 1CR4A 5BWLA 3WU0A 1T24A 1N7HA 3P0HA 3LZ6A 4RA6A 1T5SA 4PLVA 1SQGA 3RHFA 2DFTA 3O2JA 2OCLA 3CUQA 4XQCA 5KHDA 1WV0A 5C32A 2KWIA 3PPXA 1M34E 1YIDA 2W6BA 4PLHA 4CHUA 3LXUX 1KBZA 4NNPA 4MUBA 1PCXA 3HSYA 4BB0A 2A0UA 4C2UA 4N65A 3WNQA 2JDIH 3LRPA 2KPOA 3FKIJ 2FRHA 1WCWA 1QRSA 2R25B 1V3UA 4HWGA 1USGA 1PPJG 3C16C 4M87A 1FOSF 5DHPA 1WKMA 2KMUA 3EJ6A 1NSYA 4LWZA 3K6KA 2DY1A 3UC5A 3GLUA 1I2DA 2QCOA 1B0UA 4MYTA 5J6XA 4TXLA 1CQWA 4MW2A 1U5TC 4IGFA 4TWZA 3PGMA 5U9CA 4OHFA 5EZYF 1JY3P 1C30A 1CP3A 3L0YA 4FT2A 4MHTA 1ZGCA 1YS1X 1Z4PX 3RTBA 3ROMA 4XR9A 3MRTA 2BFDB 5K05A 2ZCJA 2X23A 4UAJA 2HO4A 1RE4C 3V8MA 2PXAA 3EFGA 1PT9A 4ADSG 4DVJA 3ZU4A 1IE3A 4DT1B 4B81A 2O1XA 4KNWA 3DTEA 2IE8A 2E1RA 2PJUA 3U09A 4BCCA 1RYZA 2FUG2 3D8SA 4WDQA 3ZV6A 4IYRA 4TUYB 4IXDA 4W8GA 2O3FA 2C2XA 5FTMA 4PVCA 2E49A 4PHHA 4ZZIA 1GCIA 1NSFA 1UFQA 5KUTA 4ZFNA 2BYTA 1I7LA 2DK8A 3GQBB 1U3DA 4MR7A 1R4NA 2PYDA 2GRJA 1EJ6A 3W90A 5HKLA 1KB9I 1NI4B 4HLDA 3CSSA 4NKRA 2JHAA 3B48A 3GMIA 5B55A 1MZBA 1F6DA 2IFNA 1IUFA 4UUTA 2A9JA 3IV9A 1OFVA 2DDAA 2M9HA 3PI7A 5J4VA 2QX9A 4EPRA 2TRTA 4IOIH 1EDZA 1KO7A 4HUTA 2ZB2A 4RH1A 3R4YA 3QFSA 4G0MA 1T5LA 5FA5A 1JB1A 5H7XA 5B66C 1YAHA 2KPMA 5CDGA 5DYTA 4E7LA 1YRLA 4BN4A 3AY7A 1SM4A 2IYUA 2UVPB 2CPSA 1KOLA 4Q3LA 2N1TD 3IH2A 1SUPA 5KLVK 4KYWA 4U0WA 3EEOA 2WQ7A 4EPTA 4MKIA 1CY7A 4YJGB 5DSZA 4KXUA 1H9AA 4KH0A 5K3AA 3K20A 3A1UA 2E1PA 2OFXA 3NIFB 1IY0A 3HOSA 4QFMA 5BNGA 1CY8A 1SCJA 2BI4A 4IIYA 3VNQA 3OYEA 4P9UA 4CRWB 4QREA 2PUEA 4ESOA 4ENPA 4UD6A 2VDWB 1PVOA 4DEVA 1E61A 1QC5A 1LNQA 4Y52J 2ZVNB 2JCGA 4IHSA 4B3JA 4JLDA 5A5EA 3S5UA 1LNZA 5EJ8A 1A4UA 4ZRNA 3GJ8A 1RAEA 1XC7A 1U9ZA 1MTZA 1FOXA 2RN7A 5IN5A 1CZNA 1NRWA 1QTNA 1OBHA 3ZHSA 3ZZTA 3OJ0A 3PC8A 2Q29A 4YP1A 3IAFA 5CM8B 1VQ4I 3KFWX 5EINA 1NTKG 5BORA 3Q9LA 2I54A 2WM8A 1KY5A 2I29A 1Z88A 2LF8A 3BZ6A 4NBLA 3C1AA 2XRMA 5CLLA 1V6AA 4GF5A 4TTRA 4OQXA 4DRYA 5FUXA 2WZ7A 1XZ8A 1PRYA 2O01H 4QAJA 3S1RJ 5LA6F 3T1HB 2YXLA 4S1WA 4HQEA 3QH4A 1NY5A 2XVXA 4L8LA 3OT1B 2XE8A 4IQ8A 1S01A 3VVLA 4D96A 4XKBA 4OLHA 4QWQA 2FBIA 1P4SA 4IQ4A 2X5NA 4E08A 2SKEA 3VOTA 1Z05A 4P83A 1ES9A 4NVRA 1Y4ZA 2F1KA 2CLFB 1NQAO 3E5NA 1EHCA 1IUYA 2R2AA 3D3KA 2IX7C 4CQLA 4BQRA 3WS7A 4B3MB 2F1IA 3NORA 1T98A 1PQWA 4DT1A 5LHHA 3FAZA 4MGKR 1IDYA 1SQFA 3RL0D 4O4HA 1J59A 4TUYA 1ZRDA 1CJBA 1QTQA 1YR9A 4NU6A 3Q15C 4ND5A 1M0WA 2BLNA 2KE5A 5G0SA 2EEPA 3GQBA 2OA4A 5LDGA 4O33A 2E2JJ 1GARA 4FQ8A 1S2IA 4KE9A 2JL1A 3UH0A 4LSZA 5D6FA 1I6XA 2OLKA 2NZWA 2VOJA 3NV9A 4U8GA 4RACA 2A5JA 3RAGA 1L2PA 3AEXA 4F7WA 4ZREA 4EY5A 1S5LE 3KIPA 3VTKA 4FXPA 2L7ZA 4MVJP 4Q7QA 1R8EA 1J06A 4HSEA 4QQKA 