1GDTA

Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE I OF RES DNA
publication title Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 58
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gdtA03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gdtA02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gdtA01
2XB5A 1HDDC 1U8BA 3GUVA 4MIMA 4QSHA 1TWGJ 1VI0A 3RKQA 3ZOBA 3W6VA 5FKNA 3K7AJ 1U9NA 3GTMJ 1ZQ3P 1SANA 2IBDA 3JREA 3HOUJ 2RAEA 2Y0SN 3BR1A 1Z77A 1JKPC 3ZQHA 1QPIA 2L7MP 3DCFA 4FCYA 3GTPJ 1R9TJ 2DN0A 4A3DJ 3LHFA 1TWHJ 4JX5A 1JGGA 2CRGA 5EGOA 4A3MJ 1JT6A 1H88C 2DA2A 1YRNA 2R7ZJ 1I50J 3BTIA 3OIOA 1GUUA 1RETA 2CUFA 1BJZA 4GFBA 2NOGA 4X6AJ 3G13A 3LSJA 1IG7A 2H1KA 1LFUP 1NTCA 2OF7A 1IC8A 5JLWA 4D5FA 2ELKA 2VKVA 3C2BA 4D7NA 5C4JJ 4B4CA 2H8RA 5DS9A 4A69C 2Y31A 4A3KJ 2DA4A 1VFCA 1U78A 2DA5A 3BQZA 2JN6A 3MKLA 4M3FA 4A3LJ 3BTLA 4DYCA 4JX4A 5EDNA 5M3FJ 1IDZA 4A3IJ 1LE8A 1JTYA 1ETOA 2LLKA 5EG0B 3ILXA 4EEFG 4I76A 3LNQA 2NVYJ 4A3EJ 1FIPA 3HGGA 2HXIA 2ID6A 1B8IB 4JX6A 2K9QA 1AU7A 1I6HJ 4A3BJ 1JJ8C 4V2FA 4DYQA 3GTLJ 2Y30A 2P81A 3S1RJ 2JWTA 2YUSA 4FE4A 2LFBA 2XGEA 1T33A 4QIWN 1NK3P 2EBIA 2WAQN 3A03A 1RPWA 4L5EA 2JA6J 2N8GA 3JRBA 4ABZA 5GPAA 2FJ1A 3FK7A 2DMUA 2IEKA 5M5YJ 2KDZA 3HB9A 2DA6A 2M9HA 5E3NA 1IJWC 3IH2A 5GPCA 2XGDA 1HCRA 4M3EA 3OOUA 3CCYA 4M3GA 3O8HA 5F08A 5E3OA 3ZQCA 2NS8A 4XICA 3CMYA 1DU0A 2M2EA 3JRHA 1ITYA 3GTQJ 2R5YB 5EG0A 2DMQA 3GBGA 4MFEA 4W1UA 2QF7A 5FKMA 3S1QJ 4BBRJ 1B8IA 4V2GA 4A3GJ 5HODA 4IHXA 2WB1N 4CYCB 1F36A 1OFCX 2LKXA 2ME0A 5FJ8J 2NVXJ 1JUSA 2ECBA 4A93J 1PUFA 3M3YJ 5EEAA 1QVUA 4BY1J 1FEXA 2JA7J 2COBA 3JRAA 2ZB9A 2JK3A 1HDPA 1QRYA 2VKEA 1MSEC 3G1MA 3WHCA 2AHQA 4IHYA 4J19A 1GDTA 1ZR4A 4DZPA 2B63J 1X2NA 2EZKA 1H89C 2E1OA 3CQZJ 3BR5A 2JMWA 2VPRA 1ETQA 1JT0A 1AKHB 4IEJA 1JKOC 1ZKGA 2MHCA 4JP0A 4D7MA 3O8GA 3TW6A 2MSYA 3HKZN 3JRFA 1HX7A 1IDYA 2IAIA 5FLMJ 3FKIJ 3RZDJ 2L9RA 5JLXA 5EF6A 2HI3A 1ZTRA 4NDLA 2DMNA 3SDGA 5J1UA 2DA3A 3TW7A 5IOYA 3HM5A 1TWAJ 2X6OA 1APLC 4Y52J 1HOMA 2LY9A 1JKRC 2R93J 1GHTA 1SFOJ 2K9SA 4CYCA 5F0CA 2TCTA 3BR0A 3S2HJ 3E7LA 5C31A 5F0HA 3BR2A 1BW5A 1Q1VA 2XPUA 3SJMA 1MH4A 4A3FJ 4W97A 5F0FA 1JJ6C 1WH7A 2EH3A 5K7ZA 2GM4A 3M4OJ 2HOSA 3S2DJ 1UMQA 2NVTJ 1X2MA 5FKOA 3S1MJ 3HOWJ 4BBSJ 2XRLA 1K83J 3BR6A 1T56A 3GTOJ 4LOCA 1GV5A 1Y1VJ 2D5VA 3FIWA 4BY7J 3BQYA 5C32A 5IYDJ 1ETXA 3S16J 3TP3A 3A01B 5EZHA 5K7HA 3QQAA 5IYBJ 2XPVA 2DA1A 3PM1A 1TC3C 5BNGA 4C3HJ 4FTHA 1WPKA 1JKQC 1B72B 2HDDA 2Y2ZA 2VI6A 2L0KA 2MG4A 3QPLA 2R0QC 2CU7A 3BTJA 2E2IJ 2L7ZA 3NAUA 2EZHA 4C3JJ 3TP0A 4S0HB 4D5CA 2L7FP 5EZGA 3DEWA 4FE7A 1E3OC 1MBKA 3HOYJ 2TRTA 3BTCA 2CQQA 2LTPA 3BG3A 1FJLA 2ID3A 5IOZA 1ENHA 5FKLA 5J3LA 3Q0VA 2I10A 3FK6A 3GTGJ 3JRCA 5F04A 1MBEA 5J1RA 1JUMA 2JA8J 1JUPA 1AHDP 2GLOA 5DTDA 2JA5J 1RESA 2EZLA 2MW8A 2Y9ZA 1RKWA 4A3CJ 1P7JA 5EGOB 2EZIA 1TWCJ 5K7FA 1FIAA 1FTZA 3BG5A 3ZQFA 3LSRA 1ZR2A 4XK4A 1UG2A 1Y1WJ 1K61A 5C3EJ 2XSDC 3MN2A 2E2JJ 2G0EA 2GM5A 1H8AC 2DMTA 4G12A 1MBJA 4AUXA 1OCPA 1WH5A 1FTTA 4MFDA 1OJLA 4A3JJ 1B72A 4FISA 2HOTA 3PO3J 1WCMJ 4C3IJ 3LHKA 4X1EA 5EYRA 2NVQJ 9ANTA 5FLVA 3LSGA 4XIDA 1U9OA 1MH3A 5M3MJ 1RR7A 5F27A 4Y7NJ 3G1LA 3HOXJ 3B6AA 3LOCA 3D1NI 4B1RA 2YU9J 1ETVA 3JRIA 1LE8B 1GVDA 2HOAA 1MSFC 1VNDA 1ZK8A 2XGCA 4B3AA 3A02A 3OSFA 2R5YA 4XRMA 3MVPA 4MLOA 3RQIA 1GV2A 2E19A 3HOZJ 2LK2A 5J1YA 2PMZN 5C34B 1JTXA 3ZQLA 4DW6A 1DU6A 2K40A 2EQRA 2LP0A 1XC5A 2Y9YA 1BL0A 1NK2P 3PKZA 3Q3SA 1P7IA 1D5YA 3HEFA 3UKGA 1BA5A 1IRZA 3GTJJ 3FISA 1MBFA 2FQ4A 3HOVJ 2K9NA 4UUSB 5C4XJ 2CQXA 1CQTA 2RSLA 2E2HJ 1QVTA 3IH4A 1HF0A 1XS9A 2VUMJ 3WHBA 3JR9A 1OCTC 1S7EA 1ZGWA 2OPTA 2AO9A 5GP9A 3VPRA 4QTRA 1MBGA 5E3MA 3UJ3X 3I4MJ 4DYRA 4M3BA 2XB0X 3I4NJ 1AKHA 1VF9A 2CJJA 2QCOA 3ZQGA 4RDUA 2FX0A 1ETKA 2M8GX 4M3DA 3BR3A 5M5XJ 5M5WJ 3PO2J 3IH3A 2R5ZB 1A5JA 3ZQIA 1LFBA 1ORKA 3BT9A 1Z0XA 2LVSA 2XPWA 3Q0UA 2DJNA 4C2MJ 2DMPA 3S1NJ 2ECCA 2NS7A 1ETYA 2CUEA 1POGA 2M0CA 2DA7A 5IP6A 1HLVA 3NARA 1IGNA 5IP7J 4IHWA 1IUFA 4XRSA 4BQQA 4BXXJ 2GBYA 1XG1A 3K2AA 5C35A 1PUFB 3OSGA 3JRDA 3HGYA 3TEDA 1MBHA 2MGQA 2R92J 2HYJA 4RBOA 1G2HA 4UUSA 1WGXA 2O7OA 1F43A 2KT0A 2W48A 2X9DA 4HNVA 3QPSA 3GTKJ 3SFIA 1BW6A 1I3QJ 3IV5A 4I6ZA 4JYKA 5E3LA 5FKKA 5IP9J 2M34A 2X48A 3Q0WA 3LSPA 2LD5A 4IHVA 2O9LA 3BVPA 1WI3A 1W0UA 3G1OA 3RZOJ 1ETWA 3S17J 1MNMC 3F0CA 4AYBN 2HQ5A 1YRNB 3S14J 4BKXA 3H0GJ 1TWFJ 1UHSA 2YS9A 2ME6A 2R5ZA 3A01A 3CDLA 1GT0C 5F1JA 3S15J 5IYCJ 4DZJA 1RKTA 1X58A 3B6CA 5C44J 2LR8A 4XRSG 3JRGA 2HXOA 2JJ7A 1W0TA 4M6VA 3BG9A 3H3VK 1A6IA 2WV1A 1IV6A 4MO7A 3HBLA 3L1PA 2O8KA 2DTZA 1EF4A 3HDDA 4UUTA 1O4XA 2FD5A 5IPAA 4AC0A
chains in the Genus database with same CATH superfamily
