1GDTA

Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
b'MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE I OF RES DNA
publication title Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 58
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gdtA03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gdtA02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gdtA01
4Y7NJ 5DS9A 4X1EA 5C4XJ 2M34A 3O8HA 3SFIA 1HX7A 2QCOA 4EEFG 1JUSA 4DYRA 4C3IJ 5JLWA 1OCTC 4RBOA 2VPRA 1HOMA 1F36A 4XIDA 4FTHA 2DMTA 4FE7A 3S16J 3OSGA 3I4NJ 2Y30A 3E7LA 3GTQJ 3PO3J 4JX5A 2P81A 3GTGJ 4BY7J 2GBYA 4A3DJ 4FE4A 5EGOB 1HLVA 2LY9A 3BQYA 3GTPJ 5C32A 3G1OA 1JT0A 2LVSA 3JRBA 1RKTA 3IH2A 4BXXJ 1JTYA 5EEAA 2JWTA 4QIWN 1HDDC 5DTDA 3S17J 2XPWA 1MBGA 1ITYA 3SJMA 1T33A 4D5CA 2LFBA 1MBKA 3NAUA 2NS8A 3QQAA 4IHVA 1WPKA 2MSYA 4I6ZA 4M3FA 3M3YJ 4LOCA 3C2BA 2X48A 2XGDA 1B72B 2OF7A 4BY1J 1ETQA 1FIPA 2JN6A 1D5YA 1FIAA 3LSRA 1I6HJ 3CMYA 2NVXJ 3JRGA 3H0GJ 3LHFA 1U9NA 3BTIA 5IYCJ 3TP3A 3GTKJ 2YS9A 1GDTA 1ETYA 4BBRJ 2DMQA 1BL0A 2CUEA 3K2AA 5FKKA 4JX4A 3WHCA 1IUFA 2W48A 1GV5A 1I3QJ 2YUSA 3I4MJ 5HODA 2XRLA 2DA6A 1PUFA 1GV2A 1POGA 1FTZA 1A6IA 1MH4A 1JT6A 2CUFA 2R5ZA 1ZR2A 4C2MJ 2OPTA 2E2HJ 2AHQA 5C3EJ 4M3DA 4V2FA 1I50J 1WCMJ 2ME0A 4UUSB 2E2JJ 5EF6A 4MFDA 5FLVA 3PKZA 1TWAJ 5F27A 2Y2ZA 2EZKA 2HDDA 3G1MA 5IOYA 1FTTA 1LFBA 2K9NA 5J3LA 1JJ6C 1VF9A 3HGYA 5E3LA 2D5VA 2GM5A 2MGQA 2EZIA 2XPVA 3D1NI 5FKNA 4MO7A 2VKVA 2H1KA 1CQTA 5EYRA 2EQRA 3TW7A 1H88C 3LSJA 4I76A 3BR6A 3DCFA 4IHXA 5M3MJ 1UG2A 3IH4A 5EZGA 2EZHA 4A3FJ 5J1UA 4CYCB 3LHKA 5J1YA 3BTCA 2DA2A 3IV5A 2O9LA 4A93J 5FLMJ 2LP0A 2Y31A 3G1LA 1H8AC 3ZOBA 2VKEA 1RESA 3LSPA 4BKXA 2GM4A 1Z0XA 1XS9A 1MBJA 1LE8A 4DW6A 3S2DJ 1S7EA 4IHYA 3GTMJ 1IJWC 2E1OA 4W1UA 5IPAA 1U8BA 3HOYJ 1ETOA 3BTLA 2R93J 3NARA 1MH3A 3S1MJ 2ECCA 1OJLA 3O8GA 2TCTA 3GTOJ 2HOSA 5M5WJ 3TEDA 5GPAA 2MW8A 2LK2A 4BQQA 2AO9A 1ZGWA 3BT9A 2NS7A 5EDNA 2LD5A 2DN0A 3Q3SA 1AU7A 1RPWA 2DMUA 3QPSA 1MNMC 2IAIA 3RZOJ 3M4OJ 3F0CA 1MSFC 4S0HB 2HXOA 4A3LJ 5F04A 4B1RA 1EF4A 1A5JA 3HOZJ 3HOWJ 5E3NA 1BW5A 1E3OC 2QF7A 3G13A 1AHDP 1JKQC 2DA3A 2XGEA 3OIOA 2LTPA 5K7ZA 2DA4A 1GVDA 2H8RA 4A3CJ 1GHTA 2R5YB 1JGGA 1ORKA 1HDPA 2L7MP 4DYCA 3UJ3X 5C4JJ 2CQXA 3UKGA 1X2MA 2K40A 3JREA 3JRAA 5K7HA 3S2HJ 5EGOA 1ZTRA 2MG4A 3BG3A 1DU0A 3MN2A 1VNDA 2M9HA 1AKHB 5EZHA 2JMWA 2JA8J 4ABZA 3HM5A 2L0KA 2IEKA 3S1QJ 4JYKA 1OFCX 1PUFB 2GLOA 1JKRC 3A01A 2NOGA 1TWFJ 1P7IA 2R5ZB 4IEJA 4XICA 2ME6A 3HDDA 3S1RJ 5C44J 1IDYA 3FK7A 3ZQGA 4IHWA 5FKLA 3FISA 2PMZN 2EBIA 1MBFA 5F08A 1B72A 1LFUP 3GUVA 2XB5A 1IV6A 3TW6A 3TP0A 1JKPC 1BA5A 1U78A 2ECBA 2ID3A 3LNQA 3BR0A 2K9QA 3VPRA 5IOZA 1WH7A 3CDLA 3LOCA 3L1PA 3DEWA 1Z77A 1K61A 5F0CA 4C3JJ 4BBSJ 4MLOA 1WI3A 9ANTA 1HF0A 3ZQIA 1XC5A 4AUXA 1JUMA 2CQQA 2JK3A 3H3VK 1Q1VA 2KT0A 1RKWA 1NTCA 2NVYJ 2FX0A 1P7JA 5M5XJ 4A3BJ 2E2IJ 4W97A 1ZR4A 1B8IA 3ZQHA 4M3BA 4UUSA 5E3OA 5C34B 4D7NA 4B4CA 4HNVA 5FKMA 3JR9A 3JRIA 1TWCJ 5EG0B 2X9DA 3JRFA 2L7FP 2LKXA 2N8GA 1SANA 2KDZA 1VFCA 1UMQA 3HOUJ 5FKOA 2DA5A 1MSEC 3QPLA 5E3MA 2M8GX 4X6AJ 2I10A 1H89C 1YRNA 2HOAA 3BR3A 3ZQLA 3JRDA 1SFOJ 1LE8B 1QPIA 1WH5A 3B6CA 1Y1VJ 1GT0C 3BQZA 2NVTJ 2CJJA 2HOTA 3A02A 3HGGA 2DA1A 1XG1A 4QSHA 2M2EA 1U9OA 2O7OA 1TWGJ 5F1JA 2Y0SN 2JA5J 4Y52J 1X2NA 1RETA 4JP0A 5FJ8J 2IBDA 5BNGA 2YU9J 2HYJA 2HQ5A 3IH3A 2JJ7A 1JTXA 2XPUA 2B63J 4FISA 3OSFA 2VI6A 1T56A 2G0EA 2X6OA 1G2HA 2Y9YA 3K7AJ 5C31A 4A3MJ 4GFBA 3RZDJ 4NDLA 4XRMA 1IG7A 3ZQFA 2HXIA 1R9TJ 2MHCA 3GTLJ 5IYBJ 4A3KJ 1TC3C 1MBHA 1TWHJ 5IP7J 3BVPA 4V2GA 1F43A 1RR7A 1WGXA 2E19A 5M5YJ 2JA6J 3HOXJ 3FK6A 3PM1A 3BG5A 2RAEA 5J1RA 5IP9J 4M6VA 3JRCA 3RQIA 2DMPA 3A01B 3MKLA 5F0FA 4AYBN 3S1NJ 1BJZA 2L7ZA 1W0UA 4MFEA 4XRSA 1NK2P 3BR2A 1APLC 3BR5A 1UHSA 1JJ8C 4A3IJ 1QVTA 5K7FA 5GP9A 2R5YA 3LSGA 1ZQ3P 3WHBA 3GBGA 1VI0A 2WV1A 1W0TA 1IC8A 5F0HA 2ID6A 2Y9ZA 2NVQJ 2R0QC 4A69C 5C35A 3ZQCA 4L5EA 1ETKA 4XK4A 5IP6A 4A3GJ 5IYDJ 4DYQA 1FJLA 4D7MA 4C3HJ 2O8KA 1ENHA 2FQ4A 2WB1N 1AKHA 1IGNA 2DTZA 2XGCA 2WAQN 4DZJA 3HEFA 3GTJJ 3HKZN 2CRGA 1FEXA 2FJ1A 1JUPA 3PO2J 1JKOC 3HB9A 1ETXA 2XB0X 4A3EJ 4XRSG 4AC0A 1B8IB 3JRHA 1BW6A 1QVUA 1ZK8A 2EH3A 4QTRA 3FIWA 3Q0VA 4A3JJ 1NK3P 3Q0UA 2R7ZJ 1IDZA 1ETVA 2VUMJ 2DA7A 3BG9A 2COBA 1K83J 2ELKA 2M0CA 1Y1WJ 1YRNB 2DMNA 1ETWA 4J19A 3BR1A 2EZLA 3B6AA 3HBLA 5JLXA 1HCRA 2JA7J 2RSLA 2FD5A 2DJNA 4MIMA 2ZB9A 2XSDC 4JX6A 2TRTA 4RDUA 5GPCA 1OCPA 3SDGA 2CU7A 3OOUA 3FKIJ 4DZPA 3S14J 1QRYA 2L9RA 3Q0WA 3CQZJ 4G12A 3S15J 1X58A 3RKQA 4M3EA 5EG0A 4M3GA 3BTJA 1ZKGA 4B3AA 4CYCA 1DU6A 1MBEA 2LR8A 2HI3A 2LLKA 3CCYA 4D5FA 5M3FJ 4UUTA 2K9SA 3ILXA 4FCYA 1O4XA 3HOVJ 3A03A 2R92J 3W6VA 1GUUA 3MVPA 1IRZA
chains in the Genus database with same CATH superfamily