2NOJB 1HLPA 2A4MA 2HOSA 2CVOA 2YMMA 3PP5A 4IUDS 2ATXA 3H42B 4MTDA 3H1KE 1BN5A 1SQPD 3R9WA 4XCXA 2W0SA 2F9MA 1NNI1 2FWIA 1BGWA 4EV0A 2EAUA 2AI1A 3P94A 2JAUA 1IG7A 2HRCA 1ECJA 1ZSNA 3KX2A 5JYDA 5HDGA 4GXNA 2HQOA 4BQQA 1CUWA 4YJGA 2OAZA 9GPBA 4XYLA 2FW7A 2Q1XA 3IRQA 2R6R1 1BMQA 2DA2A 4PNZA 1EXWA 1F5NA 3AK4A 4H08A 4L07A 3WGUA 3K10A 1LS6A 5JDCC 5K3DA 1XU9A 4F6CA 1JRLA 1NIPA 1HMPA 2OBBA 2VDWA 2A3RA 1Z0UA 5F7ZA 3ABKH 1DMRA 1T2EA 3UJ9A 5B2EA 1A9SA 3O92A 3INTA 4QAQA 3ENKA 1UK7A 3G5MA 3BIOA 4B7AA 3WZLA 2DETA 1VYUA 2P0WA 4EKIA 4QLBA 3JQBC 4GPAA 3ROQA 2VP2A 4A27A 3GW6A 5T7BA 2YCLA 3QI2A 3T8RA 3PSHA 1JGTA 3DXFA 2HIAA 3PFGA 1RQPA 4OJNA 4F71A 4PEVA 5J3JA 4RY0A 5IU6A 2ETHA 3V8KA 3ZR8X 4RAZA 2IELA 5HG0A 1JKRC 4HKZH 2OAQ1 4F92B 1NH4A 1QGED 2SPZA 3R6GA 2CRGA 3NYQA 3OLYA 3KFXA 5EKTA 2F3QA 3OSGA 3EXAA 3ULKA 3HEFA 5H5JA 4Q15A 3LX6A 1IEXA 1JHOA 3WL3A 1L0LE 4UTVA 1E9BA 3P0JA 4WCDA 1TU4A 3OT1A 4AD9A 1N78A 1USKA 3GHYA 3K05A 4D0LB 2Y2VA 5DWQA 4G0VA 3QXXA 1ZGBA 4BZPA 1BCCJ 3Q98A 3MJEA 3NWPA 2K88A 1IZ9A 3KT8A 1R6DA 3OYCA 2KRHA 4NEHB 1XPRA 2RHBA 2Z5IA 3ELKA 1MHPA 4Z4IA 2WE8A 1H3FA 1GQSA 1L7XA 1XN1A 2JAXA 5BYBA 2P0AA 1LPOA 4FEEA 3MCAA 2KLHA 5B7PA 1ZC4A 1YSCA 3F0CA 2C1ZA 3V2UA 4XTRA 1YB2A 1WXFA 2B4KA 3PTZA 4B4DA 4RSHA 3F6SA 3F71A 3FM9A 4WSOA 4KVAA 3DOOA 3R7AA 4K05A 4EGAA 5FUQA 2QRQA 2YSRA 2ZRGA 3TBHA 1IAQA 3MWEB 4OHCA 2J6IA 1VMAA 1Z3CA 3OL3A 2FR0A 3UV7A 4QGAA 4BV8A 1WD7A 1EVYA 2B21A 1T38A 2UXNA 4PLFA 1GG8A 4OPMA 2FRDA 4HG2A 1FLDA 5CYFA 1M2VA 3K5WA 2GCIA 4Y7NJ 1V3TA 4O25A 3AB7A 3HB7A 4PQFA 2V3CC 3VODA 3BE8A 3WGZA 3ABLH 3GLFB 5HFNA 5DJ5A 3OX2A 5AOCA 1N36B 4QFBA 3OIWA 1YJNP 5C4IA 2AH5A 1BA5A 4ZAGA 4LHZA 4IIBA 1T5IA 4TLMB 4G9EA 2B0CA 4YPFA 5AO9A 1Z0IA 2X0LA 3I52A 5CA0B 2QTZA 4JODA 4TL7A 3GO5A 3V9AA 3CF2A 3I83A 5FPKA 4PD4D 2M30A 1GXSB 3ZDYB 1NR5A 2IOYA 4RA2A 2DQZA 2YL2A 3ASYA 4MFEA 5AW6B 3VUFA 3MXOA 3DL4A 3AV0B 1CEYA 1DVRA 2P7JA 1Q15A 2QRPA 1KO5A 1QHIA 3KEYA 5HNKA 1AVTA 4MUAA 3WWYA 4FLEA 3M9AA 4M0UA 1VKNA 5TR9A 3LOQA 4NYIQ 1WCMJ 4IJ5A 1DBVO 2ZXIA 5JBIA 1YB5A 3E81A 2RNJA 4KUEA 1I14A 1G7TA 1UIXA 3S1AA 3FOEC 3FETA 2XBMA 1UOQA 5ERGB 4JLNA 2MJLA 3OKAA 4ODIA 1SQVG 3W5IA 1W4LA 4B4CA 2Z4SA 4GBJA 2E4YA 2HHLA 1HSOA 4XYMA 3CZ5A 3RRMA 1YCHA 1WVGA 3PEWA 2XF8A 1EZ4A 3KP5A 1NPYA 4UB6E 3IP1A 3Q2OA 4L4YA 1U0HC 2GHIA 2Q45A 3EF1A 1WULS 1OWOA 5ERXA 1NXVA 3V34A 4BEHB 1Z37A 2V7VA 2C31A 1JIKA 5HS4A 2IHVA 3ZU3A 1U3EM 5KOHB 1Z5GA 4Q9NA 4NC7A 3KU1A 3KWLA 1SRQA 5TGDA 1DCTA 4TVBA 5D3QA 4QATA 1YBKA 2FPIB 3ZWVA 2DT7B 4D7MA 5DZSA 3ABTA 2XUKA 3L9FA 3EQ9A 3RUCA 3RLIA 1PQUA 1DCFA 2O5EA 1SQPK 4QECA 4YROA 1J0EA 