3BXGA 4FW8A 1MT0A 3HD7D 2G1AA 4HKTA 2B20A 3OCVA 3BHJA 3CC8A 1M2WA 2PS9A 3H1KG 3RKUA 1TJYA 2NUTB 4PSWA 4HWSA 5D1NA 1PDNC 1EVJA 2CXHA 3VJRA 2X2EA 4Y2HA 2GF0A 3BJMA 2GEDA 1XTKA 4MVJE 3G2OA 1MAUA 2CMDA 4N3YB 1M10A 1FJHA 2A1UA 3BS4A 4ILKA 4REQB 5EXPA 2IXFA 3WISA 4NV3A 2WAFA 3UT5B 4RNCA 2QI9F 4BMOB 3TN7A 3USZA 1JTYA 1Q1HA 3PCRB 2X7HA 1B6TA 3HGGA 1QF7A 1E58A 1KD1Q 3IKJA 3G23A 2GVNA 2HPIA 4A3BJ 2PFSA 2JFFA 2OZ6A 2LBFB 3G49A 4M6WB 2QRPA 5GPAA 3LX6A 3MKZA 1GD1O 3HR4A 3WYDA 2KQRA 1BD4A 2HWWA 1E7QA 3DMNA 5LB4A 3CY6A 4EI7A 5CEJA 3ROQA 3CE9A 4EPTA 3IA2A 3WMWA 3TLZA 1ITYA 2R5YB 3IAHA 3ANYB 4E7IA 1KJ8A 3RM3A 1OF1A 1RLOA 1W5BA 3K9NA 3KE2A 4CQMB 3GLMA 1ZGCA 2ZUSA 5LM3A 4YRCA 3FM9A 1FEXA 2A1IA 1TVCA 3GJ8A 1W5AA 1D4FA 3RYCB 3HRMA 1GEGA 3MSCA 3RR2A 1XK6A 3EIHA 4FPXA 2OCDA 4I14A 1SXPA 5KHLB 4B3XA 2ZRBA 1BN6A 1DPRA 3DP9A 1RZ3A 2O0MA 3DZKA 2QTCA 4QWMA 1T39A 3O8GA 2ZQYA 4BX2A 2LF7A 4NQRA 2EW2A 2YBDA 3IDZA 1FMJA 1IEQA 3DLPX 2RAPA 3SDGA 3JQGB 3N0WA 5CB4A 4FX4A 3FG9A 2Z6AA 3LPCA 2RH8A 2HDNB 4I2VA 3OQHA 3HKEB 1MOZA 3NVKI 1CBUA 2BHNA 3LVFO 3OQJA 4AKTA 3I6YA 3ZXSA 2IU0A 3IVGA 3NIDB 1MJNA 4XE5B 2I3GA 5DGHA 1RPTA 2ZIWB 2ZBEA 1ZWLA 3ZY3A 3CRQA 1L6RA 2XGXA 5CAEA 3I32A 4Q93A 3WLEA 3ZLUA 3K5BA 1IXYA 1RI4A 4TKVA 3I56P 3T9DA 5GOZA 3T1QA 1QC5A 1NXXA 3KAQA 4I4TF 1HE8B 5JI6A 1PG0A 1FZAA 1A9QA 2YNYA 3OX1A 1KDOA 1QM5A 3GVPA 4MS4B 3P45A 5BPIA 3O6BB 5FA5A 1G6Q1 1F1BA 1NT2A 2FSWA 1K6OA 3LL7A 2BDTA 1XAJA 5KYUB 1FLAA 3PEYA 3VYVA 1I4EB 1W0CA 1H2RS 1C80A 1UMBA 3X44A 4Z3OA 1TW3A 4RW0A 1NTOA 4R98A 3QI7A 1V8ZA 2FHSA 3NLLA 5K2OA 1KIMA 1XO1A 3EULA 5FDFA 4DM4A 5F5XA 4Y1EA 3IEUA 5E1MA 2HJSA 2Z09A 4CQLA 2DFKB 3DXFA 2A58A 1ICEA 3CCRI 4D4GA 4EA7A 2VDRB 1H6AA 2EC5A 2GESA 4H6XA 2KIKA 2C4WA 3NWOA 2K9LA 1D03A 1GA4A 5BV1A 3E81A 4FILA 5DJTB 4LW8A 5PNTA 5KIAA 1M1UA 2OHHA 2FX0A 4JQCA 3QM1A 4ZEWA 1TIKA 3U3DA 2GHRA 5ALJA 2Z5GA 1CUDA 3I9V6 3BMOA 3K9TA 1U3TA 2GF2A 1ETYA 3OTGA 3EVFA 2ZB8A 2KB7P 5JC1A 3NTXA 1TYEB 4BNDB 3GGGA 4L8GA 4DQ2A 1USVA 4RTNA 3PHGA 2BKLA 2V6BA 5AHXA 3PS9A 2IHVA 3NC1C 3W3AD 4CEJA 4DIEA 4L74A 4XGRA 4UHEA 1JP7A 5FFNA 3UTDA 4JUBA 1BDHA 1O9HA 4K6FA 4EEXA 5B4VA 3WWPA 4TLCA 3BYZA 4UB6H 1XCBA 2OZEA 2JCBA 1DX7A 3GLFA 2IRFG 4NYIR 3MGGA 4FKZA 4W5HA 1Q1QA 3WMGA 4H17A 1NR5A 5TEWA 4DLKA 3C9IA 3DLTA 2DFLA 2YO3A 1E77A 1KN7A 3WK7A 1U3UA 2OCIA 5DNDA 1PIWA 1ZK2A 2DQ4A 4KNYA 2R5FA 4EUFA 4MW5A 2HMVA 1KZ9A 1EFUA 2MOKA 2XB6A 4Q4LA 1WJ5A 3NTQA 4GL4A 4G7OF 1JKJA 4O4IF 3KFXA 1R6AA 4XLCA 2JLSA 5LLDA 4BRYB 1YR7A 1SVLA 3BX1A 1BE3E 5AKZA 1QRDA 3G1WA 5K8UA 1U2QA 4CU2A 4KN6A 3HPQA 3SVLA 4B74A 2BEVA 1PJ3A 4BDYA 4MWGA 1KBZA 1P0QA 4XFDA 3BF8A 4IH4A 3T95A 1P0CA 4CM9A 1G5QA 5D3MB 1RADA 5IDXA 5CFNA 3DE6X 2GBIA 1FUKA 2P9YA 3WK8A 4Q7JB 2J07A 2A5LA 2BSQA 3OEWA 3OIGA 2NYVA 2JA6J 1OCEA 3LX4A 2YUTA 4JLNA 3HBFA 1WPGA 3KIOA 2BR4A 4ETIA 2ZZNA 1DDNA 3H99A 3P20A 2M9HA 1JJ7A 2WSEH 4OIRF 1NRWA 5FPPA 5JXHA 4ND3A 1GTZA 4HXGA 4P4GA 2GSDA 1DAGA 4KAFA 4BQNA 1HH0A 4NAVA 3R77A 2GBLA 3CLVA 1H42A 1Y5NA 2W2MA 2WQZA 2PLWA 2JJ8A 1DIPA 1ZH0A 2GHQA 3W1WA 1HOTA 2VDWB 4EG8A 2X3UA 2LKMA 4R8RA 1T8WA 1V5IA 4NBTA 1BJTA 3DAHA 3CR7A 1M2VA 1C0EA 4FDUA 2GZAA 2XAUA 5I01A 2WINI 1C0PA 3WGQA 2PD3A 4RZUA 3DT8A 2W6BA 3I9LA 1PJSA 5BUCA 3KSBC 3RQ4A 3PK0A 3NTRA 1I3MA 1XX6A 4H3SA 1HXHA 2EFDB 2ACKA 3GGCA 2J7KA 1CZLA 3HPHA 1KFMA 1GKKA 2EEPA 1LWUB 4I5FA 3K0HA 1CERA 4NFHA 4ND4A 1J22A 3GO4A 4L07A 5T3YA 5JQGF 2BF7A 1U0TA 4GXTA 1DKPA 1QHHA 5HZGA 5F0FA 2C9CA 4GMGA 1JIUA 1QQIA 4R2LA 4DDKA 2UUPA 2JFBA 3S1MJ 4F3CA 1T56A 3C4QA 3C8MA 1AQJA 3TKAA 1GUFA 4S0XA 3MNFA 2FYNC 3BIOA 4P1ZA 5F77A 2CH0A 5A3QA 1PDVA 4PGMA 3HUGB 3GGOA 4DLNA 2FPUA 5TE9A 1Z13A 4UUNA 4TT8A 3GAMA 2ROQA 1GITA 2O7RA 1HGVA 4CF5A 1BE6A 4MHOA 2QP3A 2ZT7A 1PFUA 3GHHA 1XQYA 1JZQA 4JXZA 5C81A 4FFBB 4TTAA 5CMLA 3MJEA 3SC6A 1QONA 3OA0A 2V5UA 2AMJA 1ZM7A 3JWHA 3D6NB 4UJ3A 1LXCA 3BC1A 3OY9A 2QRJA 1AV6A 4KQ2A 1GPBA 3UATA 1Z4NA 3AR8A 2VDLB 4AX4A 1AA0A 3AG1H 1B72A 4B17A 4HY3A 2O03A 1S8OA 5SYMA 3TXXA 3DOHA 2VQ6A 1O8CA 2YWGA 1FNCA 1K7YA 1OOEA 2G9UA 5L53A 2YU9J 2R7LA 3OF3A 2X2OA 4ENNA 5JNSA 1EV7A 3KDSE 5KHDA 1J0DA 2F6CA 2ONCA 2OV6A 3RC1A 2OC6A 4HDSA 3FF1A 1TNDA 4HQ6A 3HZJA 2OHIA 1IO4A 2LRHA 1L7EA 4QTZA 4KDPA 2BY1A 3D6FA 2KFDA 1ZL2A 1O87A 2VPWA 3UMBA 3QBTA 4TLLB 3PQJA 5KS2A 2QPLA 3IH4A 1A27A 2M6KA 4CLEA 1A35A 4MN4C 2C7QA 2FZ4A 5TGDA 4DCJA 2BCCG 5IFLA 2E85A 1BMFD 4N7RA 2AD5A 1F4VA 1D9ZA 4BFTA 4ZANA 3CMEI 1M34E 2FX5A 2OYHB 4FCWA 2XBUA 3KKQA 1XLWA 5BN3A 3II6A 3KPYA 1J23A 1WCYA 5LOVA 2NZVG 2XZOA 3HGYA 1K05A 1RR6A 1HTWA 4HJRA 4QGHA 4AQRD 3OLZA 4BLOA 4UPVA 5IT9Z 4P1WA 4RWEA 3GX4X 2VYQA 3GMIA 1P6XA 3OZFA 2X48A 3MG9A 1Z75A 4NJEB 2AMYA 1XCGB 4I55B 1VQLI 2QA5A 3CCLP 2BMFA 4L3WA 1OWMA 4BKXA 3RU3A 4KG7A 5TC4A 4MQFB 1P5ZB 3L0OA 4TWBA 3N2ZB 2NSYA 1IUPA 2WIKA 121PA 2BGLA 2WYUA 4WXRA 1WP9A 1B6SA 4R0VA 2JGDA 1JHMA 1MNQA 3N5KA 5LYYA 1TECE 2VSYA 1IVYA 4JLAA 4TOIA 3IE2A 4LHZA 2ZSJA 3LNCA 2ACVA 2CMPA 3B51X 1ULAA 1C7JA 3HRTA 2XCSB 3KR1A 3PLNA 3A4LA 4D9BA 2ZR9A 3CQ9A 2W2PA 4IFMA 1LLDA 3TX6A 5KOYA 3NPAA 1SFCD 3CSUA 3VC2A 5CH3A 4FWTA 3NHRA 4MZXA 2XGOA 4OX9B 3THWA 2WD7B 4UHFA 4YP1A 3G2QA 4MUAA 2QORA 1XTTA 4DMRA 1UAAA 2QIPA 3W34A 5BWCA 2G80A 1RQLA 3QF4A 3DOCA 3VO2A 2OR3A 1MIOB 3LNQA 3RL0B 1NJ1A 4LRQA 1I4WA 1WQ2A 3LH5A 1NU1D 2E6KA 2O50A 1G63A 2C61A 2ZRDA 2IH5A 1SUWA 4WLEA 2BTQB 3EUHC 5AW9A 2JVGA 3GRPA 2BZ1A 3EC2A 1ZIPA 2L0XA 5MN5A 3EB9A 1Z0KA 2P1JA 3HU3A 3G2LA 3TLGA 2B7LA 4P0PB 3S28A 3CR8A 