1GDTA

Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
molecule keywords SITE I OF RES DNA
total genus 58
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gdtA03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gdtA02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gdtA01
2LVSA 3IH2A 2VUMJ 1XC5A 3BQYA 5IOZA 4A3BJ 3TP3A 1OCTC 2R93J 2VI6A 3IH4A 3IH3A 4D5CA 1ZK8A 2CQXA 1JGGA 2MW8A 2E19A 1JKOC 2E1OA 3HOZJ 1NK3P 2EH3A 3GUVA 2O9LA 5E3MA 5C34B 3JRIA 3CDLA 2QF7A 2EBIA 2D5VA 2HOSA 2OPTA 1GHTA 2RSLA 5C44J 1ETXA 4M3GA 4IHYA 2WV1A 1ETKA 4XICA 2L7MP 3A01B 4IHXA 3B6CA 3SJMA 5EGOA 3RZDJ 4MFDA 4Y52J 2CRGA 4QSHA 2ZB9A 3LNQA 2HXOA 1Y1WJ 4M3BA 1U9NA 3DEWA 4A3DJ 2K9SA 4V2FA 4DW6A 5C35A 4B4CA 2JJ7A 1QRYA 1F43A 1TC3C 3BR5A 1JUPA 2VKVA 1LFUP 3Q0UA 4A3KJ 3HOYJ 1QVTA 2LY9A 2JWTA 2XGDA 1GT0C 1E3OC 2O7OA 1B72A 2KDZA 2FD5A 5F0HA 2W48A 2HI3A 2DJNA 4CYCA 2DMPA 4A3EJ 2O8KA 1JTXA 3SDGA 3BR0A 1PUFA 2XPUA 3C2BA 5EZHA 5EG0B 3HOVJ 2X48A 1LFBA 3S17J 1HLVA 2X6OA 2E2IJ 5C3EJ 3PO2J 1HF0A 2TRTA 4S0HB 4DYRA 2R0QC 2JA5J 3O8HA 3M4OJ 2LR8A 3A03A 4XIDA 3S2DJ 4C3IJ 3FK7A 4A3JJ 2IAIA 1JKQC 1YRNB 3LSGA 5IYBJ 1X2NA 5FLVA 1HX7A 3ZQGA 4ABZA 2YU9J 3ZQIA 4IEJA 4C3HJ 2JK3A 1JKPC 4XK4A 2JMWA 1FJLA 2HOTA 2DA7A 2DA6A 2TCTA 3GTGJ 4B1RA 1O4XA 2JA7J 3BG9A 3FIWA 1GV5A 3PKZA 1JUMA 2XB0X 1MBHA 1ZGWA 3QPSA 1UHSA 1YRNA 5IYCJ 1VFCA 2COBA 2MG4A 5C31A 2VKEA 2ECCA 3CMYA 5F27A 4I6ZA 2EZLA 1H8AC 2MHCA 1S7EA 5FKKA 5E3NA 5FKMA 3BR1A 3RQIA 1Z77A 1MH3A 4BKXA 1ZR4A 2DA2A 1MBFA 2NVQJ 3PM1A 3ZQFA 1RR7A 2Y30A 1WI3A 3FK6A 4A3LJ 3CCYA 2MGQA 3WHCA 3RZOJ 1Q1VA 3BR6A 1QVUA 5J3LA 3JRAA 3LOCA 3BQZA 2WB1N 1W0TA 3BG3A 1AKHA 3S16J 1TWGJ 1WCMJ 2OF7A 3S1RJ 2M34A 3GTPJ 1IRZA 4D5FA 3F0CA 3G1LA 1TWHJ 1GUUA 4QTRA 5C32A 2NS8A 1EF4A 3G1OA 1T33A 2H1KA 1B8IB 1NTCA 5JLWA 2L7FP 3HGYA 4UUSA 3LHKA 1ETVA 2X9DA 3G13A 4DYCA 1IDZA 3Q3SA 5DS9A 2E2HJ 4XRSG 2Y0SN 4MIMA 3BVPA 3PO3J 1RESA 2ME0A 2E2JJ 5M5WJ 3S1MJ 1OJLA 2XPWA 1SFOJ 3S1NJ 1IC8A 3JRHA 3S14J 2N8GA 4MFEA 1MBEA 4D7MA 4JYKA 4RBOA 4J19A 2L0KA 5GPCA 1JJ8C 5FJ8J 4HNVA 4Y7NJ 1H88C 3S15J 1RKWA 9ANTA 4DZPA 1FIAA 5FKOA 5J1UA 2M8GX 4FE7A 1B72B 2H8RA 3GTQJ 2M9HA 2AO9A 5M5XJ 4UUTA 3ZQLA 4XRMA 4BY1J 1D5YA 3HKZN 1BW5A 4JX4A 2DA5A 2HOAA 2DA3A 3TEDA 3HOUJ 1GVDA 5F1JA 3GTOJ 1P7IA 3ZQHA 2K40A 1ZTRA 3FKIJ 2R5ZB 1MSFC 4I76A 1B8IA 3TP0A 2GLOA 3S2HJ 2XB5A 3DCFA 1I3QJ 3NARA 3Q0VA 4V2GA 5M5YJ 1X58A 3H0GJ 1T56A 4JX5A 3TW6A 3JRDA 5M3FJ 3JRCA 3E7LA 2RAEA 2DMUA 4FE4A 1SANA 3BTIA 2CU7A 3FISA 5IP9J 1K61A 5DTDA 3GTKJ 3ILXA 1H89C 3HDDA 2DMNA 1BL0A 2IEKA 1OFCX 2G0EA 1HOMA 1BW6A 1CQTA 1RETA 5IYDJ 1GV2A 1I50J 2EQRA 4QIWN 3LSJA 2K9NA 1MNMC 2GM5A 5K7ZA 3I4NJ 2HYJA 4D7NA 4BBRJ 5GP9A 2EZIA 2ID6A 3IV5A 2CUFA 1W0UA 4M3DA 2ECBA 1TWFJ 5E3OA 3UKGA 2JA6J 1UG2A 1LE8B 1Z0XA 4C3JJ 2MSYA 1Y1VJ 5FLMJ 4M6VA 2NOGA 3MN2A 4AYBN 2LFBA 1XG1A 3OIOA 3QPLA 1ETOA 1OCPA 3O8GA 3JR9A 2R5YB 1ZKGA 5EF6A 3BT9A 3MVPA 4G12A 4AC0A 4IHWA 4BY7J 5EYRA 1JJ6C 4FISA 4GFBA 2Y9YA 3OOUA 1WGXA 3BR2A 5FKNA 1ORKA 5FKLA 5HODA 5GPAA 1JT0A 1NK2P 4A3IJ 2Y2ZA 3BTJA 2XPVA 2NVYJ 1APLC 3GTLJ 2M0CA 5K7FA 3ZQCA 1MBGA 1A5JA 4MLOA 1UMQA 1ZQ3P 2JN6A 1BJZA 5EGOB 4A3CJ 3UJ3X 1WH7A 2LK2A 3NAUA 1RPWA 4X6AJ 2I10A 3LSPA 1K83J 1VNDA 4JP0A 4M3FA 2FX0A 2KT0A 2XRLA 4LOCA 3W6VA 3HOWJ 2IBDA 1LE8A 1MH4A 1FTTA 2DMTA 1G2HA 4UUSB 1IJWC 2EZHA 2FQ4A 3ZOBA 2R5YA 4FCYA 3D1NI 3VPRA 2NS7A 2DMQA 2DTZA 2JA8J 1AU7A 1IG7A 5IOYA 2YUSA 1MBJA 2LTPA 2GM4A 1AKHB 1BA5A 3LHFA 2GBYA 5IP7J 2M2EA 3JREA 2NVXJ 4RDUA 3WHBA 2B63J 4C2MJ 2ID3A 3JRFA 2L9RA 3RKQA 1JKRC 4DZJA 1RKTA 1R9TJ 1I6HJ 3SFIA 4W1UA 5F08A 1FEXA 1ETQA 5EZGA 4B3AA 1GDTA 1VI0A 1HDPA 4IHVA 2HDDA 1JT6A 3GTMJ 4L5EA 3H3VK 2ME6A 5F04A 1WH5A 2LD5A 4NDLA 1DU6A 1U78A 1DU0A 2LLKA 3CQZJ 2YS9A 5C4XJ 2QCOA 1VF9A 2Y31A 1JTYA 4A69C 2DN0A 3BG5A 5JLXA 1PUFB 5IP6A 1ETYA 1IV6A 5EG0A 4A3MJ 3G1MA 1X2MA 1TWCJ 2ELKA 5EDNA 2DA1A 2CUEA 3MKLA 2R7ZJ 2WAQN 5J1RA 4FTHA 1U8BA 3GTJJ 4X1EA 1MSEC 1HCRA 2P81A 1FTZA 3JRBA 3BR3A 3HEFA 2AHQA 4DYQA 3TW7A 3Q0WA 1TWAJ 1XS9A 5IPAA 3JRGA 1ETWA 4BBSJ 3OSFA 1POGA 2HXIA 3K2AA 3BTCA 3QQAA 3GBGA 2PMZN 5EEAA 2CJJA 3HB9A 4A93J 5K7HA 3BTLA 2XSDC 1IUFA 2K9QA 1MBKA 4W97A 1U9OA 1HDDC 3OSGA 1ITYA 1WPKA 4A3GJ 3HBLA 1IDYA 1P7JA 2DA4A 2LKXA 3I4MJ 1IGNA 3HGGA 5BNGA 4BXXJ 2R5ZA 4BQQA 1F36A 3B6AA 3A01A 1ENHA 2L7ZA 2XGEA 2LP0A 3K7AJ 4XRSA 1JUSA 5C4JJ 2NVTJ 4M3EA 2XGCA 3A02A 3HM5A 4A3FJ 2R92J 4CYCB 2FJ1A 1AHDP 3HOXJ 3L1PA 4EEFG 4MO7A 5J1YA 1ZR2A 1FIPA 5M3MJ 2VPRA 5E3LA 4AUXA 3LSRA 5F0FA 1QPIA 2EZKA 3M3YJ 2CQQA 1A6IA 4JX6A 3S1QJ 2Y9ZA 5F0CA 2HQ5A
chains in the Genus database with same CATH superfamily