4HD8A 3HXKA 1E17A 2MIIA 3KVVA 4QOIA 3KELA 4DOMA 5BR4A 5E3NA 2JFXA 4HQ6A 5FIUA 1H85A 4XM1A 3OO1A 4W80A 1NTMJ 1F4LA 2P7IA 2R00C 1VL0A 5FWDA 3NHLA 2AKEA 5EJ2A 5EP3A 2PKWA 5LLSA 1TIBA 3HA3A 3OWTA 2VNHA 2HMSA 4WXRA 2IOHA 3NJRA 2W6AA 3HV0A 3NASA 1OXTA 5FTLA 1J9EA 1IPFA 3T34A 1PSDA 1G7CA 4EY4A 4N12A 4X66B 1HDXA 1INLA 4PZ9A 2H3EA 3U4QB 3GJTA 2SBTA 2JD1A 5CM2Z 2I4LA 2WSMA 1NFFA 3DHVA 5HQTA 2GTPA 2ON6A 1H05A 3FDXA 3MWEA 5B3JA 4BNZA 3ZGZA 2MD0A 2AEJA 2BTQB 5CEEA 1GKLA 4MV7A 2DQLA 3GEBA 3RVLA 4AM3A 1YS6A 2MLGA 1YE3A 4BLRA 5JDIA 1V7CA 3BT7A 1RBYA 4IIVA 5CDUA 2R7TA 1BDMA 5SY6A 5DYGA 1WZNA 3BY6A 1K8QA 5GZ6A 1XPUA 1BE3G 3BT9A 1BI3A 1SFCD 4DAEA 4IICA 1UBHS 2XDQB 2IGKA 2WHRA 1MHTA 4PHGA 5CT9A 1U9CA 3DQPA 1FFYA 3VHRA 2EG9A 5ECYA 3GLFA 1NKTA 2QYOA 3B9PA 4UXJA 3E6BA 2J58A 3MD2A 1SKYE 2OE2A 1XWIA 1B23P 3ESQA 1Y7IA 1ML3A 3PYLA 3CN9A 4A0HA 2FHSA 5L3QB 1YOVB 5J2UB 2CMHA 2AX4A 1T2DA 1BGYG 4EA7A 4FWBA 4LMBA 3SU8A 3JSXA 1UZAA 3MTJA 3SNKA 5CAEA 1GLVA 3ISTA 2F43B 1USVA 4GLBA 3MS7A 4O9BA 1YZKA 3HL4A 4UTRA 4ZCTA 2WP8J 3TUJC 3L2UA 5AIBA 4MB2A 4HR7A 4JVLA 1K78B 1GXSA 4PLGA 3W1VA 1TUBA 2XLBA 3WTVC 3LT0A 5AW6A 1O6ZA 5HWSA 1QVUA 1Q0PA 5FROA 4WESB 1XZFA 3ZMZA 4BPBA 2I55A 5BWOA 1P9QC 2VQGA 1QAMA 5I7AA 2OD7A 5BURA 3D6UA 4RK6A 3HOYJ 3ZV3A 1RUOA 3HM5A 3JY6A 4BRZA 2XRLA 2UZIR 2PWAA 3L71D 4QYXA 5DMXA 3P9QA 4XKWA 3HJGA 1KI6B 1VI5A 4BRSA 3HIFA 2EWWA 5HK8A 2GZ3A 4LZNA 4P3KA 3ER9A 1WMDA 3MMSA 3JAKB 5HM8A 4EEXA 1E9VA 1DXQA 1UFVA 2Q1TA 3IR6A 2KX7A 2J5PA 2O1KA 4NU0A 3EULA 4NFHA 3F3KA 1VG0B 1QO0D 4IXMA 4UM7A 3VOSA 5JRDS 4MVJM 4X84A 1OBCA 3QX7A 4JROA 1N7GA 2WQZA 4MN4C 4ZHSA 1I13A 1XTQA 4TMYA 2BFAA 4K26A 3CT4A 2K85A 4BEHA 4XOUA 3WMWA 3QEMB 1EPUA 2O8VA 5DLYA 3QMVA 4BO1A 3VSBA 2DKNA 5KOHA 1KZGB 5EGOB 4DNCA 4TKUB 5FV4A 3WRXA 1SXJB 3BGIA 4EA9A 2G0AA 5M5YJ 1WZEA 3CPHA 2YWDA 3I0TA 4X1IB 1G291 2ZUUA 3CWZA 3ZI4A 4YN3A 5A9RA 3L73E 5E6RB 3SS9X 4G07A 3PIPF 3WWPA 2QTLA 2B8EA 4FZJA 5KYWA 3RC8A 1IO4A 3X3HA 1A9TA 4BB6A 3GP8A 3LTEA 2BHYA 4B6OA 3D6HA 3I9NA 3HNOA 4DDHA 4N5IX 3AZOA 4ASUA 4DGSA 2YJ6A 2Q5FA 1JSZA 4JNCA 4A36A 4AX8A 2B83A 4NMXB 2CVZA 4PUSA 2DBBA 4MW6A 5FXMA 2ZSDA 2WBMA 4KBFA 2H08A 1XPXA 3NXKA 5BN1A 3O5AA 2JWDA 4BAZA 5IEBA 2CU7A 5FADA 3HU2A 2FZVA 3AEQA 3HYIA 5HNFA 4BAGA 1KTVA 2VTEA 4RZUA 4Z7NB 2WJYA 1P7PA 1P7ZA 4JYMA 2FOXA 4BACA 3KBBA 2ISSD 3HKCB 2PS3A 4JKYA 3TDKA 2D1FA 2XJ9A 1GRQA 4I7HA 1KJ8A 2BTQA 1VG8A 3CUEF 1I3MA 1B6TA 3VEPA 1MEOA 1EXJA 3J81A 2Q2OA 2FDRA 3VHQA 1LBEA 3VP9A 4O29A 1GG2A 2G9VA 1ULTA 1QGDA 4XWYA 4CF6A 1TMGE 2CN1A 4IIGA 2P6UA 4B80A 2I80A 3QVXA 4K86A 3AILA 3IUYA 4YT5A 1W49A 1YZTA 1PR9A 2FW9A 