2Z9BA 1PCXA 5ESXA 2B4AA 4LGMA 3W5VA 3DPLC 1SU8A 1D1BA 3M3PA 1LV7A 3I4CA 4MI6A 2DMQA 2QF7A 4E4HA 3T7CA 2CXNA 2FYTA 3NM4A 3BASA 4ZMRA 3T1HB 1ESDA 5AMXA 1CZNA 3T5MA 4MI1A 3DSRA 3UGQA 3B38A 4DSTA 4EARA 2BKXA 4GM4A 4S24A 3UK6A 3TBHA 5HIAA 3ML1A 3JQ9A 5KINB 9GPBA 1DAIA 2OSBA 4Q3LA 3A3KA 2JMWA 3N86A 2OO3A 4U02A 1SLQA 1U2ZA 4D7MA 4Z4CA 4YRKA 4UTXA 1PL5A 1WJAA 3HWRA 2WWGA 3OMWA 2NTYC 1JA0A 5JZBA 3B5NA 1KYXA 4KQXA 2FWBA 2CFSA 4ICIA 5ALIA 1T8RA 1DKUA 4X24A 1NJ5A 1MAVA 4NE7A 4BX0A 3TLBA 2TDXA 4YECA 3E4CA 3HE5B 3MWYW 3LDFA 4K6KA 1JJ6C 3DW1X 3MRVA 2MJZA 4KWEA 1JR6A 4RIGA 3FZGA 4RY2A 4RXMA 2PFGA 1LDJA 1B41A 1Y9EA 3NV9A 2HI0A 5GM1A 4FKBA 1JI8A 3IAM1 2PAAA 4LAFA 3ET5A 4PLWA 2LCQA 1VXRA 3RV4A 3KJEA 4K0KB 5K5OA 2ID3A 1BC5A 4OQDA 4Y2SA 4YC7A 3UFBA 5ITZA 2QP4A 2VT7A 4MVJI 2I2DA 2YR2A 3QY0A 5CRIA 4S1OA 3QPCA 1EIZA 3L5KA 4OM7A 3VR5D 1UG2A 4DV6B 1JFRA 4R2JA 4A3JJ 3H5LA 5BY2A 2AJ8A 4H7DA 2DFPA 1J2YA 4RTJA 2XDWA 3E9MA 4PSDA 1QX4A 3PJSK 1JO5A 2QVAA 4F52A 3CI9A 2A9QA 3Q3HA 1GTRA 2QLZA 4M74A 4J2TA 1DSSG 1FDMA 4NE9A 2K3PA 4XJSA 3FF5A 1ZVMA 2VRCD 5AQEA 1VL8A 2C5LA 1QFMA 1EU1A 1DU6A 5E6SA 3SF0A 1IMOA 2ZUCA 5AH0A 3N0TA 2P6MA 4J3FA 5AW8A 1RF0A 4WFQA 2XZDA 3IOBA 4LLNA 4PX2A 3JYQA 4ASVA 2WUDA 2RKBA 1H3NA 5LYJF 4XL9A 3Q87B 4O2AB 3E7KA 3DZIA 3OA2A 3NBQA 1EAYA 3WE2A 3IDFA 1DB3A 3MGCA 3OETA 3CHYA 2R6GA 3AOEC 2V1NA 4H1UA 1SBIA 1M6NA 4LMPA 2XHKA 4WCFB 5BSHA 2AD1A 2I4MA 2LBPA 3UOWA 1MD0A 5DCYA 3EGDB 4EG0A 1Y8AA 3WLJA 1T91A 4Q9AA 4OJNA 4N6JA 1PN3A 1FQJA 1I3QJ 4G0WA 1YCHA 1NFFA 3N53A 2W6AA 1F06A 5E95A 3CO5A 5CA0F 4JJGA 2YFQA 4ENVA 4IQFA 3K0EA 4DBVO 2DCEA 1FZBA 1OBCA 1PNVA 1C9MA 2FWPA 1QG2A 2OCPA 3D5QA 3OS1A 1FVFA 1F0KA 3CEJA 2HQNA 1RRFA 1TJ4A 3OEHD 5KLVK 3RKQA 1R6VA 3G0IA 2HCTA 1XNRB 1RT9A 1N2SA 3E0QA 2R6HA 2XNCA 4A7PA 4RTPA 4A27A 3I2HA 2GF9A 1V41E 1UIRA 4GFBA 5AVTB 3IKVA 4P5EA 5AJWA 3GNLA 1ID8A 2WQ7A 1NPYA 1UIMA 1BW9A 2FW7A 5JMWA 3GLFE 3AVOA 1EBBA 1ODJA 2DA4A 4G0ZA 2KIQA 4RQAA 1J42A 4LZNA 5KNDA 2HMAA 1YQ3C 3OFSA 4MLPA 4TWRA 1V71A 2EP7A 1ZRTE 4EEFG 4B31A 2HVRA 4UCXA 3MZHA 1M73E 4PPNA 4RQBA 5E38A 1QVWA 4N47A 1QLED 2OT3B 2FPWA 4Y6RA 4GQAA 1NUAA 1M2EA 1GPYA 2CF6A 5JROA 3D7NA 1G6KA 3Q2YA 5E9QA 1XELA 2GPBA 5JSUA 1QNTA 5BRAA 3PFNA 1E1NA 3GZJA 3M8JA 2A9OA 2G71A 2YV2A 1M2JA 5K3SA 5EG0A 5IKOA 4LJ8A 2EJBA 2VZLA 2JFXA 1QGKB 4UTRA 2PLAA 3IBGA 1VYTA 3QFCA 2IHYA 4DARA 1AB5A 1RRMA 1YMVA 4MV4A 5E6UA 4MHTA 5LIRA 4R8SA 1QIDA 2J5UA 4J1QA 5CFLA 2CV0A 3O6QA 4EYKA 3O8CA 1MBZA 4M2LA 4BECA 4YCMA 2CNNA 1Z17A 3GNQA 1NOIA 4UUMA 2FZEA 3WJ1A 3FDZB 3A05A 4YJHB 5K3BA 3NETA 3D1VA 1QIEA 3RSLA 3MTBA 3JZAA 1FU8A 3VYUB 4S2UA 1WCWA 4WXHA 2J9YB 3GZNA 1G0OA 4RGXA 3UHJA 1QHXA 4LJYA 2I66A 2ZGVA 5IT5A 4QRDA 1EVEA 4ZCMA 1UM9B 4LMYA 3DT9A 3O1LA 1A2OA 2ZULA 4X66B 3PUKA 2BFWA 1ZOOA 4P4SA 2I6UA 1DRKA 1Q0RA 2KRCA 3SQWA 3LI2A 2X85A 2X4LA 3TZCA 1B00A 4E4RA 1S1CA 2WDPA 3S8EA 2PMKA 2WD9A 3R5JA 2AXTC 2Q4BA 4DYDA 2O57A 5B7GA 4ARSA 1V43A 1OI3A 4NZYA 2RGUA 4EQZA 3R1IA 1MXFA 5T67A 4N49A 4PN7A 1O3QA 1L1FA 3NWJA 4POOA 4Q9LA 3ZVKA 2V6CA 3K10A 2IA1A 4YV0A 2QJTA 3NAGA 2P0YA 2B9SA 4EL0A 2F4OB 4Y28J 4K7JA 3T7SA 2ZMEA 4KI0A 1XZEA 4ND2A 1E9FA 3TE6A 1WRJA 4E7JA 3HC7A 1UINA 1S8FA 5FH9A 2QSGX 3VOSA 5KKNB 1K68A 4QYIA 1BDJA 3HDGA 3MJTA 3H6KA 1PKXA 5M3MJ 3DG9A 2DEUA 2WZCA 5FXMA 4M7WA 5C3UA 3VH2A 4JX9A 1LC0A 2AC7A 3H2HA 2QGZA 3AESB 2M5AA 3QBEA 4LY0A 1ZN7A 1MQ8B 3H4IA 3BG6A 4PO9A 4PJ0H 3R2PA 3UPDA 1NVTA 1P81A 1XAHA 2GEVA 3N2GB 3RVMA 4TV8B 3C4JA 4D98A 3AQIA 3B3FA 3DFMA 1L8QA 3RT9A 4I8IA 1MABB 1ORKA 3O75A 9MHTA 1M83A 3E8XA 1JHHA 1W2HA 3PEVA 5BRJA 2PMEA 1KAEA 2N9UA 3H2YA 4EKNB 4OYRA 1HO3A 5DXAA 1I4TD 1PR6A 1AXRA 3QQ5A 4ARZB 3AG3H 3D4PA 2O7OA 4AVZA 4CLHA 2KZGA 2GD1O 1E98A 3WGVA 3ZG6A 1M1EB 4QUKA 1D6SA 1BCRA 3MLBA 3PHHA 1CS0A 3V2IA 5B7PA 3L7WA 2IS1A 2BGRA 4HVAA 1UT5A 3T5GA 1UOPA 3PPIA 5IP5A 4NC7A 3MWJA 1S6YA 3TQHA 4LB5A 2HU5A 5C4GB 2XRFA 2H0AA 2IY8A 1EFTA 4MIMA 2PUFA 4F86A 4YXWH 1GQOA 3AHJA 5DUIA 3JCZA 4HWTA 3HGTA 4C87A 4M1MA 1PJQA 1SQPE 1Z77A 1E2FA 4PLTA 4DLPA 1TWHJ 4FFPA 5LQJA 4CQNA 2L18A 4ZA2A 5A0FA 2L9VA 3BSYA 4Y3UA 4JWTA 3C2BA 4W1PA 1GGNA 1FFCA 2I65A 1KMCA 3QENA 4YFYA 4DYCA 3HJRA 3KOWA 1ZZGA 1ZMTA 3GL9A 4HZUA 5KWIA 2VHXA 2F55A 2WAOA 2R9VA 3PQCA 4OREX 1NHWA 2GD2A 5KLVJ 2JWTA 4DQXA 3VU9A 1JKMA 3GQBB 3S7TA 3Q9SA 4D0LB 3ZCOA 3V8LA 4EJTA 4M8KA 4HEA1 5EMJA 2XRMA 4B3HA 2RGVA 4I3HA 1ECFA 4ZAFA 5KNCA 4W1UA 3P1JA 4N5DA 2QJYC 1RZRA 1SUPA 1TKBA 4O4LF 3ILSA 2KX7A 4UXNA 3DAPA 3UUFA 1L5ZA 4J4TA 1GJRA 1GPLA 5APWA 2IYQA 1R0YA 1VRCA 3LQYA 3QX7A 1T5LA 2VPLA 4QO8A 5ALVA 1JEKA 1T2NA 3K8ZA 1F12A 5GJWC 1HDGO 4OLBA 1L5LA 1PBNA 3A6FA 4HJXA 1JVNA 4HBZA 2BFEB 5EMNA 4G0MA 1DNPA 1L4LA 2XR1A 5BWMA 4KRGA 3DLAA 4M9UA 2HZDA 3UA3A 1Q77A 1TNTA 5JDIC 1GYPA 5HEKA 3TNFA 3DTIA 3MPOA 1TM1E 3DYVA 3L70E 2PFBA 3BB3A 4O4HB 1WUKS 1Y5LA 4GG1A 3DF9A 3GF2A 3UB4A 4TTIA 1Q16A 3SJMA 2NZYA 4BVAA 4RESA 5K0CA 2OC4A 3SE0A 2AXNA 3ONVA 2Y0SA 2YZMA 3FPKA 3Q10A 4OGWA 3C85A 2PKYX 4IHTA 3ZDXB 2GCPA 2H8KA 4GECA 4RQTA 4FS3A 4XKJA 4G4SP 6ABPA 1KPIA 2G5PA 1W7PD 1L5SA 5FBKA 