2BCCG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2bccG00
2FYUG 2BCCG 4PD4H 1P84H 2A06G 3L70G 1SQQG 1SQBG 1BGYG 1NTMG 2IBZG 1PPJG 1SQPG 3L74G 3CX5H 1SQVG 1KB9H 1PP9G 1NTKG 3CWBG 3H1HG 3L75G 3L71G 5KLVG 3L72G 1SQXG 3H1LG 1NTZG 3L73G 3CXHH 4D6TG 3TGUG 3H1JG 3H1IG 3BCCG 1L0NG 1EZVG 4U3FG 1NU1G 1BCCG 1BE3G 1KYOH 1L0LG 3H1KG
chains in the Genus database with same CATH superfamily
3CI9A 5AVRB 2Q6QA 1LT1A 1ZXGA 4BWNA 1GL2D 1OMIA 5KLVK 3BCCJ 1MV8A 1OWAA 3VMZA 5CCHA 1Y9BA 1GL2B 1SQVK 1USDA 3L70D 1LJ2A 2IBZD 3T97B 1VQ5P 3L75D 3M0DA 2WZ7A 2B88A 2O1JA 3IN6A 3SSUA 3VTPC 5TISE 2KS1A 4I7ZB 4IL6E 4ZMDA 3R2PA 2KZIA 4L73A 4Y99C 2O1KA 1R8EA 1BE3J 4D6TJ 2QSIA 1DEEG 3CWBD 1SQBE 2IDBA 3GHGC 1G2CA 2E75D 1M7LA 2D2CD 1NKZB 3H1IE 3OJAB 2E75B 3M06A 1S4XA 3WU2H 1RE4A 1LTBC 5CCGC 3VMXA 3HE4A 2KB7P 3Q3DA 3VOPA 3H1HE 5GTIE 1GW4A 1JEKA 5B5EH 4JQ0D 3L73E 2KZJA 1MKMA 1U57A 1BSHA 2ZVNB 1R5SA 1SQQD 1GZLA 3SWFA 2H7HA 1QEXA 2R3CA 1OW7A 3CXHD 4DJGA 1Q86Q 4RKUJ 1AJYA 3F5HA 3V2PA 2P2UA 3HUSC 2RH0A 3RK2C 1SQPD 3AE8C 1HJ0A 5CJ4A 4U7JA 1EQ7A 2A45I 3W67A 2ZYDA 1J1EB 1NU1K 2OTKE 3V2QA 3OAKA 1OW6A 3VP8A 1EDIA 1J2JB 1LT9A 1S9KE 3GHGB 3CMAP 3VMYA 5CCGD 2MKVA 4WWIA 1K05A 4HH2A 1U7MA 4O9BA 3H1LD 4N78D 2FXPA 4UB6H 2H88C 1NYHA 1JOCA 2XZRA 1N2DC 3G6EP 4GIFA 3M0AA 4MN4C 3WMM0 3Q5RA 4DCKA 2Q7CA 2Y0CA 2KIKA 2WPQA 3C9IA 2K37A 3L71E 1S5LH 2IPPA 1URQA 3KXDA 1DIPA 3U1CA 3L72E 4EDFA 4U3FD 3CCRP 5BU8B 1SQXD 2HODB 2YIUC 2WQYC 2P67A 5APYA 2LXCB 1YTZT 1SQBG 2B87B 2OYIC 1RQUA 3MZWB 2L5GB 2JDIH 2NRGA 1EZVE 2RMZA 4NPEA 1HGVA 3H1IG 3AE1C 3SWKA 1YITP 1FU1A 2I1JA 3MUDC 1RH5B 5KLVE 4I2LC 1SQVE 4N3YB 1W2BO 4RO0A 2I1KA 1L4AA 4R4MA 2OTJP 1J1DB 3H1HG 1SS1A 4XE5B 1VQKP 1CZQA 1LTSC 3CD6P 1JO5A 5EFWB 1BE3D 3L73G 4D6TD 2MJZA 2POHA 1IK7A 1Q7YQ 3M9QA 4PD4I 4OWFA 1RE3C 1JY2P 1FJKA 3RL0C 3VMAA 3CMEP 5TJHA 1E79H 2WITA 3S4RA 2H43A 2AXCA 2YKPA 2W6AA 1A02F 1LWUC 2OYHA 1RF1C 1ZR4A 3JCUH 3II6A 2N1TA 1RE4C 2KOGA 1S5LX 5AW4B 2P58A 1VQMP 3BASA 2ZYGA 2GA1A 3I55P 2BASA 3W68A 1IFJA 2YIUB 1T6AA 2OTLP 1HGZA 1Q90D 2HYNA 5CHXA 5CMZA 1N7SC 2WPSA 2L91A 5CCHD 1VQ4P 5H2FE 2IBZI 2GUSA 2OYIB 3IR9A 2M0BA 1PP9E 3M9BA 3BVHA 1AV1A 5AVVB 3MTUE 4NPDA 3B5NA 2VRSA 1VDFA 3A2AA 2KUBA 1NTKK 1M1KQ 1SFCC 