2BUBA 4AMBA 3F6OA 2P11A 3PC8C 1GARA 3JPWA 4EM6A 2MW8A 3B3AA 3IKTA 3UAZA 4HTFB 5EMKA 3WTUC 3OR1C 1JXSA 4G37A 1G3RA 2EJCA 4MHOA 5CVRA 1R58A 1P74A 2YJ5A 3FPSA 4RW0A 2BDEA 1W1IA 1MO2A 3TZCA 3NV7A 4JEIA 4KT0J 4HDAA 1Q7CA 3AR4A 3PXEA 3AJDA 5TVGA 1YZKA 3KDSE 4E1AA 1JJBA 3TW8A 4TWZA 3TEMA 3FZVA 4CLDA 1NSTA 2VJKA 2IUFA 4MQMA 2CJPA 3ZLJA 4HX8A 1R36A 3IE0A 1UFRA 4LYGA 4KQ9A 1VJ5A 3OAAD 3BR0A 1AKVA 2QX6A 3LGAA 4DPMA 3VFZA 1I2AA 3A3YB 2R32A 2W93A 2HKOA 3ZI7A 5CCEA 2W2KB 1YRNB 3O8OB 4YYZA 2JK3A 2I80A 2BUAA 3T1VA 1EWYA 4BXOB 1ZJYA 1I24A 2QWWA 1ZG1A 4Z5XA 5IWAB 4IXWA 3FMQA 2BFCA 3WHLA 4XGIA 1G5FA 2DKFA 3MB5A 1RYDA 2TSYB 3RQIA 2R4TA 4E09A 4E2ZA 3KLBA 4PLZA 3VH2A 2QHXA 3OPQA 3JQGB 2PRJA 1V8ZA 3O7WA 2RARA 1GFZA 5G53C 3GG9A 3A9UA 2KJCA 1MVOA 2WSYB 5LB4A 1PZQA 3MVEA 4A2CA 4PAOA 2TYSB 4GI7A 4KR0A 2WG0A 4X8MA 4JKYA 1LS6A 1O3TA 1UMBB 2C82A 2CDRA 1G64A 3CRNA 4YFXF 2F67A 2W70A 2A33A 3AHIA 5IDXA 3RKYA 2HAEA 4RBOA 4ER0A 4BMZA 3ABVC 4H18A 1KYZA 4YXWA 1I6LA 1SJ9A 2W82A 1Y0NA 3A8TA 4QBKA 2MKVA 3NXSA 3HKZN 2IE8A 4FGSA 3PVSA 2KOGA 4TRNA 1WUKS 4LF5B 1IJFA 4F6LA 4E07A 1KO5A 4ZK2A 4ZO9A 2XGGA 1WDWB 1BJAA 2ZM5A 2VLAA 2EHJA 3DOUA 3KKZA 3FWEA 4AIRA 4BDSA 4F6CA 4DWOA 4GNKA 3QM1A 4K3AA 2H6CA 2WABA 4OIFA 1PE0A 1DO2A 3EYAA 1UJ8A 1JM0A 2BEUA 4R2MA 3PC7A 3JS5A 4QE3A 2VBYA 2Q4RA 5IJ0A 1V1RA 4A0ZA 2VIIA 2O19A 2V0GA 4CR8A 2PX3A 1P3DA 3CCMP 1JR4A 1A8HA 3T97A 1LFPA 3Q5EA 4HCJA 2X2PA 1XZ8A 5EZYA 4FT2A 4CMGA 3ZU6A 5FR1A 3W8EA 2WU0A 4KIJA 1B6RA 3H1KE 2STWA 1M8OB 1ZM3A 2F3QA 4XQ0A 5HCIA 2VXZA 1L7RA 1QONA 3TQCA 1SXJE 3WY9A 2Q5QA 1O9BA 1YI1A 1M1JC 1JB0J 3ONWA 1EFAA 3FNRA 4AJ9A 4RS8A 4Z9XA 2PKCA 2XZDA 2ZXJA 2QTMA 3DWIA 2E1RA 2IYZA 1UBUS 1UM8A 2R9VA 4YCSA 4FVTA 2UVQA 4KPUB 2JAUA 2WSMA 1ZLYA 5IP5A 1KYOD 4RDIA 4LNHA 1VLHA 4E3WA 2R7ZJ 5J1RA 2V9VA 5E1DA 2KZGA 3LV8A 3TGUE 2FRDC 4ZH4F 3IR9A 2WIJA 3FD8A 5AOCA 1CDDA 5KJ7A 5A6SA 2B69A 2K5CA 4N3GA 1IM2A 2XCUA 2PR2A 5CU7A 3MJSA 3GI1A 3F22A 4W82A 2ZYHA 4H0LB 3VPCA 3D6TB 5EXXA 1JEDA 5G0UA 3BEOA 4L51A 2JBHA 3I45A 4XE5B 1EVKA 1OFUA 3RNOA 2VDMB 3HD7A 3R44A 1DX6A 3BGIA 3OJLA 3CBGA 1SBCA 4HLCA 2BISA 4EHAA 3AB3A 3G8AA 4XUDA 2CNBA 4ZC3A 3LSTA 4I81A 4PFJA 3KSUA 1XC5A 1WVMA 2QX4A 4OBBA 4XXHA 1WTCA 3LIIA 3L5KA 2ZJYA 3I8XA 1IH8A 2EBIA 2ZR9A 4FMBB 4PZZA 5EMHA 2R2GA 4U7GA 2WJIA 1XTCC 4BE2A 5E2AA 1N2OA 4FJ0A 4ZJYA 4I09A 4M3BA 1E0DA 4AY4A 1N0VC 3QVUA 1XAHA 4ZD6A 4XSGA 3GEBA 4IQ4A 1H2BA 3B1ZA 2FW9A 4Q3DA 5JZVA 1Z56A 1AT1A 1Q0HA 1U9ZA 2DJNA 3KR9A 4MVJD 4RD3A 3V1UA 2E2IJ 2AQIA 1AA7A 5C3EJ 3VR2D 2QS9A 4DYRA 3GLFA 3ZN2A 2MJZA 4XIDA 3VAZA 2ZYTX 3ZD9A 3P32A 2XSJC 1ZD8A 2V0NA 1QHHB 1O4XA 5EC8A 4C7MA 4N6GA 2DYSH 4WEOA 1P0PA 2G80A 2EU8A 4B40A 1RZUA 1WDMA 4KZPA 3TQHA 2AT1A 3DD5A 1L0NK 2BY2A 2K88A 1JQ5A 8OHMA 3GJ8A 4LK1F 2ZZKA 5DN9A 3P97A 1VKOA 1T5LA 1CQJB 2F4OB 2MGQA 2J6HA 2PUJA 4DIKA 2W2LD 4M60A 4WMLA 3CWBD 1SXGA 1A2KC 3U56A 2F4MB 1KA8A 4C30A 2Z04A 1NTCA 5CBNA 4I99C 2HA3A 4UPDA 3LQFA 3AG6A 1ZH4A 3EUHC 2X9GA 1YIJP 2DBRA 2YXEA 3WOVA 2AEMA 1FBMA 2OHVA 4WFKA 4LRYA 1TLHB 4G5SA 2QN2A 3MWKA 1RQ7A 1RAIA 3BZCA 3GA5A 2CUJA 4I55F 4FOOA 2D6FA 1W4MA 3W6ZA 4JX4A 5KS2A 5EMMA 1UDBA 4CR7A 3NONA 1Q1BA 1YB4A 2C5EA 3ABZA 1FX0A 5HCNA 2XF7A 5TRTA 3LIDA 2R7MA 1WW3A 3JASB 2CYBA 3VVLA 3EFGA 4M89A 4ZT4A 4P0QB 4LQDA 3Q7PA 3IT0A 1I1SA 4LSZA 4UOQA 4TSFD 3WXBA 3CEHA 1P45A 1S3GA 4QGHA 4CUJA 3MA0A 4ZQFA 2PT7A 2QAGB 5J8FA 2QSYA 3VR5H 1IMOA 3PDWA 2NRGA 1TDJA 1XGSA 2VBFA 3RASA 2QG9A 1PP8F 3GCDA 1G8FA 4JQYA 2FMKA 5JNSA 3I9V2 5BOSB 5IC4A 2D4HA 3CFYA 3JCUE 2WMMA 2QJPB 5LVAA 1WB9A 3JYNA 1NATA 1HPLA 2VHTA 3R4YA 1DRUA 4R9UC 2X4DA 3U19A 4N01A 4LOCA 3F67A 2JASA 1N5JA 5K45A 4LTMA 4RTRA 1NMYA 2CV2A 4B74A 4KFUA 4I4TB 3BASA 3O73A 3K8YA 4WWHA 2Y67A 4IRGA 1U8YA 5IOYA 2IWRA 3WI7A 3NASA 4L7VA 5GGYA 5F3WB 1NMZA 4YAIA 2P6RA 2YO2A 2HFKA 3F4KA 2NVBA 4ML3A 4UJ3A 1BE3D 3W7AA 2GGSA 3B4SA 3TKAA 4N8EA 2HBYA 4H3HB 4KYWA 5H4GA 2M1BA 3TI9A 4L0DA 5LFAA 1A50B 1XRRA 1M33A 5HDNA 2FUG1 3CQZJ 1L0LK 5DOVA 4BS9A 4Z1OA 1R5BA 2OBLA 2J0UA 4ZVKA 1EDIA 2ZSHA 5T7BA 2VQEB 1N33B 2DA1A 3OIWA 1VIAA 4NS4A 1R5JA 3IQZA 1E1NA 1WXWA 3AI7A 5LD2B 1WSUA 2P3SA 3ASYA 3BR3A 4BH9A 1J23A 3DULA 3KNZA 4V02A 3SOPA 4I1PA 1ZYUA 1RFLA 4I1IA 1T25A 2PMZN 3RS8A 1SQXD 1XO1A 1HGXA 1UT5A 5EWLA 2JDIA 1C8LA 4YCBA 3TG2A 3DJFA 3S2GA 1BE0A 1JNXX 5CYPA 4NS1A 2FEMA 1SHKA 4MKXA 3RRNA 2FQ1A 3PP8A 1KEKA 1K75A 3CC4P 2QRJA 3WL6A 1LWUB 3GVPA 1SC7A 2QW1A 4BWNA 5I4BA 2AD5A 1BC7C 4XD7A 5L4SA 3O94A 2EINH 1UQTA 1Y4UA 1XQVA 3LP5A 5AHRA 1FYLA 4C46A 4R2WA 4KL8S 2YQZA 4PLGA 1QLJA 3VZCA 1G0NA 2BMJA 2IA1A 4QU9A 1RQXA 1SAXA 4ZDOA 4M22A 2J3IA 1YGPA 1MV5A 1AMNA 4AXBA 4MRAA 5BR1A 4F8JA 4LZWA 4DWVA 4A10A 3D6ZA 1TYBE 1R4ZA 1NF9A 1KDZA 1KZYC 2P5YA 4HFJA 2GJKA 1DLJA 1TYAE 1TAHA 1U8UA 1RI1A 3D31A 4DG5A 1JDSA 5TQ2A 1CE8A 1ORHA 4ZWNA 5I7RA 1TA9A 4LDPA 2MLKA 4KIWA 2FXOA 2EP7A 4LV6A 3MTBA 2H63A 1V1MA 4YV7A 3EARA 3BRWA 3SSOA 2D5AA 4WINA 1XAGA 4AU7A 4DN6A 1FJLA 4LG0B 3ORHA 4CKEB 2DA6A 1MLDA 4NVRA 3TB6A 3KFWX 1U0SY 4E0BA 3K9QO 1SK9A 3TXXA 4YBZA 2VXOA 3AVUA 1FOSE 1DKLA 1GXSA 3UVEA 3O1IC 4BP9A 3H0KA 4L16A 2C4MA 1S3JA 4TKMA 1XROA 3WHPA 2WZCA 2G4LA 3AVQA 1X22A 5AVUB 3IIEA 2KBFA 2VJMB 2ZQZA 1GSAA 3F73A 2OQIA 1XX6A 3W68A 3R3VA 2KBEA 2DHEA 2NYVA 3H7AA 5DEIA 4O2AB 4KPGA 1BC8C 5E6SA 1C3XA 1H6CA 4EW6A 1IWPB 4NC6A 3OD1A 2OD5A 1QZUA 1VQ9P 2J0QA 3FOCA 1Z36A 1QZEA 3LI2A 4HNVA 1IO2A 4M9ZA 5CG1A 4XGKA 3JPYA 2WWWA 1L7OA 1S3SA 3HDYA 3F7MA 4FR2A 1QC5B 4JYPA 2Z8YM 4EGQA 5KX5B 5KJ6A 2Z0MA 1LB1B 