3HRUA 4RYDA 2VDUE 3G2NA 5GVRA 5G1NA 4FK8A 3LCUA 2QUHA 2E21A 1BHJA 5CEEA 1ZJWA 3T06B 2AXEA 1BRTA 4I19A 4MEJA 3H1HD 2CQQA 3CJTA 1QF9A 5E2BA 4WA8A 1BEZA 4AG5A 4RJTA 1PS0A 3V8BA 4IJMA 4LKRA 2B8TA 5TQJA 2P65A 2XPCA 3TNLA 3WIDA 2P78A 5TY0A 2INGX 3D4LA 2WYOA 1WHTA 3GH3A 3BGSA 4OB7A 4QFBA 2REBA 2RI6A 4ZOQI 2IS4A 1MH3A 5HHTA 5F27A 2AOUA 5B55A 3NUQA 2YXNA 1XTIA 3DL2A 1XRSB 4L50A 1MSFC 2G3YA 3TPZA 2HWUA 4I99A 5KDOA 3OZ7A 2W22A 1JTXA 2FLVA 3S5JA 2XZLA 3WWCA 1E9AA 2JJYA 3T3NA 3I5YA 3E9QA 2CW7A 5T6MA 3FVTA 4G1MB 3ZGXA 3L9WA 1X7WA 4OHCA 3HY4A 3BRVB 2Y77A 2JTVA 5GAHJ 2E36A 1MGOA 4H0LD 4DV7B 4QBHA 2H1SA 4X1IB 2XB0X 4TV9B 4XWOA 4IL6X 4LGVA 3TTWA 3D6TB 3E5MA 4KP7A 3R9IA 1XMXA 2XT9A 2YTZA 2V0NA 4LK2A 1Z6PA 3OZRA 1YE5A 4XMYA 1G20B 1VQ4I 4OHYA 1I6XA 4DZTA 3T9FA 3CD6P 1LLFA 1YLFA 5T57A 2P9CA 3JQAB 3H2IA 5KVQA 5IKEA 1QZTA 3W90A 4KN8A 1FRZA 1N7GA 1CETA 3LWFA 4BATA 3OQIB 2FWRA 3ETGA 2ZCJA 3S2YA 4FDMA 1WSUA 1W44A 5ED0A 4URXR 4LYFA 1PR1A 4IIGA 4DXDA 5FBVB 3OE5A 1XQ9A 3AL0B 4DV5B 2P90A 1TCAA 5FPTA 2AS5F 1Y3DE 3LRXA 3PUZA 2KDOA 4KW7A 3A3YA 3LIIA 3W3CA 2J4CA 3BLYA 3RAPR 3MWEB 4YREA 2I7XA 1F0YA 4BGVA 1ZH8A 3DLCA 4I6EA 1LS6A 3HDDA 4C7VA 2R7TA 2PQMA 1PG5A 2FEAA 3P0HA 4I2OA 1M1XB 2X86A 2PXCA 3LFTA 4TM8A 1UMDB 4G8JA 4WK0B 1LVUA 4O3MA 1NZJA 1L6IA 3KFWX 3HCWA 1K7XB 4KWHA 2WB1A 1U0JA 1OR8A 2JAUA 3U4GA 1GUBA 2PUGA 1QOPB 2GNOA 5DNCA 2DFFA 3H87A 1R7RA 2OILA 4EF6A 1KK0A 4TL8A 3D3WA 3R7AA 3KYBA 1PWXA 4ZT7A 3ZJ4A 1UKYA 4Y17A 3U2RA 5C4JJ 1Z7EA 1KFBB 2B9VA 3DGFC 3RS9A 4UXHA 1E5WA 4HSGA 1F48A 1U2DA 1UPXA 1EE9A 4Z54A 3PC8C 2ID6A 3ZMZA 1GCAA 1L7RA 3WDMA 2FBKA 1W59A 3OJFA 1ICIA 4L2IB 4XLPF 5CCGA 1V48A 1OREA 3FYUB 3GB9A 4KTTE 3DOUA 2GDZA 1ZCJA 2JK1A 1H66A 1K2WA 2EPFA 2FJ1A 3ESXA 3QVGB 1PWYE 4B76A 2PYIA 3S0JA 5BSRA 1ODCA 1UEIA 3AP1A 5EHNA 5KZMB 4UTPA 1URQD 3GBGA 1NMXA 3LX5A 4RGRA 5FFFA 2MLKA 3K9FC 3SGLA 3NHYA 2HTEA 3T1TA 1R23A 4YV7A 3PJDA 4EUSA 2LG4A 4O4JB 4BO7A 4BY1J 4BY9E 2QGFA 1U3FA 1HKQA 3GUHA 4WPGA 2WM2A 2XCUA 2W5UA 2AKAB 4HLYA 3V3TA 5HKKD 1ZVKA 4NQWB 4FYWA 1LI7A 2GFQA 3KZVA 1SC3A 3TG8A 3I12A 2V98A 1Z7YA 3ASVA 1I7NA 1YJ5A 4X7PA 1AH2A 1LA2A 4X62B 1QO0A 1Y1QA 3EGIA 3CX4A 1VSTA 2FEWB 4U2GA 3IKMB 1FP4A 3UUEA 2XCQA 3NVMB 4TSFD 2JHPA 1OW3B 5IJAA 2REOA 2VPQA 3OURA 2DBYA 4NHJA 3R41A 3B48A 3RIGA 3OJLA 1R5OA 1T2CA 4LPKA 3DUFB 5E4FA 2OORC 5I7AA 5IS2A 3G79A 1Y1TA 3FWKA 4ESHA 2ATVA 3HEBA 1U2SA 2BGWA 1J7JA 1L0LG 4ZIRA 2CVZA 1IY9A 1CDDA 5GTDA 4XIJA 3U49A 2Q8KA 4KXWA 3TB6A 1G4AE 4CT5A 1E66A 3KT3A 2AS0A 3S7ZA 2GAFA 3LK6A 4GX1A 2EWMA 1ZR2A 3FVVA 1E99A 1GKUB 2JHCA 1QKKA 5IYZB 3G9QA 2HX1A 4XUGB 5EXSA 3CURA 4ER5A 3LSGA 3L72E 4M1OA 3AG4H 1NVDA 2HPMA 3E5UA 3ZD8A 4CEHA 5C8XA 5D1HA 5DWQA 3BCCG 3R7SA 3KP5A 5EJCA 5J1YA 2VYCA 3BB1A 1DZIA 3UKGA 5M29A 3GLXA 3OW2O 4BP1A 3C3XA 3W8EA 2IBZD 5DLEA 5INTA 6Q21A 3SPXA 3U17A 3RYHB 2B3TA 3DE4X 5EL0A 2XMSA 1A8UA 3WLLA 3N6VA 1EYZA 1T2KA 5ELLA 4XKVA 1YT5A 4GLFA 2WPVB 4AJHA 2R97A 3Q9NA 1RY3A 4NNPA 5IXYA 1M1NB 4Q7LA 1TC1A 5U4XA 3A9CA 2Q1XA 4MA0A 1X79B 4WH0A 2F3RA 1VHWA 4HLQB 1MRZA 3H5NA 1TYDE 1L8AA 1K78B 2Q07A 4OL0A 4KRXA 2IH2A 1DKOA 4PZCA 5BVHB 2ZO4A 4AN1A 3H7AA 1DP7P 2ZR7A 1H2AS 3LSPA 4B3RB 1EEHA 5LL6P 5DWVA 4L85A 4UNOA 2UXBB 4TTVA 5TISC 3PSIA 5JH7A 2XU6A 4CG3A 2WAQA 1XYVA 2YUIA 3WBJA 2Y76A 4F5EA 2CLLB 5IKXA 3HGQA 1JEYB 3DE3X 2ZJ4A 3N8GA 4Y9TA 2XUGA 1B42A 1NI3A 3VTPC 1ZOPA 3CCSI 4YUZA 4JJ7A 1KTIA 4XX0B 4FASD 2H2HA 4XQ0A 1SANA 2EW1A 3TW0A 3ETEA 2ERYA 1J2UA 4W6ZA 1NG6A 3HB1A 5BQTA 1NVMB 4EFLA 3OKFA 2ZAOA 4G6QA 1CUYA 4UREA 3VOAA 3ZU4A 1BVYF 1H2EA 5J2TB 2M4KA 1P84D 2BR5A 1UBKS 1NVGA 2DA5A 5IC4A 1Z7BA 3IP5A 1RLJA 3ES9A 3BPXA 4IHKA 4X1OA 5JHGB 2ZYDA 4LJKA 2JK0A 2QW0X 2XW6A 1SFCB 3H2ZA 1SG0A 1U0SY 4DCVA 3TZKA 5KWJA 1RXIA 5KTOA 1LKXA 2O7NA 2XAAA 1TU3F 1ZLJA 5CVRA 3D8BA 1LB1B 5KX5A 2RHCA 4MHGA 4A0ZA 5THKA 2QTAA 4ZTZB 4EEKA 2COEA 3CXHD 4EW6A 2XNDA 4UDNA 3L74E 1FS6A 4X1YA 2FYUD 1G8FA 3M2TA 1G8KA 1HSTA 1JBEA 1XWIA 1HL3A 3FKSA 1MH9A 4O6JA 4AUMA 2P2UA 1UBSB 1JT9A 4CGZA 3SJZA 2OCEA 4IS3A 4ZI7A 1GDTA 3T7IA 2XYGA 4P7BA 3WYFA 4KQCA 4RENA 1KZHA 1JHFA 4OMCA 5JYEA 5K3EA 3EIFA 2AXPA 1JXQA 3VDXA 5BNZA 3J80K 4CL3A 3OU7A 4M89A 3SIWA 1DQPA 4H1TA 1TCUA 4D6PA 1X19A 1JVSA 1QHEA 3QNUA 3VZCA 3RRBA 3ED1A 4QICA 1G2CA 3ELDA 3MGNA 1EM8B 1DIBA 6YASA 1VG8A 2I7TA 3H32B 2IJLA 3WVNA 4WKBA 1W1WA 5KLIC 3B20A 3KUKA 2C9NY 2GZDA 4MDYA 1U1DA 2DF8A 3TEFA 1Z83A 1MW7A 2IFTA 3MZ0A 3V8JA 4LWQA 2AEFA 1YB5A 4HB2A 2F43A 4B3CA 4CLOB 2MG4A 3U4MA 3L73J 1SQBG 2LMDA 2NZXA 4F2GA 3Q11A 1ENHA 2CLKB 2MC3A 4OV6B 1DE0A 3UIEA 4IWXA 1XCPA 4EF5A 4MDEA 4JJKA 4YJ3A 3JYHA 1PGNA 4G0YA 1QUEA 5A3SA 2I62A 2BEWB 4DCPA 4HF0A 1U02A 3V8KA 1OU4A 2IPOA 5HMMA 1RQNA 4IVNA 1P91A 5TQ2A 1E2PA 3BJIC 4PQEA 5D8DA 3X1MA 1PR3A 4DCOA 3EQ8A 1Z82A 3FXDA 3NBYC 4CM4A 5BT9A 2X9VA 5KYVA 2ZXEA 1ORDA 1LPQA 3CM0A 1R37A 4BFWA 5EUCA 3HEFA 2RHTA 1XLUA 1QL2A 3GTJJ 5H4HA 3CONA 3V4QA 5CVUA 2D1VA 3CBGA 1NTMG 3BIFA 2KHZA 3LKDA 2VHEA 1Y4SA 3V5BA 1DU4A 2GD6A 1SKQA 5SY4A 3W7BA 5KJ7A 3RIYA 3PNTA 2D6FA 2UZ3A 2AG8A 2VRSA 1MJBA 1ZD2P 4J16C 1GPMA 