5J58A 4WIAA 2DECA 3I8XA 2OA0A 2GM9A 2PUFA 1OBCA 4HN4B 1OC2A 5LZ9A 4FFSA 3TL2A 1VQ4P 2PLRA 3CF4G 2WTYA 3HU2A 2LR2A 1V54H 1Q0SA 1BN5A 4O4HB 3SXUA 3O2PE 4EV0A 3ZP5A 2LVSA 821PA 4DE5A 3L74J 1BJTA 2FW1A 1ISMA 4U9IS 1K5GA 3M8EA 3C2BA 4BV3A 1EXVA 1E6UA 1JQLB 1KY4A 2QTMA 4QELA 3UFXB 2KS1B 1LFAA 4OXQA 3ESWB 1L0NG 4NIMA 2WJAA 3W79A 4P7KA 4P9UA 5LR6A 1I3QJ 1P74A 2AZTA 2NO4A 1BD4A 2O3QA 3I9FA 3VYIA 4Q9DA 2ME0A 5F23A 2KI5A 5ISMA 3U0VA 4M37A 4TQAA 4LF8B 1K8AQ 1ZCZA 4ZZDA 3U19A 4MVJM 3AVWA 2IHTA 2AJCA 4JJ7A 4QFDA 1JJ6C 4PLHA 5FOUA 2XPVA 4DIDA 4EPXA 4FYHA 4YV7A 4F6LA 1AK9A 1LB1B 2RBKA 2BTQA 2XCLA 3TW4A 1ZVKA 3P2KA 4YHBA 4URVR 4J0JA 2PN6A 3R6GA 5FI3A 4URHA 4X66B 3S1AA 3T8YA 2PRYA 1VKHA 1SCUB 4MR8B 2QTFA 1MQ8B 4FZRA 4ZJZA 1D0YA 2E1RA 2RBGA 3NOQA 5H20A 1MX9A 4Z8XA 2HFHA 4MI1A 1VIVA 3QVXA 2W6JH 4HKTA 1W93A 3EXFB 1XGOA 1AGNA 2P2CA 5L7YA 4KQ9A 4BMVA 4DAOA 3VSAA 2ERXA 1EE9A 3B7GA 1VIYA 3EF1A 4EF6A 4XX1A 2AN1A 4XVUA 4J1TA 1OVMA 1P9NA 2ZJSE 3H1AA 3CNHA 1J1DB 1PZNA 3AEZA 2HAEA 1T3LA 1TWFJ 3L8MA 4A7PA 2HDCA 3QGMA 1N2SA 1B72A 3COSA 2CCJA 4KYWA 5EUMA 3VPRA 3OYJA 1DG3A 3NKFA 3AF1A 1Z4OA 2DKFA 1Y3DE 4D25A 2PUEA 3BRWD 1PUEE 5KLIC 1GNPA 5BYBA 1NT4A 1X1DA 4M9SA 1D4OA 3RTBA 1TWCJ 4DA7A 2DFHA 1L0OC 5BSRA 4DR6B 4OK6A 2NTNA 1JHDA 1MSEC 1GT6A 1CEYA 5F1KA 2PX6A 1J9EA 1TOAA 3W2TA 1Q1NA 1J2JA 3MFYA 2PKWA 2WIKA 4LOHA 4I8IA 4AY5A 4WINA 4M87A 5LD2B 4G2NA 3N2NA 4K86A 1Z4QA 5KAMA 3T0IA 3KM0A 2PEXA 1XIVA 4LX0A 5IVIA 4YAEA 4IFDK 4WOCA 4TTIA 1Z08A 4BQEA 4M0KA 4EZBA 2NXCA 2F4VB 1G3SA 2ODEA 3DBRA 4YUVA 3FMIA 4FKZA 3LP6A 4LQ4A 1UIRA 3O6VA 2OHGA 3VNBA 4OLHA 4CKBB 3QHAA 4ASVA 3DFUA 1SZJG 3S4YA 4RCVA 5M2QA 3WFIA 2HPIA 3QTLA 2JQ7A 3LPDA 3I83A 4ZQFA 3OQNA 1VLVA 2C9CA 2EZUA 4K9NA 3DBLA 1C8KA 5CR9A 1FEXA 2G6BA 3QUSA 3W5BA 5LLQA 4ZCMA 5JNWA 1A4RA 4PN3A 1ZI9A 3NTLA 2VH5R 3CWCA 2MSWA 5KU1A 2VSOA 3K6KA 2DPHA 5DXJA 5B5EE 3WKCA 4JD5A 1YWGO 2COMA 3RPQA 3FVRA 1WEHA 1HUCA 3RO7A 5A04A 1JUNA 1UPBA 2WDPA 3A2NA 1JGSA 4DM7A 2EFNA 2CLDX 5HIIA 2JVHA 1VB3A 2ZRLA 2M9MA 3JQFC 4HH0A 3TM4A 2VHTA 1G3IA 2HUNA 1P7CA 4U5XA 4BDTA 5KTNA 3VJRA 1GUBA 1KAMA 4MULA 2R1VB 3KT3A 2JGDB 3OMWA 4TLAA 4C3IJ 4HKZH 2OO7A 5KTOA 3H3JA 4I50A 4PV1C 4FGJA 1LTAC 3AUYA 4JR2A 5B1DA 4MKHA 4NPHA 2XGMA 5JD4A 1N3BA 1FP2A 4NXNB 3B2QA 2WWFA 2GFQA 5FBRB 4U2GA 3HUUA 1V8OA 2ZT7A 1D5YA 3JQAD 2PZFA 4WK8F 1NW3A 2XUOA 3L0ZA 3IRRA 4XLTA 5EMKA 4OUDB 1CY4A 1FVXA 3ZWCA 1X8KA 3RARA 2IYVA 5EIXA 2ZVJA 3UC9A 5KTRA 2XCOA 1M0EA 3SJCA 3I12A 4EQ6A 2N9BA 4QNRA 3NUQA 3L93A 2XYHA 5EF6A 1HE8B 3V00A 4XGRA 3FNHA 1PBNA 3WHKA 1QCDA 2Q2OA 1E1CB 1SQSA 3CVOA 5LCXA 1B26A 4FMPA 3TD2A 1KO7A 1SMKA 4Q1VA 1XCVA 4WKBA 4YQYA 4CM4A 5K3OA 2GYWA 4JJAA 1E60A 5K5RA 5ER6A 1V7QA 3E1KA 4AX4A 2BGKA 1U5BB 1FU1A 2Z5FA 5DNWA 1IRXA 2A69F 2D0PB 4RK4A 1GGEA 2YN2A 5TV2A 1O6FA 3A3OA 4BTVA 3FHZA 3VOSA 3OX4A 2QKLB 5E4YA 1SZPA 4RV5A 4AROA 4DMHA 3U13A 5IKEA 4XRFA 4KN7X 2XCUA 3WIBA 2JGFA 1W5TA 5KQLA 1U2QA 5EGOA 2V6IA 4PICA 3QU9A 2FKWB 3AY0A 2VT3A 3LF2A 3RI4A 4XXHA 3BZCA 4P1WA 1ML3A 1MW7A 3BCRA 5APTA 5ALHA 5BR7A 4YI3A 2IOFA 4HS9A 1RAFA 1OBOA 4FZVA 1AGRA 4UVIA 5F9FA 1QRUA 1X22A 5JI2E 1EFLA 2ATCA 1T1GA 4TXLA 4UQPA 4YJDA 1NV9A 2EJRA 3D5EA 3WTUC 4U9HS 2PUAA 1K7SN 3VPAA 4TMKA 3IHLA 4A3BJ 3ZHYA 1E6EA 2KIMA 5A71A 4X0EA 1EDJA 4I6EA 3AH8A 1ZRSA 4PWZA 3CTPA 4MRPA 3ETJA 1VFCA 1O54A 2IP4A 1GW3A 2WR8A 3ZS9A 2CPBA 4WK4B 2FSSA 1IBSA 5I8WA 5BN5A 4LDRA 2V6EA 4AU1A 1THMA 3BVHA 1V4BA 4DMMA 1LI5A 1M2VB 4B31A 4ZOLA 3T7KA 3R2JA 3PXGA 3K7AJ 2ZMEA 1AN9A 1XZDA 3C5CA 5H68A 1J1IA 4FFWA 3K8OE 2O0YA 1S1CA 3H2HA 2OBYA 2CB9A 4EJFA 1A6QA 3V7RA 2SHKA 1DBRA 5JQWA 1WX1A 2OXIA 2QJWA 3UPTA 3HQ4O 2JIOA 4AYBN 5BWNA 1JIUA 1NK2P 2ZJ3A 5BW4A 3GZTB 1IATA 4N4AA 1DO8A 2R5YA 1L7XA 1PJAA 1O95A 3RKYA 3SWWA 4YR9A 1O3QA 5UKDA 1S5PA 4FJ1A 1V5EA 1MNQA 1OTXA 5FLEX 4ISCA 1IM8A 2FSFA 2XECA 1OH6A 3TZQA 3GLFE 3HB9A 4DQDA 3H5RA 4KB5A 5L3QA 1MAHA 3LC0A 3IRUA 2JVJA 1U90A 3GYHX 1K6IA 5FRMA 4ZAFA 2OUIA 2FEWB 4D74A 4BXOA 1QU2A 4BXUA 4AKGA 3IPLA 2V8BA 2NPSD 3HO6A 1B1AA 3MQ0A 5GPCA 2JUCA 2BXYA 4WKPA 3W04A 1JR3D 5DOVA 1W85B 1QRYA 4JU8A 3F6EX 2GASA 1ESEA 4MW4A 1M0SA 1DKLA 2POHA 1Z0KA 2PMZA 2WPDD 1CJSA 1YTZT 1AGXA 4R84A 5AI9A 4OHVA 2LCFA 4AS1A 3SFVA 1P1RA 4FNGA 3JAMA 1VJGA 1WKVA 4FTHA 4Q15A 3ZGNA 2NU8A 4HYTB 3FFAA 1C8LA 1PWHA 2REBA 1QH0A 1ZVMA 4P2GA 2PSSA 3KP4A 3RSZA 3NHAA 4BEHA 1B6TA 1OGYA 3DBIA 3CWBE 1KO5A 1UG0A 4ZT7A 1C3EA 3SJMA 4RIHA 1HA3A 2WOJA 4MPRA 1YG2A 3O1IC 3W67A 1UZUA 4IUCS 3V1NA 2OF7A 4GMKA 1ACIA 4HK4A 2R7UA 4W5QA 2YS9A 1XMVA 5KYUB 2Q6VA 2Y0SA 3PSAA 4RHFA 5KOHA 1Z6RA 1JTHA 3D8TA 4BHTA 4TLEA 4O4LA 3DHVA 4J0EA 1F4LA 2E7WA 2BJVA 1G16A 5LHIA 2DY1A 3EWIA 3E8SA 3K1JA 2C7OA 1MDBA 5DKFA 3H2GA 5EEHA 5APWA 4TKZA 3WGOA 4RD3A 4OXRA 1BOAA 3D7RA 4L3VA 1SXPA 4U4AA 2J0SA 7REQB 2WD7B 3E2IA 3L0BA 3B9BA 3K6JA 2HVQA 1C1DA 1K9SA 4QE3A 2XPCA 4H7JA 4BMPB 2VCEA 2VXOA 3B1XA 3HXOA 2Q45A 4J91A 4XOUA 3CVWA 1GPH1 1ETOA 3HCAA 2ZB2A 4ENKA 1SFUA 1RWVA 1PG2A 1QX4A 3GGDA 3M3PA 1TVKA 3HL4A 3S1KA 3DEYX 3C1LA 4OHKA 1G8PA 2WAOA 5HDGA 3NT4A 4M83A 3OOPA 3C5VA 2LZ0A 1QR2A 4M71A 4CH7A 1LSJA 2P35A 3A06A 4FGZA 3A1VA 3MIZA 1E77A 3KVOA 4JUBA 4CTNA 3F67A 1KH2A 2BL4A 3ZYZA 2ODQA 3AR9A 1YVRA 2EG5A 2WU0A 4M1SA 2HSDA 2AB0A 4OAOA 2M9HA 3IAS1 4XJTA 2M5AB 5AHKA 1UWVA 3W2EA 2ZIVB 5C7OO 1XDUA 3DEIA 4ZEWA 4NZYA 1J49A 2STTA 1RMTA 3VKHA 1NNLA 4YCLA 2P1ZA 5GZ3A 2WSEJ 5DHRA 3QOWA 3K2EA 1Z5VA 4GMDA 2R7KA 