1DUIA 3SIWA 2AV6A 5CA1B 5L3QA 1NH3A 1YOVA 5J2UA 2M8EA 1PFVA 1WCXA 3CZPA 4GPTA 1V5GA 1S72P 1Y0NA 5GAJA 3HDJA 3M6AA 4HMQA 2Q5HA 3W3CA 2F43A 5J2TF 2PG3A 1YDGA 3HB5X 1EIWA 2HEOA 4UAGA 4Q37A 5CVUA 1XNJA 1JI3A 1KDYA 2BHSA 4IOLA 4YEJA 3O82A 1GUYA 4ZEWA 2R6GA 4D9HA 3WGVA 4B33A 4N5MA 1LFAA 1P77A 3TGUG 3OZTA 3QPVA 3TQRA 2C03A 3U60B 4ZYGA 4RHUA 1D0XA 2KL4A 1VIAA 1JT9A 1Y9AA 4HQOA 2ETVA 2D5BA 3PNTA 5JZBA 2YTZA 3BMOA 1P19A 4H3VA 3OH8A 1Z2NX 2LNBA 1MBGA 1KI6A 5JAOA 5DXJA 2Z6QA 5EE0A 5KVAA 4MICA 4F1WA 4XJVA 1R3UA 1K8RA 2JHGA 3N2KB 4DSOA 2Y75A 1UBTS 3JAKA 3EVNA 4G6TB 4O4IF 1BOBA 2AHOA 4US1R 2A5GA 4UVAA 4BX0A 2BMFA 2NZ2A 2J5QA 3D8RA 5K0EA 1Y1VJ 4UNOA 2DPYA 3GAAA 4QPNA 1SG0A 1SEPA 3DVLA 4ZYVA 5I51A 2ZIAA 1WTCA 2FN9A 1JIQA 3PHCA 4HHEA 4ROSA 3S3TA 2R1UA 4XVHA 2W2KB 4AJEA 2IPAB 4HFNA 4RGSA 1E1QA 4KHXA 4NQZA 4H16A 5A1TA 1J09A 2OSBA 2HOEA 1D6MA 2EKZA 4JXXA 4POOA 3H1JE 2XGXA 1V4VA 5D5UB 4DLXA 2FFJA 3FPHA 5E6RA 5TQJA 3HXLA 5CJPA 3ILXA 1O3QA 5IK2A 1RTKA 1ETYA 2XGGA 4WOJA 3DCNA 3MFKA 4BGEA 4BNHA 3KR1A 4H4KC 1D9XA 1JQBA 4RW0A 2UU9B 4XLNF 1D2MA 3QY9A 3MPOA 3M8JA 5ALTA 3BB4A 4HAIA 3KAPA 3K0AB 2A3SA 3ZCVA 5I7FA 5EMMA 2JJ2A 2FX0A 1L9KA 1ND6A 2QZPA 4KO2S 3UMMA 2VF4X 2LXBA 5CD9A 4ZU3A 2KJQA 3CX5D 4KVFA 1CNMA 4DJJA 2R4UA 1V6SA 1UEIA 3OLCX 3DZIA 2EWMA 1NDQA 1QGPA 1UKEA 1PDWA 4WOCA 2ZETA 4GQBA 1FYLA 1RJFA 1USTA 1I4LD 5IULC 1TRHA 1Y5IA 2V58A 3KJIA 1EXNA 1OW3B 3BN3A 1T3UA 1T56A 2ZT5A 2VS1A 2C3PA 1WLYA 4E6KG 3ESWB 5TS2A 3WL8A 1WKVA 3GHGC 2A5YB 3CU5A 1F8GA 2V97A 4Y2YA 2QM0A 2I33A 4H13D 1N7SA 4IX9A 3SHWA 2HUPA 3D0QA 1XXLA 4LF9B 5AKEA 4CCSA 3VI4B 4A9AA 2ZTLA 3ETDA 1ZK4A 4LLGF 3T4PA 2JH8A 4B5KA 2BXZA 3K2ZA 1TUGA 1FS5A 4UNQA 5E8JA 5CA1A 4C6TB 1GZSA 1VQOI 5AI9A 4R54A 2QL9A 2ESNA 2ZB8A 3P9YA 2J5RA 1FTZA 1CY2A 1JJ6C 1QP8A 5IC6A 1BJTA 1U7UA 4RO0A 4B87A 1JVNA 5IP7J 4MGEA 1KMIZ 1R0SA 2WYOA 2CLCX 2K9SA 2AG1A 5MDHA 1ZIDA 2ASEA 1LS1A 4IDPA 1TCUA 4KDCA 1AC5A 1W96A 3P20A 2DEUA 2RK3A 5KDLA 1DT5A 2GVZC 4U3FJ 1KJIA 2HWVA 4UMFA 3RS3A 4CETA 2JGNA 4N40A 1TK2A 4EB3A 4M72A 5KTPA 3T1VA 2C5GA 2KIKA 3B20A 2RN0A 4IVNA 2HNKA 5C1OA 3CI9A 1OKRA 2VDVE 2DODA 4XQ0A 4GPZA 3PEVA 3N2KA 5L3SB 4FMDF 1UJBA 3HRNA 3SBXA 3QQ5A 2DHRA 2IODA 5JSQA 3HR4A 3CZCA 4G1EB 5JNVA 4U5XA 4RK0A 3SQWA 1EA5A 2F00A 2X9NA 3E2IA 1A5ZA 4MDHA 3IUMA 3FDFA 1SBTA 4EI9A 4O5AA 2IYSA 1E3MA 1POWA 4HTAA 1HKHA 2PAJA 5ALHA 3BMQB 1OXKB 3L74J 4O0MA 4Q3EA 1XJ5A 1UG0A 2HDOA 2RHGB 1ZM7A 2W2KA 3VC7A 2DOFA 1V2HE 2H11A 4GI1A 4BLSA 2NNNA 3PWZA 4B46A 1IZNB 2WHEA 1H4TA 4YRMA 4QRIA 4B8XA 1JTFA 3CVYA 2ZJ5A 1RYDA 3B1ZA 2NZ8A 4X6XA 5EKDA 1IQPA 1ZOPA 3M49A 2AJDA 2VAXA 