3ZR4B 4INZA 1D2RA 4UU7A 2O2ZA 2M1XA 1GM5A 4GLBA 2FMYA 4WX9A 5BW6B 1OCCH 5KJEA 4I9HA 4Z1MA 4BXXJ 3VHLB 3S44A 3NT2A 1N36B 1G3WA 5GQSA 3EXHB 4EKGA 4ZNCA 1L8XA 5L51A 3NW9A 1SD6A 4Y6QA 1UADA 1MC8A 4E03A 3HADA 1KY3A 1TKCA 1WQ3A 3CN7A 1YZYA 1Y6JA 4PPGA 4LF4B 1RAGA 3R40A 1G9XA 2CHQA 2B83A 5CYPA 2EKPA 5H70A 4OY3A 5KMGA 1F7UA 3B6CA 4C0HA 3KQYA 4L8LA 1M7BA 3IRRA 1H0SA 2VP5A 3O0DA 1IY1A 1Z0IA 1O4XA 4DR5B 3GOQA 3FUXA 4IIXA 3ZXIA 2JGJA 1ZK4A 3VR6H 4WNAB 5HK9A 1EP3B 3CCMI 1EZ4A 2W58A 2ICWG 2EDCA 4EJOA 3TDMA 1Q0UA 1X8LA 4DCCA 4AMBA 2OKCA 3K0CC 5BVZA 1GDDA 4LBYA 1I50J 3EDQA 1A36A 3JQ8A 3UK0A 1KZ4A 3BGOS 1FSGA 3QUQA 5DM6F 4D5FA 1RNLA 3ZDAA 4E2ZA 3REFA 3PPVA 4E5SA 3ABQB 4RFSB 2ZE7A 4KIGA 1RI1A 3Q7QA 3JY6A 1L7PA 4PAGA 4LXQA 1B2RA 4YAUA 1C0LA 3BICA 3B3AA 2D0OB 2W2TA 4GS5A 2YUSA 5CYGA 1JMVA 1I36A 4NESA 3C5HA 1TK2A 1P2UA 4HUJA 3OQOA 1R0WA 5DV9A 3JPWA 3HZOA 2SKEA 3L1KA 2Z6VA 1GL2B 2I29A 2OL4A 4BHBA 3CKYA 5HKBA 2ANBA 5DM70 4FHCA 1CY8A 4JP3A 1U9JA 4KXQA 2ADFA 3NVDA 2VTDA 1W25A 1WCXA 4RDCA 4JC8A 5GVSA 2ORYA 4LF6B 1QV7A 2ZYGA 1VMAA 1Z6RA 2JD0A 5GM2A 2GFHA 3NEUA 4R0MA 2B9BA 4R1MA 3JZIA 4RA6B 2AGVA 3RHSA 3ZPLA 3OCZA 2I8AA 4BZZA 1BFUA 3EHDA 1DJMA 2AR0A 5LHGA 3RAJA 3EDMA 5A2QA 1JKOC 9LDTA 4B5KA 3C1DA 2H48A 5EPOA 1OY1A 2AYYA 4BCBA 4MP8A 1O58A 3SX0A 1N7SD 4HYTA 3M9WA 4BZQA 4HAIA 5KJFA 2HEGA 3JV7A 2YO2A 3PQ3A 3IAS6 3FWYA 5DLDA 4J6FA 2VC0A 1R64A 3B6KA 4JLBA 2PFXA 4JU8A 4I5GA 3RV3A 2SNIE 2FE3A 1E79H 2R7DA 3UG7A 4UZSA 4N8EA 2EJUA 3F8SA 3N3AC 2VDOB 3TMKA 2QM8A 1UMQA 3CH4B 3WP0A 3AH8A 3N2NA 1NMQA 2I5PO 2KS6A 4LYEA 2IUSA 3LQKA 4R9RA 3AWIA 1OGJA 3DCYA 3PP5A 4JAVC 4JYMA 4UW9A 2IITA 3SP1A 4Y2XA 1NG9A 4C7XA 1XPJA 3A0HE 1QJ4A 1FNDA 4JHLA 4HNRA 4PGAA 1MO3A 3TTVA 3H19A 1N77A 1E32A 1ORVA 3QKIA 3BY6A 3NBAA 3VKFA 1L8OA 4LYGA 2ZRMA 3L4EA 4NBNA 1S3SA 2IF0A 2I10A 2QUIA 3K6SA 3A06A 4FT8A 3AR2A 3SFTA 2ACJA 4N0QA 1ZP6A 1DC8A 1WBDA 3L8EA 1OLXB 3ZQFA 4I09A 1TZ2A 3H25A 4R2HA 1KEEB 2QQGA 2FPRA 3GX1A 4BFCA 1K92A 4C4PA 3X1ZA 2VJ4A 2HOTA 1OW6A 5KWEA 3VP9A 5D8LB 2NSDA 1P7PA 3RUPA 4B4KA 3HS3A 2CYYA 4HTFA 4WSOA 1MR3F 1JH9A 2K37A 3T9AA 1ORRA 2C5SA 3B8HA 1EHCA 2PH5A 4DR4B 3VV3A 3UM9A 4L9WA 5FBWB 3N70A 2M9MA 4OWRB 3RTBA 1SQ6A 1T8TA 4JJIA 4XYGA 3MZWB 2HOEA 3DMRA 4AJOA 4RXTA 4F1JA 1L4AA 1U9CA 3BXEA 3AP2A 1VIMA 2YVUA 4ZYGA 4M3BA 4ZQFA 4KR7A 4OHXA 1A0OA 3F47A 3RU2A 2QCOA 3HXPA 4UEKA 1V8DA 2FEMA 3AI7A 2I1JA 2Z5IA 2GKSA 2ZRPA 1XZLA 3SZTA 4C2MJ 4G2NA 3WYBA 3I45A 1V1RB 4RD4A 5AR1A 1I5EA 3ROMA 2A2ZA 2F5VA 2NYAA 4V19K 3VPGA 4FYMA 3ORRA 4RBOA 4LIVA 2ZWIA 4HNVA 1FOXA 2O5EA 2CLEB 4EJSC 5EP2A 5HOOA 4AURA 1W0JA 2QYOA 5FCDA 3E70C 4LSGA 1XF9A 1KYZA 4G5OA 4ZVSA 2BFDA 3I01A 2BVLA 2BW3B 1LF5A 1OA0A 4QEKA 4OATA 2IVFA 3PRJA 1GR0A 2Q0OA 2ZE8A 2JFOA 1G3QA 4MCAA 4W6QA 3GVIA 5A5EA 4FFNA 4O8CA 4ZYAA 3H2JA 1T3GA 3WQSB 1ZQ3P 3RPEA 5A0VA 5A1JA 4POAA 1HXDA 3VPAA 3UK7A 5D5HA 4WKGA 2J0UA 4HAOA 4FCYA 5JY6A 4KV9A 2QN9A 3MTJA 2H65A 3IJRA 4DDUA 1K7CA 2D1SA 4KXXA 4Z4EA 1D2MA 2ZJ7A 2P75A 1V0JA 1II8A 2XKPA 5E8GA 4RABA 1V8OA 3KZOA 4QL3A 2OM6A 2R11A 4FFWA 1TM7E 1DIAA 5DD8A 2M3EA 4ZAGA 2WWXA 4F6LA 4AO7A 3ENZA 1VFCA 3QKWA 3VR4D 5G4KA 1JSZA 5ALRA 5G0TA 4G4JA 4LFBB 3ZWCA 4JYBA 1N5RA 2FN7A 2NUPA 3HDVA 4ENUA 3AU9A 2YX7A 4RK0A 2XOXA 1EFCA 4YLGA 4C6TA 4YRMA 4M88A 4JUCA 5GONB 5BP7A 1BQEA 2XF7A 3A1NA 4WECA 2P7VB 2F3QA 3GBPA 3VR5H 3GGDA 1MU0A 4OFBA 3DBLA 4NRDA 4BNHA 2P5KA 1OVVA 3DONA 3G9TA 5FTNA 3AUSA 1RHMA 5E1BA 1F2TB 1P1IA 4H18A 1KC3A 1QL1A 4GOOD 3BFKA 5AW5A 4KN4X 1JMMA 2FPPB 1TNSA 3KYDA 4X9XA 1EE1A 4CCAA 3WTCA 3KJXA 4UVBA 4FSHA 2FQWA 2SCUA 2PSDA 3LSYA 3A9TA 2EILH 1KPHA 3RD5A 4I36A 5EJ8A 5LZ7A 1QK4A 4N9QA 2HLPA 1IFPA 5COBA 2XTMA 3VNUA 3LW8A 1BVUA 3K09A 2ZJ1A 1LZKA 2C4KA 1R4AA 2QJPB 2NNYA 4MRMA 4RK1A 3K1TA 4GDMA 5FAKA 3AFNA 2MU1A 2ZCWA 4V0KA 1IXRC 5CLLA 2VLIA 2P68A 3DE0X 1H88A 2A06D 5EWLB 2JBAB 2ZEJA 2Z57A 4LOCA 1DAMA 1EMDA 1DTEA 2VNHA 5KNBA 2XB8A 2R7AA 1L3BA 2VJQA 2AT1A 2OAEA 1GCGA 4RM3A 1Z0UA 3DOJA 3PR2B 2A9FA 4YWHA 3FPFA 1RAEA 5LP6A 4B32A 2VBGA 2N3ZA 5F7OA 5CA1B 5K0TA 4EHBA 1PEDA 4YBZA 3WWEA 1XR3A 3TINA 4PG6A 5FKLA 3GTGJ 2DR3A 3JU3A 2VKDA 4UVIA 1EQ7A 1JHUA 3FTCA 4I1SA 3PHLA 3ESZA 1ZIOA 2EZIA 1W1WE 3BCSA 2IYWA 4KPUB 1S7CA 2NP6A 1VQ8I 1WOYA 1G66A 1XTGB 3L75E 1M6VA 5GWXA 1ZMOA 4CMCA 5MFPA 2KZVA 2JLBA 5I4IA 1KILD 3RVKA 4YNBA 1D07A 2WSEJ 1GOTA 3QGMA 1VZ0A 4B3AA 4LXYA 3HLTA 4IKPA 3S2ZA 1KFEB 1YZUA 3IR6A 4NCAA 2D0PB 3TOXA 4Q7EA 2WAEA 4WJKB 1AUPA 3BE4A 4K2HA 2DHEA 1JOCA 2ZI5A 1T6YA 1ODLA 3H1IE 5CT9A 4WDRA 1CLUA 3WTBA 1IE3A 2C8JA 3HTUA 2WT7A 1XQXA 3RAEC 4I98B 3RS5A 1XCOA 2ORED 4RVSA 4D97A 3MS2A 1C2TA 1ZJYA 4DBQA 1SUEA 3AYXB 1XG1A 2Q3MA 1SUFA 4LXTA 4FGSA 4H0LB 2WHRA 4P7FA 3OUUA 1LPPA 1Y37A 3W8NA 3DAFA 1KTVA 1OGYA 1USTA 4BAGA 1MB4A 1H85A 2JGEA 2QX8A 4G09A 1RJWA 3FFXA 2OGZA 4MZDA 2QAGC 1JDNA 3E9EA 4DF3A 2ZC2A 4XA4A 4HS9A 2ECKA 2I1KA 3D6ZA 2CZGA 2A4MA 5G40A 4R1LA 2P2CA 2WV1A 4D1QA 2R751 1GVHA 3GUVA 4MPTA 1GDHA 4X65B 1BGYE 4TKUB 4JBNA 2DT8A 4K5QA 1TD9A 2XBLA 2AKEA 4EAAA 3UICA 1LLUA 3SSMA 3K9LA 2KBFA 3IWZA 4P9UA 4E7SA 3MAAC 