2C42A 3ZCQA 1NV8A 2ZJ2A 2OYOA 2PA0A 2VPLA 4ALNA 3S44A 3STTA 2V74B 4KYVA 2BE5F 4QPPA 1EB9A 1KB9E 3HVJA 1T26A 3CT4A 3C8MA 4OV6B 1ZLYA 3MRSA 2A7QA 4D0NA 1K98A 2LG4A 4ASWA 1A36A 1HDZA 1S9KE 3ECOA 5FB2A 3ETGA 2QLTA 3SZPA 4H3VA 5IKXA 3JQQA 3FD8A 1GMJA 4HDNB 4I9NA 1U9OA 4Y2PA 3KVYA 4HJGH 4WACA 3UMBA 1CNFA 4GHWA 4G7HF 4H1HA 3JCUC 2IV2X 4KVFA 4UDYX 1EE2A 4B6SA 5BT9A 5LD2C 4DBQA 4MYSA 3UGKA 5B2FA 4M8IA 3GGCA 3P26A 1Z26A 1WGXA 1NQOA 3UMCA 2I2AA 4MMXB 1CY2A 4L3WA 4AYWA 2DFFA 1TECE 2ZIEA 2FPPB 5FPQA 3CB4A 1SOVA 4R9UC 1C9NA 1FB5A 1U6IA 3EX7C 1T2UA 3NH9A 4GI5A 5EHIA 1EFVA 1ON2A 2WA1A 4DC9A 4HBLA 4LTDA 1P62B 1L0BA 3RAEC 5J4YA 3RW9A 3T41A 4FVTA 1FTWA 2WUWE 1Z36A 3WJAA 3SD7A 4MK4A 1H94A 1SG9A 4JJEA 3ZWWA 3TZKA 5C8ZA 4X64B 4HDKA 1K4TA 5DM2A 2BGMA 4MYHA 1N78A 1KQGB 1YE3A 5B3LA 3T52A 2TDXA 3GCZA 2C5HA 3RK0A 1FRNA 3ND5A 2F2EA 2R97A 4DLZA 5B57C 4WY4C 3OZSA 4LI3X 4TL7A 4CM8A 3RC7A 1W0JD 1BC8C 1KFJB 3GHYA 3ML1A 2E5TA 1B1BA 1JUDA 4PWYA 1NY5A 1RDFA 3AG2H 4EJUA 5B6PA 4GYIA 3I3LA 3QYEA 3C3KA 1QRTA 5DS9A 2PAAA 3PA8A 1MOSA 4LHWA 5J1SB 2FZCA 2PQ8A 2EOAA 5JEEA 1S4QA 3R5XA 4RB0A 1EVLA 2V7TA 2X42A 1RQUA 3P5SA 1U1CA 1NA5A 4Y1GA 3Q72A 3W34A 1SOUA 2O7QA 4Q37A 1WW8A 1D07A 3H5VA 4D43A 1N5DA 5FFXA 1E9SA 4XOIA 3T7TA 2B9BA 1RYYA 3CESA 5HOOA 4H1WA 3H8WA 1HE3A 3HPRA 1PFKA 2OO3A 1JDBB 2RKLA 3VP8A 4KPFC 1U0FA 5CVRA 4CLOB 3BLYA 2UYCA 1FMFA 4WN3A 3I2HA 2Q1KA 4U02A 1NC3A 5LC1A 4TWIA 1QL2A 1L0NE 3S2ZA 2JEYA 2NUPB 1OREA 1NYTA 3C2QA 1PV3A 1LTJA 3JX9A 1DRKA 3M33A 2CYYA 1WA5A 4MFDA 2ZC2A 5TPWA 2K5UA 4U7TB 3K4NA 3PNYA 4D26A 1XAJA 2PKQO 2Q5EA 4CM7A 3L2CA 1NVVR 1QC5B 3BMQB 4TS4A 1T0UA 2GDJA 4CJXA 1VI6A 4OAQA 1FRVA 3UUWA 2WPRA 4I66A 4IMIB 4CKCB 3BTSA 4U00A 1PX2A 4FLMA 2G7ZA 1GQSA 2LTAA 3CNBA 4KN5A 2JIDA 1E3WB 4UKDA 4RMNA 1Z6PA 3PD0A 1IUOA 1P7WA 5EKUA 1ONBA 3GTMJ 2ZYHA 2A4KA 3T1QA 4COKA 1WFXA 5JD6A 5LB4A 1ITZA 4KGXA 4Z4IA 4EJSB 4J49A 1SFEA 2YR2A 2XT0A 5SV2A 2QQ8A 2XTNA 5ALNA 3ZHZA 3BL8A 2IDBA 1UKCA 2P6RA 1BR1A 4S0HB 3H92A 1FZAA 1DQUA 5GJWC 1PUJA 1H0MA 5P21A 2NXNA 4FONA 3KU1A 3TLCA 4DMLA 1XYYA 2OB1A 5JSUA 4O4LF 5GMOA 2GPJA 3LVFO 3DUFA 3KEMA 4FNMA 3LTEA 4KK4A 4RTKA 5FL7D 3H3FA 3VC1A 2VHVA 1V9CA 1YMVA 2WA2A 5EQFA 5HUJA 3I04A 2ZZMA 4CSWA 1QMPA 2NOGA 4F96A 3GWGA 1R10A 3OA0A 3NHKA 3NBXX 2O2DA 3ZU3A 3IUNA 1I4EB 1ODDA 1RHKA 1Y9AA 3WIVA 5KHDA 4MQ6A 3ZCSA 4OHYA 3DVRX 2Z09A 4KN4X 4LVUA 2XEXA 1WW3A 5CQEA 1W5CC 4KI0A 3DW1X 1CSBA 2FPLA 5B1AH 1PFIA 4HX8A 2FWJA 1TVEA 4CLHA 5B1SA 1TKCA 2Q3LA 4H16A 3T1YB 3ZQHA 3BFPA 5ITWA 5AKEA 1ZN7A 1F6BA 3RK2D 3LT2A 1POXA 1T1EA 3CNEA 2GI4A 3D6JA 1JIQA 2CLKB 4NWIA 4I46A 1H22A 3FDIA 3HOUJ 3HRSA 1RNLA 1KE2A 3QU3A 1X7ZA 3LKVA 1VF5C 2F64A 1OBFO 1P5HA 3AE4C 4IKFA 4TMFA 4YPOA 4CN9A 2L9VA 2J9XB 2OFXA 1VLQA 3HXKA 2FN4A 1ZUD1 5A7HA 3TSZA 4J01A 1OR7C 3Q2KA 4PPGA 1JHAA 3WTWC 4IDFA 1DAPA 3D43A 5JDCC 3NHZA 4IQ8A 2OC4A 1Q20A 3M6UA 1NHLA 2X8JB 2IYUA 1FFWA 2ZQYA 1Z25A 1AJYA 2XRNA 3C3YA 5CH3A 5TPZD 4MPTA 5JZMA 1EK1A 4EI8A 2IX7C 4LOKA 3J81K 3CUEF 1NG9A 4DCOA 4E2XA 2VJNA 4KLRA 5J47A 3DAGA 4LJ7A 1FZCB 2RHMA 2L7ZA 3BR2A 5EIEA 1G8JA 4A3IJ 4X1IB 1IHYA 3I6IA 2FQXA 2RH4A 1I6LA 2JKYA 3QE3A 4B2IA 5MFPA 3H9QA 5KJEA 2OAQ1 2G17A 5D7BA 4XUCA 2DUNA 4B81A 1ZONA 3L7WA 5H70A 2ZJ8A 4H59A 4YRIA 1RWBA 4GRAA 1F0PA 1ZDMA 3WFJA 3C0KA 3CUTA 3QLTA 3DOFA 1NP6A 2CNBA 2RN0A 4FTWA 5TISH 1IDZA 3DZKA 3RVBA 2W98A 1GUDA 1O7FA 3RANA 3QIAA 1SAYA 3WGKA 2QVZX 3I9OA 2CWWA 4M6WB 4O2BB 5KHLB 2FD5A 3OKPA 3IMFA 4LWOA 2OV4A 1N0IA 2IY7A 4EY6A 2YWFA 1JHXA 1W4ZA 5AVKA 2JAQA 1N1DA 2LLKA 4F3QA 3R9KA 3VR0A 1VL6A 1VGRA 3NASA 3ZKWA 4BB6A 5KNDH 4AL4A 5CX1A 4B4VA 2R9VA 7YASA 4IFFA 4KO1S 3X44A 1WF3A 1C3LA 4PX2A 4UU1A 4RWEA 2J5OA 4JWKA 2WYWA 1F36A 5EKSA 4PRZA 2D0OB 4QBHA 3E7LA 3DEUA 2HJVA 1U8ZA 3TSIA 4OLJA 1USWA 5GTDA 5AVJA 4TZKA 1JX6A 2G4CA 4U87A 3RVRA 1S01A 2Z95A 3HEAA 5LU8A 4Z1MH 3BYZA 2YJZA 3D2BA 1OAAA 2KISA 2BCGY 3TTSA 2ZJ5A 1L8QA 1GDTA 2A2ZA 1KS9A 3E70C 2WBLC 3ORRA 5DM0A 4IYJA 2Y1GA 2DDAA 2EV9A 1LSSA 3ID6C 3NQOA 3U7RA 4YMTA 2O57A 3AIOA 3TSOA 2HGSA 2X1DA 1UINA 5E18F 3GLKA 4E7LA 1R4ZA 2ORWA 5K1YA 5LOVB 1ESNA 5C53B 2M30A 2IXSA 3M1LA 3WTYC 3FYUB 1FK8A 2D5VA 5LYJB 4NMXB 3FGAD 4W1SA 1KY2A 3FTNA 1J2XA 3EG5A 4YHHB 4EGFA 3CXHI 5LP6F 4PRKA 3W3AH 5J1YA 1ORTA 5EN4A 1DXHA 1L5YA 3AVPA 3WO1A 4YCSA 1GFSA 4E7ZA 1PJ3A 4YDQA 5FX2A 4IUYA 3AB8A 2RJ3A 2FUG1 3HKBB 1E2GA 3JTEA 3ZEAA 1UL1X 5HM6A 2VNAA 1X70A 2BIFA 3TEDA 4E3WA 4YAFA 3B5NB 1D0IA 3IGFA 3ZE6A 5JSYA 4XJVA 1HDXA 4NQRA 4D3XA 2FYUJ 1HE2A 3PP5A 1UPCA 1C3JA 2PH7A 1AHHA 3LQYA 1JG3A 2C4TA 5BWLA 3WRWA 2CLSA 1W0CA 3VTKA 2H1RA 2A45I 5EJAA 4BZXA 4K46A 3GAZA 5AVYA 2H9YA 1YNOA 4QTYA 4YXFA 2XSZA 3TIFA 4IQ4A 3EIQA 1IDYA 2CD9A 1R0BA 4XZ3A 2JFXA 3OF5A 1JHFA 1S2DA 2XCSB 4K0KB 2GAUA 4XASA 4OHOA 3M8JA 4BP3A 2N42A 2ZCJA 4JUCA 2DHRA 1IFPA 1JUMA 3U3JA 4P35A 4NBLA 4BO3A 4WADA 1Q1VA 3BIXA 4IX9A 4RH3A 2H0RA 3KEOA 4D81A 2PVPA 3SYMA 3GD7A 2Y1LA 4G8CA 1VQPP 1U8XX 4RVNA 1SOMA 3P20A 2KDZA 1M2KA 2FCRA 4IJMA 3TR0A 4K9LA 2G1UA 4TYWA 2EQAA 4G4JA 3ZQLA 3H4MA 2G28A 2ADOA 2IPLA 2WYOA 1Z37A 2FE3A 2MA3A 3T0FA 3E1GA 