2BCCG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
b'RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2bccG00
1SQQG 3H1LG 1BGYG 1BCCG 1P84H 1KYOH 3BCCG 3H1IG 2BCCG 3L75G 1L0LG 4U3FG 2IBZG 1EZVG 1SQVG 3L74G 4PD4H 1KB9H 2FYUG 1SQBG 1BE3G 1NU1G 2A06G 1PPJG 1SQPG 3L73G 3H1KG 3H1HG 4D6TG 1NTKG 3CXHH 3L72G 3L71G 1NTMG 3CX5H 1NTZG 5KLVG 1L0NG 1PP9G 1SQXG 3TGUG 3CWBG 3H1JG 3L70G
chains in the Genus database with same CATH superfamily
1SQPK 2ZYGA 5KJ7A 1SFCD 3HE5B 2YXQB 3RBXA 2MKVA 1FZCB 5AVZB 3GG2A 3H1JD 1SQXE 1ZLLA 1LGHB 3CCSP 4W80A 5KAFE 1KYOE 3HD7D 4GIFA 3MUDC 1S5LH 3N7NA 4EI2A 2HPCB 3VMAA 3H1KE 3VMZA 3GHGC 3C1LA 2KB7P 4DJGA 2ZT9B 3A2AA 3RL0D 5AW6B 2MJZA 2YO2A 2OYHA 2IYPA 2P2UA 2H43A 2LR2A 5AVRB 4ZMDA 3MZWB 4JBZA 2OGUA 1SQBJ 1J1EB 1LTAC 1X9VA 3L72J 1CI6B 3B5ND 2JDIH 2FKWB 4H13B 2M5AA 2J58A 3TGUD 1RF0A 2WPVB 1FBMA 3H1ID 2GA1A 3T97B 5CJ4A 2ZAEB 1Q86Q 5L8RJ 1NHLA 1N86A 1EDIA 2ZFCA 1JY3P 1L4AD 1LTBC 3MHVA 1JUNA 1EXIA 1QEXA 1DIPA 2A06G 1N7SC 1NTKG 2HODA 3TNUB 4YPCA 2J59M 2ZXEB 1G2CA 2Q3EA 1LTSC 1JOCA 3GW6A 3WU2E 3A0HE 3AE5C 3MIWA 1BSNA 3G71P 2N9YB 3H1JE 3PJSK 4HKZH 1YBKA 1L0LK 1RH5B 3S4RA 5DJTB 1EDLA 2KZIA 4C7NA 1AQTA 4IOIH 3KPEA 1LTJC 2P67A 1JCDA 2Y9ZA 3PP5A 1JM0A 1RF1B 1SFCC 2A06D 1URQD 2IBZI 1NTKD 5GTIH 3LIDA 1PGOA 4R4LA 5APQA 1XTCC 1M1JB 4RJTA 2RMZA 5KLIC 3HD7C 3TGUE 1BCCJ 3WU2H 2D2CB 3WUTA 4Y99B 2K1AA 3H1IE 3D6YA 2A45G 2KNCA 3FX0A 1FZGA 2KK7A 3RL0C 1SQQG 4K3AA 3HRNA 4WY4D 3GF7A 2K9YA 1OX3A 3W68A 1J2JB 2QJKC 1NVOA 3TDKA 1SQBG 1QVFO 2KSJA 2KSEA 3MTUE 5APSA 2OYIC 3B5NC 4ASVA 3LIEA 1LT9A 3L73J 2ZYDA 2HYNA 2PP6A 1DD3A 1VF5D 1S4XA 1LWUC 5CBNA 1Z56A 5CCHA 1VQ7P 2R32A 2C9LY 2C9NY 1Y8AA 1AFOA 1OVVA 4D6TG 1L4AC 5CCGA 4OGQB 3RBZA 3AEGC 3HUSB 4GOEA 2KUBA 1S72P 4JQ0D 1N73B 5AW4B 1KC8Q 4I7ZC 1SQQD 3CWBJ 3V5BA 2FFDA 2WSEH 1GL2A 2ZXXA 1SQBD 1TU3F 2ZVOB 2AEJA 1NU1D 4OH8B 2ZVNB 2A06E 1FDIA 3BRVB 5AW8B 1NTKE 2BCCG 1NTMK 5KLVK 2WSCH 2WPQA 1KILD 1VQ8P 1KMIZ 2POHA 2WPRA 2QE7H 1JMBA 4UB6H 3KDPB 3GMAA 1IFIA 2BEQD 4DOJA 1MUUA 4D6TD 1JTHA 3L71J 3VMYA 1FAVA 4BRYA 2IZ1A 4ZNCA 1OW6A 5M1BA 2IFMA 1RQUA 1URQC 1NTZG 1LTTC 3V6IA 2YMKA 2IZ0A 3V2RA 1RE3A 2AEMA 2KI7B 1LP1A 2BCCD 5H2FE 2PGDA 2M5AB 3OJAB 1AJYA 3TSIA 3RK3B 4WY4C 1IO4A 5B66E 2KP8A 3MUDA 3R4YA 3H1HE 3V2PA 1SQXK 3GHGA 1SQQE 1WRGA 1VF5C 1SQBE 3BVHA 1NU1E 2WSSH 1LTGC 1NTZD 3KYQA 2H88C 2HODB 2HR3A 4QMAA 1G2CB 3L70J 2YMYA 1KILE 3B71A 2I1JA 3L75J 3AE3C 2QEXP 2E43A 1OIPA 4ASWA 2WQYC 5CMZA 5H2FH 1M56D 1S3JA 3IF4A 4D6TE 5AVWB 5C39A 1Q2NA 2XNDH 2XU6A 4C7NB 1BE3G 1PPJG 1YJ9P 1KTMA 1AA0A 3E7KA 1K8AQ 1N7SA 1KILC 1FJPA 3CI9A 3UIAA 1VQLP 5APWA 2LXBA 4H0LB 4YXDC 4W7YA 2BCCE 3CCEP 3L71G 3EQ2A 1L0NG 1FOSF 4XFJA 2WSEJ 2E76D 4TLFA 1EZVG 2KNCB 4L75A 4M3LA 1FDOA 2M8RA 3KHUA 2Q9IA 1FU1A 1LTJA 2W90A 2V7QH 1AVYA 2WSCJ 1BE3D 