2BCCG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2bccG00
3L75G 3CXHH 4PD4H 3H1LG 1NU1G 3L72G 2A06G 2IBZG 1P84H 3BCCG 1BE3G 3H1KG 3H1IG 1SQBG 3CX5H 1NTZG 3H1HG 5KLVG 1SQPG 1SQQG 1NTKG 1SQXG 3L74G 1PPJG 3CWBG 4D6TG 1PP9G 4U3FG 1BGYG 3L70G 1L0NG 3L73G 1L0LG 1KYOH 2FYUG 3TGUG 3L71G 1EZVG 1NTMG 1KB9H 1BCCG 2BCCG 3H1JG 1SQVG
chains in the Genus database with same CATH superfamily
4JF7A 2WVRA 1IFPA 1ZXGA 3FWLA 1EDIA 1HH0A 2NPSC 2FYZA 1R8EA 4IFMA 1X0TA 5KJ7D 1SQBD 2KS1B 3BATA 4TLFA 1AV1A 1Q2NA 1Y47A 2GM4A 4C7RA 2NPSB 3VMZA 1YYCA 3EFGA 1SLQA 1JY2O 3L75D 1FJKA 1L4AA 2IBZG 3ABVC 4PJ0E 1LT9A 3SWKA 2P67A 2ZXXA 4DOJA 5AVVB 3B4SA 1KFMA 1FDOA 3A0HH 3I56P 2VRSA 1LT9C 1KILD 1JNMA 1SVFA 3PP5A 2WSFJ 1FZBA 1EQ7A 1WRGA 1L4AB 1FDIA 1LT9B 4I1LA 2Z5IA 1IO4A 2C9NY 3VYIA 1J1EC 3VOPA 2ZT9B 2J5UA 1L0NK 1LTSC 4OH8B 4RO0A 5KAFH 1LTJA 1J1EB 2N1TA 5BU5A 3KXDA 4Z1MH 3OW2O 2JP3A 3P8CE 1L2PA 1FC2C 4WWIA 2KXPB 3V6IA 3BCCJ 2KYVA 4WY4C 1KORA 2RKLA 5AW5B 3KPEA 3G9RA 2E42A 3U1CA 1LTJB 4OWFA 4WY4B 1SQVJ 2I1KA 4BXLA 1YJNP 1FZEA 5B5EE 5C39A 5APYA 3EFFK 5KKZC 3P8CD 2Y0CA 4AUWA 1KB9E 3BVHA 2Y0EA 1H0TA 2HFED 2YXQB 5KKZB 3MTUE 3I55P 3TGUG 1L0NE 1FOSF 2D2CD 2IFMA 1NU1G 3CLQA 3L35A 1X8YA 2R32A 3U1AA 3WU2H 1H0TB 1ZN5A 1KB9D 1T3JA 2O1JA 3CCVP 3KZIH 2LKMA 2M3EA 1H89A 3M0DA 3R2PA 1L0ND 2HR3A 4EDFA 2SPZA 1LTBC 3L73J 2IYPA 4PV1C 3L70E 3RBZA 3SWFA 1L0LK 4K3AA 5APTA 2R44A 4OGQC 3PJSK 4PV1B 1NAYA 1M7LA 1JM0A 1N7SA 1KV4A 3H1IG 2L91A 2YIUC 3CCRP 2OARA 1S4XA 2E76C 3L70D 1BSHA 1KB9I 3KDPB 5L8RJ 3TNUB 2WPSA 5GTHH 3TK1A 4ZNCA 4W7ZA 1IFJA 3A3YB 2OYHA 3GHGA 1NTZG 2K1AA 2W27A 3CWBG 2BASA 4U3FG 1HWTC 1Q82Q 4H13D 1DIPA 2OYHC 4YPCA 5CMZA 1G2CA 3HE5B 1NYHA 2Z4EA 4R4LA 3CC2P 3H1KG 1SFCD 3V2PA 4ZMDA 5AVZB 2OYHB 3GHGB 4W7YA 3ITKA 3V4WA 3HE4A 1KQGB 5KAFE 1JY3P 2ZJSE 1YTZT 3CC4P 2AEFA 2LXCB 2ZAEB 2KNCB 1N7LA 4OVNF 4BRYA 2OQQA 4D6TJ 4WVZA 1OW7A 2GUSA 2JKVA 3A0BE 2YMKA 3L71J 2QE7H 1ZOYC 1MUUA 2O01J 3AEBC 3E1IA 1LP1A 5TISH 1L0LD 1VQ4P 1CZQA 4I6MC 3JC22 1U7MA 4BRYB 1OVUA 4BWNA 5KLVD 3CI9A 1K8AQ 4DCKA 1K04A 3LIEA 1VQPP 3W67A 3CXHH 2YKOA 1VQKP 2JO1A 2Q5UA 3HD7C 2OTJP 1AQ5A 2E75C 2A06D 3B5NA 3L73E 2YO3A 1NKNA 1KQFB 1ZP0C 4GOFA 3CCQP 3HD7B 3A5TA 1GMJA 3B5NC 2E75B 3QH9A 4ASVA 1S3JA 5APUA 3E1RA 2KOGA 1PV3A 1M1JA 1FS0E 3B5NB 2W83C 1Z56A 2WZ7A 3MZWB 1PFIA 1HJ0A 3L73D 1X22A 2PFXA 1BCCG 4PJ0H 5CBNA 4Y99C 1BGYJ 4XE5B 5CBOA 2PP6A 1SQQG 2OTKE 1GL2A 1M1JB 1HVVA 4KHXA 4QMAA 3O8ZA 2FYUG 3N7NA 3WUTA 4Y99B 3G71P 3VMXA 1BE3J 3SFEC 4HJGH 2Q3IA 1SQBG 4L74A 2W6JH 1QX8A 3E7KA 1ZRTE 2GUVA 3GMAA 1X79B 1YTZI 3D71A 3L72E 3RK3C 1A02F 1KYOE 4JYBA 1JY2P 3D70A 3L74J 4B86A 2IX7C 3L71E 1LTGC 1W2EA 3P32A 2OTLP 1PP9D 2R5DA 5AW9B 2FXPA 3C9IA 1ZRTD 2E74D 4I7ZC 3L72D 3B8EB 1KYOD 1FZCA 3B71A 2AEJA 1RE4A 5B5EH 3S4RA 3KHUA 1T2KD 2HG5D 