1NSYA 4NOJA 5BV2P 3W4KA 3I56P 1TUBA 1KXJA 3L0CA 3ICPA 1Y5RA 5FJIA 1D2CA 3M9XA 2YC4C 1Y5MA 4RTPA 4FIDA 4BV2A 4YELA 1I3MA 3NEUA 1P31A 2VLAA 4XRMA 2D4HA 4RU1A 4KK3A 4C7XA 4Q4LA 1BE1A 1QV9A 3MT9A 3IR5A 5HMLA 3WUUA 3K4BA 4XUGB 3JVIA 4C9YA 2R11A 2QLLA 4PD4H 4D41A 1XTUA 2R7DA 1ISSA 2VP2A 2A14A 3VJLA 4GPBA 4PVCA 3F72A 4GO1A 2W4QA 1OI2A 1AZLA 1YVPA 3UICA 4LF9B 4QVIA 3AM4A 5BSEA 1IJKA 3HS3A 1K0UA 1AQJA 1DKPA 4K6FA 5FADA 4UNOA 3HD7D 1X9VA 1QYVA 5I5GA 1SVIA 1M7GA 3KUXA 2CK3A 5KK1A 1D3YA 2RJNA 2J6BA 4WVFA 3IULA 1TLFA 2LWIA 3W0LB 3OLCX 2JCSA 2IVFA 3PUIA 2DZDA 4BVLA 4D5GA 5KKAA 2FFDA 5TF0A 4RSGA 3QVVA 4WFKA 3RIYA 5LQMA 1C30B 1AZSC 1C7QA 1MBEA 3DM5A 3NAGA 3PSFA 3D3EA 4JB0A 1TE2A 2P7JA 2V5UA 3Q5DA 5IJ9A 1W34A 1DGRM 3ZZ1A 1L5OA 4LJZF 3R77A 3WWZA 1Z7UA 3RGWS 3NU1A 2I3ZA 3LDFA 2QTNA 1JIJA 3H6GA 4GKVA 2QD3A 5CNIA 2DMTA 4MA5A 3E4CA 2WMNB 4RAFA 3I9LA 1YLFA 2XXAB 1U02A 2X1MA 3OTIA 5ALUA 1WZEA 2ADFA 2P2SA 5EEAA 1R6BX 4JLNA 2PYIA 4GOOD 5A5FA 5CJ0A 2PH5A 1E9VA 2KNCA 3HKEB 2V0GA 1NPYA 4N03A 4US2R 2PYZA 2FTKE 2QIPA 2F8LA 4MRAA 4IQFA 2XY4A 1XTCC 1JDBC 2R8YA 1SG6A 4IUDS 1EUCB 1S72I 1V43A 3WG9A 4Z4EA 3HCFA 1V7ZA 2VJDA 1NTMD 2I66A 5KLIB 2CD7A 1GJRA 3KOZA 2E71A 1CQJB 4QX6A 3T95A 1PHRA 4LMYA 4EVRA 2AKAB 1JA0A 3WRYA 4JL8A 5E3LA 2C2KA 3CW9A 1PR4A 1OXSC 1QFSA 2CC2A 4HEA2 2HPCB 1PIXA 5JDIC 4YXWH 5TQ0A 1F12A 3AJDA 4WXEA 1EZVD 1GGNA 1YB1A 2JARA 2NO9A 2G72A 1O8BA 3RSLA 5DSTA 3AESB 1E8MA 5EY5B 5C7YA 4ND6A 2GCGA 3NC1C 2H4JA 3Q3VA 2Y8EA 3ENWA 3T3MB 4DR4B 5FNVB 5HF9A 1M6VB 1ZM3A 2KZGA 2FEPA 2DN0A 3E5UA 3R3SA 2NYVA 1NTKJ 2CCKA 2E21A 3KUKA 2P4QA 3HVRA 2V7UA 4EJSC 1JU4A 4GSYA 1UKAA 2AI1A 2PKQP 2CL5A 5ED0A 2ZQ5A 5FD6A 4R2LA 5FFNA 3FPGA 2AXPA 2DK5A 4FD3A 2BFWA 4BX0A 4ZANA 4FYIA 2VWPA 3CCRI 3V2IA 1PLLA 4GZ6A 5CVUA 4I5IA 1N7LA 2YNYA 1VC2A 1QZZA 1P7YA 4DOZA 5THKA 5AI6A 1QUFA 1Q3TA 1MIJA 2XRFA 4QJ5A 5EAIA 2GA1A 1Y9BA 2RK3A 4OA5A 3D59A 3DOOA 2OCAA 4XPIB 4P98A 3U40A 2J30A 1KP2A 2BY0A 5FRNA 2HLDD 1JB1A 4PSUA 1XN1A 4AUWA 3H8JA 2YHIB 1KYVA 4B74A 3L8EA 4KR6A 4X85A 4MVJI 1K4MA 2OXEA 3PIIA 1OKKA 2PJPA 2H9IA 2ZIUB 5AJXA 4AP6A 1M8KA 3OJXA 5JQGB 2X9DA 2BFBA 2VYNA 4FFNA 4KMFA 3LCVB 2ONCA 1RKBA 2V9CA 1SA0A 2EZ4A 5FKOA 2F8SA 4LS3A 1QRDA 1DEKA 5E20A 1Z0FA 4N18A 1SCAA 2YOFA 1CZUA 4G0QA 5BN3B 1KKUA 4CHTA 4D0PA 2P11A 2JWDA 2ZREA 4LISA 1DL5A 3QU6A 1WHSB 1OR8A 3HZOA 2VSQA 3KC2A 4CMKA 3O6QB 1Z47A 1QPGA 2C3MA 2VNHA 1YQUA 4KFCA 3B8HA 9ATCA 4RPGA 1T9HA 5JCOA 3RJMA 3PV0A 3VVBA 4LV6A 5CVEA 3UIEA 1C9YA 3CISA 4JROA 2XGOA 1IAQA 1NVWQ 1K6OA 1SQXD 4MJLA 3TIIA 2NADA 4B4KA 1EWYA 1DXQA 1XNHA 4KW7A 2Q2VA 2Y4NA 3VU3A 4P4SA 4OQNA 2ZRJA 4NONA 5BSKA 3SF8B 5DWQA 5ILUA 4B44A 2WTAA 2O1EA 3KUCA 3TPFA 2W71A 1Q6YA 3ZG6A 1FUKA 2FN7A 4BDZA 4R5HA 4A69C 3OBBA 5F1OA 5HILA 1VQ5P 4WCFC 3V3KA 3WDMA 2C88A 3V2UA 1NZDA 4DIMA 1MO3A 5F7OA 4CIBA 2M3BA 4ZALA 4IG9A 5BPHA 1XYGA 3LW5H 4KODA 5AH0A 3ZU2A 4EK9A 2WT9A 4N78D 2B69A 3VNAA 3U5ZB 1UXOA 2ZSUA 4HYYA 3NOVA 1DBIA 1SKUA 2W6QA 5DGXA 1I4LD 3HB0A 2Y69H 1VQ7I 2IF2A 4FDTA 2YO3A 1F6DA 4JX6A 3O2SB 4EF5A 4V39A 3H4IA 1M8OB 4K9MA 3SDGA 2B4QA 5GAGJ 2BGUA 1T3TA 1VBFA 4YP6A 3RI3A 3HADA 3FSJX 1HSJA 1CE8A 2YMLA 2VHZA 4MWGA 2XWJI 1KRXA 3FDFA 3E84A 4RXTA 2X76A 1PS0A 4V1CI 1XL0A 3CM0A 5JLWA 1V11A 3OCYA 1F8FA 3M9HA 1L1EA 4DS3A 3MD0A 1YFZA 1M2JA 2CLOB 1XJQA 2W90A 1N8TA 3DKXA 4TKUA 2CNOA 2COEA 4RTQA 1JFFA 2VN2A 4C2BA 1EEXB 3PIPF 1J2YA 1SQXK 1BN7A 1E7WA 4LW8A 1I6HJ 2FEKA 3W7VA 3ONWA 4LE2A 2E76C 1Q0LA 1D1TA 4WLEA 1ETYA 1RBQA 4TLCA 4WOKA 1SXJA 2QS9A 4K9RA 1DCFA 1LTJC 1DHRA 4ZQGA 1E7MA 1G4HA 2RGRA 2JD0A 2BKAA 4LLGF 4YCNA 3RU9A 2E75C 2EZKA 3UK6A 4OB8A 3G1MA 4A15A 2IELA 3WY9A 1L5RA 2IV3A 1ULAA 3D64A 1VQ8I 3CBGA 1UHWA 2GM5A 3RK1A 3CE9A 5JJ5A 4TWBA 5FEMA 2CSXA 1T3SA 2GPWA 5LHGA 3AKDA 4Z8YA 1TM4E 3ABMH 1XCBA 3R76A 1MMGA 3DE7X 3U4CA 4NCIA 5KB3A 3L0PA 4DYDA 1A82A 3CCBA 2XYVA 4M1WA 1ZM9A 3RODA 5GVSA 1Z7EA 4MS4B 3JAWA 5F9MA 3DE4X 3FCEA 3C3XA 3TF5A 4MP8A 2HCBA 1JPVA 5GPAA 1Q2NA 4RF3A 4HWGA 4ZMBA 3PC3A 1W4MA 2NS7A 1MNEA 1YRBA 1S72P 5DTMA 1U8TA 4QM7A 1OFGA 5F04A 3ND7A 2YWEA 3T8TA 3ERCA 2QVBA 3T97B 4AXBA 4WXDA 3OIOA 3OSUA 1U2DA 2IJGX 3PEEA 3OZUA 4UM9D 4TVSA 1U28C 4POOA 3LRTA 2NO1A 1MZBA 4LGWA 4G0VA 4PQGA 1QF6A 5HS9A 3WLRA 4EYEA 1P77A 1RPJA 2C61A 2H94A 2WAAA 1YB4A 3LVBA 1TA0A 4U7BA 4RMHA 5HBRA 1CY0A 2BZSA 3DE2X 4DTIA 3H5IA 2Z5UA 2QOEA 4AUXA 4S35A 2JK3A 1EH7A 3OL3A 4DUGA 2HEGA 3D4LA 1I3CA 1V3VA 4GNRA 1D1SA 3WLFA 5ELXA 1NTCA 4O3MA 3HWSA 3JD0A 5DYTA 1R8SA 3IT3A 3RJ9A 4WJZA 1SQQD 1K4KA 3HCEA 1YW7A 1KP3A 3M0AA 3BICA 2Y1FA 4K87A 1J0DA 4OIQF 1KZGB 3LE8A 3M6IA 1E9BA 4P3KA 1HFEL 5HJ7A 1RKVA 1OJ7A 4PNPA 3ZDAA 3A9CA 5CA0F 4JYBA 5L4NA 1P0PA 2FFBA 3L1VA 4IEFB 4BRZA 2AOUA 3I5XA 1J8FA 1Y89A 3UMSA 1KDYA 3IP7A 1Z33A 3HUGB 1KEZA 2D5AA 1CZHA 4BASA 1WWKA 3QMWA 1COWA 5CDSA 3R7SA 5LJLA 2I4MA 3W5DA 1NULA 5AKKA 4KZPA 1Q86Q 4A2QA 3FE2A 1CJTC 1X87A 4N7JA 1M0TA 2UYHA 5JZBA 2REQB 3UMYA 4FMBB 3FK6A 1I36A 4HH3C 3EFEA 3D4BA 2EJVA 3T06B 4MVJP 1DX7A 1MCZA 5CEEA 1BRMA 3OU6A 4UEWA 3N07A 3B13B 2HPMA 1EXMA 4I6GA 2XKMA 4A12A 1FSZA 3KTAB 