4G4SO 3G49A 5LUBA 2W11A 2P8TA 3OQHA 3L8YA 1RE1A 5EJFA 5JH7B 1Z83A 5C8DA 2C98A 1HM5A 4ZCIA 2NP7A 1GU0A 4Z4CA 3JQCA 3IVMA 1ZKDA 1MQSA 4WCFC 3BMNB 3K0AA 2ODBA 2H7VA 3TIIA 1I6HJ 1Y8AA 2W9XA 3NIGB 3P9ZA 5AJTA 2NRGA 3DW1X 4WBSA 2CDCA 2VH2A 4KN5A 1DNPA 4E7SA 2I9KA 5E1WA 3VJRA 1JIIA 4HDNB 4E6PA 4B8ZA 5JO0A 1OZAA 1Y8ZA 3FCCA 1GTVA 2AFHA 2E60A 1BKDR 2X9QA 1U3TA 3A6GA 4OG2A 1HK7A 3OQIB 3AVQA 5LNK6 2NXEA 3DQVC 2CK3D 4EATA 1QG0A 2WJVA 2FOLA 1GZ3A 2PRRA 4U7TB 4W9NC 2JA2A 3NAQA 3ZXYA 1XOIA 1B8IB 4A3LJ 1U3UA 2Z1MA 5A2QZ 3D4OA 1MH1A 4JXZA 4BNCA 3GFMA 2JGLA 1Z4IA 1NV8A 1EK2A 4NXMB 1PL0A 5I5EA 2ATCA 3V1YA 3ZGXA 3LYUA 2XPCA 1XSVA 4IG4A 1NQXA 1FZCB 4O4HF 1OHHD 4JLOA 1E4VA 4IZZA 4CIAA 1UM8A 2YUSA 3CVJA 3Q5GA 3WTXC 5AVJA 1V45E 3JRXA 3GFTA 1X7WB 1DGWY 1ZMOA 2MSWA 5LRRA 1UC5B 3P9SA 3BK7A 4F96A 1RXIA 2IBSA 4N4OB 1Y5LA 4LECA 4E7PA 3L40A 5EYRA 3ABMH 1JU3A 3QKUA 5U1PA 1B8PA 1UJ5A 3RRFA 2FY8A 4FI3F 3BCUA 4K6FA 4RXTA 1ZI9A 3RU7A 3Q5DA 2Z9CA 4F3CA 1FC0A 1PZFA 3RT7A 4M83A 4S3MA 2E76C 5T8KC 1AUVA 4RQAA 3L4SO 3AVWA 3C4QA 3DKVA 4CFZA 3KQNA 2N9BA 4KO8A 3WIBA 1XCGB 3AWDA 4AUMA 3IAM6 4DSZA 2VBCA 1SEUA 2PX9A 1K5HA 1KGDA 5LGNA 3SAJA 3AJEA 5CVDA 3D7KA 3HCEA 2ECOA 1MTOA 3LGAA 2GPTA 2J67A 3C74A 3SXPA 4C5AA 2OBMA 3Q3JB 1NMYA 2Y1KA 3TL4X 4MMZB 1ZH8A 3WE7A 4CT0A 4H6VA 3D4IA 4DLUA 3BMQA 1QX4A 4ZVLA 2HA2A 1MO2A 2OHJA 2BJHA 4F7ZA 3IQZA 1JALA 3OJEA 4L6AA 4D8TA 1ZLLA 3G2MA 1G7SA 1OAOA 1SD1A 2WY8Q 4DB2A 1GTG1 5IAKA 3BQNB 3W4IA 3EF3A 5FKLA 1U02A 2BDTA 4EVIA 3MW8A 4Q1FA 2OKCA 3A6LA 4DHEA 2Q6QA 2RGEA 4J75A 2FAXA 3S28A 4MPJA 3ETLA 2IS6A 1VA5A 1YRBA 1JH8A 5JH7A 1VKRA 3AUJB 2J6HA 1Y7HA 2KW5A 2V7QH 3BH6A 1KS9A 2JIOA 1MMFB 3Q3VA 1SG9A 4RAFA 3ABQB 4FJ1A 1DIPA 5KCZA 4ARUA 4V0ME 3BMNA 3A1EA 5LYJA 1U7JA 2ZJ4A 3D64A 4Y9TA 2PQMA 3ZQHA 4QBTA 3GT7A 2VK4A 1JLSA 4ETWA 3U0VA 1NJSA 4MCIA 3FWPA 4B3AA 1OI2A 4F4IA 1ZUNB 1WW3A 3GGPA 5CNKA 2CW5A 4BV3A 4HDNA 4UM9B 2W2MA 1P2VA 4I4IA 2O2EA 3ROEA 1X70A 3WBBA 1GNPA 4IY1A 1CSBA 4N6GA 3OQIA 3ROXA 3VUEA 3EDCA 2SNIE 4E7IA 5J43A 4KI7A 1FQKA 2XDVA 3TI9A 1YT5A 4R81A 3V5NA 1Q77A 1HFKA 4LFAB 5DTJA 3PEEA 3ZJTA 1B8IA 3S17J 4L0MA 4Y99B 2L0KA 5FORA 4GGPA 1K8ZB 5DI3B 2D5CA 2CFSA 2DY0A 4N9QA 4R3NA 2Z5HA 4R2KA 2FLKA 4FC6A 1KNXA 1ZN2A 5KSZA 1I39A 1XAJA 2ZT9C 1FZCA 3H5TA 1Z0SA 2I62A 1IMOA 2GNPA 4G84A 5JI3E 4D7NA 3DKPA 4GDMA 3I55I 3E3NA 2GSDA 3FWEA 1ZITA 1SUCA 3A2KA 1APLC 2WWFA 4OX9B 3A0BH 2LBPA 2W2LA 1X7WA 3BZBA 1SP4A 3NBUA 1SOWA 2VSQA 3G1MA 5L3ZA 2G28A 2HADA 4R9UC 4EGSA 4EUKA 3SJAA 2OFFA 4OQZA 1XZKA 4UBKA 3PS9A 5TISH 1LEBA 2AXTC 5JHFA 1BOOA 1MVLA 3EXHA 2MOKA 3GJZA 1LQTA 721PA 1S5PA 4TGLA 