1SQPJ 3GLMA 2Q6QA 1Q82Q 2B89A 1SFCA 1NTZE 1DD4A 1SQVG 1PGQA 1LT9B 3CXHI 3V4WA 3AEBC 1T8ZA 3CXHH 3HD7A 2B9BA 1JEKA 5APYA 3HE4A 2E74D 2LKMA 3CCQP 1GD2E 1JY2N 1GDTA 1L0ND 1EZVD 3JCUE 1LTIC 1T3JA 1J1DB 4R4MA 3VTPC 1YIJP 2FFDB 4PD4I 1GL2B 1NYHA 2OYIA 3B5NA 1QLED 4LC1A 2FYUG 1LWUA 1SQVD 2P7JA 1K05A 3NMDA 5KAIE 2I1KA 2QJPB 1H89A 1JMMA 1OFCX 2AEFA 5KKZB 3CCJP 1L4AA 1BSHA 3AE7C 4UB8E 1JY3N 3KZIE 5AW0B 3BCCJ 1JTHB 1FE6A 1H0TB 4BRYB 2OYOA 3P8CD 1BE3E 1JY2P 3H1LG 3USSA 3U1AA 3C8VA 2YIUC 1GZLA 4U3FG 3RK2B 1BDCA 2K9JA 4OVNF 1GW4A 2Y0DA 3JC22 1L0LJ 2FYUD 3L37A 3CCMP 1LP1B 1M7LA 2E76C 2FBWC 4N6JA 1QX8A 3FWNA 1L0NE 1KQLA 1SQPG 4UB8H 1H8AA 1EZVE 2J5UA 1CW5A 1KYOI 4H44D 4AUWA 3GHGB 4XE5B 1URQA 1FZAA 3VN0A 5KAFH 2K37A 1KYOH 3FWLA 1Y47A 1MFTA 3FXDA 1PP9J 3M91A 3H1LD 1SS1A 1FS0E 1X22A 1M8OB 2KLUA 4U3FD 1P84D 1EDJA 3KQGA 2FYZA 3WUUA 2Q1KA 1SQVE 2E74C 1JNMA 3O6QA 3A7OA 3FGAD 1A02F 4WY4A 2FXOA 2GUSA 2IDBA 2XZRA 3CCUP 1IK7A 2E5YA 1FZFA 5APVA 1S9KD 3M0AA 3P8CE 2Y0CA 4PV1D 1HJBA 3JSVC 2WSFH 2R5BA 5AVVB 1N7SB 1SQQK 1KORA 2O3JA 3L74J 3M9QA 2OARA 3ZDMA 3M9BA 2FYUE 5APXA 2RN0A 2AXTE 1NU1K 4EYYQ 4GKGA 2WPSA 2HLOA 1ZN5A 2FY8A 1KN7A 3A0HH 5E79E 3EFFK 1RE4C 2NPSD 1VQ6P 1LTJB 2QJYC 2HG5D 1KQGB 4YXWH 1NGMB 3EFGA 2GM4A 1NTMJ 1CSBA 5KLVJ 4KJMA 3H32A 1KILA 1BGYJ 3H1LE 1OW8A 1HBWA 1SFCB 3L72G 4U3FE 1P84E 2YNYA 1H88A 3H25A 3PTZA 1NAYA 3MD0A 1WMKA 4BWNA 3BASA 5KLIB 2Y0EA 2SPZA 3CC7P 3HD7B 1SVFA 2AXTH 3EWKA 1YHQP 1HH0A 4ZKUA 2FYNC 1VQ5P 3HE4B 1X8YA 4H44C 2QRXA 1YQ4C 3RL0B 5E79H 3I56P 2QJKB 1S9KE 5AW9B 3AECC 3CX5D 3L35A 1VQMP 2N9BA 2B88A 2OYIB 3B5NB 1ZP0C 1QGKB 1OWAA 1IFMA 1LWUB 1OVRA 3L72D 2N1TD 4JF7A 3SFEC 3D70A 4IFFA 1D7MA 1SQXJ 5GTHE 5AW5B 3TYYA 1AQ5A 1L4AB 3B4SA 1MV8A 2WWWA 5CHXA 1VQNP 5EFWB 1YJNP 1GK4A 2E5TA 4PV1C 5AVUB 3H1KJ 2OYHC 1WT6A 4I7ZB 1HGZA 3CCRP 2JR8A 3BATA 3L74G 1H0TA 4HYTB 2KIKA 1BDDA 2ZYAA 2RKLA 1EC5A 2HFED 2K9JB 1KQFB 1KB9D 4N78D 3CD6P 1ZW0A 3D6ZA 1YJWP 1BCCG 2E75D 5CCHD 1GTWA 4GOFA 3CL3D 3D71A 1VPCA 1HTLC 1MFZA 2H7HA 1OMIA 3NTNA 2VRSA 4RO0A 3WMM0 2NPSC 1KFNA 1NTMG 5KLVG 1Q90D 2WSFJ 1VDFA 1HVVA 1DEBA 5AVTB 1IC2A 1PV3A 4IL6X 1SP4A 3SWYA 1URQB 3CX5E 4JYBA 2O01H 3L74D 3L73G 2QSIA 2WT7A 2Q7CA 3L4FA 3L36A 2V4HA 1YTZT 3L72E 2JJLA 2OTLP 3H1JJ 1BCCD 3O6QB 4NPEA 2H89C 2NRGA 2ZJSE 1ZRTD 4WY4B 1GU4A 3PH0A 1PZQA 4XA4A 3M06A 4EOTA 3CWBG 1NTMD 5KLVD 1FJKA 4NPFX 1L0NK 3AE6C 1S2EA 3CPWO 5B66H 3A3YB 4GDOA 1VF5B 1RY3A 3NFQA 2A45H 3OW2O 2ZT9D 3CX5H 1ZMEC 2N1TC 1HF9A 1SQXG 1X0TA 2QG4A 3L73D 1KB9E 2R3CA 3AE1C 5KTBA 2W6BA 1IJDB 3H1IJ 1W2EA 2YXRB 1FC2C 1SQVK 4H13D 1NO4A 2BASA 5AVYB 5APUA 2XV5A 3C9IA 4I1LA 3CWBD 2XNXA 5AW7B 1YTZI 4JYCA 2AXCA 4DT0A 2IPPA 1Q7YQ 2E75C 5CCHC 3H32B 1PPJD 1KILB 3HTKB 1DX7A 4GT1A 1T6AA 3AEEC 1LNQA 1M1KQ 1NKNA 1KB9H 1FDMA 1BCCE 5TISE 1DH3A 5APTA 2PFXA 2L91A 