2QWXA 4IAOA 3PBKA 1WNFA 5ANRB 2VOOA 4NZZA 5TR9A 3Q0EA 3DULA 4RH0A 4I14A 4A5OA 2P90A 1K04A 5I01A 4A3EJ 3NO4A 1O7JA 5EMLA 3NMUF 4D96A 2IZ6A 2JLSA 2O8EA 3AUSA 1NK3P 2IPXA 2VXCA 5IT9K 2PZKA 5BT8A 3SWFA 4P55A 5LRSA 3JAKA 3OPYA 3QX9A 1MC8A 1E3JA 1JR3E 3O73A 4DY6A 3ICWA 2O3FA 2AIRA 4Y1RA 3CC7I 2JAOA 4FK8A 1EXIA 3DCYA 2JLAA 2KBFA 4XOPA 1BHQ1 3G82C 4QODA 3H8VA 4PY2A 2VAVA 3RCOA 2C54A 3BPSA 4X8OA 5EHGA 2FGKA 3KAJA 4G5SA 2ZP1A 2I6FA 3MT0A 1W36D 1GVJA 4LITA 4P32A 1LUAA 1VHQA 4JX5A 4UUMA 1D2AA 4KN9S 1HQCA 2HVSA 3OYCA 4P33A 3FGZA 4CYMA 1NOHA 2VFAA 4AZVA 2J3LA 1GLNA 1M8PA 1X1QA 1R15A 4MWDA 4EY5A 2ODNA 4IGAA 2PZLA 5GV7A 3Q7TA 2VYFA 4EITA 4CF7A 5JZSA 3HA7A 3ABLH 5FBHA 1AS3A 2SICE 3WTBA 3ECCA 1VQ7P 1NL3A 2LMDA 3VYVA 4N8DA 3OC6A 2LRDA 3CUVA 3J7ZI 5AW7B 2P27A 4B45A 1JAZA 4Q9JA 4B3MB 1FQWA 5TMPA 3N39C 4HUJA 1LT1A 3LX8A 2QTVA 3A14A 1E2EA 4U2CA 3GJ5A 4D92A 4ZDKA 1OCEA 3MSCA 2AD1A 2F4IA 2SNIE 3FMOB 2RH5A 4EO4A 1Y47A 4QJIA 4YVFA 4UVAA 4ARAA 1DCTA 1QB7A 1K79A 2PDAA 3EW7A 2DBBA 2ZRPA 1UDBA 1VOTA 3LVRE 4MO7A 1LFPA 3KFWX 5J4LA 1V3UA 3KT6A 3G88A 3EXEB 1PQWA 1SZCA 1XPUA 1ADYA 1RP1A 2FOKA 4ZHQB 1SBIA 4CCKA 4H0LC 4MNUA 4QMAA 5HK8A 3ULKA 2KXPB 1H2AS 3PHHA 3I0MA 3BX1A 1CUCA 4NU5A 3BTLA 3SYRA 3PI7A 1Y4AE 1A4UA 3A7EA 4XM3A 3DOIA 2QEXI 2C4KA 4ECAA 3ZZNA 1SC6A 4CM9D 2OFFA 4HRIA 2QQFA 1CP3A 1JLLB 4TMVA 4WXRA 2NSHA 2RBEA 3PUHA 3QVWA 3ZMUA 1X3UA 2VP6A 1T6BY 5FEUA 2K9MA 2O8BA 3WXBA 4QPOA 2X40A 5FFZA 1VPCA 3DUWA 4LA4A 3DKKA 3TQOA 2OLEA 3T7EA 3UJHA 1VQ8P 2ZWVA 3TFQA 1J21A 3KSRA 1EK2A 3DHYA 1GARA 2HCTA 4YJGA 2OILA 4KIJA 4Y9SA 4V1CB 3ABIA 2VR1A 5IM5A 4FZ3A 1DUVG 3DE0X 4Y2SA 2Q2NA 4LOAA 1AHIA 1VE6A 1CRWG 4D0GA 3ONQA 1EDOA 2P0AA 1H1DA 3V6IA 1GSOA 4BN4A 4HNRA 1FMLA 3BMCB 3NJ8A 4EL5A 4IXWA 4WNAB 2RGYA 3T1TA 4GBMA 1ENYA 4WY4B 3Q9SA 4M60A 4YRMA 4U7PB 3LSTA 4W97A 2BFEB 2F3TA 4YCMA 3QFSA 2QMOA 1IFMA 4IEEA 2ZDHA 1FMJA 3AMVA 3N76A 2H43A 1RPZA 4PRYA 1R7RA 3NKVA 1N86A 2W2VA 2NG1A 1PEKE 3HPGA 3PNMA 1TLHB 3CPSA 1AFOA 2X3YA 3LT4A 1R4MA 5CJJA 4YO7A 4D9MA 1BR4A 4MWEA 2OC6A 3KQVA 1SQXG 4UVCA 4ETIA 3UEOA 3UBMA 1EGHA 4ITRC 4DT1B 1X2NA 2Q0OA 3L4KA 1HKHA 3K1AB 3ANYB 4J7CA 4HEHA 3D3KA 4KE7A 2HB6A 3FBIB 3OSFA 3HBFA 3OYDA 5HIAA 4P4TA 1MMFB 4ZI3A 3PUFA 3V7SA 3WI7A 3Q0TA 4HLYA 4JX9A 1XMJA 3V4PB 4BO7A 4B3GA 1CUXA 5M5YJ 4BNXA 2XGGA 2HDNB 3FA2A 4BXFA 1VPWA 4NVRA 1D09A 4CA0A 4CUGA 2X2FA 2EIJH 1YBMA 2X9NA 4QDJA 3BR5A 2X3FA 4K2EA 1ZFNA 3BIFA 1KR2A 2XA1A 1TO6A 1R6DA 2YV2A 3H7IA 2SCUA 1X9HA 4P81A 4F56A 5G0TA 3V46A 4N9QA 4HX2A 3TMKA 2BCEA 4AZSA 2DQSA 5A4AA 1GRQA 1RYMA 3K3PA 3OFND 5AW3A 3EIFA 3FUUA 3DZ8A 3DTEA 2QXTA 3NHSA 3BFVA 3CX5D 2SECE 1W1IA 2G40A 1UFRA 5GONA 1WCYA 1M76A 4QPQA 3S1AB 3ZHTA 5JYDA 4Q9HA 4IRUB 4J0GA 1JXOA 3JZAA 1GKUB 4L9VA 2PRJA 1DADA 2W82A 5KOJB 1QQAA 1XD7A 3FWLA 3Q8XB 2IUTA 2P0EA 3ICQB 3HE4A 4UATA 1S3GA 3CT6A 2Y71A 3U7FB 4XSXF 3UV3A 3ZWYA 1P33A 2HJSA 3K6SB 1LNQA 1EUDA 3U3XA 1E5DA 4IJ5A 1E3PA 1V8DA 1ZJYA 3F9KA 4IYRA 3K2BA 1I39A 1JCCA 4JP2A 1PP9D 1VLMA 1UB9A 1QGYA 3B8EA 2BGCA 4UCQA 2V1NA 4BAZA 4NC9A 3R9WA 4ZFNA 4RGXA 2EYQA 3ZJYA 2BFFA 4D5CA 3QFRA 5INTA 3NBAA 3M07A 3S2SA 3W9YA 2FQ3A 2FK7A 1B72B 1FIAA 3QP9A 3PLRA 4I99A 2YMMA 1WEKA 4N5IX 1TYAE 1YJCA 1XF1A 1DPFA 5BSWA 1I0ZA 3CC7P 2O2ZA 2JFQA 5FI1B 2B1RA 1HFJA 3NWTA 5DYNA 5FIUA 4R1TA 3W90A 4LBVA 1HYBA 2XUBA 1QO9A 3C1UA 1ZGGA 2YXQB 2WJGA 2OBLA 1IXCA 4DSTA 2DR0A 3MJFA 2QSGX 2Q6IA 3C3MA 1J2JB 1VF5B 2VBCA 2G6TA 1SC4A 3G1UA 4J1SA 1YW9A 5DU2A 4KPUA 5MGNA 3K0LA 4KVAA 3AK4A 4BJ6A 2ZXWH 5HG0A 2B4RO 2LP0A 5D6FA 4WWHA 2QJPB 2IZOA 2NVUB 3G5MA 2XF2A 5B2ZA 5HHTA 2F62A 2QJFA 1EK6A 3F23A 2NUTB 1Z39A 3EDPA 4GIBA 4YEJA 4N0PA 1Y3AA 3SHFA 3QKRA 3REOA 2QAGA 5CM2Z 3JQDA 3QLVC 1RXCA 5D3QA 3FHTA 1NQUA 2GFIA 4LWQA 1HW1A 4QPCA 3O8QA 3QEMA 3EDRA 3LECA 4RK1A 1MMNA 4UFNA 4H6XA 3PT9A 4HDSB 1A1SA 1XNGA 1AKVA 1V8ZA 2ZLBA 3JALB 1A9RA 3FSRA 1OIXA 2VA8A 3W6OA 3MBOA 3U7HB 1P7IA 4MUXA 4CL3A 2FN8A 5AW2A 1E62A 5FKLA 1TFRA 5K5QA 3V1LA 3TW6A 3LX4A 4RKQA 3KTFA 1UCRA 1CJKC 1SQQG 2NQTA 4P22A 5C8DA 1BW9A 5JR3A 4O2LA 4MTCA 1N5MA 2FMIA 3ZY2A 5HKAA 4HEJA 1AGYA 2FX0A 2QE7D 4HXGA 1P6XA 4EYSA 1CC1S 2XWQA 1C81A 1NYLA 1ZW0A 5L6MB 2QUZA 4E2WA 1I5OA 1RE0A 1YRNA 4Q9LA 4WBSA 2JA2A 2EARA 3T5TA 2O5RA 5B5EH 4I50B 3T3IA 4HRXA 3GW2A 1E2DA 4FBGA 3WIUA 4BNTA 1KJZA 5C1IA 3SJZA 5D5UB 3UAZA 4R51A 3QELA 3IVMA 3NTUA 1KIFA 4CI0B 4RIEA 1EQ2A 1XZJA 3TECE 2FG6C 4FDAA 1K08A 4CPDA 5TQ2B 1VBMA 3ZDYB 4MRSA 3UHPA 5APVA 4ZI7A 3C5HA 2UZKA 3B20A 3JQPA 1WMEA 2OESA 3N6VA 4ZJUA 5B3AA 3DFMA 2FHPA 5E1WA 2RAEA 5FLKA 4ZC1A 3JRCA 4QYTA 3GC6A 2W1OA 2WTXA 4RGVA 4WMLA 1EVQA 1J5YA 1EEHA 2OBPA 1MVNA 3CVVA 5KAIC 4EQ6B 4IWXA 3HDQA 3DMNA 3WHBA 1XDDA 3E7WA 2YVLA 1RQ2A 5ILQA 4DJDC 2FNPA 3WLMA 3PTLA 3GTJJ 3CEHA 2VI5A 2RC6A 3TBFA 1QP7A 3TL6A 1KYWA 4C7VA 1J42A 4LFCB 4DWJA 1P2DA 1BX0A 4RD1A 2XDYA 4GYKA 1S8FA 4J4HA 1GDDA 3DC2A 4QG7A 2P41A 5DGIA 5JLXA 1HM5A 1GQFA 1JLSA 4MHSA 4A82A 3E7DA 2ZZKA 3QM1A 4RGYA 4RB2C 1RYHA 1URQA 1PJ2A 1R5NA 4R9VA 2HIAA 2DBQA 1CZQA 4V0KA 2LR8A 3LY8A 4D5FA 2HMUA 1QUEA 4A36A 3G0CA 1EE1A 5TGZA 2FXAA 1DEOA 