3QX8A 3LHIA 4NBQA 2ZT7A 3SGLA 3HXLA 4ZI2A 5IS2A 1FFWA 4DRXA 1T6BY 3B85A 1QL1A 4EB3A 2OZLB 1XX5A 5ALUA 2HYNA 1NVMB 3U13A 1WWKA 5A3SA 3H1JG 5KOHA 4GBGA 2CNNA 5HKAA 2QNBA 2IZOA 3JZIA 3CZAA 4Q3AA 2OV7A 3HIFA 1TUBA 3A27A 3DDUA 1JAHA 4G12A 4AC0A 3Q1MA 1MP0A 5HPYB 1TCUA 5FKNA 2W2NA 4YREA 3NWJA 2JJLA 1HXDA 1JQKA 5LQUA 2JIRA 4RMNA 3ETEA 1H4VB 1E3EA 1D2CA 4J03A 4FWBA 1IN6A 2IYLD 3A4CA 5HNHA 4M3FA 4TWIA 1A4RA 3TFQA 1RWQA 3K9BA 1UBEA 4PZEA 3M0DC 2R8XA 1WXDA 2Q6QA 1GNSA 3PD7A 2XIGA 2IY8A 1EE1A 2HJRA 1VLVA 3EXIB 3IYLW 3IAM6 4LC9A 4UAUA 4YELA 5APXA 4F4UA 1FS6A 4HYTB 2YCBA 1MGOA 1FSEA 5J5CA 4GE3A 3EY9A 2BFDA 1YDMA 3TQNA 5H68A 2YJNA 2PX4A 2BFPA 4D92A 4FSXA 4OFBA 3W7VA 4MEYF 3CLTD 3WLHA 1PJRA 5EJFA 1ZRNA 1IFPA 4D0LB 3D1LA 1M1JA 1FP4B 2XZTA 4MI6A 3ICOA 1SUPA 2XX3A 4RK5A 1TM1E 3U9SA 3TL6A 1VQOP 3NI2A 1EZZA 2ABWA 3S55A 5G40A 2DU8A 3M0DA 2GBCA 2XZRA 2QRPA 3MOIA 4N7BA 3FIUA 4Q24A 5HLTA 1WJ5A 4OXXA 2WWHA 2VZLA 4RHXA 2VLIA 2L2OA 4GBJA 3SMQA 5TEVA 5E8RA 3N58A 5FPQA 4AG3A 3CMCO 2O5RA 2R8BA 1S3IA 1C8VB 1YUBA 1EGMB 1HWYA 5KJ7C 2B7CA 2KWIA 5EUCA 3VHXA 3HCPA 4WLFA 1WL8A 3GRUA 4B7CA 2KK7A 4PGGA 2OTLP 4ZMDA 4FYPA 3G59A 3QW4B 2NV0A 4PWZA 2O8NA 5H2FE 2OZEA 3FPLA 4G9BA 1RDFA 4OPMA 1ZBQA 4ZIRA 3LCRA 1J9GA 1HNXB 2R47A 4YCCA 3OYGA 1DBRA 1S7OA 3JW8A 3LQKA 5EYPB 4QUDA 1N5LA 4ETWA 3KOUA 2B4QA 1NLYA 3FOBA 1EXWA 4XGNA 1P1BA 1I33A 4M1MA 3THWB 5A9RA 3UJAA 1T3ZA 2MYUA 3LP8A 4MS1B 3I2HA 3BR5A 2D7DA 2AMJA 2BKLA 5I5GA 2CSOA 4RMIA 1KJNA 2FX2A 2FD5A 3AG1H 3GT3A 5K0LA 4IH9A 3K4LA 4JJ6A 1WD7A 4WD3A 2MSKA 1MFZA 4G89A 4OD0A 1IZ7A 4HDUA 3IURA 2K3PA 4YGYA 1WXGA 1TZLA 2FOWA 3K0AB 4Z99A 1BOOA 3HMKA 4LJSA 5IYBJ 4MUNA 1YZUA 4UAJA 4IKEA 3JVVA 5DO9A 1YK0A 3FMPB 3OS0A 2QG6A 1QOZA 3Q5DA 4G1EB 2UVPA 3SJUA 2I8DA 3UMVA 2QL6A 4EUHA 2VF5X 4DBLE 2VRCD 3T4UA 4YFNF 3PFBA 4WACA 5HE8A 1FZTA 2YVQA 4PPGA 5ISMA 1NU1K 4KQEA 5JAIA 1SUFA 3FXRA 3V00A 5FT9A 1IG3A 1KC8Q 2FZCA 4QTRA 5H59A 1MABB 4KXMA 4DJTA 4URUR 1D3AA 1HYHA 2IELA 1O5OA 3RRXA 1ZD5A 4BNCA 1U1EA 3TTXA 4XSXF 4GOOD 1E5QA 2SHKA 1KVRA 3FPHA 4LMPA 3KJHA 4M0MA 4HVAA 5KYTA 3UMMA 1WULS 4FOSA 2C2OA 4AJKA 4DC9A 4GRIA 1ZUD1 1TXGA 1R9GA 2Q2EA 2ZWMA 1BXGA 1ZH5A 3ZNPA 1Y6QA 3WQQA 1ZUIA 3BA1A 2BBSA 3VR4D 4QX6A 3IP9A 3MM4A 2DUNA 4TZ0A 1Z6PA 1YV9A 2IGNA 3ZJUA 3FPJA 3EJWA 1A7KA 1W5CC 3I05A 3BXPA 4JKIA 3KSRA 3SHWA 1TQMA 3VR6H 4EAQA 3RC7A 4UVGA 2EZUA 1NF2A 2R5FA 4LAFA 2W71A 2GF0A 1CFJA 2H7HA 4HC4A 1W44A 3QKSB 5FNVA 3Q5SA 1SXJC 2KI5A 1U4SA 4BQRA 3C43A 2H9AA 4PLTA 3PRKE 4JITA 2WJZB 3JQAD 2PUDA 5ARBA 1LC0A 2PZJA 1XG5A 1N2SA 4O59O 4WCGA 3GO5A 4Q9JA 3KD3A 1QE0A 1RBQA 3IAUA 2YX1A 1BGVA 4CJXA 3P2OA 3ZQCA 1ZGGA 1UC4B 4L5BA 2WE8A 1FS0E 2O7QA 2XV1A 1U2PA 2CXUA 3K09C 5BOSA 3OAKA 4D25A 3USSA 1SBQA 3HOWJ 2PRIA 1OBVA 3EBOA 3LOPA 4CETA 3PCTA 4HGOA 5KKZB 1J1DC 1K0FA 5E20A 1XQYA 5TGZA 3EC1A 3EODA 2O0HA 4BHBA 2WY2D 3OCZA 2NADA 4MUFA 2NQ8A 1X8KA 1LUJB 4I3FA 1Z2EA 1JEEA 3OCVA 5KTOA 2PUAA 4ES6A 1R5LA 3RSFA 4HAMA 2LV8A 4MIYA 5CA0B 4Y28J 4M9UA 1N6RA 2XUDA 1DUSA 3FYUC 1RLUA 2O8BA 5BYKA 1ETQA 1BFKA 3D2LA 5K3SA 1WXQA 4W1SA 1PGOA 1KA9H 5JROA 1ZYRF 1FZCB 1MMNA 5LPNA 2GN4A 4EPRA 2ZB3A 2AOXA 4RVDA 2YKPA 2DDAA 2HEGA 2DFPA 2ZUVA 1IQRA 3ZIAA 2WI8A 2A3RA 4K2EA 1DG1G 1CS0A 5FEMA 1HGVA 2YV3A 3E9ZA 3LX8A 4FOTA 3OEHA 1DGWY 2CVOA 4E14A 3AEUA 1W1WA 1EZVE 2P30A 4G0OA 1PZEA 2OUIA 1GYQA 1U2RA 3ITDA 2R5DA 4FHGA 1G8AA 1IN4A 2P7CB 1M6NA 3WU2C 5ECGC 2XDQA 2PJZA 3H9GA 1FYEA 2XAHA 3HUTA 2E4YA 2Y1OA 3QPUA 4A3FJ 1BQ4A 1PVVA 2YOFA 4QOIA 5EJMA 3RRJA 2GRJA 2DM6A 1R1UA 2XB6A 3GFBA 4N9HA 3KKOA 2M6LA 5AJUA 1KTVA 3UMCA 5DZSA 1TEHA 3WIDA 2G8NA 4HN9A 3V7YA 2NO0A 2FOIA 5JFTA 1FFDA 2D59A 2NTJA 5H3LA 3COWA 1H0KA 2GOMA 1DDOA 1RZRD 3IJEB 1GGNA 5E7JA 3GVIA 2R6FA 1NG6A 3QTTA 5KPDA 4AY5A 3IX7A 4FBLA 1E60A 1C7EA 1T6SA 1IZ8A 5FWXA 3OYCA 2O2HA 5DI9A 4YI3A 4BLSA 3U3JA 4W7SA 1KQFB 3FTPA 2ENUA 3DTNA 3LW5H 1BN6A 4QPJC 1TF2A 3OLXA 1MB9A 3ULKA 4JC4A 4MS4B 1EWKA 2UUBB 4M37A 1YC5A 5KVRA 3U39A 3GLQA 4DQKA 5KNBA 4K2HA 1NSYA 5EZHA 2VYQA 3OG9A 2WD9A 3KJGA 2E36A 5HS4A 3HEMA 1K78A 3DM9B 1Z74A 3CCRP 1XQ6A 3DWLE 3JRXA 2HNAA 1I36A 4KLAA 2BR3A 1T3UA 2QUFA 1PK7A 3OQ1A 3L1VA 1RT9A 2OBFA 4M74A 4BXLA 4C9YA 1UKYA 2WPRA 2HWUA 4QXRA 4JA2A 1E6EA 1YS9A 3EZYA 5KTYA 2RGGA 4L28A 4AJHA 2FR8C 5CEFA 4ZHQA 1OXXK 5IAEA 2ZJPF 1RRVA 5LU9A 1DAFA 3MD2A 5D5QA 3G9QA 3CC8A 1E2GA 5K3AA 3N8KA 1QPMA 4OIPF 2G1PA 1UC5B 4BXFA 1H4TA 2PAFA 5GINE 2GEVA 1GZ4A 4FINA 2CV0A 1Z7YA 4PYOA 4P34A 4EUKA 2ERCA 4NAVA 4EI9A 5HSGA 4H6WA 4Z7QB 2XUOA 5EESA 4DSTA 2Y0SN 3PTZA 2VPQA 1EZVG 1D5CA 2WFLA 3CC7P 1FP2A 1NASA 3VGPA 4AD9A 1D4AA 1CUCA 4Q1AA 3B52X 1YTLA 4A1FA 4GD3Q 1GPUA 4KWTA 3SEFA 4BO2A 1RPTA 1T6XA 5ILVA 3F78A 1NFQA 2A6HF 5IHXA 1XDWA 4Y1EA 4DMFA 4R1MA 4RHYA 1VOTA 3M82A 1RCTE 1EDKA 2O9JA 2CZGA 2J67A 1UBJS 4MV9A 2PVPA 5HZGA 2D06A 3HADA 5KYNA 2PKWA 4F85A 1GUBA 1UOEA 3QKWA 3IEKA 2EFOA 3FISA 2OESA 1RXWA 1GZSA 4WFJA 3VYTB 2G0EA 2MSDB 2QROA 3U7IA 3GLIA 3WLIA 4URWR 2Z5FA 1F1BA 4KAJA 1UWLA 2OCGA 5CJ4A 3FOFC 1F4LA 4Z2YA 3OP4A 3EW7A 4N76A 2DWQA 1L5YA 4YXFA 1W29A 4BJ5C 4BX8A 