2FYUK 1ZRTE 4KHXA 2OTKE 2QVAA 2B87A 2W8ZA 3L71D 1NTME 2PRRA 5KLVE 2IBZG 1RE4A 3K5BA 4LLHA 3IN6A 1IFDA 3CC2P 1USDA 1XTGB 2WMMA 1E79H 3AE2C 1K73Q 3NXSA 4CPGA 2OTJP 4L76A 2W27A 3L70G 1VQPP 3L73E 1NTKJ 3L75G 1EDKA 1KD1Q 2M0BA 1VQKP 2K3RA 2R44A 1FZCC 2CPSA 1N8RQ 1S5LE 1GW3A 3P32A 5DJUB 1NAFA 2RH0A 4I2LC 1E5WA 2D2CD 2O01J 4K35A 1T3UA 3M9HA 4W7ZA 1R5LA 2P10A 2ZT9C 3VYIA 3CWBE 1NJIQ 2IBZD 2K88A 2H8PD 4RESB 1IFJA 2R3SA 2GUVA 3Q5RA 1T2KD 1PPJE 3JCUH 1J1EC 1IFNA 3H1IG 1W5CE 2KYVA 1GK6A 3L70D 4I6MC 4H13C 2JWAA 3L75D 4DZOA 3VP9A 3U1CA 3QWOC 3G3ZA 3PHLA 1EXJA 1N2DC 2UWJE 1GU5A 1QL2A 1VQ9P 3H1HJ 1NTKK 1HGVA 3L71E 5KAIH 4OGQD 1ZR2A 3G6EP 2FXPA 1SQQJ 3O8ZA 3N4XA 4IL6E 2JKVA 3KZIH 5AW2B 1L2PA 4B86A 1NU1J 2YIUB 4ZKPA 1KQSO 3P7KA 2WT7B 1YITP 4L73A 1OW7A 1U7JA 1SLQA 3I5CA 3CMAP 4PJ0E 2E76B 3R2PA 2Z5IA 1AVOA 1K9MQ 1JY2O 3G9RA 5KJ7D 2NPSA 4D6TJ 4EIJA 5BU8B 2WVRA 3WUVA 3IAOA 3TF5A 3IFMA 2V7QJ 5CBOA 3TK1A 4WBAA 2IX7C 5GTIE 3H6PA 3U59A 2IBZE 1DEEG 3VMXA 1EZVI 1SQPD 1RF1C 1USEA 4IL6H 2P1JA 4KT0J 3L70E 2IYOA 1M1JC 2E74B 2W6AA 1VL2A 2BCCJ 3E1RA 3L75E 5BU5A 2D2CC 4Y99C 2L5GB 1EQ7A 3LW5H 3QH9A 1RHZB 1SQBK 5TJHA 4HJGH 3CCVP 3M0DC 1JY3O 4PJ0H 1U57A 4O9BA 3BCCG 2KZJA 2PAJA 3RK3D 3Q1MA 3PRJA 1FZBA 3W67A 1T2KC 1W2BO 2YKQA 4YTPC 1ZXGA 1OXZA 4U7JA 1NTZJ 2N1TA 1HUCA 2O1KA 1PGPA 1PL5A 1L0LG 2M3BA 3Q5SA 1ZV8A 2KOGA 1U7MA 2C0XA 3HTKA 4NPDA 3H1HG 1OZHA 2KS1A 2Z4EA 2YKPA 1YI2P 1QL1A 2I8DA 1IZNB 4OGQC 3HUSC 5BVZA 1A02J 1CZQA 4AYCA 1GMJA 3BCCD 1N73C 2B87B 3IR9A 1NU1G 2QM7A 3G4SP 2Q3IA 1PP9G 2QJYB 2W83C 3Q2YA 1ZR4A 3GF3A 1YQ3C 1PIXA 1SQPE 1NH4A 3SFDC 3MP7B 4LGDE 3B8EB 4UB6E 4BXLA 1L0LD 4DCKA 1NOHA 5KJ7C 2BEZF 1P84I 4H0LD 3OA7A 1S5LX 3H1HD 3P8MC 3E1IA 1P84H 3ABVC 1Y9BA 2LXCB 2FYNB 3PLNA 3AE9C 1NTZK 1MKMA 1LJ2A 4H44B 3SWKA 3RK3E 3V2QA 2WTYA 1S1CX 2YKOA 5AW3B 1BE3J 1YYCA 1MZ9A 3OAKA 3V2NA 5CJ0A 1PP9D 1HWTC 4WWIA 5AVXB 3HE5A 1FZCA 5AVSB 1M57D 1RF0C 1IFPA 3RK3C 4IFMA 1M90Q 1FOSE 1ZOYC 4MN4C 1L0NJ 3Q3DA 1G1IA 2HPCA 2QIWA 2JO1A 3BCCE 4PV1B 5CCGD 3AEAC 3V4QA 5GTHH 2OYHB 2E42A 1RQVA 3RL0g 1BGYG 1FZEA 3I55P 3CXHD 3CCLP 3LW5J 3VOPA 2KXPB 1VQ4P 1GL2D 3FXEA 1CI6A 1SQVJ 1L0LE 2XDJA 2QM8A 3F5HA 4L74A 3S9OA 4HH2A 3T97A 3ITKA 3A0BE 2O1JA 1AV1A 1PFIA 2NPSB 2WZ7A 4AQRD 2QA4P 3AE8C 4PD4D 3CMEP 2DW3A 4A7PA 3TNUA 1PP9E 1BGYD 5B5EE 2A45I 3CX5I 4H0LC 2P58A 1HJ0A 2FYUJ 3RK2D 3Q5PA 3AEFC 4Z1MH 1R5SA 4N78E 2Z5HA 1R8EA 2IFNA 1KZUB 1UIIA 3CC4P 1OVUA 3TGUJ 2OQQA 3H1KG 3A0BH 4TT3H 1VQOP 2G8YA 2JWDA 1JCCA 1IK9A 3BRTB 3CXHE 1RF1A 1LT1A 3RGUA 4GODA 3H1LJ 2N1TB 1LT9C 4U3FJ 2Y9YA 3CLQA 3L74E 5B5EH 2O01N 1M1JA 3MGNA 2R5DA 4IFDK 4JPZB 5K5GB 1KB9I 2KS1B 1SQXD 2C0WA 3VP8A 2XKMA 2M3EA 3M0DA 2JP3A 2W6JH 5CCGC 1JB0J 1KFMA 1KV4A 1KYOD 2Q5UA 4C7RA 2CK3H 3AE4C 4C46A 3H1KD 4PD4E 1NWQA 1J1DC 2YO3A 1NKZB 2ITAA 2CPBA 2FXMA 2FFDC 1GL2C 4WVZA 1JO5A 1X79B 1UIXA 1BGYE 3SSUA 2E75B 1Q81Q 1N7LA 1N7SD 4EDFA 4OWFA 3H1JG 3AEDC 4N3YB 2QJPC 5KKZC 2NZ2A 3KXDA 1G1JA 4RKUJ 3HUSA 2WITA 4Y28J 4WB4A 4HB1A 1N73A 3II6A 5AW1B 1QVGO 5TISH 2G3AA 3A5TA 3S1KA 3F89A 4PD4H 1PGJA 5AVQB 3RK2C 2JEEA 3SWFA 1RE3C 2KLVA 1K04A 3TGUG