1J56A 2E7XA 3VO9A 4P36A 3ZCRA 2WFLA 5H82A 4L28A 4HLNA 2MLGA 2NO6A 1E1CB 4EG7A 4X92A 2UWJE 1FZTA 1RIFA 4QU0A 3ZWYA 1VA5A 3A14A 2GM9A 4W5WA 3AINA 7YASA 2GJAA 5M2QA 2ZYIA 3TNUB 2XVMA 1B7GO 4R4JA 4G65A 2C7OA 2WQYC 3N8KA 3C6XA 3EWSA 1HDXA 4ZQCB 4C05A 2EDAA 4D0NA 4QM7A 5JATA 5AVQA 2CVFA 2C96A 2WP0A 1U7WA 5LMUB 5E3NA 2GXAA 3RJPA 1AC5A 3CBQA 1JALA 2WHPA 4Y9DA 3LV8A 4HDVA 3P0RA 2A9JA 6ADHA 2HA3A 3SEAA 1CI6B 3LQ4A 2O0KA 3F98A 4PTYA 3RVPA 1X9VA 3BGVA 2LDXA 2FZWA 4YT8A 2JI6A 2X42A 1JJAA 1CW5A 2ATEA 3DDUA 3ET4A 3FNEA 1OFCX 1D6MA 2HYFA 1QYVA 1GIAA 1RJFA 4B4OA 2HK7A 2WHYA 5DTIA 2O2HA 1QYRA 1KYIA 3D2BA 1C7ZA 4EGSA 2XUDA 2FPGB 2VFAA 1URQB 3F4BA 3DQQA 4DLYA 5DH9A 1YVEI 2QG9A 2X6WA 2OCKA 3GAFA 1KEPA 1OAOC 3K4CA 1VKJA 5JLXA 3V1NA 1NYRA 1G9SA 1V5FA 1TWAJ 3JALA 2VASA 1BWPA 1M1YA 2DXIA 3L7OA 3FFAA 3S2HJ 2J59A 2PZBA 1G98A 5EXDA 2VDPB 5EIAA 1VGRA 2NS0A 3T5TA 2VL8A 3QV1A 5IVDA 1CVRA 2WY2D 4WF2A 4RMGA 1J7KA 4JBAA 4ZQBA 3I73A 3T9BA 4LB6B 2NUAB 3HVHA 1QQBA 4KQ1A 3OJXA 4F4FA 1SQVJ 5CHXA 1FTSA 3ZGNA 5H80A 3VN0A 3ITDA 1T2VA 2XCRB 1QQTA 5HS8A 3GRZA 3GVXA 1G60A 3G9XA 5A5GA 5AJYA 1E1KA 1J4AA 3PEEA 2D1QA 3MXOA 1E6MA 3VAZA 4ZI3A 2C4HA 4BU2A 4D6TJ 5LWQA 3AB7A 4ZHQF 4LX8A 4WBNF 4LRUA 4MUHA 3K1AA 5ES3A 3QFTA 5DNAA 3SXPA 2IGNA 2G7HA 2JBWA 2FETA 2PR7A 3KT8A 3ZBQA 4H13C 2XV1A 5E8JA 1Z05A 5DI9A 3O91A 2KP8A 1V4NA 3Q0EA 4DUGA 1QYIA 5EMMA 4X1EA 4MAFA 4K9KA 4XQGA 4XKWA 3UF0A 1LE8B 4MLOA 1EK1A 3G2KA 4QPDA 1VJGA 3C48A 1CUCA 2NPSC 3V8RA 3ZHUA 4PIVA 3FFBA 3G5MA 5AI4A 4PZEA 3SIXA 2NXNB 4MIYA 3NHWA 1UJBA 4JXXA 4PEVA 4XYLA 4HSEA 4UAJA 1YMUA 3T35A 4OF4A 1FFSA 2O06A 3AHIA 3DWFA 2KNCB 2X15A 2C88A 2FR1A 2N42A 1I9GA 1OR7A 5DASA 5HYVA 3SDZA 3ANTA 1WSDA 3LKZA 1SCUA 3G7SA 2IH4A 4LG0A 1ZK3A 4OHRA 3DKXA 4E6PA 1QLJA 2HDCA 3A1UA 1ZOSA 5B6PA 4FB5A 5K6AA 3L93A 3A5TA 4I8XA 2X9DA 1B26A 1SA0A 4N5NA 3ZUGA 3CA8A 3U48A 3CF5F 2VF2A 2ZTMA 5BUZA 1DIOB 3WGIA 5APTA 4JUDX 1AQYA 4WWHA 1XU7A 3ZQQA 2EAUA 1HQYE 2HQ5A 2G07A 3I2JA 1TWFJ 3CX8A 2X8JB 1KRXA 3JSPA 1N86A 2FSIA 4Y1RB 4FYIA 4PCUA 2QMYA 2Y0BA 4CKWA 4RLFA 5BSGA 1SOAA 2WSIA 5CTAA 3JC22 2PUJA 5EHXA 1EF4A 1U5CA 1EG2A 2GILA 4TS9A 4RJKA 2ZVPX 1Q0ZA 2WTMA 2HUNA 4HZIA 5CA0B 2AG6A 3TR0A 2I6GA 1AN0A 3SM9A 2BYVE 2MMCA 1L5HA 3LS2A 4ZREA 1ECBA 4HDRB 3K31A 4G8XA 4IHAA 3ER8A 1EE2A 3FW1A 5K20A 3LWZA 2AYXA 5EXXA 3HE4A 4B0OA 5H2FE 2Q6KA 2ZI7A 3NM6B 3HCRA 5T4EA 4DY4A 5F4ZA 2Z30A 4HVLA 2CD9A 4DE5A 5A06A 1JY2P 2E48A 3ZGYA 1UKCA 3IWFA 2JANA 1VP3A 5ED4A 4MRAA 2F5DA 1DKMA 3V1UA 2A45I 1TLTA 1P9WA 3WUTA 1YBVA 2VS1A 4L9NA 3CLKA 2C9LY 1WD5A 1JQLB 3KPVA 1LBHA 1VB3A 1RPWA 4FR2A 2HC9A 2NTVA 1BX1A 2ELHA 2QWXA 2M30A 2IY7A 2UAGA 1EFPB 3GA5A 2ET6A 2EA4A 2ORVA 1ETUA 3L02A 1Z67A 1DI0A 2F1RA 4YR7A 1AGRA 1YZVA 1GSOA 5FTJA 3JATB 1ZGAA 3U3KA 4MR7B 1MJFA 3LO8A 2Q1KA 2O07A 1JHAA 4X8OA 4WAUA 3FMRA 4IJVA 3PIDA 3GYHX 1TQ6A 3NHFA 3H05A 2AN9A 3JQ7A 2FMXA 2ILVA 1DZ3A 1WV1A 1KJYA 2ZSIA 1LTJC 4R71A 2CCGA 2QQAA 4AO6A 4N03A 1TQ2A 4R6XA 4XN0A 4C0BA 4FYYA 2WV9A 5GTHE 4C2AA 3TSIA 2RC6A 5FNVA 2OTJP 2NQ2C 1SCQA 4HDKB 3AEDC 3LGXA 1O5OA 2YV3A 2YN2A 4YMIA 1NOKA 2P2GA 1UDAA 1YB1A 2QTHA 3AFOA 4FYKA 4AIRA 3KX2A 4CM1A 1KFNA 4Q05A 2FGKA 5IDWA 1U8XX 5E9AA 2V6FA 4AZ0A 2B78A 3OJEA 2IYOA 3ZLJA 2XYQA 4BJHB 1ZSNA 4G1UC 1ODIA 2DYRH 3QU2A 2OBMA 3UVEA 1T5OA 4RF5A 2PS1A 1FOSF 4L78A 4MV7A 1A5TA 2VL7A 4GNKA 4BO9A 1RH5B 3E0JB 2PGXA 4TVOA 3A4VA 1NF2A 2JI9A 1XK7A 2WC2A 2E2IJ 4JOQA 4WKCA 2H1CA 4HX4A 4OSOA 2BGGA 4KB5A 1R27A 1R5HA 5E1WA 3QG1A 3AV3A 1IM5A 4MKFA 1W75A 1Y3FE 1YA8A 1CIPA 4MRNA 5F2NA 3L43A 1E2UA 1P7JA 3KXDA 3TZ6A 4OKNA 5GZ1A 5HUHA 1GZ6A 1N2CA 4ZT4A 3SG0A 1UPAA 2J3EA 1QVVA 1T29A 1C5KA 4U6SA 5KOHB 5THQA 4YRNA 2MD5A 2GM5A 1GN9A 1XZHA 4IHJA 1JDJA 1RQGA 1OLUB 4C08A 2Z3VA 1CYEA 1S2IA 4TN1A 4DPKA 2FDCA 3K0FB 3S4RA 1KQFA 4DOZA 3R8XA 3KHKA 1ADGA 2HPCB 3JVIA 3MVPA 1AKUA 1YA6A 2UUBB 4U3JA 1J1DB 1NVAA 3K4NA 2XF8A 2OTLI 3DZJA 1VMEA 4D9HA 5HLTA 2C9MA 3SK0A 1SMTA 2YX1A 2IDKA 5CDTA 2J87A 2QX4A 3BM5A 3HD7B 5DHPA 4US2R 4JCCA 3OYLA 2X3YA 4C0LA 1NKSA 3OQVA 2CJJA 3IR7A 3P9ZA 1VQPI 4HDCA 3X1DA 1M2KA 4WN9B 4O33A 5LHHA 1MZPA 3TO5A 1FIUA 2QTLA 3NIGB 4Z8XA 3CWBJ 1RYEA 3OJWA 3C45A 4U3FD 2F1HA 1JQJC 4RD3A 1W36D 4DBZA 1GCUA 2FQYA 2WVJA 1FXUA 1N6PA 3LCCA 2XF6A 2OO7A 1U3CA 3AKCA 1QBGA 3WDKA 2GJ4A 2OHVA 2F48A 1DH3A 2XMZA 2YXDA 1UBGA 1T5BA 4DBRA 3K3PA 4Q19A 4YP0A 4FLEA 1N6OA 4QECA 1G7CA 4F11A 3E03A 4Y99C 2V6MA 5BMVF 3L92A 3ADOA 1NXPA 2HXOA 2K7LA 2WT8A 3OX3A 1F0PA 3CKLA 1NQWA 1EDEA 4KDFA 1KGSA 2IIVA 4E7ZA 1HDDC 4HEHA 3LSMA 1STOA 2VO1A 1YI2P 3FRIA 1ISGA 4HC4A 3NT5A 2QENA 1ECJA 4X6UA 1A8SA 2NOGA 1QYXA 1IC6A 1ZITA 1F5NA 1WW8A 4F4CA 1GRCA 2P1RA 3WRXC 3OEYA 5FA8A 3HNPA 5C37A 2XD9A 4M0EA 3JVUA 5HE9A 2W7TA 4RTLA 1K6XA 4L9AA 3U81A 4Z51A 2XXAB 3TGLA 1XTRA 4LYDA 2VIIA 3C5EA 4FE3A 2CC2A 2NO7A 2HQAA 1RYHA 4Z49A 3E6AA 5KKAA 1W52X 2YMQA 1TE2A 1QIHA 2GZHA 3FLMA 1CS4C 1UQRA 4IDEA 1JQEA 1V4BA 3BL5A 2KDZA 4GQBA 3OBIA 4OBXA 4E7LA 3GEEA 3ZGOA 3I28A 1E69A 1USUA 1YZHA 4OEHA 2CNLA 2RHHA 3ONDA 4P58A 4YVFA 5IAGA 2FYZA 4IEFB 1NM5A 5I9LA 1XTPA 3MWGA 