3ACBA 5K1ZA 4O5AA 1FFHA 4TOIA 4BFWA 3VKFA 1FLDA 3WIOA 2JA2A 4AMUA 5K6RA 3CUSA 3DBHB 4KICA 3EXFB 3ILHA 3MJRA 2VP0A 3KDPB 3DO5A 1A5ZA 2OSVA 3DOOA 4IKFA 1TKAA 2RHMA 4XYBA 2XC7A 5AJZA 3CTAA 5JS1A 1XHLA 2CHFA 4ZMSA 4FYMA 4DM3A 1X3LA 1WMSA 1U2ZA 1V9LA 2VUSA 3I5YA 2J5XA 5C7OO 4QDTA 1X7WB 4XLAA 3UFBA 1BKDR 1Q2NA 1OF1A 2QQBA 3I0MA 4CKCB 1LJLA 2SCUA 1YVEI 5TSDA 4QTZA 1OY1A 3K96A 2Q7OE 3BCBA 1RP1A 3UMYA 2WM2A 1AA0A 2D7CA 1A31A 4K9RA 4KQMA 3C3PA 3SYTA 1GQQA 4HQEA 5M2QA 1Q44A 1L4HA 3ISPA 1UDAA 1R71A 4IL6X 1QIIA 1RZVA 1U3VA 3GTMJ 2ZCJA 1GQFA 2ZR7A 2PUTA 4BAGA 3B9PA 4YLGA 3L04A 1IK9A 3ENWA 3STXA 1V11A 5JLXA 2EXXA 2Q41A 4ENSA 2XR1A 5BOXA 2Y66A 1HA3A 1Z38A 1YZHA 1ZVKA 2R79A 1G1MA 1UZLA 2J4DA 1P4HA 1UWCA 1VF5D 4QOHA 1PJ8A 3HM9A 5IM4A 2OYSA 3FM9A 1VKHA 1B3BA 2YWGA 3PHBE 3CCUI 2A5WA 3F6YA 3QP5A 1U1IA 3ZCVA 1EHYA 4JP1A 5A1TA 3FTNA 4HI0E 2R5NA 2V97A 5T4BA 2GLUA 3LGXA 4TXJA 4D3YA 3PJGA 4NU5A 5FBWB 1OVUA 2ZYAA 2G4CA 4AL4A 1BDBA 1JUSA 1XXHA 3K16A 1W0CA 2QN3A 1XZIA 1KYVA 4UQPA 2VUTA 3EPHA 2EWWA 4LVCA 3LSRA 1G7SA 3N7NA 2A45I 4F4FA 1IDN1 1ZNWA 4RFVA 5JAMA 3HL2A 3BN3A 4D5CA 2ID4A 2NPSA 4XGQA 4CGYA 3T1QA 2AKYA 3K6SA 3H1IG 2GCPA 3ZJ5A 1ML3A 1XQXA 4KPUA 1G21B 4UE3S 3M1CA 1P92A 2RB5A 3G7UA 1D8AA 5AWFC 2VDUE 2H5EA 4ZT6A 1ZD4A 3AZQA 4UNSA 3H1JD 1YQAA 5CD9A 4TTQA 3I5AA 1K06A 3N8IA 1OX6A 2XRNA 4PLHA 4PXSA 3MGBA 3VR1A 2OTCA 4TRMA 4LGMA 4HGYA 3G2JA 1JTXA 4BQPA 4Y9TA 3UPDA 3BIXA 5I7AA 1QHHD 4ZQHA 1KOGA 1SVIA 2E5YA 4F5WA 4R9VA 3DVLA 4JBZA 3W8DA 2D2WA 2W6JH 4RVFA 5L45A 4REMA 3RFCA 2O07A 1MCZA 4MPRA 1IONA 3N8DA 4MVJF 4C5BA 2X1EA 4FMCF 4CKWB 1TCAA 3DYIA 2WSSD 3EH2A 2AFIE 5IG2A 2FKNA 4CTKA 2JEZA 1CS4C 3D4NA 3S6JA 2ZYSA 1OOEA 4GDFA 4MR8B 3AERB 1KEVA 3RT1A 3D3WA 3Q3CA 4D4GA 3FDZB 1GG5A 2YY6A 4MAAA 2GPJA 1SA0B 2GRUA 2VHWA 4NBVA 5D1HA 2M34A 4M83A 3AVTA 3J80Z 3GLHA 3K4HA 3IUEA 4XLLA 4L18B 3QKUA 2YNMD 2FLWA 3EAGA 1RMTA 3A7DA 2HODA 1IXZA 3AQIA 4GXNA 3IP6A 3WYGA 4RKUJ 3CUEF 1EDBA 5LMNB 2A5DA 1SY7A 1REQA 2N8GA 1P0CA 2QPLA 3SIPA 1F51E 4DYDA 3I32A 4JQCA 1G5IA 1P29A 4DT1B 4R2LA 2VYNA 3ZV5A 3LSHA 4UEJA 3NRCA 3JWEA 4HNQA 5EZYB 3V7CA 1SU8A 5EJ9A 1X7YB 1LI5A 3WLAA 2UUOA 2BEOA 2KP8A 2DLLA 3FXOA 2DP4E 3PDUA 3E18A 4MLDA 4C7KA 5I7SA 1MG5A 2E3JA 4BGVA 3CNQS 5FOVA 2NXEA 3OPVA 4FT8A 3TPCA 5KDLA 2YZNA 5IBCA 4CLOA 3TDMA 1L5HB 4Y2HA 1ZI8A 2FW0A 1W25A 3QBEA 1XJQA 2ECOA 4HFMA 2FFAA 4BGDA 2Z57A 2O3UA 1KSFX 4NH4A 1C7IA 1YAHA 1SD2A 4WZAB 4EW3A 1UJ5A 4TUYB 2Q2OA 2Y9YA 3CJTB 5CT6A 1WGXA 1TC1A 1VP3A 2KB7P 2OENG 2DRIA 4N0PA 2VF2A 2B9SA 2VSXA 4DMLA 5ALTA 1M1YE 3ISTA 4RVNA 1CUJA 3DTIA 4N4OB 1E4VA 2AE2A 4HLDA 4YK7A 3E8MA 2BFWA 2VF4X 2FJ0A 2IHJA 4DLPA 1E59A 2XQGA 4PIPA 3GP5A 2IKQA 3H8JA 2FWJA 1EQ2A 4MTCA 2R7VA 3MBKA 1TB4A 2HQNA 2C4WA 3CUUA 5MN5A 3DDSA 4YPCA 3PUIA 3FPCA 4PXAA 3ASNH 3E9NA 1H9AA 3V5BA 4MEJA 4M8KA 2XAQA 4KIBA 4UUMA 3DZJA 2VJAA 2IU6A 1E1YA 4AYCA 2E7ZA 2BJVA 2RKWA 2Z83A 1IJEA 5JZOA 1FBSA 3FNQA 1P7ZA 4HS4A 2UVPB 4LVNA 4W5OA 1D1CA 4C4RA 1A77A 4TYWA 3TQIA 4PQFA 1DKMA 1RJGA 5AK4A 1PP9D 2JF0A 5M7EA 4Z86A 3BIFA 4EJUA 1UAYA 2MU1A 2DAOA 3V2HA 3SD7A 4P1ZA 2ZQ5A 2ZVJA 2E37A 2H0RA 5LIRA 3DPSA 2ZUDA 3QF4A 4OG2A 3OOPA 4RLFA 3D7MA 4ZJUA 5D87A 4OIRF 4JJ8A 5C8YF 3K9CA 2Z2XA 1QCYA 1YVPA 5KCMA 1SFCB 2JATA 3RCBA 1C9NA 4GI2A 1S72P 2NZ8A 1I6KA 4V1CA 1FIPA 3L36A 4GFDA 3GLFB 1GGMA 2JIMA 1SQVJ 1UMCA 2XMDA 4PGAA 1D09A 1DTEA 3Q3IA 3LT5A 3OEEA 2IYYA 3F7OA 4ETMA 4A4DA 1ANKA 3OJCA 1M2WA 2OYIB 2KZIA 3F49S 4PQRA 5DM60 1YTZI 1JE0A 1CIVA 2CMDA 2MH2A 2G77B 2QTVB 2AS0A 3P20A 3MAJA 1W30A 1U28C 1SQXJ 1Y8RA 3GRVA 5EERA 3FXMA 3H25A 4GC9A 2AV6A 4A6PA 2OVFA 1G3MA 1TC3C 4HVTA 1KDOA 1UJ2A 1R9JA 2GEJA 4M9QA 2I6XA 3NGXA 4BFYA 3H0EA 4A3EJ 4PXYA 3HVHA 2ZI7A 2PIAA 4D42A 3P0HA 3GBPA 4S0HB 3GMTA 5JCOC 4C3IJ 4UZFA 3ADKA 2RIPA 2AZDA 4ZU3A 3QVXA 3ZMVA 4F5ZA 4YRMA 3FIWA 5FO0A 4IIBA 1IUYA 2EP8A 3CMYA 3BXGA 1TBXA 2XYPA 4RDCA 2YHAA 1ILWA 4CMEC 4LW8A 3AETA 3UJ8A 1ZIOA 1J0AA 4UM7A 1PG0A 2P58A 1J75A 3AKEA 3IIKA 3IMGA 1E98A 3RCOA 5DYYA 4K03A 1F4PA 2Q7XA 2VDRB 3NEPX 2VP4A 3G49A 5DS9A 1G4DA 1EUZA 3M6LA 1TA0A 5FJJA 2PZMA 2C59A 4PFQA 3DMFA 1YC2A 3H36A 2OQQA 1W4CA 1U63A 5DM6F 3FZNA 3UG7A 5GMOA 4GOFA 1ZK1A 2I2XB 1KL7A 1MJHA 5IXYA 4JBHA 1MX3A 3KL4A 1C3OB 3LC2O 4N03A 1YFJA 4K46A 1Z4KA 3NKVA 4GIBA 3VR6A 1KSHA 5E8IA 2BEJA 3KUUA 1G8MA 4ZZDA 1KAGA 4M36A 4D56A 1SANA 5JMPA 2VEOA 3WO0A 1BNCA 2F8MA 3EIFA 4ENNA 3W5SA 5A2QZ 4IJKA 5GJWC 1NXQA 4BOYA 1IBRA 2R4UA 5CNMA 2CL7X 2HBQA 2ZJBA 4KWHA 5DMXA 2YJGA 4A7PA 5IH7A 1E63A 4IIEA 2WJ4A 1XTUA 3F74A 5FLMJ 1C4WA 2R65A 1GKLA 2O2SA 4BY7J 1XSDA 3CCSP 1HUCA 4GFBA 1A95A 1C0IA 5E6UA 3RSSA 3TTUA 1YRAA 3NDJA 4H0EA 3DWFA 1PS0A 1RM0A 2LRHA 2WYHA 4B6QA 2Z2YA 5EZSA 1D1QA 4B32A 2WSFH 4HDRB 4FFBA 3SYLA 3C4JA 2W6CX 5D3MB 4E46A 2QKYA 1JI3A 3AB8A 3V42A 3I0ZA 2P2ZA 1J8YF 2BY3A 2XUQA 1L4YA 3Q6MA 4UQOA 4H4CA 5BURA 4D9CA 3F3SA 4X45A 5A5EA 3PCXA 4Z0NA 4HDNA 3HXTA 4LF6B 1YDWA 4B83A 3GAFA 1FDTA 5EIHA 4BMOB 2FSGA 3NHBA 2O8XA 3KPWA 5BSHA 2NUPA 1XCJA 3B1XA 5E9QA 4REQA 4ZCIA 4II7A 4IOJA 4I3GA 3NKFA 5B5SA 1RD4A 3JALB 1K8RA 