2WT4A 4F97A 4MR8B 3KC2A 1CD5A 1OX5A 3TGLA 3RFVA 1B7GO 4PRZA 2YJNA 1JIUA 2IBMA 1KV4A 1B41A 5FCDA 4FKZA 2C99A 1DIBA 1MXHA 4PS0A 1YQ3C 3AP2A 2C1EA 3R41A 1PL5A 1TO6A 2IVFA 1LUAA 4PSDA 3U7IA 5A6VA 3M81A 2XR1A 4KGVA 1VFPA 5E79E 2A59A 2P35A 2P9EA 3L7MA 2P8SA 3M9BA 2K4BA 2ZJ7A 2OYHB 4OYLA 4WADA 2O3SA 3BH7A 3D70A 3CX3A 1FMCA 2QLBA 3MOIA 3P2KA 4I1OA 2BN4A 1KI8A 1NBMD 1NDUA 5EIXA 4ZYZA 3WLFA 4DOZA 4IUBS 4YHHB 2YICA 2A9PA 2IPQX 1LTTC 2VQ3A 4WDRA 1KZYC 4FDLA 4Z5XA 3ZQIA 5DN9A 4XYGA 2JFUA 2A06D 1KZ7B 2CMPA 2KKOA 5HA5A 2QR2A 1OGIA 2DWUA 5J1SB 2KLUA 4O4JB 2FQXA 3QBDA 4LHWA 2W83A 5DSXA 3ZS8A 3GIWA 5LGTA 3K0EA 3M89A 1M72A 3HQ4O 3F7TA 4CFSA 4TSKA 1R16A 3WTUC 3KYBA 4W1SA 1PWHA 1J1EB 4LS3A 2IKQA 4EAQA 1WEKA 4JLBA 3GYBA 1DADA 4IFFA 4RDHA 1GIAA 3IUBA 2IX3A 4OVNF 3RRBA 4IDNA 3MJHA 1VHDA 1MGPA 4C4TA 4RVGA 3I8OA 1X58A 2DUNA 1Y3BE 3QLUA 4OIMA 3QY0A 3F97A 4KPGA 1IFNA 1L5MA 3L6BA 4PLTA 4B3SB 1TM1E 2G3AA 5FI5A 1WP4A 1WPGA 2PCLA 2OHHA 2IEIA 1PFQA 4BLUA 4LNUB 4BU2A 3OQ6A 1IOZA 3M4JA 5HCIA 3Q6IA 3AEBC 1IZ8A 4XOPA 1Y3AA 1P6QA 2FHPA 2YBDA 4QDUA 2WMOB 2UYQA 4RZ3A 2V03A 1AQJA 1UL1X 1WABA 5HIJA 2JEOA 4CM8B 3KPVA 5AW1B 1D6NA 1UDRA 2ES4A 5DI3A 4YDQA 2WTAA 4J0IA 4NBWA 1R23A 2BFMA 5M29A 2OUMA 4TT3H 2QVBA 1JH9A 2K5UA 3GJSA 2ZU6A 2QV7A 5KLVD 1YJ9I 3BMCB 5IG2A 4UPEA 3H65A 4YAUA 1LNSA 5F0CA 5BOSB 3EK2A 3MWDB 2VCHA 1DLIA 2J7PA 3EXEB 1CSEE 3OJXA 2HZ7A 1HZZC 2VT3A 2K3FA 3TXXA 3ESBA 4OY3A 4B6GA 5E95A 1WJBA 4OWRB 5CPBA 2O2HA 1ACJA 3D0KA 4N3BA 1UJ2A 3ACDA 2R7FA 1YB4A 3C1UA 4R1PA 2JTVA 4KQFA 2X3UA 1U78A 1WBJB 3HP4A 3K4NA 2I4TA 4MR8A 1UUFA 3G0DA 4IL6E 4G7OF 4GX0A 1HQKA 3KZXA 2QT9A 2DKFA 4NK4A 1DP7P 4N03A 1HDOA 3G9TA 5ENZA 3RWMB 2YNYA 3FXAA 4AC0A 1F1ZA 1FF9A 5TQ0B 3KCQA 2VPWA 4AYTA 3V3KA 2PGIA 4QRHA 2AK3A 3V1KA 1E89A 1MC5A 1XK6A 2FSIA 3ZHUA 3D3WB 5D85A 1MNAA 3U9LA 3F6CA 1URQD 2ZJPF 4EKDA 4JJ7A 4TSFA 1N5DA 3SZTA 4QOHA 1FDSA 2YNMC 1DB3A 3K35A 1B3RA 3HZHA 3V5BA 4WKGA 3HJNA 3J81k 2ID4A 4XLFA 1SVIA 3JQQA 3R44A 4F3NA 4DMGA 5LU9A 2BL4A 1L0NE 1AZLA 1NJGA 1R8XA 2PGDA 2IWHA 4ALLA 2NV0A 3OHSX 4O4JA 1ZJ4A 3V42A 4F55A 4BVLA 4CDRA 1FLVA 2XGSA 4P4TA 3RL0g 4JPZB 2ZSHB 1E7QA 4OHZA 1ZS9A 1QL2A 3U40A 2OAEA 5AD1A 1ZNXA 1WXQA 4HZGA 2E7XA 1BDCA 2AT1A 2V0CA 4LLLA 5EUMA 3WBJA 4RIIA 3JREA 2P1JA 2HRRA 5EHNA 2O8EB 3OYGA 4KRGA 1EA7A 4HNSA 3WE3A 4IFDK 1K7XB 2RMZA 4KGDA 2R92J 3O8RA 5JBQA 1N2OA 3HK2A 2QKLB 4MGHA 3JV7A 4LNUA 4QPOA 3OCXA 3IAM2 2I6GA 4UTOA 5EFZA 4DC9A 2HHAA 3KKLA 2EIMH 1XHLA 1B8OA 1GL2D 3LCMA 5CPRB 2QN3A 4DLAA 1T4MA 3RAJA 4H0CA 3RUHA 3QWLA 2EFYA 4FHFA 1YNOA 4Z99A 5EKUA 5EA2A 2IRWA 2H5EA 1WP9A 3AT1A 3PXDA 4ZCRA 