1D1PA 2XD9A 3IEXA 4A1OA 1S96A 1GN8A 2QDKA 4IOAF 4M88A 5FA8A 3WV5A 2A1IA 2DULA 2QRKA 4O59O 1TYEB 3DDNA 3FYCA 2VJQA 2Z4RA 1S2IA 2O52A 4XN0A 4PFJA 5EGOB 1XZFA 2CQNA 3DAPA 4KO3S 4YTEA 2OAZA 1U81A 2QQEA 3EUKL 1GR0A 3OQOA 4QOFA 2DETA 1OCRH 2MT9A 4BB5A 1RYFA 2J3EA 2RMKA 1IFNA 4EI2A 2PWBA 2NS8A 2DG2A 2MSYA 4QRHA 3TUJC 3TNFA 3K4JA 3IAS6 1I7LA 1LC3A 3NGXA 4IF6A 3K69A 2XCIA 3HZJA 2KYRA 3L8GA 5HM8A 3GLGA 4B6GA 5KINB 1XALA 5GONF 2O2XA 5AO9A 3NG1A 3UK0A 2XCQA 3OLZA 2WKWA 5B5SA 1GU0A 3Q5RA 1NNEA 4BHBA 3F8WA 2QRUA 3IXQA 5KWIA 5DASA 3HFJA 5DT2A 1N34B 2ZUWA 4EHNA 4LJ4A 3M8KA 1UWCA 2FVXA 1E5VA 1SWVA 2PZMA 1KBQA 3HJUA 4D8UA 2RE8A 4IOCF 1STOA 1X7GA 2P2DA 4LZNA 4L8LA 3LK6A 4L5YA 3IV5A 4LWZA 5FLMJ 4O33A 3RSCA 3IP6A 3W2AA 3C41J 2GQ0A 4ZOLB 3TO5A 1DO0A 2D2WA 3IOMA 3QUCA 4BCDA 3ZWBA 2O01N 2BOLA 4GZMA 4Q7EA 1F9NA 3IUQA 3P9IA 2C7RA 3MTQA 3FMSA 1SFRA 3OT4A 3IUMA 1CG6A 4INZA 2IA2A 4DDVA 1ZP6A 4ZGGA 2X7JA 1FNDA 3MJEA 2IW3A 3QJYA 4JYAB 4YIRX 2ZSIA 3GUUA 3CCEI 3LCRA 4OIPF 1P3DA 4EG4A 5T8KC 4D9EA 2R5YB 2YZ2A 1Z3XA 5HKBA 2JO1A 4KQXA 5AW4B 3QXSA 4HLXA 1NI4A 5DTIA 3BA6A 3A70A 3JU3A 2ZJQF 1DGQA 3FPLA 3TQIA 3Q3DA 4P4UA 3OTOB 4BJ1A 5TF4A 2JAXA 3UWPA 2BEVA 5AKYA 4O1MA 2L69A 2ICAA 3CKMA 4BXOB 4HFNA 2WU1A 1UKYA 2H3EA 4LZLA 1N8SA 1P2BA 1ZY2A 4L9NA 2AE1A 4BFWA 2MD0A 1HEIA 1P7JA 3DF9A 5D3KA 1H1TA 4CE6A 4YALA 4PJLA 2O05A 4F2HA 3AY7A 1HDOA 4GQAA 3L00A 2HH9A 2KRCA 1A8PA 4TSKA 4M0CA 4KDFA 3U6KA 4BFSA 3HO8A 2CB0A 2XT9A 1N7IA 2EBUA 1VRCA 1KJJA 4AM8A 3DE6X 3FYHA 1HURA 4JLPA 2IYSA 2DO7A 1G20E 5F1JA 3GJ6A 2NU8B 4Y1EA 1QJCA 4GOLD 3LY7A 1YI0A 2M8RA 2FX2A 3R61A 1IJEA 3LIPA 5M34A 3BOSA 4JLAA 1RSZA 2WF9A 4WT7A 4ZVUA 5LP6A 4P7GA 4A10A 1RC8A 2BMDA 2YCLA 4CG0A 3PHBE 3LMMA 2GTPA 2Q5OA 5KJFA 2CZGA 4DG5A 4ZT6A 2C9NY 2QN9A 3WB0A 4RXUA 1NMYA 4PUSA 5KOHB 1X74A 1TPYA 1T6YA 1N75A 4JLBA 3TKAA 5CDHA 3GT0A 1YHNA 5EEGA 3WSVA 4PRLA 4Y28J 3B51X 4KSBA 3UT5A 2Q0XA 3R4VA 5IYDJ 3HTKA 5CYFA 4F60A 3CURA 1PFUA 3HKZN 4ZVSA 2OCBA 4C89A 1NE2A 2V4ZA 3S27A 2XB0X 2Z2XA 3MWJA 1BO6A 3LA6A 2JLUA 3LJKA 1GRRA 3HFGA 3DP7A 3I64A 2JS7A 1P3Y1 2LY2A 5LUAA 2DW3A 4B3IA 4Q5IA 1C1DB 4URZR 3ER9A 5HS8A 5HQ3A 4MIYA 1EWRA 2OYSA 4QUAA 3W2GA 4ZXPA 2B34A 2V7GA 2GFHA 4Y6RA 4WFJA 1TVKB 2OD2A 1ZJJA 2D5IA 4G01B 2GEDA 3A3PA 4ZI7F 4HFJA 2M34A 3SFIA 3P0EA 1C1HA 5DNAA 4H4KC 1AA6A 3EVGA 2V6FA 3AHCA 4BKRA 4G6DA 2KIQA 3GXOA 1XEXA 4C7MA 4BMNA 4QLOA 3ZK9A 5AHRA 1XJWA 3CG0A 4CEIA 4YQZA 4DLBA 3VODA 2AN5A 2E2WA 2WWIA 3ELDA 3BCCJ 4BXXJ 3CH4B 2ODTX 4J1TC 1TTTA 1F14A 4K3UA 1NUSA 2BE7A 2R8EA 1IN5A 2R32A 3JQ9A 3KQGA 1NTME 2C3OA 1NMXA 2I2XB 1WJAA 5I3CA 1YFHA 2CO5A 2F5CA 5KNDA 4K03A 1IH8A 3I76A 2KMLA 3RVOA 4YP0A 1FYDA 2QA5A 1VG0B 1KVRA 4B6EA 1NUQA 3DZJA 4MCJA 4E31A 1GFWA 3E48A 3EWNA 1FPMA 1SBHA 2W2NA 1ZW1A 4CTJA 4DVGA 4O25A 5AVRB 2P9JA 4Z1OA 1EZVE 2QUIA 1OI3A 4YRTA 3NBYC 4QUIA 3SNKA 3F5FA 4AG6A 5TX7A 1MH9A 1TU0A 2QR3A 4ATNA 4G5RA 3BXZA 1KAEA 4C46A 1LCIA 5KWSA 4MKRA 3KP2A 1KB9H 1NBHA 2P6OA 4HYQA 1NKNA 2Z9OA 3A3NA 2R5DA 2GDZA 1EP2B 4YR7A 5B6IA 5K8LA 5B7NA 3D6VA 1NLMA 3IEKA 2CDCA 1LLFA 2QJPC 2BW0A 2I2BA 3VU9B 5TVGA 3VFZA 3CU5A 5BMOA 2EERA 1A88A 5IC5A 3ESBA 2L42A 4K9SA 5ILSA 2PMEA 1WMAA 3O2NA 4P08A 1QYRA 1KPIA 1ZRHA 4D3ZA 3OWTA 2WT7A 5CPRB 1G8SA 4W9RA 1I7SB 1QVWA 3CIFA 5C1PA 2OGZA 1C9MA 4UEOA 1S4MA 3C5EA 5IK2D 5ILGA 3WLQA 3GLHE 4Z9YA 5K7HA 4FR5A 4OYLA 4TXJA 5ALSA 1BVUA 2OKGA 2GUGA 3I6MA 3OIGA 4WCFB 4MQUA 1XTTA 5ALMA 1M2OA 1OW8A 4A8PA 3P9ZA 2JPDA 4HDKB 1U8YA 2VRSA 1Z6ZA 4PIMA 5ULLA 3U4DA 3KPEA 3MINB 3RYHB 2HUPA 4H0FA 1XSXA 1YJ5A 3K70D 3O3CA 2FOXA 2WF6A 1GQ2A 4Y30A 1IIBA 1Z2PX 3T7RA 1N0WA 3A1WA 2HHLA 3RKRA 1VJ0A 4DNFA 3A4NA 4XB1A 5FHQA 5JT1A 4G1BA 4B4CA 5TJJA 5AKIA 1KSHA 2HOEA 2D8AA 4DEVA 4QICA 1K89A 2I2WA 4HAUA 2J9GA 3CCEP 2XTJA 4A5NA 2G06A 1RCTE 1UK9A 1MF7A 5B4TA 5EKDA 4YX9A 3F46A 2HOTA 1FC0A 3PE3A 3FPAA 3COYA 3BE8A 2PJUA 2VDNB 1U1FA 3FCXA 1L9XA 3BXXA 1SQXE 1CY7A 4U2EA 1EK5A 1SULA 3T4UA 4WFQA 1GTRA 3CGWA 5APUA 1OU4A 3L02A 3ZCVA 2CHVA 3URMA 3O8LA 1B8NA 3GYBA 3HCBA 1SXHA 4GR5A 3SIRA 4QA9A 3PPXA 5LQNA 2GAOA 3I55I 1TT0A 3KVVA 3SBOA 2CLIB 1RQLA 3FX0A 5AJZA 2GRUA 5ETJA 2FPOA 5JAZA 2E76B 3VZSA 3OLWA 1KERA 5H9VA 1IULA 4URYR 2R87A 1E32A 4B3DA 4CQMB 2BDEA 2XDVA 3GGJA 1LTJB 1TGVA 1XWWA 1EBFA 4RVDA 1B8VA 2PXCA 3NIFB 3KWLA 5DD8A 3AUJB 4XGKA 3CXRA 4MPDA 1TZLA 3SS7X 5JEDA 2FRHA 1QIIA 4BO9A 2O5EA 4NHEA 2WAQN 4IIJF 3TZCA 4DLKA 2E75B 4N78E 3M6LA 5C5EA 5LQSA 1P6RA 2ZRNA 5D3MA 4OMZA 2C0XA 3MZHA 1F8GA 4XRSG 4ZVVA 4BE4A 2BZ1A 2FPXA 2FEAA 3I9KA 4L9JA 5PNTA 1I1NA 2BE9A 4CMIB 2GPYA 2JH8A 2GPBA 4LZAA 3DWIA 1ZP0C 3AHIA 3CCJI 2H11A 3EFBA 1AG9A 2I4OA 3HIFA 4EA7A 1SOWA 5SZHB 4URUR 2PGOA 1LGYA 3I04M 4D9HA 3K1ZA 4LI0A 1ZJ6A 3LC2O 3CDIA 3H2IA 2ZVOB 4LOIA 4BE2A 4BE1A 2FUG6 1EC5A 4E12A 3KLBA 4UEKA 3GJYA 4UE2A 2CPSA 2I7TA 5BSMA 2OCXA 3D1JA 3G9TA 5BMVA 4GE3A 1WUKS 1I80A 3KDPA 3R60A 3CO7C 3HCNA 4BO6A 1GZVA 3QIVA 2C9DA 4JP1A 3DUFB 4ZRNA 2OCKA 2AH5A 2ACWA 2V6BA 1G4DA 2AOTB 4NCJA 1KDRA 4QJBA 5FAKA 4LMPA 4XWOA 4CUJA 4DLYA 2IIVA 5AW1A 4KYUA 4P54A 1B74A 4RJ2A 4IJAA 5IASA 4FDUA 