1IK7A 1VPCA 3H1JE 2FXMA 1LTAC 3L71D 4I7ZB 1OWAA 1PGPA 2WT7A 1E79H 1EDLA 1KILC 1FZGA 5TISE 1IFNA 3M91A 3MP7B 1G1IA 5CCHD 1FZCB 1SQXK 1EZVE 2I8DA 5AVXB 1YQ4C 2H43A 1KILB 2JR8A 1NTMD 5AW1B 2P2UA 2G3AA 3USSA 2WT7B 3H1JD 3RL0g 5APSA 1OW6A 2XU6A 3P8MC 2W90A 4GOEA 3CXHE 2KS1A 1AVOA 5CJ4A 1HUCA 5AW8B 1KYOI 3M0AA 3C1LA 1CI6B 2FFDC 1EZVD 1YJWP 2JEEA 3GG2A 2FYNB 1IJDB 2CPSA 1FOSE 1BGYE 2B87A 1D7MA 5AVTB 2FFDB 5AW3B 1PIXA 1N86A 2WSFH 2KI7B 3CXHD 1FDMA 2KB7P 2KK7A 2KLUA 1BE3E 2RN0A 1PZQA 3RK2C 3OJAB 1GW3A 1SQXE 4DT0A 1MFZA 3LIDA 3R4YA 1P84E 2B87B 3JCUH 4O9BA 1JMBA 1BGYD 5CCGA 2YKPA 1RF0C 3RK2B 3T97B 3CMAP 1RF1A 4XFJA 1L0NG 1H8AA 3M06A 2O1KA 2D2CC 1EZVI 5CCGC 1KQLA 1OIPA 1T6AA 3L37A 1KTMA 1BE3D 1RF1C 1SQXD 4W80A 2IZ0A 2Y9YA 1JEKA 2D2CB 5TJHA 3H1LE 1HF9A 3CXHI 2I1JA 1RF1B 4IOIH 3BRVB 1QGKB 2WSSH 4IFDK 5AVWB 3HUSC 4WY4A 2HODA 3L70G 1IFDA 2OYOA 2L5GB 5APQA 1W2BO 1EC5A 1OXZA 3A2AA 3A0BH 3CL3D 3HUSB 2R3CA 3H1HJ 1HJBA 3H1LD 5APXA 1YQ3C 1JO5A 1RE3C 3WUVA 4ZKUA 3CMEP 1M8OB 3II6A 2HODB 1NU1J 2NPSD 3CCJP 3U59A 1KZUB 1CW5A 5DJTB 1A02J 1J1DC 3CPWO 1GU5A 1T3UA 1TU3F 3D6YA 1LWUC 4KT0J 3AEGC 1MKMA 1DEEG 1J1DB 3H25A 4JYCA 2Y0DA 1L4AD 2H7HA 1OZHA 1JB0J 5KAIH 1L0LG 1SFCC 1LWUB 3AEEC 3AE2C 1JCDA 1BSNA 2ZT9D 5AW2B 2CPBA 1LTIC 2XNXA 2XKMA 2AXTH 1SFCB 3FXDA 5KLVG 4IL6H 1Q7YQ 4H0LD 4LC1A 1M57D 1VQLP 1S1CX 3MHVA 3TNUA 1SQVK 1LGHB 3PRJA 1NTZJ 2A06G 4N6JA 4CPGA 1AJYA 3BRTB 1M1KQ 1HTLC 1QLED 2YNYA 2N1TD 4OGQB 2OYIC 3Q3DA 3HE5A 2JJLA 1J2JB 1Q90D 1OFCX 3MGNA 3JCUE 3IN6A 2K3RA 2YIUB 4MN4C 2WSCJ 2OYIB 2E76B 4DZOA 3L73G 1VF5C 1KYOH 1Q86Q 1FU1A 2B88A 2KNCA 3BCCE 3L4FA 1IFMA 1NO4A 3H1HE 2HPCA 1VF5B 2O01H 4EOTA 1RY3A 4JPZB 2P58A 4KJMA 3UIAA 1R5LA 2BEQD 1SQVE 3AE4C 1VQ7P 3G4SP 4C7NA 4K35A 3RBXA 3AE3C 1QEXA 1USEA 2FY8A 1DD3A 4RESB 3BASA 2FBWC 3FXEA 4PD4E 3BCCD 2HPCB 5E79E 3H1HD 1URQC 4L75A 1RQVA 5EFWB 3SSUA 1M90Q 1YJ9P 4C7NB 1FAVA 1VQ6P 4PV1D 1SQVD 2UWJE 2WSEJ 1URQB 2KP8A 2QJPC 3SFDC 1VQ5P 2WPRA 3A7OA 1PP9G 2Q1KA 1YI2P 2V7QJ 3HD7A 4PD4D 4C46A 2QJPB 2QRXA 3CCUP 3L72G 3QWOC 3OAKA 3PLNA 1AA0A 1YIJP 1N7SD 3FX0A 3W68A 2WPQA 2QVAA 1BCCJ 2Y9ZA 2JWDA 1DEBA 1ZR4A 5KAIE 3FGAD 3K5BA 2ITAA 4L73A 1LNQA 1OMIA 5H2FE 1SQQJ 3RL0D 1PPJE 2P10A 1JY3N 2FYUJ 2E74C 1K05A 4ASWA 2ZVOB 1FBMA 1ZR2A 1PGJA 2PRRA 2IZ1A 2AXTE 3V2RA 2IDBA 5AW6B 1T2KC 1NTMG 2YMYA 4WB4A 4IL6E 1YHQP 3H1JG 1PL5A 3S9OA 3LW5J 2AXCA 4PD4I 2E74B 3FWNA 1SQBJ 1GD2E 1NHLA 1KMIZ 1P84H 1FZFA 2ZYAA 2JWAA 3G3ZA 4L76A 3HTKB 3AE6C 5CCHC 1PPJD 2O01N 2H8PD 2WTYA 3IFMA 2B89A 3C8VA 1JMMA 3V4QA 3CX5H 2GA1A 3CD6P 1G1JA 1EDJA 3L75G 3AE7C 1DX7A 2NRGA 2AEMA 1ZMEC 2IYOA 3AE5C 4D6TE 3VTPC 2JDIH 1SQQK 2IFNA 3RK3B 1AQTA 2BCCJ 3IAOA 5KJ7C 1OX3A 2KSJA 2A45I 2K9JA 2PAJA 1SQPJ 2M3BA 1BE3G 2ZYGA 2WMMA 5AVYB 1GDTA 1SQXG 3B5ND 5KLIC 4RJTA 4D6TD 1KILA 1FZAA 1N8RQ 