chains in the Genus database with same CATH topology
1SQQG 3H1LG 1BGYG 1BCCG 1P84H 1KYOH 3BCCG 3H1IG 2BCCG 3L75G 1L0LG 4U3FG 2IBZG 1EZVG 1SQVG 3L74G 4PD4H 1KB9H 2FYUG 1SQBG 1BE3G 1NU1G 2A06G 1PPJG 1SQPG 3L73G 3H1KG 3H1HG 4D6TG 1NTKG 3CXHH 3L72G 3L71G 1NTMG 3CX5H 1NTZG 5KLVG 1L0NG 1PP9G 1SQXG 3TGUG 3CWBG 3H1JG 3L70G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  3H1L G;  1BGY G;  1BCC G;  1P84 H;  1KYO H;  3BCC G;  3H1I G;  2BCC G;  3L75 G;  1L0L G;  4U3F G;  2IBZ G;  1EZV G;  1SQV G;  3L74 G;  4PD4 H;  1KB9 H;  2FYU G;  1SQB G;  1BE3 G;  1NU1 G;  2A06 G;  1PPJ G;  1SQP G;  3L73 G;  3H1K G;  3H1H G;  4D6T G;  1NTK G;  3CXH H;  3L72 G;  3L71 G;  1NTM G;  3CX5 H;  1NTZ G;  5KLV G;  1L0N G;  1PP9 G;  1SQX G;  3TGU G;  3CWB G;  3H1J G;  3L70 G; 
#chains in the Genus database with same CATH topology
 1SQP K;  2ZYG A;  5KJ7 A;  1SFC D;  3HE5 B;  2YXQ B;  3RBX A;  2MKV A;  1FZC B;  5AVZ B;  3GG2 A;  3H1J D;  1SQX E;  1ZLL A;  1LGH B;  3CCS P;  4W80 A;  5KAF E;  1KYO E;  3HD7 D;  4GIF A;  3MUD C;  1S5L H;  3N7N A;  4EI2 A;  2HPC B;  3VMA A;  3H1K E;  3VMZ A;  3GHG C;  3C1L A;  2KB7 P;  4DJG A;  2ZT9 B;  3A2A A;  3RL0 D;  5AW6 B;  2MJZ A;  2YO2 A;  2OYH A;  2IYP A;  2P2U A;  2H43 A;  2LR2 A;  5AVR B;  4ZMD A;  3MZW B;  4JBZ A;  2OGU A;  1SQB J;  1J1E B;  1LTA C;  1X9V A;  3L72 J;  1CI6 B;  3B5N D;  2JDI H;  2FKW B;  4H13 B;  2M5A A;  2J58 A;  3TGU D;  1RF0 A;  2WPV B;  1FBM A;  3H1I D;  2GA1 A;  3T97 B;  5CJ4 A;  2ZAE B;  1Q86 Q;  5L8R J;  1NHL A;  1N86 A;  1EDI A;  2ZFC A;  1JY3 P;  1L4A D;  1LTB C;  3MHV A;  1JUN A;  1EXI A;  1QEX A;  1DIP A;  2A06 G;  1N7S C;  1NTK G;  2HOD A;  3TNU B;  4YPC A;  2J59 M;  2ZXE B;  1G2C A;  2Q3E A;  1LTS C;  1JOC A;  3GW6 A;  3WU2 E;  3A0H E;  3AE5 C;  3MIW A;  1BSN A;  3G71 P;  2N9Y B;  3H1J E;  3PJS K;  4HKZ H;  1YBK A;  1L0L K;  1RH5 B;  3S4R A;  5DJT B;  1EDL A;  2KZI A;  4C7N A;  1AQT A;  4IOI H;  3KPE A;  1LTJ C;  2P67 A;  1JCD A;  2Y9Z A;  3PP5 A;  1JM0 A;  1RF1 B;  1SFC C;  2A06 D;  1URQ D;  2IBZ I;  1NTK D;  5GTI H;  3LID A;  1PGO A;  4R4L A;  5APQ A;  1XTC C;  1M1J B;  4RJT A;  2RMZ A;  5KLI C;  3HD7 C;  3TGU E;  1BCC J;  3WU2 H;  2D2C B;  3WUT A;  4Y99 B;  2K1A A;  3H1I E;  3D6Y A;  2A45 G;  2KNC A;  3FX0 A;  1FZG A;  2KK7 A;  3RL0 C;  1SQQ G;  4K3A A;  3HRN A;  4WY4 D;  3GF7 A;  2K9Y A;  1OX3 A;  3W68 A;  1J2J B;  2QJK C;  1NVO A;  3TDK A;  1SQB G;  1QVF O;  2KSJ A;  2KSE A;  3MTU E;  5APS A;  2OYI C;  3B5N C;  4ASV A;  