3JCUE 4FXOA 4F3KA 1N9GA 3OC0A 3SYMA 4LDJA 1JHDA 3IT1A 4AM3A 3EMKA 2X8AA 2B6NA 3DTEA 2BMAA 2P9HA 1CPYA 4C0QC 1F4LA 4HFMA 3NHBA 5JD6A 2VZ9A 1F2DA 3C2QA 1RF1B 2PG4A 2CDCA 2CGEA 2JL1A 3LCMA 2DM6A 3V97A 1RAHA 1IUYA 4R9VA 1SXJA 3MUNA 1OXKB 4R1NA 1X1BA 4G36A 2F17A 5DNWA 2QBYA 1Q7GA 2LY9A 1VTNC 1FDWA 3CNOA 4FYVA 2R7VA 4BXFA 3ND6A 3PFKA 4QMAA 4K87A 3GFFA 3AJRA 1I3AA 1LCIA 4BLVA 3IHWA 3GTOJ 1GV0A 1OWOA 2IUEA 3HCOA 4PPQA 3R0ZA 3G1UA 4LOIA 1BCCD 2C29D 2PZAA 4L4SA 4L72A 5HRUA 1DCFA 3O8BA 2P69A 3BRWD 4DQUA 4MW2A 1T5TA 3KT0A 4O2RA 5LBUA 2KIUA 4UNNA 1ZYUA 3TLJA 2O8EB 1M1YE 5ILSA 2LCIA 1ZICA 3FK6A 3H86A 2OPHA 3FVWA 1UFMA 1XVVA 3TFWA 3O38A 2JA5J 2PY6A 2PNJA 5EGOB 1XV5A 1UB9A 5ILVA 1JFFA 1VQ7P 1OH6A 3M9LA 5B5EH 2GM3A 2PL1A 3T8TA 2QE7A 4N3NA 2B7EA 4M54A 2QYTA 3OZSA 5LDHA 5E20A 4ALIA 3GJYA 1UJMA 3MCUA 2FU5C 1HT2E 1KZ1A 2PJZA 5C4MA 4AJ9A 2A0KA 1HNNA 4JI7B 4HR7A 4R7ZA 1P84H 3A4CA 5IMBA 1OZHA 4TTRA 1C8KA 1M72A 4DSOA 4A2WA 1LUJB 2NYXA 3OCXA 4HMQA 4H0CA 4P3NA 3HMQA 2DRIA 3RVBA 1AKQA 4JJEA 5LQKA 4X7RA 3RUIA 1L7BA 5HIIA 2EL9A 2IZ0A 5HKLA 2JI4A 2XV4S 3I09A 4WXCA 3O9ZA 3JQEA 3M4NA 2I7VA 2DBQA 1NN1A 3CLUC 2H08A 5JW6A 1XD2A 1E7WA 4UQLA 4JNKA 3E1SA 2DP4E 5IUNC 1VA4A 4TLAA 2E1PA 3ZZ1A 5D4SA 1CUEA 3Q5FA 1X86B 1PEYA 3CVXA 4Q3BA 1R8QA 1HOXA 5HKAA 4LF7B 3QKUA 1FDUA 2BEKA 4HV5A 4AS2A 4G4IA 3OJCA 1NLUA 4OQFA 3G1OA 5GAEJ 3WU1B 3AIIA 1UZCA 1RWWA 1RHJA 4AKEA 4TYQA 2F3SA 1N32B 2QJKC 1EVYA 5CLFA 4KYIB 1KYYA 3LYHA 4M22A 2F3UA 2V9CA 1X1PA 3EGWA 1VLVA 1J8QA 1E1YA 5EJ9A 2JWDA 1WB9A 1HVVA 3OT5A 3KTDA 1EGMB 1H8AA 2VJPA 2V79A 2CDAA 3MUOA 3NHPA 5BPDA 1OXMA 2VPIA 4L8WB 4WEOA 3AVWA 2C2XA 3MC1A 5A6VA 1YNSA 1WXGA 2NLOA 4LD5A 3OH8A 1TL7C 5AICA 5TV2A 1XZDA 1U2TA 1G5TA 1EGAA 1UOQA 1JQ3A 4DR3B 2X9LA 2WTAA 3SEQA 5K3AA 4O29A 1S9HA 3R5HA 1J8FA 4XARA 2JN6A 3JX9A 3M2PA 5BW4A 4EIWA 3CLRC 1U98A 1U5BB 3AE5C 3PYMA 3LYUA 2GLTA 1ZV8A 4RADA 1ZGBA 1LP1A 4LJRA 5ERYA 2JKYA 4O1HA 2SICE 3TDKA 4N5IX 4DB4A 3OJAB 3F8WA 4QIWN 1MQ9A 2EF1A 1OH7A 1RE4A 1I33A 3OIFA 1T2UA 2EIHA 1JLLA 1ESNA 2VNKA 3F7NA 2SHKA 3CUVA 3ZE7A 1IFJA 5C52B 2JGNA 1IOWA 4MQ5A 1PG2A 4CKEA 5TJJA 2O6HA 4R1OA 2W42A 1AUQA 4UOZA 3I42A 4PAMA 5JJ5A 4CT4B 1ECLA 1SC6A 3KQLA 1N2DC 4IZ6A 5CQGA 4GZ6A 1M7GA 3HWX1 3MS4A 4QYTA 3NHJA 3N6XA 3NPMA 3PDUA 5BVGA 1JUSA 5BXYA 3K4HA 4PPYA 1RIOH 3GEMA 1Y6QA 1FX7A 1G21B 4KO8A 2O3SA 2VJNA 2ZB9A 1A7JA 2VKEA 2FP4B 2C4TA 3ZZNA 3CF0A 3ITNA 2H2IA 4DLRA 1X7XB 2PH7A 5CFQA 1JPNA 2MKVA 2NRAC 1A5BB 1AKWA 3DF7A 5CR9A 1M6WA 2HSJA 1E3WA 2OCLA 2X3FA 1U9IC 2OB2A 3K7EA 1GADO 2IAIA 1ML3A 1ZH6A 5ITWA 3V1MA 5DGCA 3KJIA 3RK0A 1IXCA 3CP2A 1KB9D 3X1KA 2QRUA 4GVPA 4WVZA 3O8RA 5FEUA 3RTGA 3V4GA 1KU7A 3ZE6A 1MJ5A 1PZGA 4FB4A 1L0NK 4C7NA 4L4RA 1Z62A 1VL5A 1PJ2A 2F9MA 1FLDA 2DFTA 5IAAA 1X0TA 3EVGA 3WHLA 1R50A 4REOA 2XGMA 1BE1A 5F64A 2DR2A 2PTGA 5DIFA 3M3DA 3GLIB 1PNQA 4Q4CA 2LIPA 5ADUS 1VPCA 4NBSA 2ERXA 4HBLA 2ID9A 3T5CA 4JI1B 5ECWA 4HS4A 3KPWA 3EOAI 1HLFA 4GYJA 1Q50A 4BP8A 5L8RJ 4EJVA 1EVIA 3TL3A 4IZIA 1XZIA 3H5AA 3PA6A 4M73A 2B82A 2Q21A 4N0EA 3K4BA 3UJHA 1OI7A 1BJRE 4HAZA 2DUNA 4K9PA 3IC7A 3P0FA 2VHJA 5HOQA 4FNMA 4Q47A 2O1KA 1E5XA 1AB6A 1YVUA 2C3MA 1RVV1 2OV4A 1F2VA 1E1RD 1UXKA 3JTMA 4A10A 3T9EA 1TM2A 1DBWA 1XUOA 4LOLA 5JYCA 3MOSA 4DLXA 4Z0TA 4IFEA 2C0WA 4QIHA 4A92A 2E1CA 1LVGA 1VPEA 2Q99A 4E12A 4CG1A 2A14A 5EJFA 4IJAA 3G71P 1D3YA 3D64A 4BB6A 2H6CA 5CD1A 1SBHA 1GV2A 2RJNA 2EIJH 2R1UA 4UCFA 3STWA 1MA3A 1EFVB 2J9GA 4MQ4A 1QRSA 2A0WA 4NPDA 2AJBA 4QJIA 5BR7A 4CTJA 2IYFA 5FOTA 1N2CE 1KILB 1C7EA 4PX9A 1CJVC 1KH2A 1YBMA 3ZDFA 1HKTA 2YV5A 3TXYA 1XXHA 4NMWA 4A4DA 4DANA 2FWJA 4KO3S 4HD8A 1JR4A 2UVPB 4RF4A 2MFZA 2ZUBA 5JSZB 3ZHRA 3S1NJ 1ZBDA 2HTSA 3KL4A 3CUOA 3DVLA 2WWIA 3IUBA 1F51E 2PSEA 3R3YA 2OU2A 4PBRA 2WLTA 1QGPA 3LAWA 5J23A 2NXCA 5ALHA 3OMYA 2H94A 1R71A 3UGJA 2VQCA 4N5LA 2KXPB 3U37A 1IXZA 3R2JA 5AVUA 2H09A 3JASA 1YJWI 1JMKC 1IBCA 4XKCA 1A4UA 1T1SA 4CJXA 3SSNA 1J0RA 2OENG 1TLFA 4RSRA 3A6KA 4BKRA 3EXEB 2EFCB 5FHQA 3UKJA 4Q1DA 4ZTBA 4FIDA 3LDAA 4N12A 4FR0A 4OSPA 2O8KA 2YWBA 2G1KA 2IQIA 1LT9A 1ZUWA 4YAJA 4D3ZA 4ZJZA 3GLQA 1VQKP 3ESAA 1F4KA 3QE0A 4GC9A 3W6KB 4KQHA 4JK3A 3WI7A 3VKGA 4TXMA 1FU4A 3RSZA 5FO0A 3WFIA 3IP3A 3IRVA 3WXBA 2AEJA 4NC8A 4YMLA 3LHFA 1PFVA 2F8MA 4AYWA 1NBHA 2ON6A 2R3CA 1TOAA 2CWDA 4M8SA 1REPC 2XGGA 1USKA 2BKUA 4A5SA 4PX3A 2JO1A 5CCGC 3FBIB 3A27A 2R8EA 5AJHA 4OHBA 2C0XA 3WTVC 2H31A 3MMNA 1Q86Q 1W5CE 2CVPA 3Q85A 1R0BA 3C97A 3EUEA 1O9BA 3CUUA 1SOWA 3DLIA 1G8YA 4GXRA 3VPSA 4I81A 3AG6A 2FPIB 1V55H 1Z91A 4YQFA 3T7TA 1C3VA 5AK4A 3SMQA 3NH9A 4MJLA 1UDCA 1YR9A 3A03A 3QFFA 3KEOA 3W3AH 3ZMDA 4UEOA 1E8MA 2YCLA 4P8RA 2PJPA 4CLDA 1WNFA 2YQZA 5KEIA 2ACWA 3NHAA 1Z7LA 2UV8A 3W2TA 2NV2B 1K4TA 5IT4A 2D8AA 4DLBA 1Y8ZA 5KHOC 3EEQA 3K0LA 4CXFA 4ON9A 2QLJA 1RLIA 3I9V2 4UVAA 1IOLA 2B8JA 2R4GA 2VC1A 3OICA 4MO2A 3DOEA 3B1KA 4CT0A 3BG7A 3CUQA 2HU8A 1XPOA 4HXEB 3DMDA 3SQMA 1P4HA 4I01A 4TWIA 4OAPA 4LZZA 1T98A 3O7MA 1VRVA 3ZI4A 1OFTA 1KI3A 5HF5A 3C6ZA 1K04A 4KV7A 3RIMA 4QPQA 3RK3E 1NTKD 1AJYA 1OB5A 2NM0A 10MHA 3U16A 1E3QA 1G2OA 2HT6A 