4UB6H 3AEAC 3Q2YA 1HGVA 3RGUA 2YKQA 3CCLP 2QJYC 2K9YA 2K9JB 1NTKJ 1MFTA 3AE9C 5KLIB 3MUDC 3MIWA 2QSIA 2NZ2A 3IF4A 1S2EA 1CI6A 1IZNB 1M56D 2QJYB 1S9KE 3S1KA 5B66H 2WPVB 3H1LG 1NWQA 1W5CE 4N78E 1SQQE 1JUNA 4LLHA 2FFDA 1R5SA 2Q9IA 4NPDA 1GL2D 1JY2N 1N2DC 4GIFA 2QA4P 2B9BA 3N4XA 1NAFA 1IC2A 1S72P 2XZRA 1QVFO 4H44D 1N73C 4N3YB 3TYYA 1SQPK 1SQQD 2C0XA 4GT1A 2RMZA 1L0NJ 1VQOP 2XDJA 3T97A 2Z5HA 1FJPA 1N73B 1KFNA 4IL6X 1YITP 3GF7A 1RF0A 1QL2A 1KILE 1NTKK 2Q6QA 1PGOA 4HYTB 4EI2A 5APVA 2PGDA 3L74E 3L70J 2C0WA 3V2NA 4HKZH 2MKVA 1L4AC 2BCCE 1WMKA 3CX5E 1NH4A 3KQGA 4IFFA 2KSEA 1S5LE 1P84D 3HUSA 3VP8A 1GZLA 2ZT9C 2HLOA 1SQPE 3M9HA 4A7PA 3TF5A 5GTIE 2W6AA 3G6EP 1XTGB 3L74D 4GKGA 2J59M 1OVRA 4H0LC 3V5BA 1RE3A 1NJIQ 1GW4A 4PD4H 2BCCD 3CX5D 5E79H 1NTKE 2E43A 1YBKA 4H0LB 3GF3A 3TGUJ 1RQUA 1T8ZA 3CCMP 2E5YA 1SQPD 3PTZA 5AW7B 2KZIA 1LTJC 2N1TC 1GK6A 3L36A 2P1JA 4JBZA 3D6ZA 4UB6E 4UB8E 1P84I 1RHZB 1L0LJ 2N1TB 1LWUA 1NTKD 1HBWA 1JCCA 1QVGO 3RK2D 5K5GB 2IBZE 2N9BA 4DJGA 4H13C 5KLVJ 4R4MA 1JOCA 1SFCA 3BCCG 1GK4A 2KZJA 5B66E 3H1HG 3CCSP 3CX5I 4XA4A 1VDFA 3OA7A 1DH3A 2MJZA 4YXDC 4H13B 1U7JA 5H2FH 2Q7CA 3EWKA 4JQ0D 1UIXA 1SQVG 2A45H 5CCGD 1VQ8P 5CJ0A 2W6BA 1BDCA 3H1IJ 2G8YA 3TSIA 2IBZD 2R5BA 5BVZA 3WMM0 1NVOA 3NFQA 5APWA 3AEDC 1IFIA 3H6PA 5KTBA 3CC7P 3CCEP 5M1BA 2WSCH 2LR2A 1NU1K 3H32A 1K73Q 2OYIA 3CWBJ 3M0DC 4U3FJ 1LT1A 2Q3EA 4WBAA 4YXWH 2QJKC 2FXOA 4WY4D 2K37A 3Q5PA 3H1KJ 4TT3H 2QJKB 3F5HA 1VQ9P 3H32B 5KLVK 2QEXP 3AE1C 4I2LC 2IBZI 1N7SC 2WQYC 4ZKPA 2CK3H 3VMAA 3A0HE 1S5LX 1MV8A 4EYYQ 2ZXEB 1N7SB 4NPFX 3RL0C 1PPJG 3SWYA 3TGUE 2A45G 1VL2A 4YTPC 2WITA 2WSEH 3GHGC 1NU1E 4HB1A 3RL0B 1URQA 1PP9J 2V7QH 1L0LE 1NTZK 2FKWB 4LGDE 3GLMA 3L72J 3TGUD 1XTCC 1G2CB 2O3JA 5KLVE 5AVRB 1NU1D 3Q5SA 3JSVC 1Q81Q 1RH5B 2XNDH 2H89C 3I5CA 2ZVNB 2N9YB 3F89A 3MD0A 4OGQD 3HE4B 3Q1MA 4U7JA 2A06E 2M0BA 5AVQB 1JTHA 3H1IE 3M9BA 3NTNA 3PHLA 5AW4B 3M9QA 1LTTC 1NTMJ 2E76D 2YXRB 4D6TG 3NXSA 5CHXA 1VQNP 3LW5H 3H1JJ 2R3SA 3AEFC 3HRNA 3L71G 1FE6A 1E5WA 1LP1B 3Q5RA 2WWWA 1NTZE 1JTHB 2XV5A 1EXIA 3IR9A 3CWBE 1VF5D 1NGMB 4U3FE 5AVUB 3HTKA 3KYQA 3H1ID 1Y8AA 1NOHA 3WU2E 1DD4A 2J58A 2OGUA 3EQ2A 1EXJA 3KZIE 3H1KE 5CCHA 1GU4A 1U57A 2QIWA 1NTZD 1EDKA 1ZLLA 3CWBD 3L75J 4U3FD 3AECC 1M1JC 1EZVG 3O6QA 3TDKA 1SS1A 3VN0A 2QG4A 1URQD 3AE8C 1MZ9A 1AFOA 1WT6A 3H1KD 2POHA 3WUUA 4RKUJ 1KQSO 1S5LH 4Y28J 2H88C 1JY3O 1IK9A 1NTMK 1GL2C 3O6QB 5GTIH 2E5TA 1SQXJ 1PGQA 5KJ7A 1PP9E 1OW8A 2ZYDA 2DW3A 3GW6A 2V4HA 4H44C 5GTHE 1GL2B 1BGYG 1LJ2A 2HYNA 2FYUK 3V2QA 2P7JA 3HD7D 2E75D 4AYCA 5BU8B 5AW0B 1HGZA 1AVYA 1CSBA 4H44B 1X9VA 4GODA 2C9LY 1USDA 1SQBK 4EIJA 5DJUB 4NPEA 1UIIA 1VQMP 2KUBA 2LXBA 4HH2A 3H1LJ 1K9MQ 4UB8H 2RH0A 3MUDA 1OVVA 1Y9BA 2M5AA 3PH0A 2IPPA 2ZFCA 3ZDMA 2QM7A 2KLVA 3L74G 1NTME 1KC8Q 2W8ZA 1BCCE 3NMDA 1ZW0A 1FZCC 1KB9H 1RE4C 2BCCG 1GTWA 2BEZF 1H88A 5AVSB 2M5AB 4M3LA 3RK3E 1QL1A 2K88A 1SQPG 4AQRD 2FYUE 1KD1Q 3P7KA 2M8RA 3VMYA 1ZV8A 1N73A 2KIKA 1BCCD 4GDOA 1SQBE 1SP4A 1S9KD 1KN7A 1NKZB 2YO2A 1NTKG 2FYNC 1BDDA 4N78D 2NPSA 3RK3D 3L75E 2QM8A 2FYUD 3VP9A