3LIE A;  1LT9 A;  3L73 J;  2ZYD A;  2HYN A;  2PP6 A;  1DD3 A;  1VF5 D;  1S4X A;  1LWU C;  5CBN A;  1Z56 A;  5CCH A;  1VQ7 P;  2R32 A;  2C9L Y;  2C9N Y;  1Y8A A;  1AFO A;  1OVV A;  4D6T G;  1L4A C;  5CCG A;  4OGQ B;  3RBZ A;  3AEG C;  3HUS B;  4GOE A;  2KUB A;  1S72 P;  4JQ0 D;  1N73 B;  5AW4 B;  1KC8 Q;  4I7Z C;  1SQQ D;  3CWB J;  3V5B A;  2FFD A;  2WSE H;  1GL2 A;  2ZXX A;  1SQB D;  1TU3 F;  2ZVO B;  2AEJ A;  1NU1 D;  4OH8 B;  2ZVN B;  2A06 E;  1FDI A;  3BRV B;  5AW8 B;  1NTK E;  2BCC G;  1NTM K;  5KLV K;  2WSC H;  2WPQ A;  1KIL D;  1VQ8 P;  1KMI Z;  2POH A;  2WPR A;  2QE7 H;  1JMB A;  4UB6 H;  3KDP B;  3GMA A;  1IFI A;  2BEQ D;  4DOJ A;  1MUU A;  4D6T D;  1JTH A;  3L71 J;  3VMY A;  1FAV A;  4BRY A;  2IZ1 A;  4ZNC A;  1OW6 A;  5M1B A;  2IFM A;  1RQU A;  1URQ C;  1NTZ G;  1LTT C;  3V6I A;  2YMK A;  2IZ0 A;  3V2R A;  1RE3 A;  2AEM A;  2KI7 B;  1LP1 A;  2BCC D;  5H2F E;  2PGD A;  2M5A B;  3OJA B;  1AJY A;  3TSI A;  3RK3 B;  4WY4 C;  1IO4 A;  5B66 E;  2KP8 A;  3MUD A;  3R4Y A;  3H1H E;  3V2P A;  1SQX K;  3GHG A;  1SQQ E;  1WRG A;  1VF5 C;  1SQB E;  3BVH A;  1NU1 E;  2WSS H;  1LTG C;  1NTZ D;  3KYQ A;  2H88 C;  2HOD B;  2HR3 A;  4QMA A;  1G2C B;  3L70 J;  2YMY A;  1KIL E;  3B71 A;  2I1J A;  3L75 J;  3AE3 C;  2QEX P;  2E43 A;  1OIP A;  4ASW A;  2WQY C;  5CMZ A;  5H2F H;  1M56 D;  1S3J A;  3IF4 A;  4D6T E;  5AVW B;  5C39 A;  1Q2N A;  2XND H;  2XU6 A;  4C7N B;  1BE3 G;  1PPJ G;  1YJ9 P;  1KTM A;  1AA0 A;  3E7K A;  1K8A Q;  1N7S A;  1KIL C;  1FJP A;  3CI9 A;  3UIA A;  1VQL P;  5APW A;  2LXB A;  4H0L B;  4YXD C;  4W7Y A;  2BCC E;  3CCE P;  3L71 G;  3EQ2 A;  1L0N G;  1FOS F;  4XFJ A;  2WSE J;  2E76 D;  4TLF A;  1EZV G;  2KNC B;  4L75 A;  4M3L A;  1FDO A;  2M8R A;  3KHU A;  2Q9I A;  1FU1 A;  1LTJ A;  2W90 A;  2V7Q H;  1AVY A;  2WSC J;  1BE3 D;  1SQP J;  3GLM A;  2Q6Q A;  1Q82 Q;  2B89 A;  1SFC A;  1NTZ E;  1DD4 A;  1SQV G;  1PGQ A;  1LT9 B;  3CXH I;  3V4W A;  3AEB C;  1T8Z A;  3CXH H;  3HD7 A;  2B9B A;  1JEK A;  5APY A;  3HE4 A;  2E74 D;  2LKM A;  3CCQ P;  1GD2 E;  1JY2 N;  1GDT A;  1L0N D;  1EZV D;  3JCU E;  1LTI C;  1T3J A;  1J1D B;  4R4M A;  3VTP C;  1YIJ P;  2FFD B;  4PD4 I;  1GL2 B;  1NYH A;  2OYI A;  3B5N A;  1QLE D;  4LC1 A;  2FYU G;  1LWU A;  1SQV D;  2P7J A;  1K05 A;  3NMD A;  5KAI E;  2I1K A;  2QJP B;  1H89 A;  1JMM A;  1OFC X;  2AEF A;  5KKZ B;  3CCJ P;  1L4A A;  1BSH A;  3AE7 C;  4UB8 E;  1JY3 N;  3KZI E;  5AW0 B;  3BCC J;  1JTH B;  1FE6 A;  1H0T B;  4BRY B;  2OYO A;  3P8C D;  1BE3 E;  1JY2 P;  3H1L G;  3USS A;  3U1A A;  3C8V A;  2YIU C;  1GZL A;  4U3F G;  3RK2 B;  1BDC A;  2K9J A;  4OVN F;  1GW4 A;  2Y0D A;  3JC2 2;  1L0L J;  2FYU D;  3L37 A;  3CCM P;  1LP1 B;  1M7L A;  2E76 C;  2FBW C;  4N6J A;  1QX8 A;  3FWN A;  1L0N E;  1KQL A;  