2BMWA 4PCQA 2GDZA 2O2EA 3UMSA 2QX8A 3GT7A 4IIJB 1CR1A 2F48A 3DC2A 2F64A 5DNAA 4NQRA 3OA7A 1W4RA 5IY5H 1QFZA 2J7PA 1U0RA 3N70A 4GKJB 1Z8DA 2F43B 3WNDA 3G9RA 5C39A 1M8JA 3AR5A 4M8NE 2O4CA 5E7IA 1I0LA 1NTZJ 1RZ4A 2VNSA 1V43A 2BGGA 5BUQA 2PV7A 3V8VA 3DE1X 1TGYA 2GM3A 2NVTJ 5JBQA 3EN0A 3V8JA 3HM5A 1M7BA 4TT3H 1SGWA 1VHLA 3EFOA 3L1PA 4XEUA 4MO7A 3A9VA 2ZQYA 1E1CB 3R7NA 4BFXA 3W1WA 1Z3IX 2CQQA 1LPQA 1MNAA 5JS8A 1YTZT 2C9BA 1XCPA 4NYJR 4ENRA 4Y6PA 3QVGB 1G8YA 1M57D 2H9YA 1ZMEC 5CA1F 2Z4RA 1FOXA 3R6WA 1Z91A 4RZ2A 3ZP5A 4M3GA 2CK3A 3HCEA 1IHOA 3H1PA 1OA1A 1S9HA 3M6AA 3HMQA 1VMEA 1Z29A 5T4HA 5JPCA 2RH5A 4QNRA 1NL3A 5CCGC 4RORA 1EP2B 3LTNC 3ETCA 3PWKA 2B20A 2FPUA 2VDKB 3DDWA 2PKYX 3ROEA 1K73Q 5K0EA 5CTJA 1SKUA 2UDPA 3E5RA 4XWOA 4UKDA 2W43A 4Y2JA 5EVCA 2UKDA 3Q3HA 4EM2A 2QL5A 3D8TA 2O3QA 3ZMDA 1EM8A 1D7MA 5EIBC 1UL1X 3HB5X 1EPUA 3HE4A 5A3RA 2FYUG 4PINA 4AECA 2BRUC 2YKGA 1YZYA 1I51A 1Z9BA 4GR9A 3K2EA 4NIMA 1C4OA 5KQLA 2XB4A 2WY8Q 1XTJA 3DFUA 2MYNA 4CIVA 1DG3A 4I5FA 2JCBA 5IBRA 3WK4A 1KJZA 1EFHA 4G0PA 1KU0A 5J9FA 2JO1A 4Q0MA 3MFKA 2WZ7A 3B02A 5TLSA 2RDPA 1QKKA 3Q7EA 3L37A 3FW1A 1K4TA 4LWPA 4IFDK 3BVPA 4CDGA 2WVAA 2OR3A 1XTIA 3CXUA 4IJMA 2WIGA 4D8TA 2FOXA 2RAVA 3WBJA 4GPZA 3FFBA 4YFYA 1USUA 2JAWA 2XNDA 2ZJ3A 1YDGA 4BTVA 2A1UB 3G2LA 4W5JA 5EA2A 3SS7X 2ZMEC 2J31A 1CEXA 1E89A 1YAJA 1NTZE 3CMMA 1SHLA 1W5BA 4H4DA 4GOEA 1EGQA 4JK3A 1BIFA 4LIVA 1Z4LA 1D6MA 1XJ0A 3B5ND 3O8RA 1X58A 1Q3TA 1O3SA 1J2UA 2Z5IA 3P9SA 2FZEA 1KILD 4FZRA 1AQJA 1CUZA 2VDLB 2DMNA 3LQ1A 5F78A 3VISA 1CDEA 2GKGA 1RYYA 4PG5A 4G8CA 1US8B 1S2NA 1A8SA 2WHPA 1RR6A 5NULA 4IDHA 3WB9A 1AG9A 3BSFA 2HCBA 5CVIA 5AW5B 3GEHA 3QPLA 2UZ4A 3GPCA 4WI1A 4TT3D 4U3JB 2QA4P 3EMDA 1K6OA 1GMJA 2HA6A 2ZMEA 3PUWA 3WK5A 1J2JA 1STOA 2ZIZA 1E2HA 2LRDA 3ZS9A 3ZHRA 1GA1A 3NVMB 2E76B 5HX7A 4RGBA 4MV7A 4Q00A 3OX3A 2Q0OA 3C5CA 3R0IA 1JAIA 3QEJA 2CO5A 2VKDA 1BOFA 1DX7A 3IDQA 3S8YA 3K9HA 5JW6A 2FI1A 2VB6A 4TKVA 1DPUA 1S5PA 2B1QA 3D3KA 3GIWA 2RHHA 4Y0AA 2YN0A 2NNWB 1YQDA 3RYCA 1GDTA 2IVZA 3AKZA 2JSPA 3MEQA 3LXMA 1PR6A 3M6MD 1V7PC 3PFNA 3BL5A 3M4NA 4A0YA 1GGHA 4F4IA 1EE9A 2XNDH 3L72J 4LB5A 1YHQP 1RQUA 1S2OA 3JRBA 4NR0A 1KSJA 1PG2A 5KEIA 4AAYA 3K1TA 2Z58A 3DVQX 3FCUB 4OX9Y 5B66C 5JI6A 4IQFA 1T4GA 4Y1FA 5FYQA 3L75E 1WZUA 4PYQA 3KTAB 4WOKA 3P2EA 4CT4B 4EFKA 4PG8A 1SCUA 1MZBA 2Q5IA 5HBGA 1OVGA 3QLVA 4NC7A 3C85A 5JANA 2W4MA 3GLKA 4Y7DA 5LLTA 2N0SA 3EW9A 2AG8A 2E0IA 4JI6B 4YCJA 2PY6A 2N47A 2F1IA 1NY5A 2RHDA 3DT6A 3IV7A 1LTKA 3V7UA 1MIHA 2DWOA 5K20A 1YI2I 4Y2QA 3RH0A 3U3KA 4IG9A 1OCTC 1OZAA 4GGMX 5CPFA 3H9EO 4KP7A 2RAUA 3G8BA 2F3PA 1WBDA 5F9FA 5K0JA 2NZVG 5DTJA 3CLOA 1IN8A 4BC0A 1DBSA 4II3A 1KYOI 2E87A 1CY7A 3LXUX 3WLFA 5CHXA 4DVGA 2CCGA 2IDBA 4R9SA 3JX9A 2Q3EA 4DDKA 1QOQB 4NENA 2L91A 3QXJA 3WISA 3ZWQA 1N2XA 1I1HA 2M32A 4D96A 3O8LA 5I7VA 4B86A 2WFZA 1DFHA 1N4DA 4ZYHA 4TS1A 3BM5A 4IDPA 1NW5A 4Y1GA 2CH0A 3UJCA 1VCMA 5K8JB 1ST3A 3RFTA 2WKWA 5KSOA 3BC1A 2V7GA 4ABZA 4K9QA 1RE1A 3GOHA 5B4TA 3CE6A 4RH3A 1CQIA 1NYHA 2RI1A 2WKPA 2C83A 2HU7A 1S1CX 2QBYB 2I4LA 3C5EA 1K3FA 3RVNA 4LIUA 2BXYA 2JI6A 5JPDA 2X1HA 4Y2VA 3G82C 1PHPA 4HAYA 3UXEA 1QQTA 2IYTA 3G1OA 1JVSA 4V0NA 4IL5A 1DH3A 1R0KA 3BRCA 3AE8C 1PVDA 2QTRA 3ZHUA 1ZN9A 1FZBA 1KJIA 4JOCA 1HLDA 3RSHA 2XGOA 2ZXWH 3HKBB 4JELA 4JC5A 4NEGA 3DE0X 3PKJA 1G9SA 5GPCA 4N0BA 1RKWA 1QORA 2H8RA 3LZDA 3OM8A 2X0EA 1AZLA 2P2LA 4WFIA 4CGZA 1GXQA 3T3NA 1AN9A 3IAHA 2J32A 1EU1A 1AQIA 4NARA 4FGLA 2DCUA 4QDXA 3M9HA 2CLEB 4R2HA 3FOEC 2GXSA 2RE8A 4RH0A 1XWFA 4JUCA 4CO8A 5HKBA 1SCKA 1AC5A 5TRDA 1OVMA 2MIIA 2J3MA 3R76A 1A98A 3HVRA 2QRLA 3OEED 1CNFA 1ZS9A 5BNIA 3T1BA 3NM6B 1VMAA 4P83A 2KPOA 3URMA 2Q9UA 1Y1VJ 8ABPA 3VYSB 3ITEA 3KZIC 2RG7A 3MOSA 1M0EA 3B60A 3Q0EA 4BJ1A 5ES4B 3JAKA 4FASD 1ULAA 3VR2A 3A4VA 2O0LA 4PYMA 1JWBB 3UKDA 4NNPA 5CK5A 1KAEA 2NU6A 4OXNA 1G6OA 2BT4A 1WOYA 4MINA 4E4HA 4HKZH 3N2IA 4TMKA 5GQSA 1K9VF 4WNAB 1DBPA 2P1DA 1IBCA 2PWYA 5D4RA 4N0QA 1JKJA 3A1YA 1SEVA 2ZS7A 3JYHA 2DERA 4JA0A 1BMFD 3X1MA 4C0QC 4MZXA 4JYZA 2GOXB 1Q77A 3L7KA 2VBWA 2BMAA 5DOZA 3LLSA 2NZWA 2JAHA 1RKTA 4IIYA 3PF8A 2E74B 4WESB 2G09A 3EGDB 2ROQA 3LLCA 4BQAA 5EWJB 4PSCA 1OZ0A 2NXJA 2VRCA 1C2YA 2HU5A 2BFBA 2X9QA 4Q7JB 4ZEWA 4ENQA 4DB4A 5LP6C 1V9SA 2ORIA 2XCQA 4FXPA 2XOKD 1AGYA 4P5OA 5CBPA 3SJZA 1Z5VA 4MSUA 3K2AA 4UD6A 3VKVA 1F2UA 5IT9Z 1A71A 4JVNA 1S8AA 1VQ6P 3DE3X 4L0ZB 2C94A 5JJLA 3RJZA 2IU3A 4M8IA 4Y9UA 2WWIA 2OAP1 2C2WA 4JT4A 4L8LA 4D6XA 2ZXIA 1M75A 2ZPUA 5GVRA 3T5XA 2PWZA 4N54A 5JC8A 4V0QA 1R5GA 4FPXA 4WHMA 2QN6A 2DUMA 4E5YA 2IEAA 5B5EH 4OHXA 2PJPA 2FXVA 3P2YA 3ZNQA 4GOXA 3EZNA 1ZK8A 1A36A 5LP6A 2W4SA 2P9QA 3HSFA 5CAEA 3QEMB 3JSOA 4DV6B 3RG8A 2DF8A 13PKA 3ECOA 1HDEA 4V0ME 2I3GA 5APQA 4LZPA 5J59A 3ZWYA 2Q3IA 5B30A 4F46A 1BXZA 3M6WA 3FWHA 1ABFA 4RZIA 4S1TA 4QM6A 2OYRA 4YJFA 5D3QA 4R1PA 1AB6A 3QBJA 4G1CA 3TW0A 3H1AA 1HQDA 4QBFA 3FPKA 4XLTA 1XEXA 3DXYA 3L40A 3QY9A 1XCLA 3U9LA 1L7XA 3ZXUB 2EARA 3IVGA 2PEZA 3UGKA 3P9ZA 1LB2A 1T36B 4JGBA 1KMQA 2IS6A 4G1UC 4OP2A 2JA5J 1YVRA 5F3DA 1EFPA 1I4EB 4QDOA 3IHLA 