chains in the Genus database with same CATH topology
3L75G 3CXHH 4PD4H 3H1LG 1NU1G 3L72G 2A06G 2IBZG 1P84H 3BCCG 1BE3G 3H1KG 3H1IG 1SQBG 3CX5H 1NTZG 3H1HG 5KLVG 1SQPG 1SQQG 1NTKG 1SQXG 3L74G 1PPJG 3CWBG 4D6TG 1PP9G 4U3FG 1BGYG 3L70G 1L0NG 3L73G 1L0LG 1KYOH 2FYUG 3TGUG 3L71G 1EZVG 1NTMG 1KB9H 1BCCG 2BCCG 3H1JG 1SQVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 G;  3CXH H;  4PD4 H;  3H1L G;  1NU1 G;  3L72 G;  2A06 G;  2IBZ G;  1P84 H;  3BCC G;  1BE3 G;  3H1K G;  3H1I G;  1SQB G;  3CX5 H;  1NTZ G;  3H1H G;  5KLV G;  1SQP G;  1SQQ G;  1NTK G;  1SQX G;  3L74 G;  1PPJ G;  3CWB G;  4D6T G;  1PP9 G;  4U3F G;  1BGY G;  3L70 G;  1L0N G;  3L73 G;  1L0L G;  1KYO H;  2FYU G;  3TGU G;  3L71 G;  1EZV G;  1NTM G;  1KB9 H;  1BCC G;  2BCC G;  3H1J G;  1SQV G; 
#chains in the Genus database with same CATH topology
 4JF7 A;  2WVR A;  1IFP A;  1ZXG A;  3FWL A;  1EDI A;  1HH0 A;  2NPS C;  2FYZ A;  1R8E A;  4IFM A;  1X0T A;  5KJ7 D;  1SQB D;  2KS1 B;  3BAT A;  4TLF A;  1AV1 A;  1Q2N A;  1Y47 A;  2GM4 A;  4C7R A;  2NPS B;  3VMZ A;  1YYC A;  3EFG A;  1SLQ A;  1JY2 O;  3L75 D;  1FJK A;  1L4A A;  2IBZ G;  3ABV C;  4PJ0 E;  1LT9 A;  3SWK A;  2P67 A;  2ZXX A;  4DOJ A;  5AVV B;  3B4S A;  1KFM A;  1FDO A;  3A0H H;  3I56 P;  2VRS A;  1LT9 C;  1KIL D;  1JNM A;  1SVF A;  3PP5 A;  2WSF J;  1FZB A;  1EQ7 A;  1WRG A;  1L4A B;  1FDI A;  1LT9 B;  4I1L A;  2Z5I A;  1IO4 A;  2C9N Y;  3VYI A;  1J1E C;  3VOP A;  2ZT9 B;  2J5U A;  1L0N K;  1LTS C;  4OH8 B;  4RO0 A;  5KAF H;  1LTJ A;  1J1E B;  2N1T A;  5BU5 A;  3KXD A;  4Z1M H;  3OW2 O;  2JP3 A;  3P8C E;  1L2P A;  1FC2 C;  4WWI A;  2KXP B;  3V6I A;  3BCC J;  2KYV A;  4WY4 C;  1KOR A;  2RKL A;  5AW5 B;  3KPE A;  3G9R A;  2E42 A;  3U1C A;  1LTJ B;  4OWF A;  4WY4 B;  1SQV J;  2I1K A;  4BXL A;  1YJN P;  1FZE A;  5B5E E;  5C39 A;  5APY A;  3EFF K;  5KKZ C;  3P8C D;  2Y0C A;  4AUW A;  1KB9 E;  3BVH A;  2Y0E A;  1H0T A;  2HFE D;  2YXQ B;  5KKZ B;  3MTU E;  3I55 P;  3TGU G;  1L0N E;  1FOS F;  2D2C D;  2IFM A;  1NU1 G;  3CLQ A;  3L35 A;  1X8Y A;  2R32 A;  3U1A A;  3WU2 H;  1H0T B;  1ZN5 A;  1KB9 D;  1T3J A;  2O1J A;  3CCV P;  3KZI H;  2LKM A;  2M3E A;  1H89 A;  3M0D A;  3R2P A;  1L0N D;  2HR3 A;  4EDF A;  2SPZ A;  1LTB C;  3L73 J;  2IYP A;  4PV1 C;  3L70 E;  3RBZ A;  3SWF A;  1L0L K;  4K3A A;  5APT A;  2R44 A;  4OGQ C;  3PJS K;  4PV1 B;  1NAY A;  1M7L A;  1JM0 A;  1N7S A;  1KV4 A;  3H1I G;  2L91 A;  2YIU C;  3CCR P;  2OAR A;  1S4X A;  2E76 C;  3L70 D;  1BSH A;  1KB9 I;  3KDP B;  5L8R J;  