1SQP G;  4UB8 H;  1H8A A;  1EZV E;  2J5U A;  1CW5 A;  1KYO I;  4H44 D;  4AUW A;  3GHG B;  4XE5 B;  1URQ A;  1FZA A;  3VN0 A;  5KAF H;  2K37 A;  1KYO H;  3FWL A;  1Y47 A;  1MFT A;  3FXD A;  1PP9 J;  3M91 A;  3H1L D;  1SS1 A;  1FS0 E;  1X22 A;  1M8O B;  2KLU A;  4U3F D;  1P84 D;  1EDJ A;  3KQG A;  2FYZ A;  3WUU A;  2Q1K A;  1SQV E;  2E74 C;  1JNM A;  3O6Q A;  3A7O A;  3FGA D;  1A02 F;  4WY4 A;  2FXO A;  2GUS A;  2IDB A;  2XZR A;  3CCU P;  1IK7 A;  2E5Y A;  1FZF A;  5APV A;  1S9K D;  3M0A A;  3P8C E;  2Y0C A;  4PV1 D;  1HJB A;  3JSV C;  2WSF H;  2R5B A;  5AVV B;  1N7S B;  1SQQ K;  1KOR A;  2O3J A;  3L74 J;  3M9Q A;  2OAR A;  3ZDM A;  3M9B A;  2FYU E;  5APX A;  2RN0 A;  2AXT E;  1NU1 K;  4EYY Q;  4GKG A;  2WPS A;  2HLO A;  1ZN5 A;  2FY8 A;  1KN7 A;  3A0H H;  5E79 E;  3EFF K;  1RE4 C;  2NPS D;  1VQ6 P;  1LTJ B;  2QJY C;  2HG5 D;  1KQG B;  4YXW H;  1NGM B;  3EFG A;  2GM4 A;  1NTM J;  1CSB A;  5KLV J;  4KJM A;  3H32 A;  1KIL A;  1BGY J;  3H1L E;  1OW8 A;  1HBW A;  1SFC B;  3L72 G;  4U3F E;  1P84 E;  2YNY A;  1H88 A;  3H25 A;  3PTZ A;  1NAY A;  3MD0 A;  1WMK A;  4BWN A;  3BAS A;  5KLI B;  2Y0E A;  2SPZ A;  3CC7 P;  3HD7 B;  1SVF A;  2AXT H;  3EWK A;  1YHQ P;  1HH0 A;  4ZKU A;  2FYN C;  1VQ5 P;  3HE4 B;  1X8Y A;  4H44 C;  2QRX A;  1YQ4 C;  3RL0 B;  5E79 H;  3I56 P;  2QJK B;  1S9K E;  5AW9 B;  3AEC C;  3CX5 D;  3L35 A;  1VQM P;  2N9B A;  2B88 A;  2OYI B;  3B5N B;  1ZP0 C;  1QGK B;  1OWA A;  1IFM A;  1LWU B;  1OVR A;  3L72 D;  2N1T D;  4JF7 A;  3SFE C;  3D70 A;  4IFF A;  1D7M A;  1SQX J;  5GTH E;  5AW5 B;  3TYY A;  1AQ5 A;  1L4A B;  3B4S A;  1MV8 A;  2WWW A;  5CHX A;  1VQN P;  5EFW B;  1YJN P;  1GK4 A;  2E5T A;  4PV1 C;  5AVU B;  3H1K J;  2OYH C;  1WT6 A;  4I7Z B;  1HGZ A;  3CCR P;  2JR8 A;  3BAT A;  3L74 G;  1H0T A;  4HYT B;  2KIK A;  1BDD A;  2ZYA A;  2RKL A;  1EC5 A;  2HFE D;  2K9J B;  1KQF B;  1KB9 D;  4N78 D;  3CD6 P;  1ZW0 A;  3D6Z A;  1YJW P;  1BCC G;  2E75 D;  5CCH D;  1GTW A;  4GOF A;  3CL3 D;  3D71 A;  1VPC A;  1HTL C;  1MFZ A;  2H7H A;  1OMI A;  3NTN A;  2VRS A;  4RO0 A;  3WMM 0;  2NPS C;  1KFN A;  1NTM G;  5KLV G;  1Q90 D;  2WSF J;  1VDF A;  1HVV A;  1DEB A;  5AVT B;  1IC2 A;  1PV3 A;  4IL6 X;  1SP4 A;  3SWY A;  1URQ B;  3CX5 E;  4JYB A;  2O01 H;  3L74 D;  3L73 G;  2QSI A;  2WT7 A;  2Q7C A;  3L4F A;  3L36 A;  2V4H A;  1YTZ T;  3L72 E;  2JJL A;  2OTL P;  3H1J J;  1BCC D;  3O6Q B;  4NPE A;  2H89 C;  2NRG A;  2ZJS E;  1ZRT D;  4WY4 B;  1GU4 A;  3PH0 A;  1PZQ A;  4XA4 A;  3M06 A;  4EOT A;  3CWB G;  1NTM D;  5KLV D;  1FJK A;  4NPF X;  1L0N K;  3AE6 C;  1S2E A;  3CPW O;  5B66 H;  3A3Y B;  4GDO A;  1VF5 B;  1RY3 A;  3NFQ A;  2A45 H;  3OW2 O;  2ZT9 D;  3CX5 H;  1ZME C;  2N1T C;  1HF9 A;  1SQX G;  1X0T A;  2QG4 A;  3L73 D;  1KB9 E;  2R3C A;  