3O9ZA 2EQ5A 3T0FA 4X24A 2NPSD 1TU3A 1AGNA 2PEZA 3TO6A 4EB6A 3CISA 1M74A 5BOSA 3MWDA 3C97A 4LJ4A 2J4FA 4JOQA 4YC7A 2JNWA 3EXEA 1FLNA 3NNDA 4F7DA 5LVAA 3VVMA 4D9NA 2OEPA 4FILA 4AXXA 4G37A 2IP2A 3N07A 1BVUA 3RGUA 4HRVA 5K01A 5EQFA 1WNFA 3H4VA 1TA9A 3TG2A 3CCJP 2HF7A 3SHFA 4L9JA 1FJXA 2O7RA 2VAWA 1QNFA 3SD7A 3HZZA 2ZUFA 4AIHA 1RZRA 1I30A 4BX8A 4LDJA 4DN6A 3FMQA 3II6A 1GDHA 1JY2O 4PRKA 4B47A 1JKQC 2JRMA 3QM1A 2VSXA 4MKFA 1VQ9P 3NC0C 3IAS6 3AR4A 3E70C 1Y3HA 5CX1B 2BMAA 4LXQA 4DV5B 3AOEA 3REQB 2EZKA 3DOHA 1E9RA 5HKOA 3RPQA 3FUCA 3JRCA 5IW8A 1T1JA 2P1RA 4DZOA 2B87A 1XSXA 4ESFA 3AONB 5FKJA 4OYRA 1FMTA 1KYOI 3RK2B 2XB4A 5K4AA 1E6EA 1M2JA 3K2QA 5DTRA 4FCCA 5CP8A 1SURA 3UJ3X 1ST2A 1YL5A 3HB9A 4YRVA 3D3WA 3O2SB 3U37A 2VJBA 4KYUA 4UOQA 4LYFA 1TVCA 2VZ8A 1Q3TA 1LK7A 1XG1A 2A1UA 3DL7A 1XL0A 3F0TA 2H7XA 1W59A 1A8SA 4RU1A 1A27A 3MUDA 3M6LA 2H4YA 4QWMA 3KE9A 2AW5A 4I5DA 1EWRA 4IJAA 4Q00A 4LRWA 4P4GA 3CJRA 1CG6A 3SJMA 2C7BA 4CH7A 2I4IA 4X71A 5EEAA 2ZSHA 4H4EA 3AKDA 1NBEA 3GROA 3D2AA 3LC0A 3OZ7A 1YOBA 3NOXA 3GEDA 4AZWA 4Z4GA 3KDPB 4DHWA 1YO6A 2Y1DA 4D98A 2MG4A 4KU4A 5D4SA 1YD7A 1OBVA 3RVJA 2HCBA 3L1UA 3CE9A 1NGSA 2OV7A 4YV1A 2Z83A 4XSGA 4TN1A 2NXJA 5GOZA 2BGKA 3F6EX 2GAAA 4A2WA 4Q4HB 2N46A 4RDCA 4KN9S 1ZY2A 3C3DA 1HORA 3QENA 3MP7B 3OA7A 2M0CA 4IEIA 2XGMA 3R6WA 3NBMA 1XU4A 4KTVE 3MKYB 3ZDBA 4EKGA 3NCHA 2AN1A 2PWZA 4EHHA 3IBGA 4TV9B 3HKBB 3DTNA 1K97A 1N8TA 5A0VA 3LV8A 4Z3OA 1LKXA 2IHNA 1FQJA 2ASVA 3CRMA 5DX1A 4YRGA 5I9NA 5DIZA 3CXHI 3KKPA 1NVAA 5LQDA 3VJKA 1L8QA 4HN4B 4TMXA 3U62A 5I8PA 2HODB 1F8FA 1VSQA 3FFAA 3VGJA 2VUHB 3IBTA 2OCEA 4YXWH 3TTWA 4A4DA 2ORYA 4L9AA 2FJ1A 4R84A 2PN1A 1DTSA 3MB5A 2OYIB 2ZS9A 3OUTA 1U99A 5TPZD 1M7BA 2QGNA 2E5YA 2BFDA 2FSVA 2B20A 2LREA 1TWFJ 3OYAA 1U9NA 2VT7A 1FNDA 4KXFB 5JW6A 4P0QB 2L17A 1KMHB 3OZWA 3UGTA 1JYEA 1JQAA 2XNXA 3C3EA 1IIRA 4QBIA 2OHVA 5CX1A 4KJMA 5JEEA 3N76A 3IUQA 3LFKA 3REQA 4W6ZA 1SELA 4U5QA 3VTZA 3KJEA 1IWOA 1GNSA 2BF7A 1FYMA 3VPFA 4IJWA 1OROA 2J0UB 4H1TA 2BT4A 4CLHA 2L02A 1D8AA 3ZVKA 2GAIA 1EX7A 4UCQA 1E1CB 1NI4A 3ZXUB 2A7QA 4WLEA 1DFGA 3FPJA 2E48A 2IDBA 5E17F 5KIAA 2XNCA 2XNDD 3IDZA 2EFWA 1YZLA 3L0BA 1A95A 1N25A 5KAFH 1Q7CA 2GM3A 2O3TA 2X5JO 4YMTA 1UXHA 1YIJI 3P0EA 4QT4A 2R7QA 1WJ5A 4DJAA 1S2GA 1EGMB 3M8FA 1QDUA 4JOMA 1XJCA 3MKZA 3GHHA 4I4CA 4KFCA 4F12A 4CM9A 4AS3A 2WTBA 5LBUA 1ZJWA 5FLXK 1EX1A 4HS4A 3VZBA 1VHTA 3KTDA 2UVPA 4NAUA 3QE4A 1FJLA 4Y9DA 1QHFA 1EWVA 1UBLS 1XKQA 5KNDD 4E31A 1RE0A 3O6VA 4RJKA 5JNTA 2WI8A 1Z5OA 2P30A 3HJEA 4R7GA 4W7ZA 3NT5A 4FYKA 1SOUA 4E5UA 1ABBA 4XRMA 1VPEA 2BFEB 3DZHA 3MELA 3COPA 4F6LA 4MI1A 3O94A 