3TNU B;  2WPS A;  5GTH H;  3TK1 A;  4ZNC A;  4W7Z A;  1IFJ A;  3A3Y B;  2OYH A;  3GHG A;  1NTZ G;  2K1A A;  2W27 A;  3CWB G;  2BAS A;  4U3F G;  1HWT C;  1Q82 Q;  4H13 D;  1DIP A;  2OYH C;  4YPC A;  5CMZ A;  1G2C A;  3HE5 B;  1NYH A;  2Z4E A;  4R4L A;  3CC2 P;  3H1K G;  1SFC D;  3V2P A;  4ZMD A;  5AVZ B;  2OYH B;  3GHG B;  4W7Y A;  3ITK A;  3V4W A;  3HE4 A;  1KQG B;  5KAF E;  1JY3 P;  2ZJS E;  1YTZ T;  3CC4 P;  2AEF A;  2LXC B;  2ZAE B;  2KNC B;  1N7L A;  4OVN F;  4BRY A;  2OQQ A;  4D6T J;  4WVZ A;  1OW7 A;  2GUS A;  2JKV A;  3A0B E;  2YMK A;  3L71 J;  2QE7 H;  1ZOY C;  1MUU A;  2O01 J;  3AEB C;  3E1I A;  1LP1 A;  5TIS H;  1L0L D;  1VQ4 P;  1CZQ A;  4I6M C;  3JC2 2;  1U7M A;  4BRY B;  1OVU A;  4BWN A;  5KLV D;  3CI9 A;  1K8A Q;  4DCK A;  1K04 A;  3LIE A;  1VQP P;  3W67 A;  3CXH H;  2YKO A;  1VQK P;  2JO1 A;  2Q5U A;  3HD7 C;  2OTJ P;  1AQ5 A;  2E75 C;  2A06 D;  3B5N A;  3L73 E;  2YO3 A;  1NKN A;  1KQF B;  1ZP0 C;  4GOF A;  3CCQ P;  3HD7 B;  3A5T A;  1GMJ A;  3B5N C;  2E75 B;  3QH9 A;  4ASV A;  1S3J A;  5APU A;  3E1R A;  2KOG A;  1PV3 A;  1M1J A;  1FS0 E;  3B5N B;  2W83 C;  1Z56 A;  2WZ7 A;  3MZW B;  1PFI A;  1HJ0 A;  3L73 D;  1X22 A;  2PFX A;  1BCC G;  4PJ0 H;  5CBN A;  4Y99 C;  1BGY J;  4XE5 B;  5CBO A;  2PP6 A;  1SQQ G;  2OTK E;  1GL2 A;  1M1J B;  1HVV A;  4KHX A;  4QMA A;  3O8Z A;  2FYU G;  3N7N A;  3WUT A;  4Y99 B;  3G71 P;  3VMX A;  1BE3 J;  3SFE C;  4HJG H;  2Q3I A;  1SQB G;  4L74 A;  2W6J H;  1QX8 A;  3E7K A;  1ZRT E;  2GUV A;  3GMA A;  1X79 B;  1YTZ I;  3D71 A;  3L72 E;  3RK3 C;  1A02 F;  1KYO E;  4JYB A;  1JY2 P;  3D70 A;  3L74 J;  4B86 A;  2IX7 C;  3L71 E;  1LTG C;  1W2E A;  3P32 A;  2OTL P;  1PP9 D;  2R5D A;  5AW9 B;  2FXP A;  3C9I A;  1ZRT D;  2E74 D;  4I7Z C;  3L72 D;  3B8E B;  1KYO D;  1FZC A;  3B71 A;  2AEJ A;  1RE4 A;  5B5E H;  3S4R A;  3KHU A;  1T2K D;  2HG5 D;  1IK7 A;  1VPC A;  3H1J E;  2FXM A;  1LTA C;  3L71 D;  4I7Z B;  1OWA A;  1PGP A;  2WT7 A;  1E79 H;  1EDL A;  1KIL C;  1FZG A;  5TIS E;  1IFN A;  3M91 A;  3MP7 B;  1G1I A;  5CCH D;  1FZC B;  1SQX K;  1EZV E;  2I8D A;  5AVX B;  1YQ4 C;  2H43 A;  1KIL B;  2JR8 A;  1NTM D;  5AW1 B;  2P2U A;  2G3A A;  3USS A;  2WT7 B;  3H1J D;  3RL0 g;  5APS A;  1OW6 A;  2XU6 A;  3P8M C;  2W90 A;  4GOE A;  3CXH E;  2KS1 A;  1AVO A;  5CJ4 A;  1HUC A;  5AW8 B;  1KYO I;  3M0A A;  3C1L A;  1CI6 B;  2FFD C;  1EZV D;  1YJW P;  2JEE A;  3GG2 A;  2FYN B;  1IJD B;  2CPS A;  1FOS E;  1BGY E;  2B87 A;  1D7M A;  5AVT B;  2FFD B;  5AW3 B;  1PIX A;  1N86 A;  2WSF H;  2KI7 B;  3CXH D;  1FDM A;  2KB7 P;  2KK7 A;  2KLU A;  1BE3 E;  2RN0 A;  1PZQ A;  3RK2 C;  3OJA B;  1GW3 A;  1SQX E;  4DT0 A;  1MFZ A;  3LID A;  3R4Y A;  1P84 E;  2B87 B;  3JCU H;  4O9B A;  1JMB A;  1BGY D;  5CCG A;  2YKP A;  