3AE1 C;  5KTB A;  2W6B A;  1IJD B;  3H1I J;  1W2E A;  2YXR B;  1FC2 C;  1SQV K;  4H13 D;  1NO4 A;  2BAS A;  5AVY B;  5APU A;  2XV5 A;  3C9I A;  4I1L A;  3CWB D;  2XNX A;  5AW7 B;  1YTZ I;  4JYC A;  2AXC A;  4DT0 A;  2IPP A;  1Q7Y Q;  2E75 C;  5CCH C;  3H32 B;  1PPJ D;  1KIL B;  3HTK B;  1DX7 A;  4GT1 A;  1T6A A;  3AEE C;  1LNQ A;  1M1K Q;  1NKN A;  1KB9 H;  1FDM A;  1BCC E;  5TIS E;  1DH3 A;  5APT A;  2PFX A;  2L91 A;  2FYU K;  1ZRT E;  4KHX A;  2OTK E;  2QVA A;  2B87 A;  2W8Z A;  3L71 D;  1NTM E;  2PRR A;  5KLV E;  2IBZ G;  1RE4 A;  3K5B A;  4LLH A;  3IN6 A;  1IFD A;  3CC2 P;  1USD A;  1XTG B;  2WMM A;  1E79 H;  3AE2 C;  1K73 Q;  3NXS A;  4CPG A;  2OTJ P;  4L76 A;  2W27 A;  3L70 G;  1VQP P;  3L73 E;  1NTK J;  3L75 G;  1EDK A;  1KD1 Q;  2M0B A;  1VQK P;  2K3R A;  2R44 A;  1FZC C;  2CPS A;  1N8R Q;  1S5L E;  1GW3 A;  3P32 A;  5DJU B;  1NAF A;  2RH0 A;  4I2L C;  1E5W A;  2D2C D;  2O01 J;  4K35 A;  1T3U A;  3M9H A;  4W7Z A;  1R5L A;  2P10 A;  2ZT9 C;  3VYI A;  3CWB E;  1NJI Q;  2IBZ D;  2K88 A;  2H8P D;  4RES B;  1IFJ A;  2R3S A;  2GUV A;  3Q5R A;  1T2K D;  1PPJ E;  3JCU H;  1J1E C;  1IFN A;  3H1I G;  1W5C E;  2KYV A;  1GK6 A;  3L70 D;  4I6M C;  4H13 C;  2JWA A;  3L75 D;  4DZO A;  3VP9 A;  3U1C A;  3QWO C;  3G3Z A;  3PHL A;  1EXJ A;  1N2D C;  2UWJ E;  1GU5 A;  1QL2 A;  1VQ9 P;  3H1H J;  1NTK K;  1HGV A;  3L71 E;  5KAI H;  4OGQ D;  1ZR2 A;  3G6E P;  2FXP A;  1SQQ J;  3O8Z A;  3N4X A;  4IL6 E;  2JKV A;  3KZI H;  5AW2 B;  1L2P A;  4B86 A;  1NU1 J;  2YIU B;  4ZKP A;  1KQS O;  3P7K A;  2WT7 B;  1YIT P;  4L73 A;  1OW7 A;  1U7J A;  1SLQ A;  3I5C A;  3CMA P;  4PJ0 E;  2E76 B;  3R2P A;  2Z5I A;  1AVO A;  1K9M Q;  1JY2 O;  3G9R A;  5KJ7 D;  2NPS A;  4D6T J;  4EIJ A;  5BU8 B;  2WVR A;  3WUV A;  3IAO A;  3TF5 A;  3IFM A;  2V7Q J;  5CBO A;  3TK1 A;  4WBA A;  2IX7 C;  5GTI E;  3H6P A;  3U59 A;  2IBZ E;  1DEE G;  3VMX A;  1EZV I;  1SQP D;  1RF1 C;  1USE A;  4IL6 H;  2P1J A;  4KT0 J;  3L70 E;  2IYO A;  1M1J C;  2E74 B;  2W6A A;  1VL2 A;  2BCC J;  3E1R A;  3L75 E;  5BU5 A;  2D2C C;  4Y99 C;  2L5G B;  1EQ7 A;  3LW5 H;  3QH9 A;  1RHZ B;  1SQB K;  5TJH A;  4HJG H;  3CCV P;  3M0D C;  1JY3 O;  4PJ0 H;  1U57 A;  4O9B A;  3BCC G;  2KZJ A;  2PAJ A;  3RK3 D;  3Q1M A;  3PRJ A;  1FZB A;  3W67 A;  1T2K C;  1W2B O;  2YKQ A;  4YTP C;  1ZXG A;  1OXZ A;  4U7J A;  1NTZ J;  2N1T A;  1HUC A;  2O1K A;  1PGP A;  1PL5 A;  1L0L G;  2M3B A;  3Q5S A;  1ZV8 A;  2KOG A;  1U7M A;  2C0X A;  3HTK A;  4NPD A;  3H1H G;  1OZH A;  2KS1 A;  2Z4E A;  2YKP A;  1YI2 P;  1QL1 A;  2I8D A;  1IZN B;  4OGQ C;  3HUS C;  5BVZ A;  1A02 J;  1CZQ A;  4AYC A;  1GMJ A;  3BCC D;  1N73 C;  2B87 B;  3IR9 A;  1NU1 G;  2QM7 A;  3G4S P;  2Q3I A;  1PP9 G;  2QJY B;  2W83 C;  3Q2Y A;  1ZR4 A;  3GF3 A;  1YQ3 C;  