3GFSA 5B4VA 1VQLI 3LL7A 1W6RA 2VL7A 1N77A 1C0WA 2GVDC 1P9QC 4LZZA 3C6KA 4JEMA 4B3SB 1DC5A 2FB9A 1D4FA 3ON5A 3HXQA 2ZIXA 1N6KA 5BUCA 2EV5A 2Y1DA 3FYDA 1MJNA 2ODWA 4TS3A 2ZBGA 2BFDA 1V8BA 3D3JA 3AV0B 4QJ3A 1AUQA 3RQ4A 2YHBA 2OFWA 1K8XB 3CBQA 4G2TA 5GIPE 3LSJA 3JARA 3TLBA 1QNFA 3FOEC 1JM0A 3HRTA 5K2OA 1BYIA 3L0DA 5H02A 5AJWA 3TOZA 2PP6A 4MRMA 3BK2A 3M3DA 3JRXA 2B8NA 3TZBA 3GMDA 5EJMA 1ZKMA 4BQIA 3EZ2A 1W8IA 1VG1A 1ELOA 5K5GB 4KITB 4UB6E 4ZQEA 3NHLA 4F3TA 1U0HC 4XLHA 1U0JA 2XXBA 5E95A 4F71A 2ZRHA 3A2AA 3JR7A 1OVGA 4PNEA 1U8EA 2H07A 2OZLA 2C97A 4MV1A 4NG4A 2ZMEC 1W0KD 1JL3A 1SK9A 2VTKA 1ISJA 4UZEA 4I4IA 3A4CA 5CA1B 1RXIA 1WJCA 2CXNA 5DX1A 1RTTA 4NQWA 3FXUA 1L5VA 5THQA 2TMDA 3CSDA 1QB8A 4M6YA 1UPXA 5FWDA 1VE1A 5EHZA 5G0VA 1O95C 5C8YB 3SQOA 1NF9A 3C14C 2HOQA 1ZAKA 2KP6A 3KQNA 3K96A 1ZL0A 1NU6A 4FGSA 2V1DA 1GL2D 3AY3A 5JAUA 4CCNA 1VA4A 2GYUA 3Q88A 4RK0A 3QUQA 1SQQE 3B5IA 4A0RA 2XYRA 3MG9A 2BCCD 1ZLJA 2AFHE 4LKOA 5K8UA 5B7QA 3OA7A 3B1WA 5GZ1A 4Z5XA 3ZKWB 3W1VA 4KDEA 5CX1B 5AVZA 3L9FA 3KSBC 1KYTA 1ILEA 1JT9A 5BNWA 2QPLA 2YZNA 5EWLA 1E96A 1FMTA 4W8HA 1GVNB 4GMFA 5D7NA 4KIGA 1XXHA 1EFPB 4FEYA 5D6EA 2GF0A 3PWTA 1SLQA 1CPYA 4MGEA 4CM5A 4BE0A 3ZC3A 2LKDA 4D6TD 2H7YA 1D04A 1UMCA 3EFOB 2R6GA 2IBMA 1TC3C 1H2WA 4CZZA 4H3KB 2X6WA 4Q16A 4F8YA 3DLPX 2C2GA 1ARZA 5DIFA 1Z2NX 3FZEA 4I9HA 5A2QZ 2Y0EA 1LTHR 5AK6A 1Y4SA 2DMPA 2ZUFA 2EEZA 1GTVA 3GFPA 1RF1A 1LBTA 3BIOA 1TADA 4OXXA 1ZGBA 3MYYA 3WICA 2PBZA 3JSPA 1ZAOA 4FS8A 3VYTB 5E9QA 3R0XA 2OXCA 3DDCA 4L8WB 1SQ0A 5GM1A 1CY1A 1N33B 3JPWA 3V1YA 5AVWA 3PNVA 1C2TA 2QD4A 4B46A 4IS3A 1EQ7A 5JXIA 3DWFA 3X1JA 3ENKA 2XROA 1ADGA 5A9RA 4H7FA 5ALIA 3KLMX 1US8B 1E2BA 3KL4A 3V5NA 4AZ0A 3G2OA 4UZFA 1MB3A 3RYFB 3F8MA 2H5JA 4WOPA 4H0LB 1ZM2A 2VDJA 1G2PA 3ZZ0A 2P68A 3H18A 1H2ZA 2UZ4A 3RKQA 2GD2A 2ECKA 2HLNA 3W6KB 5DHUA 3RTCA 3Q1MA 5EP4A 2X1CA 3N4MA 2PX0A 4UTNA 2JJ8A 4IHKA 5JARA 1HL3A 4YRQA 1W76A 3AQIA 3GF7A 3I37X 4A92A 4OATA 1KMHA 2YCBA 4GKGA 1YE9A 1P5JA 5FBKA 2HC9A 1TYCA 2DWQA 2P0WA 3OW2O 3ZWAA 3SM9A 1DQYA 4KIWA 3ZW8A 2AWNA 1U8UA 2C5GA 3FXEA 5AVYB 5CA0A 3WKEA 1N32B 3EEYA 2FFHA 3K7EA 4U8HA 1P1FA 3C8ZA 2ETVA 4MKZA 5JHHB 4LGCA 5EP3A 2QNBA 3CCJP 3TTYA 4W80A 3L4EA 3G8AA 4Q03A 3OAAD 1P2VA 3BXFA 2FR0A 3SVLA 1LDMA 5B1HA 2V1XA 2IV7A 1G2OA 4EHLA 3L7YA 2FWNA 2X0EA 2QL7A 1JT6A 1K7YA 4TXMA 2WUEA 3MBIA 4LRYA 3UNXA 4B5LA 3QPAA 5F12A 3UAYA 4KR9A 4CMCA 4DCNA 4EWLA 4CPGA 4XTRA 2PQ6A 3OESA 1S9HA 2YPRA 3ZGVA 2OTKE 1OHHD 1Y39A 3IQFA 3F49S 2Z5LA 3HDYA 2X9QA 1YBAA 4I76A 3U6BA 2F43A 4ENNA 3NCTA 1NTMK 4WGFA 3PNSA 2ZXXA 1EVKA 1D7MA 4IX1A 2NZWA 4KQ1A 3MTEA 1YZYA 5BMVF 4LC9A 1J0RA 1UBNA 1XA4A 3MGCA 1PVVA 3PIOF 3B71A 4S3MA 5EVJA 3QEJA 4O6JA 1G17A 2GRAA 5CVVA 3GTOJ 1SFXA 1JJAA 2UZ3A 1IEQA 4ND3A 3NPMA 1VTNC 1F38A 1PR6A 1U7JA 1Q77A 4R8LA 1JLMA 1KBZA 2VWHA 4JIMA 2HLPA 3H9CA 1BW5A 1Z7GA 1RZVA 4GQIA 3ECHA 4DBLE 1WABA 4CCSA 4OVNF 3KBBA 3PNLA 3R5JA 2ZBVA 1QRRA 5DNVA 1XDBA 4MEAA 1DMRA 1UJ5A 1V35A 2DU8A 1F6WA 4WA7A 4NP6A 1MKYA 5BSVA 3GJ7A 4CL0A 2A3NA 1MC4A 3AWIA 3A2KA 4H4DA 2P6UA 3QKWA 2PG3A 3B7WA 3DP9A 2X77A 4OJNA 3UYKA 2G0AA 2P8TA 2ID3A 4M3LA 2YIMA 3WS7A 1FSSA 2G9NA 3EZ7A 4LDJA 1OFVA 1OGIA 4MLOA 2K4BA 4DDUA 3UN1A 4DTCA 4DIFA 1G3UA 2QGNA 4J0DA 3WAGA 4KX5A 1ZARA 2MJZA 3QSGA 2FFDB 3W7AA 1GK4A 3Q3JB 3I4FA 4H31A 3FR8A 1ZA2A 5BW5A 1K4SA 4ILKA 4XCQA 1B9NA 4GLJA 5EJ6A 1QPIA 3LKBA 2UWJE 1ZI6A 5C9ZA 2HBRA 2OHXA 1SFKA 3PXXA 4BATA 3U2RA 1XCGB 2V9PA 4NXMB 3IT1A 5ICCA 2O0MA 3RRZA 1T0JB 3KZNA 2PH3A 1IOWA 4BFTA 1G6KA 1X7YA 3ASNH 2O3JA 3VMYA 1QHHD 2Q4OA 2HK6A 4FOTA 2ECQA 1IZNB 3O9VA 5JPDA 3P0HA 2QD2A 3EOAI 3CC4I 4J16A 2J5PA 3EPKA 1M83A 4NDLA 2BSXA 2C92A 2O3RA 1FSEA 2IIBA 4BNYA 1PWZA 1M8JA 2UZ1A 3TLEA 2WPSA 1I32A 1E5LA 621PA 3EQ8A 2NV2B 5DM60 4JF7A 2K3FA 1J56A 1TM5E 1KQSO 4CIYA 1QAOA 4TSFD 1FBUA 1MR3F 4PZAA 3E7PA 1TJ5A 1L7QA 1D0ZA 2ZAMA 1JKJA 1R0XA 4KH1A 4WV3A 3HDTA 2JEEA 2XDAA 4Y9UA 4NU6A 2EFPA 5CB4B 4GUDA 4C0QC 2WNIA 1N2HA 2PMBA 2CF5A 4NL4H 2ZULA 2OHVA 4HTFB 1VJDA 4AQRD 2UXXA 4D57A 3BE6A 4I1RA 1UPUA 1Q5PA 2GN8A 3HN6A 3QXXA 1Y6FA 3BASA 3PXDA 2Q5LA 3H1KJ 2WJZB 4ASNA 2D5BA 1XDZA 1IPEA 3RUPA 3D6FA 3GZ4A 4YRVA 4QQ8A 4HNTA 5DNDA 1MFZA 4B0PA 2ECOA 3RROA 2XHZA 2W85A 1M1EB 1M66A 1O3TA 3G2HA 4UUVA 3WNBA 3ZY3A 4PQEA 2FYNB 2KBEA 3S14J 5KVSA 3S15J 2XWBF 4GOEA 5GWXA 2W6AA 4PG6A 5EKXA 3FFXA 4EZIA 4D97A 1N2JA 1P9OA 2OCGA 4ENPA 3WIEA 2GWHA 2QYOA 5ITZA 5ESXA 2N1BA 1PP9E 4NDNE 1LP1A 3T7CA 5I9TA 4X1KB 4D8VA 2R60A 1PV2A 1R0SA 5EQDA 2K7ZA 5MGBA 2PSEA 4KWIA 3K4PA 4JVNA 3CR3C 2G5PA 2D2CC 4QOIA 1R8JA 2OTJI 4JDUA 5J3JA 2VYQA 3OJ0A 4LOCA 2OXRA 3TQSA 4QNNA 4G65A 2HU8A 2R8BA 2ZB7A 1TJNA 5I9IA 4O2AA 1JEYB 4ER6A 1AQTA 1QO7A 1R50A 1HTTA 2Q5JA 3PVSA 2P65A 1N5OX 4ENTA 2BISA 2A0UA 2IA0A 3SKXA 1I50J 1Y1TA 4KIFA 2Q28A 3B3FA 4L6IA 1TJPB 3ZQ4A 1X42A 6PFKA 2W6JA 3G71I 3EY9A 1SA0B 2GAAA 1LNZA 4UFPA 2QTGA 2IVMA 3KZYA 1MDMA 1ZVJA 2UXNA 1BMDA 2JJMA 3T9CA 3AYXB 1BQEA 1RS0A 2AMVA 5CD1A 1DEAA 3HHPA 1R5HA 4DJJA 4ZV7A 3IQWA 3AF4A 2XOXA 2Q6TA 5ENDA 1GG8A 1JQKA 1RKUA 1BD3A 2HJHA 2YW9A 3JS5A 3C85A 