1RF0 C;  3RK2 B;  3T97 B;  3CMA P;  1RF1 A;  4XFJ A;  1L0N G;  1H8A A;  3M06 A;  2O1K A;  2D2C C;  1EZV I;  5CCG C;  1KQL A;  1OIP A;  1T6A A;  3L37 A;  1KTM A;  1BE3 D;  1RF1 C;  1SQX D;  4W80 A;  2IZ0 A;  2Y9Y A;  1JEK A;  2D2C B;  5TJH A;  3H1L E;  1HF9 A;  3CXH I;  2I1J A;  1RF1 B;  4IOI H;  3BRV B;  1QGK B;  2WSS H;  4IFD K;  5AVW B;  3HUS C;  4WY4 A;  2HOD A;  3L70 G;  1IFD A;  2OYO A;  2L5G B;  5APQ A;  1W2B O;  1EC5 A;  1OXZ A;  3A2A A;  3A0B H;  3CL3 D;  3HUS B;  2R3C A;  3H1H J;  1HJB A;  3H1L D;  5APX A;  1YQ3 C;  1JO5 A;  1RE3 C;  3WUV A;  4ZKU A;  3CME P;  1M8O B;  3II6 A;  2HOD B;  1NU1 J;  2NPS D;  3CCJ P;  3U59 A;  1KZU B;  1CW5 A;  5DJT B;  1A02 J;  1J1D C;  3CPW O;  1GU5 A;  1T3U A;  1TU3 F;  3D6Y A;  1LWU C;  4KT0 J;  3AEG C;  1MKM A;  1DEE G;  1J1D B;  3H25 A;  4JYC A;  2Y0D A;  1L4A D;  2H7H A;  1OZH A;  1JB0 J;  5KAI H;  1L0L G;  1SFC C;  1LWU B;  3AEE C;  3AE2 C;  1JCD A;  1BSN A;  2ZT9 D;  5AW2 B;  2CPB A;  1LTI C;  2XNX A;  2XKM A;  2AXT H;  1SFC B;  3FXD A;  5KLV G;  4IL6 H;  1Q7Y Q;  4H0L D;  4LC1 A;  1M57 D;  1VQL P;  1S1C X;  3MHV A;  3TNU A;  1SQV K;  1LGH B;  3PRJ A;  1NTZ J;  2A06 G;  4N6J A;  4CPG A;  1AJY A;  3BRT B;  1M1K Q;  1HTL C;  1QLE D;  2YNY A;  2N1T D;  4OGQ B;  2OYI C;  3Q3D A;  3HE5 A;  2JJL A;  1J2J B;  1Q90 D;  1OFC X;  3MGN A;  3JCU E;  3IN6 A;  2K3R A;  2YIU B;  4MN4 C;  2WSC J;  2OYI B;  2E76 B;  4DZO A;  3L73 G;  1VF5 C;  1KYO H;  1Q86 Q;  1FU1 A;  2B88 A;  2KNC A;  3BCC E;  3L4F A;  1IFM A;  1NO4 A;  3H1H E;  2HPC A;  1VF5 B;  2O01 H;  4EOT A;  1RY3 A;  4JPZ B;  2P58 A;  4KJM A;  3UIA A;  1R5L A;  2BEQ D;  1SQV E;  3AE4 C;  1VQ7 P;  3G4S P;  4C7N A;  4K35 A;  3RBX A;  3AE3 C;  1QEX A;  1USE A;  2FY8 A;  1DD3 A;  4RES B;  3BAS A;  2FBW C;  3FXE A;  4PD4 E;  3BCC D;  2HPC B;  5E79 E;  3H1H D;  1URQ C;  4L75 A;  1RQV A;  5EFW B;  3SSU A;  1M90 Q;  1YJ9 P;  4C7N B;  1FAV A;  1VQ6 P;  4PV1 D;  1SQV D;  2UWJ E;  2WSE J;  1URQ B;  2KP8 A;  2QJP C;  3SFD C;  1VQ5 P;  2WPR A;  3A7O A;  1PP9 G;  2Q1K A;  1YI2 P;  2V7Q J;  3HD7 A;  4PD4 D;  4C46 A;  2QJP B;  2QRX A;  3CCU P;  3L72 G;  3QWO C;  3OAK A;  3PLN A;  1AA0 A;  1YIJ P;  1N7S D;  3FX0 A;  3W68 A;  2WPQ A;  2QVA A;  1BCC J;  2Y9Z A;  2JWD A;  1DEB A;  1ZR4 A;  5KAI E;  3FGA D;  3K5B A;  2ITA A;  4L73 A;  1LNQ A;  1OMI A;  5H2F E;  1SQQ J;  3RL0 D;  1PPJ E;  2P10 A;  1JY3 N;  2FYU J;  2E74 C;  1K05 A;  4ASW A;  2ZVO B;  1FBM A;  1ZR2 A;  1PGJ A;  2PRR A;  2IZ1 A;  2AXT E;  3V2R A;  2IDB A;  5AW6 B;  1T2K C;  1NTM G;  2YMY A;  4WB4 A;  4IL6 E;  1YHQ P;  3H1J G;  1PL5 A;  3S9O A;  3LW5 J;  2AXC A;  4PD4 I;  2E74 B;  3FWN A;  1SQB J;  1GD2 E;  1NHL A;  1KMI Z;  1P84 H;  1FZF A;  2ZYA A;  2JWA A;  3G3Z A;  4L76 A;  3HTK B;  3AE6 C;  5CCH