1PIX A;  1SQP E;  1NH4 A;  3SFD C;  3MP7 B;  4LGD E;  3B8E B;  4UB6 E;  4BXL A;  1L0L D;  4DCK A;  1NOH A;  5KJ7 C;  2BEZ F;  1P84 I;  4H0L D;  3OA7 A;  1S5L X;  3H1H D;  3P8M C;  3E1I A;  1P84 H;  3ABV C;  1Y9B A;  2LXC B;  2FYN B;  3PLN A;  3AE9 C;  1NTZ K;  1MKM A;  1LJ2 A;  4H44 B;  3SWK A;  3RK3 E;  3V2Q A;  2WTY A;  1S1C X;  2YKO A;  5AW3 B;  1BE3 J;  1YYC A;  1MZ9 A;  3OAK A;  3V2N A;  5CJ0 A;  1PP9 D;  1HWT C;  4WWI A;  5AVX B;  3HE5 A;  1FZC A;  5AVS B;  1M57 D;  1RF0 C;  1IFP A;  3RK3 C;  4IFM A;  1M90 Q;  1FOS E;  1ZOY C;  4MN4 C;  1L0N J;  3Q3D A;  1G1I A;  2HPC A;  2QIW A;  2JO1 A;  3BCC E;  4PV1 B;  5CCG D;  3AEA C;  3V4Q A;  5GTH H;  2OYH B;  2E42 A;  1RQV A;  3RL0 g;  1BGY G;  1FZE A;  3I55 P;  3CXH D;  3CCL P;  3LW5 J;  3VOP A;  2KXP B;  1VQ4 P;  1GL2 D;  3FXE A;  1CI6 A;  1SQV J;  1L0L E;  2XDJ A;  2QM8 A;  3F5H A;  4L74 A;  3S9O A;  4HH2 A;  3T97 A;  3ITK A;  3A0B E;  2O1J A;  1AV1 A;  1PFI A;  2NPS B;  2WZ7 A;  4AQR D;  2QA4 P;  3AE8 C;  4PD4 D;  3CME P;  2DW3 A;  4A7P A;  3TNU A;  1PP9 E;  1BGY D;  5B5E E;  2A45 I;  3CX5 I;  4H0L C;  2P58 A;  1HJ0 A;  2FYU J;  3RK2 D;  3Q5P A;  3AEF C;  4Z1M H;  1R5S A;  4N78 E;  2Z5H A;  1R8E A;  2IFN A;  1KZU B;  1UII A;  3CC4 P;  1OVU A;  3TGU J;  2OQQ A;  3H1K G;  3A0B H;  4TT3 H;  1VQO P;  2G8Y A;  2JWD A;  1JCC A;  1IK9 A;  3BRT B;  3CXH E;  1RF1 A;  1LT1 A;  3RGU A;  4GOD A;  3H1L J;  2N1T B;  1LT9 C;  4U3F J;  2Y9Y A;  3CLQ A;  3L74 E;  5B5E H;  2O01 N;  1M1J A;  3MGN A;  2R5D A;  4IFD K;  4JPZ B;  5K5G B;  1KB9 I;  2KS1 B;  1SQX D;  2C0W A;  3VP8 A;  2XKM A;  2M3E A;  3M0D A;  2JP3 A;  2W6J H;  5CCG C;  1JB0 J;  1KFM A;  1KV4 A;  1KYO D;  2Q5U A;  4C7R A;  2CK3 H;  3AE4 C;  4C46 A;  3H1K D;  4PD4 E;  1NWQ A;  1J1D C;  2YO3 A;  1NKZ B;  2ITA A;  2CPB A;  2FXM A;  2FFD C;  1GL2 C;  4WVZ A;  1JO5 A;  1X79 B;  1UIX A;  1BGY E;  3SSU A;  2E75 B;  1Q81 Q;  1N7L A;  1N7S D;  4EDF A;  4OWF A;  3H1J G;  3AED C;  4N3Y B;  2QJP C;  5KKZ C;  2NZ2 A;  3KXD A;  1G1J A;  4RKU J;  3HUS A;  2WIT A;  4Y28 J;  4WB4 A;  4HB1 A;  1N73 A;  3II6 A;  5AW1 B;  1QVG O;  5TIS H;  2G3A A;  3A5T A;  3S1K A;  3F89 A;  4PD4 H;  1PGJ A;  5AVQ B;  3RK2 C;  2JEE A;  3SWF A;  1RE3 C;  2KLV A;  1K04 A;  3TGU G; 
#chains in the Genus database with same CATH homology
 1SQQ G;  3H1L G;  1BGY G;  1BCC G;  1P84 H;  1KYO H;  3BCC G;  3H1I G;  2BCC G;  3L75 G;  1L0L G;  4U3F G;  2IBZ G;  1EZV G;  1SQV G;  3L74 G;  4PD4 H;  1KB9 H;  2FYU G;  1SQB G;  1BE3 G;  1NU1 G;  2A06 G;  1PPJ G;  1SQP G;  3L73 G;  3H1K G;  3H1H G;  4D6T G;  1NTK G;  3CXH H;  3L72 G;  3L71 G;  1NTM G;  3CX5 H;  1NTZ G;  5KLV G;  1L0N G;  1PP9 G;  1SQX G;  3TGU G;  3CWB G;  3H1J G;  3L70 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...