3HOYJ 1Q2UA 3NYIA 3WK7A 2AG6A 3SS8A 4J4BA 3CCRP 3IKTA 3GF2A 5EIBC 2GK3A 4PSAA 2FP3A 1NFFA 1X7WB 3GN1A 1QWSA 1G3MA 4ON0A 3K0AA 2CHFA 4YT8A 4BKMA 3QPSA 4OJYA 1NBWB 3HSEA 3IV7A 3LDHA 1UJ8A 1OX6A 5EHXA 1KQNA 4P4GA 3AF3A 3U81A 4RKWA 3WLAA 3N87A 4U3JA 5JPIA 5FT9A 1NXSA 3QUTA 3VKVA 3CINA 2X19A 2IC5A 1VIDA 5BV7A 3F6OA 3S2HJ 3IO5A 3VPFA 3FLEA 1T9CA 3U4QA 2OG2A 1ZX1A 1K7AA 4DPLA 4BXLA 3AUUA 1G6OA 1OROA 2WWRA 1E3SA 3F21A 3VAAA 3ASVA 4D44A 3W2WA 1BDBA 5BUZA 2FMTA 4UU8A 3JCZA 4PE5B 3ROQA 4Q1AA 1OOEA 4JI1B 1VG9B 4JB3A 2BFOA 1P9RA 5CGZA 5ALKA 1UXGA 3PXCX 4P96A 2K88A 3S9OA 3MOIA 4OJKA 2A6HF 1PNTA 1CE8B 2FF7A 3OOYA 1XTKA 1YJ9I 5CVJA 3BWYA 4D1QA 1X15A 1XPJA 4MAFA 3ELWA 5AW5A 4AVYA 2GSDA 1MEEA 4HGRA 1RYBA 4D6TG 1RI3A 2Q3IA 2E43A 1DKNA 2AXCA 2JA5J 3GLLA 1SQQK 3G4SI 4E6KG 3O92A 2BGRA 1U1DA 4YMVA 4OMUA 4IKEA 5HA5A 3IN6A 3ZUGA 4RTLA 2KP8A 2WVHA 4AC9A 2QRHA 3PUVA 2Q27A 2BWJA 3IJ5A 3IAM2 2WSCH 5CB0A 2DM6A 3F5HA 4ZIRA 4NH0A 3SLRA 3ZWXA 3A7DA 1P44A 2XVMA 5HLTA 1NTMG 1CI6A 3DEJA 3AR4A 1VYTA 1PJQA 5E2AA 2RHTA 1DELA 3U3KA 2Z6UA 4FASD 3WL3A 4HSTA 3BAZA 4LGMA 3ABUA 5K5EA 1L5ZA 2JZYA 2PGDA 5I7AA 3R7WB 3OCZA 2IGNA 3IAAA 4BLQA 4XRRA 1OPXA 4N4NB 2X1VA 4AXXA 2ZRIA 4YWHA 2LXBA 3DCJA 1EZVG 3CC4P 1YA8A 2H4HA 2DKNA 2HF2A 3UB2A 5CTJA 4DQ2A 1S8OA 2K86A 2WJJA 1XELA 1E69A 4J3JA 1O97C 3U60B 3JAWB 1B41A 2VATA 3FAKA 1JP7A 1VYVA 4Z9FA 1E2MA 3DFGA 5BURA 5EJEA 2NNYA 3AOGA 3IILA 4UPVA 3O8NA 2FEXA 1GGMA 3A32A 4J0IA 2EILH 4CCAA 4FYKA 1UODA 2CG4A 4RAYA 5C4XJ 5AVVA 4KGDA 1BCSB 1NP7A 1W73A 2PBLA 4R8RA 4XB2A 1E0JA 3MJTA 3CE6A 3MTAA 5BWMA 2ZDQA 1P0CA 4OUKX 2HI0A 1NH3A 3DDSA 2W2KA 5EWJB 1KTMA 2I2DA 3BEDA 1I1OA 3IVAA 2BPOA 1HKSA 5DM1A 2IXTA 5FR2A 1JJFA 1QHNA 5C80A 2EJTA 3TG2A 2Y1KA 4FILA 5HVNA 1TU4A 1YB5A 3PJFA 3GUZA 4R8KA 3WWDA 1SN7A 1W52X 3L01A 3GNTA 2PFBA 1HBWA 2E5ZA 3LPAA 4PCAA 4JITA 1G59A 1VPEA 1FOSF 1BX1A 3FF4A 4C7RA 2IU6A 1X1BA 3WWYA 3MKWB 1CKEA 3KXPA 4PBTA 1F5TA 4KGVA 5ITVA 5CRIA 2OYCA 3U3OA 3AGPA 1YI8A 4U8GA 1XRRA 1XRSB 2TECE 4HQEA 1YZUA 2OZ6A 3OPXA 3MMPA 1S6LA 4G6TB 5L4SA 1DFHA 2CNDA 4W5WA 1QV6A 4W8OA 3QPWA 1HPLA 1CHDA 2BZGA 4AKEA 3RYRA 1CP2A 1ZC3A 1EP3B 2AOUB 4M9ZA 1U9ZA 2OXTA 2FPMA 1Q7EA 3ONDA 3GUDA 4E08A 1P73A 2JLRA 2B82A 5F1PA 1VDZA 4L08A 3OQPA 3NARA 1MH3A 1KEKA 3M4JA 5EJ7A 1FYEA 1VB5A 2C8LA 1Q7TA 1RPAA 5DUKA 3G0OA 4FFLA 2W83A 4YECA 3W4JA 3TH5A 1ODTC 3A4VA 3SXUB 5JNUA 4ZQHA 3NHRA 4UNRA 4M7RA 2PMWB 4ECEA 2QL9A 4X8LA 1GU4A 4GX5A 4AG5A 4O2AF 1GQQA 3ZXYA 1WDTA 4QKQA 4HNQA 5F2OA 2L7MP 5FBQB 2O3TA 2I1QA 5E17F 1QHSA 1S3SA 1UELB 3AY6A 1U11A 3N28A 3MAAC 1B3RA 1TLTA 2J85A 5DYIA 2PMZN 2O8EB 1WPGA 1CJMA 5AICA 4MGRA 4AIKA 2XE7A 1MEJA 3H5TA 3M34A 5C5CA 3N2YA 3L1PA 2WT8A 3JAKB 2E9SA 2ZT5A 3SZLA 1NBIA 5DEOA 5K0EA 5A3QA 1P0FA 2J45A 4RW0A 4J0KA 2QLFA 2BTQB 1OXTA 1Z0AA 1QP0A 2OCYC 4LHSA 4Y1RB 2NNNA 3DO6A 1NATA 1EWKA 4HQRA 1XHFA 3A11A 1E9FA 4DBRA 2NXEA 1SS1A 4M38A 2WINI 4UDOA 1PL5A 3ZZTA 2XKAA 1VKZA 2FFDC 1W5EA 4ITVA 3GDGA 5JASA 2A05A 1L3IA 2HWXA 3K0EA 1QR6A 4GXTA 2Y0SN 1JLHA 3ZXUB 2IBDA 4R05A 1ONNA 2PD6A 4H7DA 1SKYB 2DTEA 1QDLB 3RBZA 3MK31 1YA4A 1RZ3A 4ED9A 1TKBA 4MGIR 2M0BA 1YC5A 1PR1A 4Q4JA 2E19A 1DKQA 3BMNA 4ZT4A 4H44B 3HOXJ 2VZEA 3GOQA 2YV3A 1XQXA 1J0EA 1QONA 1VPVA 3MMXA 2C7PA 4FE3A 2YHUA 4TT8A 4J8PA 2OGTA 3AEUA 4YWJA 5FLXZ 4MNTA 1AUXA 2ACEA 1YJ9P 4A8JA 4WF2A 1WNTA 4BWVA 1TJ3A 2CJYA 2IBZD 2X15A 3CMEI 4A0YA 2VBFA 4XWTA 2HU2A 3DTVD 4MYUA 1F3LA 2CS3A 4N0DA 5C8VA 4Z99A 2VDQB 3I5UA 5EMMA 2XR1A 3PHLA 1RM3A 1M5TA 3IBSA 5CCBA 3G4SP 1KRWA 4DV1B 1BW6A 4WZAE 4PN7A 1Y9EA 5AM5A 3A2MA 3TJMA 3L4FA 2LW7A 1KFBB 3WRYC 3Q0UA 2AOWA 5DE3A 4LC0A 3TEFA 4F46A 4LDQA 3CN7A 3EUWA 2R5WA 1PZFA 5IJXA 5ES3A 1N2CE 3ZN0A 4KBGA 4CGYA 3R5KA 5E6UA 2WFMA 3V9PA 3KQUA 3BSSA 4G0PA 2DK8A 1PT8A 2DBVO 3EA4A 4CYCA 3GVHA 3MB8A 3UJDA 2RARA 2WDZA 1DBSA 2OUKA 2JT1A 4EG1A 3LS2A 2EFEB 3U9SA 3UATA 2FYNC 1BI3A 1Q84A 1KQPA 3ZDCA 2WM3A 2BZTA 1XQWA 4HQ6A 1CRPA 2O8BB 3CWBJ 3UZUA 2JZOA 1XU4A 3DBRB 1GGKA 1R1DA 1AV7A 1XT6A 1ZLXA 3GEMA 3WE3A 2WRZA 3DKRA 2AHRA 2NP7A 2AC7A 3W3CA 1AURA 3OEEA 1RKTA 1TM3E 4JHXA 1RCUA 2YWRA 1DCKA 3NAUA 3C1OA 4UB8E 3CLSD 4J03A 2K2WA 2PT9A 1L4AA 3LBHA 4LF5B 4Y2GA 3KAPA 3DBLB 5TE9A 3NUGA 3WB9A 3PX2A 3ZTWA 1T24A 3ZOKA 2QZSA 4II7A 4H17A 1T2KA 1W94A 2B36A 4L0DA 1KSGA 3OLVA 4N40A 3BDAA 4Y0NA 3ZE0B 3VH1A 2RHWA 4C0HA 4LJ8A 1L7OA 4DIEA 4ZV9A 2DF8A 3K20A 5HDNA 2Q6LA 1Q6ZA 4ZVQA 2N1TD 2HJRA 1HE4A 4I9FA 2QEXP 2V7XA 4PEVA 1KRHA 1R4MB 1CFJA 2F9LA 4RHEA 3F73A 4GYJA 4JI3B 2AEJA 3QXHA 2ZVNB 3VR2D 2J3HA 2W58A 2DVMA 2OSVA 1DQSA 4MYCA 3T35A 3KQWA 4PSVA 2OCPA 2A35A 2RFLA 2C82A 2Q4DA 3I53A 3GRUA 3ILVA 1YZGA 1CY8A 2XODA 1U4OA 3LW7A 4Z6KA 1T5DX 3KPHA 2WSYB 3C45A 2UDPA 2CKMA 1GYQA 4ESHA 4OO3A 5JCOC 3ITEA 4MYDA 1I4DD 4HH1A 2PFGA 5IYZF 2YXEA 2QHXA 3GDFA 5ILOA 1TO2E 3IKMB 2Q0SA 3HOWJ 1GV1A 1QBGA 3VTPC 2P62A 1A04A 1MMSA 3AKZA 1SD6A 1FW8A 2F5VA 1M5RA 4LG0A 4NFHA 4KGZA 1GCIA 4JYCA 4LNHA 2F3PA 5JFRA 1MORA 4KX3A 2SCUB 4R2HA 3TBKA 1Y7PA 2BI7A 3WQRA 1VNDA 3P9CA 2XQKA 3J7AY 3KB6A 3G3ZA 5HFNA 1R4AA 1X3WB 1GNLA 1T36A 3L79A 5AW3B 5CPBA