C;  1PPJ D;  2O01 N;  2H8P D;  2WTY A;  3IFM A;  2B89 A;  3C8V A;  1JMM A;  3V4Q A;  3CX5 H;  2GA1 A;  3CD6 P;  1G1J A;  1EDJ A;  3L75 G;  3AE7 C;  1DX7 A;  2NRG A;  2AEM A;  1ZME C;  2IYO A;  3AE5 C;  4D6T E;  3VTP C;  2JDI H;  1SQQ K;  2IFN A;  3RK3 B;  1AQT A;  2BCC J;  3IAO A;  5KJ7 C;  1OX3 A;  2KSJ A;  2A45 I;  2K9J A;  2PAJ A;  1SQP J;  2M3B A;  1BE3 G;  2ZYG A;  2WMM A;  5AVY B;  1GDT A;  1SQX G;  3B5N D;  5KLI C;  4RJT A;  4D6T D;  1KIL A;  1FZA A;  1N8R Q;  4UB6 H;  3AEA C;  3Q2Y A;  1HGV A;  3RGU A;  2YKQ A;  3CCL P;  2QJY C;  2K9Y A;  2K9J B;  1NTK J;  1MFT A;  3AE9 C;  5KLI B;  3MUD C;  3MIW A;  2QSI A;  2NZ2 A;  3IF4 A;  1S2E A;  1CI6 A;  1IZN B;  1M56 D;  2QJY B;  1S9K E;  3S1K A;  5B66 H;  2WPV B;  3H1L G;  1NWQ A;  1W5C E;  4N78 E;  1SQQ E;  1JUN A;  4LLH A;  2FFD A;  1R5S A;  2Q9I A;  4NPD A;  1GL2 D;  1JY2 N;  1N2D C;  4GIF A;  2QA4 P;  2B9B A;  3N4X A;  1NAF A;  1IC2 A;  1S72 P;  2XZR A;  1QVF O;  4H44 D;  1N73 C;  4N3Y B;  3TYY A;  1SQP K;  1SQQ D;  2C0X A;  4GT1 A;  2RMZ A;  1L0N J;  1VQO P;  2XDJ A;  3T97 A;  2Z5H A;  1FJP A;  1N73 B;  1KFN A;  4IL6 X;  1YIT P;  3GF7 A;  1RF0 A;  1QL2 A;  1KIL E;  1NTK K;  2Q6Q A;  1PGO A;  4HYT B;  4EI2 A;  5APV A;  2PGD A;  3L74 E;  3L70 J;  2C0W A;  3V2N A;  4HKZ H;  2MKV A;  1L4A C;  2BCC E;  1WMK A;  3CX5 E;  1NH4 A;  3KQG A;  4IFF A;  2KSE A;  1S5L E;  1P84 D;  3HUS A;  3VP8 A;  1GZL A;  2ZT9 C;  2HLO A;  1SQP E;  3M9H A;  4A7P A;  3TF5 A;  5GTI E;  2W6A A;  3G6E P;  1XTG B;  3L74 D;  4GKG A;  2J59 M;  1OVR A;  4H0L C;  3V5B A;  1RE3 A;  1NJI Q;  1GW4 A;  4PD4 H;  2BCC D;  3CX5 D;  5E79 H;  1NTK E;  2E43 A;  1YBK A;  4H0L B;  3GF3 A;  3TGU J;  1RQU A;  1T8Z A;  3CCM P;  2E5Y A;  1SQP D;  3PTZ A;  5AW7 B;  2KZI A;  1LTJ C;  2N1T C;  1GK6 A;  3L36 A;  2P1J A;  4JBZ A;  3D6Z A;  4UB6 E;  4UB8 E;  1P84 I;  1RHZ B;  1L0L J;  2N1T B;  1LWU A;  1NTK D;  1HBW A;  1JCC A;  1QVG O;  3RK2 D;  5K5G B;  2IBZ E;  2N9B A;  4DJG A;  4H13 C;  5KLV J;  4R4M A;  1JOC A;  1SFC A;  3BCC G;  1GK4 A;  2KZJ A;  5B66 E;  3H1H G;  3CCS P;  3CX5 I;  4XA4 A;  1VDF A;  3OA7 A;  1DH3 A;  2MJZ A;  4YXD C;  4H13 B;  1U7J A;  5H2F H;  2Q7C A;  3EWK A;  4JQ0 D;  1UIX A;  1SQV G;  2A45 H;  5CCG D;  1VQ8 P;  5CJ0 A;  2W6B A;  1BDC A;  3H1I J;  2G8Y A;  3TSI A;  2IBZ D;  2R5B A;  5BVZ A;  3WMM 0;  1NVO A;  3NFQ A;  5APW A;  3AED C;  1IFI A;  3H6P A;  5KTB A;  3CC7 P;  3CCE P;  5M1B A;  2WSC H;  2LR2 A;  1NU1 K;  3H32 A;  1K73 Q;  2OYI A;  3CWB J;  3M0D C;  4U3F J;  1LT1 A;  2Q3E A;  4WBA A;  4YXW H;  2QJK C;  2FXO A;  4WY4 D;  2K37 A;  3Q5P A;  3H1K J;  4TT3 H;  2QJK B;  3F5H A;  1VQ9 P;  3H32 B;  5KLV K;  2QEX P;  3AE1 C;  4I2L C;  2IBZ I;  1N7S C;  2WQY C;  4ZKP A;  2CK3 H;  3VMA A;  3A0H E;  1S5L