4WZBB 1KU3A 5ALLA 1FB5A 1T9BA 4FNOA 1QYDA 3HSEA 1PK9A 4Q4AB 5DCUA 3SHTA 4JUDX 2DA7A 4QUJA 3PUZA 3VR0A 3T5PA 1MAAA 1WSBA 3HO6A 3E5QA 4O4LB 4G1VA 4BIMA 1L4NA 2WWVD 4QT4A 4BDYA 1QHEA 2YOGA 1I2ZA 3JZDA 1YMQA 5JVDF 1V3UA 1YHNA 3N2KA 3NDIA 3KP2A 2DEUA 4XDHA 1G5RA 4WX2B 5JLJA 3RK2B 3VEPA 2Q1WA 1NTME 2C8KA 1P4GA 4FMDB 2P90A 5B53A 3HSRA 4EYYQ 1ISGA 1QE5A 5EJ2A 3R7WA 4FTWA 1U5AA 3S0JA 1OKKD 3OZTA 2Q7CA 5KK1A 4IEIA 2H4FA 2O2JA 3WGGA 5EZQA 3DF8A 4MRVA 1G6NA 2QUHA 5CYFA 1RI7A 4QLOA 2G5CA 2WHXA 2GZDA 1LLDA 2PXHA 1D2EA 1F9EA 5D3ZA 3LIPA 2C3OA 1IZZA 1D6SA 2Q1SA 3G0IA 3QA3E 3ED1A 3R3HA 3OC6A 1DIAA 2WG1A 4CG0A 2XHKA 5B58T 3FYDA 2QQGA 5KJ1A 4MGKR 1MC4A 2C3PA 1YR2A 3RSGA 1DQPA 1FP4A 3B9BA 5JD4A 3NHYA 4I8DA 2OXTA 1T6ZA 3UK6A 2N46A 5IARA 4YRLA 2O8EB 4GT1A 1T8UA 4JX9A 4B7UA 3B13B 2QRZA 2JLZA 1E1QA 3W9UA 1QTQA 3GJ5A 4B8XA 3QUAA 4X63A 2Q21A 3UK0A 2FSHA 5IZCA 5BPIA 1IK6A 4UHTA 5DM70 1QRTA 1M56D 4JFAA 3EIEA 3QWAA 3OIOA 4GMKA 1ETOA 4QG7A 5CX1A 2A06D 2CGEA 4P22A 1JHVA 2I8CA 5FKJA 1JFLA 1JKIA 2ODWA 2WM9B 4XZ3A 5EP1A 2RHLA 4L0YB 1LDEA 1P9QC 1DKPA 1FQOA 2EDAA 1Z0KA 7REQA 2P6UA 1TT5A 3ON5A 3L0ZA 5D5PA 2OG1A 3CF6R 3SBDA 1E79A 3AU9A 1SQQD 4Z4QA 3W8FA 2QGNA 1Y1SA 2R5YA 3NWTA 1Y3CE 2Q1UA 3RJMA 5EE1A 4DGQA 3UB2A 1E6WA 3BRTB 4IJ6A 5EPEA 5CFOA 2C2XA 1NVTA 5IZCC 1TF5A 4WNIA 1PYDA 3E6CC 2GA9A 1HDPA 5DX0A 6NULA 3I37X 1JT6A 3S32A 4MHSA 1Z88A 2H89C 2BW3A 2FEAA 4AI6A 1FDVA 1KEZA 1KY2A 3DMDA 1YRLA 5U4XA 3QIVA 3TEJA 4HATA 4LJZF 3K71B 2G5GX 3RVPA 1SCJA 5LP1A 1VZ3A 4M1TA 4KUMA 3MK31 3F3KA 1XMSA 1F3LA 2NVOA 2K6GA 2MJLA 3OSZA 3EPRA 1NR5A 1ILEA 3HWRA 2AJDA 3P19A 5AONA 4B48A 4KRFA 5H16A 4ANFA 1HFKA 7YASA 2JDID 2G3YA 4PV1B 2OGSA 3UM9A 4BVKA 3KLPX 4MUAA 3GLIE 1RC0A 1QTRA 1VL0A 3WGUA 1BQEA 1IBSA 4DQ2A 1ZVQA 2V9PA 2JZCA 4LOAA 3MNFA 4HXFB 3P4UA 3ZK8A 5DCWA 3H2HA 1JR2A 2VT6A 3A1DA 3CN9A 4LSGA 3DEHA 4UU1A 4TTIA 5I8PA 4NZPA 3OQBA 2Q5HA 4QOSA 2DHRA 3F5QA 4M0LA 4EKGA 1DFIA 2GZHA 3WU1B 4Y98A 2O8DB 1Q92A 4G5OA 1CR0A 3WQRA 2DBBA 4ZVNA 3TW8B 3AZOA 4TL6A 4PSWA 2QTHA 2YHIA 4JN6B 4R40A 3ER9A 3GUYA 2SKEA 4C4XA 1E5VA 4IHTA 4A5MA 2B1GA 4WVZA 4LXTA 4YT2A 1EQ7A 4P96A 3HU3A 2PNJA 2EPFA 3TFOA 4UZSA 5G1OA 2YNYA 1NAIA 2J3QA 2NS0A 4OAYA 4DG9A 1TQPA 3AEXA 3B73A 3C7AA 1GAXA 4U7FA 1WF6A 3VHQA 2HCRA 1JY2P 3W6JB 3HKZA 3OA0A 4PGMA 4F60A 3Q7TA 1ZD9A 4GYJA 2RIRA 3NPAA 5BXYA 1PT8A 3A2LA 2ZR8A 3OT1A 5FROA 5DCLA 3N74A 1KR5A 4OYYA 4OH8B 3RADC 1SFCD 4CH7A 1K5GA 4RK7A 1RQPA 5E9AA 3QZUA 1G1JA 2XRMA 4YIFA 4UNPA 1O7FA 4D45A 4B9AA 4C07A 5AKLA 4CL8A 3LHKA 2H1FA 3MP7B 3L3BA 1EV7A 3DJYA 5IJZA 2YDYA 4BV2A 1ZOSA 4GQIA 2VASA 1H6DA 4HRIA 1JJ8C 4B80A 4U63A 1JI8A 3PQ6A 3UJPA 1PYVA 4IJVA 3OIFA 4DC1A 3QAHA 4H0CA 3VO2A 5BVHA 2JHPA 5KTSA 4DR5B 1N7SC 4IOCF 3W7BA 4HB2A 2C1XA 5CGQB 3GA7A 4LVUA 2GLOA 2NV2B 1W75A 1T3JA 1WUIS 4DMUB 1ZVVA 1NPYA 2GJ8A 4ZDWA 5BPDA 5JSZA 4EMSA 4Z0HO 2P10A 3SZRA 4ENTA 4YASA 2XBUA 3H5WA 4ASUA 1GTJ1 1QYRA 1DPRA 2X1LA 3HO8A 3UWOA 4F4JA 4P5PA 4FQ7A 4AIIA 1I14A 1S8OA 3I4NJ 2JFFA 3R3UA 1NG1A 5JO9A 2MWMA 4E88A 4AKSA 4LPKA 1IXCA 4ZXPA 3KELA 3STTA 4G36A 3EDYA 1XVIA 3MJFA 1D5VA 3UJ9A 4HDSA 3FHOA 2X9VA 4ND8B 3DBOB 4AM3A 5H3CA 3A05A 5TB5A 3HFRA 1YJCA 3W5VA 3IAOA 3FKJA 3GX1A 1XZLA 3O1LA 2FSUA 3HNRA 2JGKA 4BKUA 2OXRA 1HE4A 3PD1A 3ZMUA 1EBFA 1T8ZA 4DXDA 4WN9B 2FPOA 4M7RA 3LF2A 3HUEA 3M6UA 4GR5A 4MS4A 5DTRA 4JY7A 3COPA 3RHSA 1HXHA 2CMFA 2VXYA 3WMEA 2MSLA 1OW7A 3TSIA 3QFRA 3AFGA 2N3ZA 4EMUA 2ZFUA 4HQLA 4ZU1X 1RAAA 1LBQA 3O8QA 2ZXXA 3GRYA 4GOMD 3ZLUA 5C4XJ 2V5VA 1NZJA 3L7WA 2B87A 3L0OA 2WJJA 2MDTA 1Z62A 2OOKA 1E3IA 3ZDBA 4AUEA 3DE6X 1EEHA 1VPTA 2JHAA 4QBTA 4FSDA 4F2DA 5A06A 2AYZA 3KUCA 3CVYA 1X4OA 1SKBA 3SE0A 2A94A 1CUBA 4NV1A 5HLHA 4PTZA 4RA9A 3JASA 4J1TC 3S99A 3UAWA 4CQMB 4DR2B 3HYSA 1E6MA 1OKKA 1VBKA 3I5MA 2PT5A 2ZTUA 2JGMA 1K9MQ 2OEPA 3UJDA 2XBMA 1CJKC 1T8RA 5U9CA 3EWIA 4LMAA 4U2EA 5FH9A 1U3CA 1P2BA 1SBYA 4J01A 4CYCB 5EIFA 2ZCVA 3SDBA 4R1HA 2P9FA 3LPLA 3E1KA 3ROXA 3LDFA 4OAPA 2WZQA 3I4PA 3SC2A 1KETA 2OMKA 3DXFA 3TP3A 5LOVA 4PO8A 1IM8A 1ZK0A 3U5TA 3GUVA 4DSOA 4RIIA 4LLLA 4DF3A 2P1ZA 5BR4A 1NC1A 3T06B 4OINF 3T12A 1WZEA 4RABA 2RGUA 1A8PA 4URFA 1C5KA 2ZWIA 3V4RA 3RC8A 4PWYA 1BKSB 3ZGNA 4DW6A 2GQ0A 3SR4A 4W7YA 4GZMA 4RVOA 2J9FA 3CSDA 1HH4A 2UVDA 1UBHS 2O6LA 3CLKA 1QQ5A 2NU6B 4DCUA 2MSEB 3R0XA 3IR6A 3QU4A 2ZBGA 2C0PA 3JWIA 4DV5B 4C01A 3RIYA 2XXJA 4L7QA 4LBVA 4JIMA 3JSPA 3OX1A 3S2DJ 3EF3A 2VNAA 3GLSA 1JLLA 1QVWA 2DY1A 4ZCPA 3ESXA 4YWHA 4QAQA 1ETHA 3V7NA 4M72A 1M2OB 3QPSA 2UXXA 1EB8A 1TF7A 5C31A 4F92B 4ZMBA 3VSLA 5DP2A 5JCJD 2H51A 3PNQA 1XK7A 4W5QA 1MBFA 3PM1A 2AOUA 5LYJB 3IESA 4AJOA 4MWTA 3MTDA 4PLWA 4NEHB 4FS8A 5JVGF 3N2GB 3ANSA 1P19A 1PV2A 3GXOA 5BT9A 3OEYA 1Y0UA 4U9IS 3BMNB 3SE7A 1ZRTE 2BMEA 2W7TA 1SVWA 3LY8A 1ZRSA 4TV9A 1ADCA 3CLSD 1WMFA 5B2EA 3FI9A 4CF4A 1FTWA 2INGX 4KXXA 4Z9YA 2IUEA 1OU0A 2NU7A 4L9WA 4J8PA 4B3HA 1XL1A 4C76A 3U1DA 1H88C 3S15J 2X3FA 4BJ6C 4RB3C 2BL4A 4XRMA 3IAM2 3WO1A 2JSCA 4ROSA 3AG2H 4YXWD 4E6EA 3CWQA 1CHNA 2P69A 2MT9A 1GVDA 3KLNA 2GZMA 3RC3A 4O9BA 3ADBA 5HJ7A 1AV1A 1B4DA 