2L9RA 5G53C 3TD2A 4FC6A 3DD1A 5TPZA 3MJCA 2VSXA 2DMRA 1A50B 5F0CA 1JF8A 3BR0A 3ZDMA 4ETMA 3CNHA 1FYFA 1JQKA 4A16A 5ALDA 2XPUA 2QRVB 4CYMA 2O3FA 2YWRA 3SICE 2FVYA 2L02A 4FDAA 3ITEA 1U0OC 1CUGA 4I9GA 1O94A 2O2XA 4UTNA 4P2BA 4PM4A 3SY8A 1Q82Q 1RABA 3PT9A 2CZCA 2XIQA 4F2PA 3PWZA 1SXJE 4BB0A 4IFBA 2J5QA 2YL2A 3PDIA 4FCTA 2GNPA 2L7FP 2HH9A 1J07A 2OK8A 2GOMA 3AE7C 3KEGA 5B37A 1IDOA 5E2IA 4BFVA 3P9NA 2WUEA 1ZGGA 3BEOA 3JQFC 3RFXA 3CXUA 1Z33A 3SR0A 4EYEA 4UOQA 3O1JC 3I9FA 1LS1A 5GJVC 1L0NJ 3KZYA 3D31A 3V9PA 5L3SB 3PKIA 4CO8A 3TTTA 2QNRA 3S70A 2EA2A 3MN2A 4UM7A 2YHBA 5SICE 1JHQA 3H1JJ 1GQ2A 1E3DA 5FLXK 4WADA 5JU6A 2JIRA 4JQ0D 2YOFA 3DBHA 1N6LA 2BTEA 3IGFA 5AVXB 3VQTA 4MPRA 1MNDA 1QDLB 3L07A 1A1VA 1UC9A 1ZHFA 1B1BA 1EFRD 4OGKA 4DWOA 4YUXA 1O95D 5HJ5A 4F5DA 1I3NA 5EFWB 1T1RA 3KKEA 3T3HA 1AT1A 1P7IA 2RGYA 4E46A 3PXAA 4QAJA 4HH2A 2EX1A 5IULC 1EWTA 5IBPA 2PUAA 2CEKA 4F9EA 2P6RA 3VU0A 2RGBA 5JNUA 3JRNA 1ZVJA 3EZNA 2QUZA 4OVKA 3TDZC 3SWYA 3K6JA 4XLNF 3ZQGA 1E2XA 4ARCA 3LWBA 3I9MA 2MWMA 1FY2A 2E75D 3IT3A 4AN4A 2IYAA 1SQQD 2CXRA 3IJEB 2OLKA 3U9LA 3X1YA 4EYSA 4J6EA 1KH3A 1G0NA 2PQ8A 2R92J 3DVSX 2O5CA 2ZVOB 3TZQA 2VOJA 3V7NA 1Z4LA 4PS0A 1LW6E 4F2DA 2BL4A 3DPSA 3AKYA 1CQJA 2C57A 1JZSA 2XWQA 1QZYA 2YHSA 1QG0A 3QXCA 1V47A 2ZIEA 2E5LB 1U2RA 4R6WA 1EWVA 3KVOA 4IO0A 4MYCA 3IQIX 4Q6WA 4MIKA 4WLNA 1IUNA 5KOJA 5E6RA 1PPJG 1BU8A 1WMEA 4J1TC 1QQ7A 2AJCA 1MD9A 1TWGJ 2ZI3A 4KZPA 1ZIYA 3JW8A 5LZ9A 5HIMA 3THSA 2REQB 3TVYA 2ODEA 1NU1K 2NXJA 1GRRA 1FTWA 4W7HA 1OWNA 2LH9A 3IEKA 1QWSA 4IIJF 1IG7A 2WSBA 4KQWA 1WV0A 1XDUA 3A1YA 3QK7A 3NEYA 5DLQC 3V4FA 4ZICA 3L0PA 3K0AB 4ENQA 4KLCA 1NKNA 2IOFK 2WPQA 3LK7A 1Y3BE 3L9FA 4Q7KA 1EZVE 4PS1A 5K99A 4OHOA 3F4KA 1G59A 4EW2A 2PGLA 2Q2VA 2H17A 2VE9A 4LZJA 4ZFNA 2LFBA 2XWBF 1OFUX 2EBIA 1FPMA 4WY4A 1VLZA 2PT6A 3ZCXA 4AKGA 5D6EA 4QBIA 3LBYA 4QBFA 1XD7A 3AI1A 3OOUA 2EG5A 2ZIXA 3M1CA 1ZELA 5A04A 4NVRA 1YDFA 4IJKA 1PP9D 3CO6C 3STVA 2DSNA 5CBNA 3GJXC 3A58B 4Y2GA 3Q6NA 1B73A 3DKWA 3U7JA 1OA1A 4DT1A 4LVCA 3H9GA 2RC4A 1CZQA 1T0IA 3EFBA 5AO9A 1D09A 2PE5A 2XRZA 4QGSA 2GBGA 1YWGO 3W6NA 4BPBA 1MO6A 2HNHA 3MTEA 3GFSA 4RSGA 4I4TB 3I6BA 4KIFA 4B85A 3ETJA 5J2UA 4JP0A 4Q01A 1T5SA 1XHEA 5A62A 2E4UA 3FHLA 1J75A 2A5JA 4IOJA 3M89A 2G28A 1XRPA 3GVCA 5HTOA 2YQ5A 3LW5H 3UJCA 1YX3A 4KICA 4N6OA 4DA7A 3E7LA 4GP7A 1M1JA 2HMTA 4ITVA 3SS8A 2HFED 1RFGE 3DE2X 4YXFA 3RK1A 2F90A 2RHJA 2BASA 4Y8VA 4D9CA 2N9YB 4D4KA 4JUAA 2RH0A 2DLDA 1Z35A 3MCAA 1U11A 3BHMA 2OYIC 4QEDA 3SN6A 1IK6A 3UG6A 3M5CA 3HCPA 3IAM6 4EF4A 4PZDA 2MR5A 1NLFA 3BG3A 4JKYA 1Y8RB 3QWFA 1IH8A 3ZLVA 4MKXA 4DIMA 4URUR 1YHQI 5EP3A 4EB6A 1ULYA 2P4SA 2X9GA 2IEGA 1QHIA 1GRVA 3GVHA 4I5IA 4G12A 1QO7A 2CXOA 2JGFA 4Q02A 1MBJA 1GU5A 3AEAC 2QOEA 4MITA 3A6LA 2F1IA 1PQPA 3HWSA 2PJRA 4KAXA 3PU6A 3SJAA 3WNQA 1IBKB 2KB0A 2E60A 1OX3A 3O8OB 1ZXLA 3D1NI 4FGKA 2QU8A 4AROA 2XQVA 2XGCA 4C06A 4C9YA 2OZKA 2QRXA 2IXSA 1ZW0A 4L5CA 3K30A 5CX1A 3W2GA 2AOTB 1EX1A 1DAFA 1B8VA 3LXUX 4ZYWA 3P0JA 4AICA 4O1IA 4DOJA 4TMTA 1TW2A 1DO2A 3MTQA 5ERIA 1ON1A 1OCTC 4RPKA 5JDCA 3SF8A 2B5WA 5KLVE 3UW1A 4AIJA 3CJNA 2CK3D 1WUYA 1C1DA 1VJRA 3D5LA 3SI7A 3FHTA 2ZE5A 3I2IA 3J7ZI 4GBGA 3GEPA 4RD1A 1FUUA 2C20A 2CVQA 1Y9DA 4XGQA 2C31A 2Q9BA 4O4IB 2IHNA 2BEUA 3II6X 2MGQA 4PFKA 2QW8A 2A05A 3OAKA 1L5MA 2I2XB 1SVIA 2DOEA 1ORHA 2QK4A 2JFQA 2HNKA 1UT8A 1XXHE 2J5XA 1IJDB 3U9GA 1IRIA 4GVXA 1QFXA 1XD9A 221PA 4GWLA 1UZUA 1KSGA 4FNOA 3F6OA 2E4VA 3D7RA 1EH7A 5KSOA 5F1JA 5KTPA 1QHFA 2LXNA 3TR5A 3L0CA 1LDNA 3F67A 1W36B 5CNIA 1WJBA 1IV6A 1QIFA 4L0ZB 2ESHA 4LNUB 1D04A 3VZQA 3AU8A 3QBJA 3UYLA 2FSUA 1J1EC 3KZNA 1DD3A 1TKRA 1T8SA 1SQVK 1CD5A 2PSFA 4B09A 3BROA 1H3FA 2QL5A 2WVHA 4Q48A 2XGSA 4WUVA 3NYRA 3BTIA 4MVJG 3H9QA 4C21A 1K8QA 2A69F 2PUBA 1YRLA 1LFUP 2VH2A 4EL5A 1FFDA 2JFZA 3I5AA 2AIRA 3TLXA 1GPNA 2R87A 4ESFA 2PZ8A 3NC0C 3C6BA 5L45A 1JEQA 3SFDC 3DBIA 3I5UA 4BCDA 5BYAA 4GMFA 4GIBA 4MVWA 4Z0HO 2G25A 3PIOF 1G6OA 1L0OC 1YOVA 4KGZA 1FMFA 4GP6A 4HWKA 3LW5J 5CIWA 1XTCC 3RCBA 2A35A 1CK4A 4DLWA 4EMBA 3H2KA 1WW3A 3QVLA 1C0WA 2JQ7A 1NU1J 2Z4EA 4E5YA 5JQGB 8ATCA 2L4AA 1DOHA 2E5NA 5F08A 4LE2A 4NICA 2IF2A 3NXSA 4G81A 3LVBA 2X0IA 4CM8A 3TL6A 3CC2I 3ZVNA 4JFAA 4UU0A 1W7PB 3BMXA 4LC9A 4KFTA 3TZHA 5HFAA 3CX3A 1YTZI 4MGRA 1B9MA 4X20A 3SJCA 1MSEC 4R54A 2IP4A 3QYEA 5HRAA 1R9NA 4KMSA 3O3KA 1JT0A 3GA0A 5AVWB 2BI8A 2PAFA 3KTAB 4TVKA 1NJ8A 4TS4A 4C76A 4WKPA 1L2PA 3PHIA 5T6BA 5IZCA 1C1XA 2FQ1A 1K7SN 3HQ4O 1DQNA 1XJCA 3AR6A 2QUBA 3IBCA 1W85A 3UFXB 1AF7A 5KWVA 5CW1A 4XBFA 4L3OA 3AILA 2QVOA 3E9DA 1VGVA 1WU7A 3ZY2A 3DDOA 2TRSB 1DVRA 4CCYA 3PH0A 3FIWA 2YMYA 2B4KA 1CIJA 1X74A 3E5HA 2PN6A 3FPHA 1SN7A 2X6QA 4J49A 1F2UA 2IHJA 5CCHA 3QXHA 3OQPA 1SXIA 1CXZA 2OGTA 2QLNA 4GPD1 4D3XA 4RK4A 3QVOA 2R5NA 5D87A 4QWQA 3H11A 3H36A 1OI4A 3RYFA 4EJFA 4P4NA 2ONZA 5K5QA 5IJ9B 3LF1A 1TJ5A 2BT4A 4BDZA 3RJZA 1Y1WJ 4EDFA 4KXVA 3AETB 4AO8A 4O63O 4I3FA 2C7PA 1GUAA 4U7FA 4QNMA 1V5EA 4MFDA 1NJ2A 1YJCA 2NUBA 2P2ZA 5AW1B 3SR3A 1H6BA 3BJ6A 1SEVA 3ZDCA 2KLUA 1XNHA 3LQFA 4BYMA 4EJ2A 3LOCA 3CWQA 1NH3A