X;  1MV8 A;  4EYY Q;  2ZXE B;  1N7S B;  4NPF X;  3RL0 C;  1PPJ G;  3SWY A;  3TGU E;  2A45 G;  1VL2 A;  4YTP C;  2WIT A;  2WSE H;  3GHG C;  1NU1 E;  4HB1 A;  3RL0 B;  1URQ A;  1PP9 J;  2V7Q H;  1L0L E;  1NTZ K;  2FKW B;  4LGD E;  3GLM A;  3L72 J;  3TGU D;  1XTC C;  1G2C B;  2O3J A;  5KLV E;  5AVR B;  1NU1 D;  3Q5S A;  3JSV C;  1Q81 Q;  1RH5 B;  2XND H;  2H89 C;  3I5C A;  2ZVN B;  2N9Y B;  3F89 A;  3MD0 A;  4OGQ D;  3HE4 B;  3Q1M A;  4U7J A;  2A06 E;  2M0B A;  5AVQ B;  1JTH A;  3H1I E;  3M9B A;  3NTN A;  3PHL A;  5AW4 B;  3M9Q A;  1LTT C;  1NTM J;  2E76 D;  2YXR B;  4D6T G;  3NXS A;  5CHX A;  1VQN P;  3LW5 H;  3H1J J;  2R3S A;  3AEF C;  3HRN A;  3L71 G;  1FE6 A;  1E5W A;  1LP1 B;  3Q5R A;  2WWW A;  1NTZ E;  1JTH B;  2XV5 A;  1EXI A;  3IR9 A;  3CWB E;  1VF5 D;  1NGM B;  4U3F E;  5AVU B;  3HTK A;  3KYQ A;  3H1I D;  1Y8A A;  1NOH A;  3WU2 E;  1DD4 A;  2J58 A;  2OGU A;  3EQ2 A;  1EXJ A;  3KZI E;  3H1K E;  5CCH A;  1GU4 A;  1U57 A;  2QIW A;  1NTZ D;  1EDK A;  1ZLL A;  3CWB D;  3L75 J;  4U3F D;  3AEC C;  1M1J C;  1EZV G;  3O6Q A;  3TDK A;  1SS1 A;  3VN0 A;  2QG4 A;  1URQ D;  3AE8 C;  1MZ9 A;  1AFO A;  1WT6 A;  3H1K D;  2POH A;  3WUU A;  4RKU J;  1KQS O;  1S5L H;  4Y28 J;  2H88 C;  1JY3 O;  1IK9 A;  1NTM K;  1GL2 C;  3O6Q B;  5GTI H;  2E5T A;  1SQX J;  1PGQ A;  5KJ7 A;  1PP9 E;  1OW8 A;  2ZYD A;  2DW3 A;  3GW6 A;  2V4H A;  4H44 C;  5GTH E;  1GL2 B;  1BGY G;  1LJ2 A;  2HYN A;  2FYU K;  3V2Q A;  2P7J A;  3HD7 D;  2E75 D;  4AYC A;  5BU8 B;  5AW0 B;  1HGZ A;  1AVY A;  1CSB A;  4H44 B;  1X9V A;  4GOD A;  2C9L Y;  1USD A;  1SQB K;  4EIJ A;  5DJU B;  4NPE A;  1UII A;  1VQM P;  2KUB A;  2LXB A;  4HH2 A;  3H1L J;  1K9M Q;  4UB8 H;  2RH0 A;  3MUD A;  1OVV A;  1Y9B A;  2M5A A;  3PH0 A;  2IPP A;  2ZFC A;  3ZDM A;  2QM7 A;  2KLV A;  3L74 G;  1NTM E;  1KC8 Q;  2W8Z A;  1BCC E;  3NMD A;  1ZW0 A;  1FZC C;  1KB9 H;  1RE4 C;  2BCC G;  1GTW A;  2BEZ F;  1H88 A;  5AVS B;  2M5A B;  4M3L A;  3RK3 E;  1QL1 A;  2K88 A;  1SQP G;  4AQR D;  2FYU E;  1KD1 Q;  3P7K A;  2M8R A;  3VMY A;  1ZV8 A;  1N73 A;  2KIK A;  1BCC D;  4GDO A;  1SQB E;  1SP4 A;  1S9K D;  1KN7 A;  1NKZ B;  2YO2 A;  1NTK G;  2FYN C;  1BDD A;  4N78 D;  2NPS A;  3RK3 D;  3L75 E;  2QM8 A;  2FYU D;  3VP9 A; 
#chains in the Genus database with same CATH homology
 3L75 G;  3CXH H;  4PD4 H;  3H1L G;  1NU1 G;  3L72 G;  2A06 G;  2IBZ G;  1P84 H;  3BCC G;  1BE3 G;  3H1K G;  3H1I G;  1SQB G;  3CX5 H;  1NTZ G;  3H1H G;  5KLV G;  1SQP G;  1SQQ G;  1NTK G;  1SQX G;  3L74 G;  1PPJ G;  3CWB G;  4D6T G;  1PP9 G;  4U3F G;  1BGY G;  3L70 G;  1L0N G;  3L73 G;  1L0L G;  1KYO H;  2FYU G;  3TGU G;  3L71 G;  1EZV G;  1NTM G;  1KB9 H;  1BCC G;  2BCC G;  3H1J G;  1SQV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...