1GCUA 4KNVA 2CLKB 5HZMA 3LCVB 5CT4A 4C22A 4Q5SF 5HE9A 1SIWA 4HAOA 4OQFA 1HL3A 4DEXA 4L4YA 4BB6A 3L71E 2IPLA 1USGA 4JSTA 2A14A 3PS9A 1F0KA 1ON2A 1B8OA 3B5NA 5EWMA 1ZUNA 5HUJA 4BBRJ 2AOTB 3DBRA 4FR5A 5CAEB 2Q3FA 3WWDA 2H7XA 4M76B 4FCCA 2OCKA 3V1KA 3HE4B 2G6TA 2I87A 2UYGA 4LFAB 1CEEA 4MA0A 2JEEA 5LBQA 3MD0A 3E7FA 1KK1A 1MNDA 5JZ9A 2XV5A 1WXEA 3N3AC 1IEXA 2QM0A 1WH7A 2V3VA 3HWX1 1E3JA 2WW8A 1AS0A 3UUEA 3IP3A 1D3YA 1IJWC 2WD7A 1A5TA 1AOXA 4Q9LA 3CF4A 4P36A 3DVSX 5DD8A 3TM5A 4X62B 5FBLB 2JA8J 4MWEA 1P72A 5ARDA 1YE5A 1BA3A 5CJJA 1FU7A 2P35A 2BY1A 4E08A 3SBXA 1S2DA 3A70A 3EAFA 3ZJVA 3K5IA 2JWDA 2FBHA 3G8YA 1QC5A 2DZDA 2OTKE 3QYJA 10MHA 2WAMA 4OV6B 3GFMA 2VQGA 1N2CB 3H84A 4GI1A 4HRYA 3R09A 3SX2A 1HQCA 4OGWA 4IDQA 3AG5A 2C95A 3OI7A 4CKCA 2P6PA 4OH7A 5JAHA 5E79E 4KXNA 5DEQA 5KLIC 1VSTA 3TLCA 2V4HA 1SN7A 4Q21A 4C6TA 3AE1C 2XMBA 4IRIA 5HTKA 4I46A 1US8A 3T3PB 5JEEA 3H2KA 4EFDA 1UUFA 1L5VA 4JHXA 3CKKA 4TRRA 3WKBA 1HC7A 4ZQBA 4MGZR 5CA0F 1NUQA 1KGSA 3HBAA 2PZBA 1R7RA 3U4IA 5TT0A 1DU4A 2G7UA 3EBPA 4TSFA 2E5FA 3G8CA 3CF4G 4BRSA 1FFXA 3BMCB 2EFJA 2GFQA 3PQFA 1WFXA 3JVUA 3NANA 2LSOA 2E43A 1XEWX 1WSAA 2AUMA 3TNUB 4K88A 5M3MJ 4KPEC 3DWGA 3WFIA 4KO4S 4FYWA 3N3BC 1XD8A 1M2HA 5JNUA 1Y34E 4DXHA 1I7QB 5ALWA 1OFVA 3HR4A 3IC7A 2QJYC 1REQB 3L72D 3SIWA 1X9IA 5FWNA 2XKAA 1LTBC 1Z5GA 2A9FA 3H75A 4HDCA 3DLLF 3CU5A 2DBZA 1X6VA 3Q8WA 3K9GA 1R37A 2B78A 2HPAA 4HEA2 1XTQA 2ZRMA 3KWJA 3V1MA 3EG9B 4OYRA 1JJIA 1F43A 4H7JA 3NCHA 4DCKA 3F6BX 4UAVA 4EBFA 3AESB 1C81A 4DZRA 2C5LA 2V1NA 3EEBA 2AG6A 3K0CC 4QFMA 3TOSA 1Y4SA 1FMJA 3I1YA 4QDKA 3BE8A 1G63A 1KI7A 4JBNA 3A3KA 3PE6A 4QZVA 2IYFA 5ERGB 2JLVA 4H1VA 1WUJS 2P1RA 4YJ3B 3MRXA 3N87A 1GNLA 1S4XA 4G01B 2QSZA 1JH9A 1JAXA 2FZLA 1V35A 4K1LA 2ZXEB 1XOIA 4ZDKA 1GV5A 1CY1A 3A04A 4FMPA 5CXXA 4UVBA 4EQQA 4Y8VA 3LQRA 4UASA 1IL0A 1G66A 3GEEA 3ESDA 3PLNA 1TJ3A 1FSSA 2J5BA 5K4AA 1DTWB 4BKXA 2MBFA 2BTQA 5DF1A 1D6NA 2NG1A 5ED0A 3N28A 1GPBA 1JCDA 1JLRA 4XQFA 3Q12A 1RRCA 4DUYB 2W6PA 1B8IB 1WE2A 1Z4NA 5IT9K 3ZVRA 5IK2D 1FEZA 1TUIA 1XN7A 4MDHA 4EF4A 2HJWA 3RYIA 2X8WA 4MAMA 3DCYA 1UK9A 2E2HJ 2C2HA 2WTYA 1DC3A 2ME0A 2IOHA 1CTQA 2W5UA 3FSRA 4G24A 1M34E 3STHA 4U3JA 2QLLA 1G3TA 4N41A 2QXTA 1F0YA 3L0CA 5MFZA 2Y48A 2OYCA 3ZE1B 2RHRA 1UMDA 2Q3HA 3CCJI 1KZHA 3QWLA 3QFCA 5ADUS 4EO9A 1I3QJ 2BPOA 2REBA 4D3ZA 1TYZA 4UNOA 2WJ3A 2PSJA 1RXUA 4KYTA 1EGHA 5DDIP 3UHOA 4HEJA 1QG2A 2CD7A 3NX4A 2JFZA 3IAS2 1NTKG 2NNLD 3ML1A 2R7NA 1E6UA 2X85A 1NUSA 4ECAA 1LPNA 4YTPC 2Y99A 1KV4A 3IR5A 3FHTA 1BWQA 2GAIA 4B0PA 1SPBS 4M6VA 4CFYA 5HDKA 3FNEA 3M4ZA 5J47A 1LRLA 2AEJA 4F9FA 2WDZA 3S28A 3BZBA 4NV0A 5FKLA 4WTOA 4KIGA 4UW9A 3ZIUA 4G5XA 3WWEA 1ZU5A 2XQVA 2JN6A 1OVRA 1APBA 4KNYA 1ZESA 3PNSA 3LT2A 2CNKA 2YWBA 3GQBA 3U1TA 3TJZA 3Q2IA 3HV2A 1GV1A 2VQ6A 2IU4A 4X90A 1NO4A 4RX1A 2WJGA 1ZJJA 4BACA 4MKFA 3I1FA 3D1NI 3W4KA 2C7RA 3CZ5A 2W85A 3B6KA 3T1HB 4Y13A 1B93A 5K99A 2A58A 3KCNA 1E64A 4E31A 1DTSA 1A02J 2CZCA 3VOTA 5DV9A 4EENA 4F3KA 3L70G 2HK8A 3OIPA 3MHTA 2GSWA 1NTZK 1U8TA 3VI4B 3K72B 2JFXA 2JFVA 4M0CA 1YQ3C 2YXDA 1ETYA 3LOUA 2WJHA 4XSHA 3WK7A 1NBME 5H2FH 4G6DA 3A28A 4EHDA 2W98A 1K89A 1L1FA 5JQWA 2PGXA 3BHIA 3ETLA 1QO7A 2F62A 5AW0A 5DRYA 3K9TA 1T8PA 3UK7A 1U90A 1K88A 2VN2A 4Z7OB 4BMPB 5KTKA 5I3ZA 1BVRA 3P2MA 5LXTB 3A10A 1X94A 5KAFE 3WMGA 2VE9A 3GJQA 5D51S 4KWEA 2Z43A 3S4RA 2B8TA 5IC6A 1CI6B 1FLNA 1W85B 3V4SA 3OKCA 5E6RA 3IQHX 3C9IA 3PQCA 4CN9A 2C7OA 2CVFA 1ZAKA 4XCXA 1NTOA 2JK0A 4GW3A 4UC0A 4KYIB 1OTHA 1TZ2A 3MQFA 4KXQA 2O1EA 3L46A 4I2NA 3U4GA 2WU3A 1OFTA 3I1JA 1OYYA 4PFKA 3H05A 1E66A 2A67A 2O48X 2C5FA 1JKMA 4DDUA 4CUGA 4FDVA 4NZYA 2DBVO 3T41A 4KRYA 2POHA 5ALHA 1MJ5A 3S7TA 5IT5A 4P9FA 3TOZA 3BF7A 5D8KB 1USDA 2QMQA 3D2CA 3HOYJ 1Z6GA 5ALXA 2GERA 3N0RA 1B72A 2KMUA 1NVDA 1W2BO 2CG4A 4OWRB 1PJ2A 1J6UA 3AHGA 1U94A 2YO3A 3HJNA 4ZCRA 2UUZA 1JA1A 3LP6A 4Q12A 5LHGA 1VI6A 2H4JA 3QUBA 3KDAA 2ZITA 3U1BA 4KFCA 4QTUB 1NAFA 4XB2A 4RUKA 4I08A 1XU7A 4HH4A 3HVJA 2R44A 3BIOA 2Z4TA 1Z4QA 2CUTA 1BS9A 2SICE 4WCVA 1BMFA 3CWCA 2A9VA 3K0LA 5FYDA 2QQ0A 2YIMA 3HOSA 2BONA 2GVNA 1OH5A 1XTZA 3UJHA 3KFXA 2Y2UA 5BWMA 1TWGJ 1LTIC 1S89A 1X9GA 4N78D 1YONA 1SVUA 2M4GA 1X7XA 1LV7A 5K5OA 3RKXA 5EQTA 3TRKA 3PX3A 3QVWA 1NQUA 3E23A 4BLOA 2Z3YA 4I0BA 4RJTA 3ND7A 1EK2A 5ALVA 3X1WA 2R1TB 1ISIA 5LP6B 2Q46A 3MWFA 5HVQC 3IVXA 4YAOA 2V6BA 1MBEA 5L4LA 2B6HA 3E81A 4RYDA 1KMCA 1QRDA 2IGMA 3HCCA 3HS3A 1UKZA 3R5HA 4QGAA 4IXNA 1H5QA 2J45A 2D0DA 2F6RA 3EXAA 1QIEA 2J6BA 5CJ0A 2B9BA 5JNWA 1BD3A 2FWIA 1KZ7B 3S2HJ 1UT6A 1QGED 5BN5A 4JJAA 4JX5A 2ATXA 3O8ZA 1OXTA 3E3NA 1PGPA 5CNKA 4UV9A 1T26A 1WO8A 1Q57A 4KW7A 1K86A 5I7OA 2WYIA 2PO5A 3ZWOA 4BP1A 1H88A 2HA0A 2ZM6B 1RETA 1YK1A 3LBNA 4WNAA 1VQ4I 4RQUA 5E6SB 4NMLA 1J21A 1SU7A 1QQ7A 3VTZA 4EARA 3IUPA 3NHAA 4C3JJ 2YZMA 2HK6A 4NU0A 1N8RQ 3MWMA 3KBOA 4C1NA 4R1NA 3LSKA 3M49A 5BMVF 1E9DA 4ZC1A 3ZE7A 3KKKA 1QHSA 1Q17A 1TD9A 3D0QA 3OZRA 3NEUA 3OLYA 1PGNA 4X1OA 4KH1A 1FOEB 3S2IA 2QLFA 1AK2A 1TEVA 2I4NA 1PP7U 1FTTA 4HUJA 3U7FB 5JNTA 2BV6A 1ECLA 5HKKA 2J46A 4WN3A 1T1GA 