1OV4A 3QRFF 3ZG6A 2DR3A 4ZYUA 3KDPA 2QRGA 5IANA 4DVGA 1NLUA 5D5XB 5IT5A 4RH0A 3M91A 1GQYA 2OZ6A 3GBPA 5L4LA 2Y2ZA 1MU0A 1LZKA 3M6XA 4IH1A 4Z4QA 1NN3A 3GLHB 3HEAA 2R9VA 1KQ3A 5BQ5A 5JFGA 3VH3A 4OBEA 2R5WA 1HBWA 4EJOA 1PT5A 3T95A 5DT9A 5C5CA 2VF2A 2IXDA 4NCIA 5B2FA 4ZKUA 3EE6A 1VG1A 4ZJYA 3MD9A 1IDN1 5KNLA 1RJGA 3TLYA 7MHTA 3F4BA 5TS3A 4GQAA 4BDSA 2AUMA 3VGPA 3HA5A 3PENA 5B4VA 2DA7A 2QX6A 4NG5A 3WYGA 4ISBA 1GVJA 3M9QA 2PT6A 5I4BA 3NALA 5LWQA 3JSAA 3RRXA 1MJGA 3C3CA 3IXQA 3NM5A 4M9QA 1FW8A 1NC1A 2VDQB 4O02B 2IUTA 3HKBA 3SLRA 3A70A 2L91A 1ECBA 2GEFA 3QYAA 2CBZA 3VMYA 1LW7A 2DQSA 4D8WA 5JMOA 3L9WA 3FHNA 1IXRC 3KXIA 1LY1A 4PR3A 3Q9UA 1NP7A 1KC1A 3HN7A 3FTFA 1SMYF 1KH3A 2P5TB 1WOMA 1M5UA 2R1TB 4OU5A 1T1GA 2HODA 4L5IA 1WMSA 2OCCH 4B3HA 1L5HB 3R3VA 4W99A 4US0R 4XR6A 3DAFA 1J9GA 5TGZA 2IHYA 2XYHA 4Q1DA 1RQGA 4MQVA 1F2DA 1MQ8B 4ZKDA 5ANRB 3ZY4A 621PA 4HVLA 4LF5B 3O75A 1MO4A 4PD4E 3FOCA 3SXJA 3GLXA 2MU1A 3GEGA 5TMBA 3ZJUA 5I3ZA 3C2HA 3MRXA 1HNWB 2Q0OA 2JIZA 1KMHA 4IDAA 1Z33A 1WGXA 3HOVJ 5AOAA 1OXSC 3CNHA 1YULA 2ZRJA 4X1OA 3H1FA 4XX1A 3ZQKA 3H1GA 2VWQA 4TLDA 4MW7A 3QG5A 1E3LA 1G3MA 3VPAA 2J0UA 4G3XA 2C84A 4BNUA 5COAA 3I3SR 1NWQA 1W87A 2X2EA 1E9FA 4XUDA 3G1TA 5HIMA 3CG4A 4AO7A 2DTZA 3D71A 1F7UA 3V7NA 1E1CA 1ETUA 4GM0A 4LSMA 5ES3A 4QOEA 1T9BA 5LIRA 4N78E 3W68A 4BO4A 2M5AB 4KX3A 1GVDA 4QPDA 5HODA 5EE1A 5G2OA 4LQ4A 2BXYA 4CXMA 3K0BA 3OY9A 3KB1A 1WT6A 3JQAB 2WDZA 3ZJVA 4IFIA 4FP9A 3HVIA 1IN6A 4HW0A 2N42A 2CNKA 2GXQA 2P9QA 3K2BA 4WF2A 5K8VA 4DEYA 4EJWA 4OHKA 4P8RA 4XSXF 1VF5B 1JKPC 3HXMA 2YYAA 1KPHA 1RYMA 3T1OA 4R1SA 1BFKA 1CUEA 4Y6LA 4R51A 2G9WA 3SOPA 1MDFA 2ZK7A 1AUXA 4ABTA 1N8KA 5D8DA 3L8MA 3DFMA 1Y6GA 1X7HA 3GGCA 4LJ6A 2LDBA 1V7QA 3D6YA 4IX1A 3AIOA 2Z09A 4TQAA 4INZA 3HA7A 1IHPA 1KVUA 4IXNA 3E3AA 1GA6A 4D44A 2EFGA 3KP6A 3GCXA 4YAEA 2CMDA 4JI7B 4KV9A 4JY7A 3GLHA 3GMDA 3QXJA 2DFKB 5H2FH 4IZ6A 5AM2A 3DD1A 4ZDWA 2IYXA 2N1BA 3OE1A 5IP6A 2R97A 3TTSA 1P9LA 2NUAB 3MTQA 3CBGA 3CH6A 5JE8A 3RREA 3IAS2 1JIJA 3KR0A 3KSRA 1LEHA 3VMXA 2TRSB 2AB0A 4YWJA 3IV5A 5J8CA 3O47A 4NCKA 2R7MA 2IAIA 1PEDA 2P9GA 3KKOA 2BGUA 2BUBA 1YUBA 3TOSA 2FVYA 2HZTA 3SWWA 3FDYA 1XEXB 1QLWA 1ZK1A 2G7UA 1J9IA 1E8DA 1W29A 4XLLA 2C88A 4L9TA 2FZKA 5I4IA 3OR2C 3BRWD 1KYVA 5LYJF 1SBNE 3TNUB 3BFPA 4NC9A 2Q2EB 2ZRNA 4ZEMA 5LHIA 4N6OA 1RE3A 3H2BA 3QBVA 2X13A 3B85A 1VFNA 2V9KA 2WU4A 1QU2A 2GJ4A 2O8KA 3V8RA 3JWGA 1IHUA 1P1JA 5E2IA 4PONA 1XCVA 4XZ3A 1CRZA 4RGVA 1U2DC 3M82A 3S3OA 3ZDFA 2ZYTX 1BH2A 2WUEA 3SM9A 4G94A 1JQKA 2OTCA 4NJOA 1RIFA 5DGCA 1YZUA 2FF5A 2CMGA 2REXB 4R79A 1QO9A 3AHFA 1UWKA 3C5WP 3IVCA 5ETJA