5I9BA 5AJXA 3IPYA 4RXMA 1UXHA 5KC9A 5JAZA 4PGFA 2HXGA 1LTJC 4FS3A 2J6CA 1GDHA 3FWYA 3T5BA 3HPQA 2CLCX 4BKPA 4EW2A 1EUYA 1M1ZA 1JLLB 3QE4A 4A8JA 2Z1DA 2M6RA 2BCGY 3NM5A 4HFRA 3H9JA 3P9QA 4YI5A 3TQRA 3ZDFA 1SKQA 2CW5A 2QD4A 3JYQA 2G9RA 2CXPA 1W6RA 3P9NA 4Q3BA 2PP6A 1EFRD 3ZHVA 2XXAB 1K4KA 2GXGA 4RM2A 5FFXA 4ER5A 2W2TA 5DM0A 3QVTA 1FNNA 5HR5A 3LLUA 1E1DA 1S7GA 1A96A 3HYIA 1ZQ9A 2PLFA 3GLIB 3TTSA 1CZLA 4JLWA 2QJYB 1U7PA 2B30A 1E2FA 1ZNQO 2KISA 5COQA 2BH9A 3ONDA 1RABA 5FV7A 1NNLA 1CUXA 5A2GA 3VH1A 5CX1B 5EAIA 4D4JA 2ACEA 4LRQA 1XD2A 1P0FA 4CEJA 2XNJA 1JR6A 1B6TA 1W2WB 5D5XB 1RPZA 1JHUA 3GGGA 3MFQA 3QLJA 3L70J 2Q0HA 4RGUA 3FAZA 2HT6A 4XLCA 2VRSA 5IOZA 4PW0A 3EPLA 2RV8A 4HDKA 2QJPC 2WQZA 1WHSA 1JGGA 1CD5A 2M3BA 5ALNA 4JLUA 2DR3A 5G2OA 2HOSA 3ZYCA 4Z6YA 2HUPA 2BGLA 4BE1A 4RJ2A 3DHWC 5JPIA 1SBNE 3HNOA 2XASA 3O95A 2OAZA 2WSFJ 4GG1A 4HNAA 4FNAA 4LXXA 3X1YA 4G86A 1JHHA 1ZRDA 3CP2A 4V19K 3I8OA 3MFYA 2OYHA 3B1WA 1EXMA 3IPCA 1IVYA 1R5NA 3R0QA 3PXCX 1C0KA 1RI4A 5BR7A 3NWBA 4ARUA 4AY3A 4DCGA 2P6MA 4EX7A 4NHEA 3BWYA 4OMUA 2FMLA 3U4CA 4AULA 1ZI6A 3M34A 4IEJA 2NWQA 2R7DA 2Y2VA 1I3AA 4LF4B 1NVVR 1AY0A 2PJRB 2OFWA 4ZO7A 3V97A 5HM8A 1GAEO 2A45G 4GLOA 2I5PO 1ODKA 5SICE 3CJQB 2EW8A 2Z98A 4WXMA 2YKOA 5KNCD 4KV7A 1WNFA 5EKDA 4L4ZA 4N49A 4IKPA 3C2GA 4I55A 4CZZA 3NOVA 1JPNA 3BMOB 1GQYA 1NE2A 1C50A 4B47A 2KPMA 3NIDB 3ABQB 1YFZA 2ZRGA 1YKFA 3VH4A 2B7LA 3H13A 3GDHA 2YW9A 3IELA 2QZPA 4CCJA 4YJHA 2PZEA 2BFMA 2ON6A 1KPIA 1QNTA 2D8MA 1B6AA 4TLFA 3IVAA 2FX3A 3CW2A 1SG6A 4Z4HA 3P0JA 4D41A 5KYKA 4QVIA 2H2FA 4NZMA 4O29A 2OECA 1LSJA 2H7CA 4OM7A 4Q37A 1U2GC 4UUOA 4I4IA 4ME6A 3O31A 1Q5PA 4EHJA 1V6CA 2GILA 2ZXFA 5KZMB 4DANA 3M6XA 1TK9A 2Z56A 4URYR 4AP9A 3HQ4O 1GLVA 2K40A 2C5AA 1VQ5P 3AW8A 2LCIA 3IDFA 1NG7A 1ZVJA 3FH0A 3IV6A 3Q0VA 3AVXA 1MTZA 1U04A 1ORWA 3I76A 4ZZIA 1P2TA 3H17A 2D1VA 1UCFA 1L7NA 2FBIA 4JP8A 3CMAP 3ZV6A 4YAFA 2G36A 1QJCA 1CY2A 2AF3C 2CKMA 2ZSIB 2XF6A 1O6BA 4J91A 3F23A 1K05A 3P2IA 3UMFA 5CDUA 2ECBA 4AQ7A 2CXXA 2UXCB 2BHYA 1I3CA 1M2FA 1OXUA 3FUWA 1W5EA 1K4YA 3H1TA 4XMYA 4RKFA 5AW7B 2M0CA 4DUZB 4G09A 1LX7A 2M6SA 3WGHA 2ZRFA 4EJFA 3LF1A 3U4QB 4PZAA 4JI3B 1YJAA 4PN7A 3FCSB 4H7EA 2ZIXB 3AEQB 3KETA 6YASA 3EE6A 2PKEA 3E5XA 2CVZA 4I50A 5HJ5A 2DE0X 4PHGA 2YX7A 3TINA 4H1HA 3AERA 3DOIA 2EFGA 2OPHA 3E0XA 2OBXA 5ADHA 1IG7A 1YW7A 4MB2A 1UJCA 5H82A 4MNTA 3GLHB 3KAQA 5DK4A 3VNRA 2ZFWA 4OM8A 1KZUB 4EO7A 4ZO4A 5JUWA 1NOHA 2HDDA 4ZODA 1BM9A 4IDNA 3IPRA 3KAPA 1ZH6A 3B53X 3SWYA 3UXHA 2KS1B 3C7CB 1EJ6A 3EPJA 2HY7A 3OESA 3R7AA 2ZW9A 4X1EA 2D3TA 5HHTA 1VQ9I 1R10A 4C0AC 4L85A 5T6BA 1U1DA 1QSGA 2DTXA 2NXNA 1X0VA 2BCEA 1J09A 1SEUA 3OZFA 3QX3A 2KLVA 4RAQA 5TC4A 4JSRA 5JH7F 2YCLA 3Q9VA 5FEUA 1ZISA 3F2IA 2QM3A 1E7YA 5EJ7A 4HW0A 2CXQA 1J2XA 1GKKA 4INZA 2YUTA 3O6QA 4KISA 5F33A 4MO2A 1AUVA 2ZRCA 1JQLB 4TXLA 3JD3A 5DM7F 3VOPA 3GR6A 4RXTA 4BASA 3F96A 1GFSA 3T7JA 4EJ0A 2REQB 2HSGA 2R85A 2JIBA 3M3PA 1P9NA 1W2EA 5E3LA 4RHTA 2LP4Y 5BO5A 2MMGA 2LYCA 5C51B 1BSVA 3PICA 4H2DA 4GL2A 4M1SA 3KTAA 2R7UA 1WIWA 4XJVA 1D0IA 3EOZA 4IGEA 5IUNC 3PSAA 3NC0C 1JHMA 2P77A 3PGA1 3VPXA 1WJGA 1OPRA 5C44J 1ZH2A 4XICA 2AW5A 4JD5A 4C04A 5GZ1A 5U1PA 3HG7A 2BKEA 3OIDA 4F3NA 2RMKA 2B7EA 4R8MA 5EJCA 4N0EA 2CMKA 3U60B 1UBCA 2X0DA 4WKBA 3DBLB 1KB9I 4CTJA 1AKUA 4DIMA 1LFDB 2BEUB 1KFJB 3Q0UA 2DU9A 4E4YA 1IBLB 3WMWA 2PMDA 3KZVA 1YCHA 4TKZA 1OCRH 1SD7A 4FFRA 2X51A 4MWGA 5AK5A 2L4MA 3E9RA 3AG4H 3GQBB 1MB0A 3W0LB 1YBFA 2OUMA 3LUCA 3GFLA 3M4OJ 2AXNA 2X3UA 2YUIA 5M5BA 4F9TA 1IOLA 3MWEB 3B36A 3RSCA 4ZYUA 2WBMA 5IVHA 2W8ZA 1FDIA 1BCCD 3EB9A 4RA9B 3KEOA 2II6A 1QIHA 2I7XA 5F27A 3PR3A 2Q1YA 2XAUA 1LLFA 4WXRA 5E9WA 1TK3A 4IWYA 1ADJA 5LIPA 4HZFA 3FWPA 4GKKB 2EG9A 2OF7A 5ICMA 3WDMA 4G0UA 1F8FA 4JKOA 3I59A 5BNTA 1FAVA 4Y3OA 5JBIA 1Z7GA 2QJRA 1LTHR 1IU9A 4AS3A 1GPYA 4YG2F 2PLWA 3QLTA 2HT1A 3KJXA 1MAUA 2XB8A 3CLRC 2QRVA 1TOAA 2H9IA 3DEFA 5FTMA 1V4RA 3DT9A 4ZCMA 2Y1EA 4JU8A 1QH8B 3RSOA 3DLCA 3CH6A 1P0IA 5F23A 1ZM9A 1UEXC 1KIMA 3IT3A 1SHZA 4UUTA 1Z73A 5JVDB 2L4AA 2OORC 1WKMA 1H9GA 1NNEA 1ZRHA 3CONA 3KOYA 3RAPR 3HHEA 4LE2A 1V25A 4O33A 3H5LA 5T67A 1K6MA 3IAEA 3KTFA 4LF8B 1H8HD 4FUQA 1MQSA 2FRVA 3C48A 1DIGA 3C1AA 4G0ZA 4AO8A 3T4XA 3BTVA 3IVCA 3GPIA 4DA7A 4O4HF 3IV5A 4EVRA 1JMBA 3L2RA 1ID8A 4DVJA 2E89A 2EEPA 2JJMA 4FNMA 4L75A 3UXMA 2R6AA 2NAPA 4RTOA 1KQGA 1HORA 1ZKGA 5AH0A 3B6JA 3S40A 1BRTA 5G1NA 4EK9A 3QGMA 4D5GA 1F9NA 2BDTA 5GPAA 2ZRHA 4K81B 1WTAA 2JPCA 4ISCA 2SNIE 3EWNA 2IYPA 4A3CJ 3ABOB 3O8CA 2LK2A 3ZQUA 3FBNB 3G0CA 1NHGA 1PNOA 4BEJA 3NETA 3KYLA 4FI3F 4OJTA 3W6VA 2FPKA 3U2RA 1CQZA 2O2IA 2C3UA 1SP4A 4ZKPA 1TFUA 4BO8A 1UBNA 4Q4HA 4YEDA 3PUXA 1EWRA 2CK3H 2DPYA 3LPMA 3B3GA 3I6YA 5KU1A 2RREA 4MPDA 4KLRA 2R7LA 2DTEA 3LY5A 3R9XA 2EHDA 5ALKA 2GTIA 3IAS6 1WPXA 2WIDA 2O0YA 1ZLLA 1W5AA 4TLCA 4RPKA 3AFHA 4PG4A 1YR7A 2WUWE 3M1LA 4HK4A 1IFNA 2IC5A 1T9KA 1HEYA 1PUFB 2PTHA 2AD1A 3WRYA 2WOOA 1N2HA 5LUBA 3CUVA 3EFFK 1ADGA 3OZAA 4KXLA 2XDWA 2IF0A 4LDQA 4IO1A 3CXHI 4M0DA 4H15A 2RCNA 2ZE8A 3TNDA 4HO1X 4WLUA 5L7TA 4Q1VA 5MN6A 4D9JA