5M1BA 1SQBJ 1KQGB 1D7MA 1T3UA 1BCCG 1H8AA 2M8RA 1LTTC 4I6MC 3IFMA 4H0LC 1IFMA 3RL0D 3L71G 3H1IJ 4L75A 2WSSH 3L72G 1AQTA 3U1AA 1L0NE 1LT9C 2Y9ZA 1KORA 1G2CB 1LTIC 2A06E 3H1HJ 2FYUG 3P8MC 3N7NA 3LW5H 1PPJG 3L73J 3HE4B 1VL2A 1UIXA 3WU2E 2OGUA 3CL3D 3D6YA 1ZV8A 5AW9B 1EZVG 5AW1B 1Y47A 1KFMA 1N7SD 1NTZK 3MIWA 5KLVG 5B5EE 3GW6A 2NPSA 2OARA 1CI6B 3JSVC 3FXDA 3GHGA 1PGQA 2LKMA 1URQC 1SQVG 3CXHI 1RY3A 1NAYA 2LXBA 1PL5A 2V7QJ 1NKNA 4EI2A 4TT3H 4JF7A 5CCGA 1BGYD 2CPSA 1P84H 5AW5B 5BU5A 4JBZA 1NH4A 3HTKA 1L0LK 1KC8Q 4H0LD 1ZW0A 4H0LB 1KB9D 5DJUB 4BXLA 1ZRTD 2WSEH 1IK9A 1VQ8P 1LT9B 3KYQA 1QL2A 3U59A 4OGQC 2FYZA 1KYOD 1JMBA 3HUSA 1UIIA 3A0BH 1MUUA 3PRJA 2IX7C 3L71J 1OZHA 5KAFE 1X79B 3L36A 3L72J 4M3LA 1FS0E 3V4QA 5APQA 3WUTA 1URQD 4C46A 2K88A 2OYHC 1SVFA 3ITKA 1ZLLA 1URQB 2WSEJ 1S5LE 3TK1A 3TSIA 1YTZI 2BEZF 5APWA 1RHZB 2M3BA 2Q1KA 1SQQK 4DOJA 5KLVJ 1AVOA 2JP3A 4AQRD 3S1KA 1NU1G 1SQVJ 3G3ZA 3L74E 1PGJA 2Q9IA 1JUNA 5L8RJ 1KQFB 3D70A 2WT7A 3B5NC 1IJDB 1L4AD 3P8CE 4YTPC 1NVOA 3TGUG 1SQBD 1L4AB 2E5YA 1KN7A 5AW0B 5H2FH 5KKZC 4HB1A 5KTBA 2W6JH 2OYIA 4I1LA 2B9BA 1M1JA 4GT1A 1R5LA 4W80A 4Y28J 1CSBA 3MUDA 1S1CX 3CX5D 1N73A 3H1HD 2FBWC 3MGNA 2N1TD 4GODA 3IAOA 2OYHB 3KDPB 3L73D 2N1TB 1Z56A 3WUVA 3AEFC 3JCUE 3V2NA 2QE7H 1TU3F 1JTHA 2WSCH 3VN0A 1VQNP 1RE3A 5CBNA 2CK3H 1PP9J 1IFIA 2WPRA 3RK3E 2NPSC 4TLFA 3PJSK 5AVTB 1NTZE 1HTLC 3H1JE 1LWUA 1RF1A 1DH3A 2D2CB 5E79E 3B5ND 2C0WA 3CCSP 4QMAA 5KLIB 3N4XA 2DW3A 3VP9A 2Y0EA 5AVSB 3B5NB 2ZT9C 3CC4P 1NAFA 1SP4A 3Q2YA 2WSCJ 2A45G 1S9KD 1KD1Q 1L0NJ 1NU1J 1CI6A 3V6IA 1N7SA 1L0LE 1FBMA 3CCEP 4EOTA 2XV5A 2IBZE 1M8OB 2HG5D 1YQ3C 1T2KC 2JWAA 1QVFO 4BRYB 4ZNCA 1NTMK 2WVRA 3FGAD 1OVRA 1SFCA 2BCCE 3P32A 3L71D 3AE6C 3AE4C 3L72D 4Y99B 3AE9C 3L74G 1FZAA 2W27A 2QG4A 1KQLA 4K3AA 5APUA 2NPSD 3B8EB 1JY3P 2P10A 2NPSB 5CBOA 3NMDA 4GKGA 5APSA 2YMKA 3GF7A 3A0HE 4EYYQ 2NZ2A 1NTKG 5KAFH 3ABVC 3V2RA 1EZVD 1KILC 2A45H 2K1AA 5KLVD 2HFED 2AEJA 1QGKB 1BCCE 3H1KE 1HBWA 1P84E 3HTKB 1KB9I 4HKZH 2KP8A 1T2KD 3CPWO 2W83C 3BRTB 1VF5C 1KYOI 1EXJA 2QJKC 3USSA 4LGDE 2PFXA 1A02J 2FYUE 1MFZA 5AVQB 3RK2D 1PPJE 4W7YA 3HUSB 1YI2P 3AEDC 4L76A 3RK2B 1S72P 3QH9A 3BCCD 1HH0A 4WB4A 1VQ9P 1T8ZA 1NTZG 3RBZA 3A0BE 4HYTB 1M1JC 2K9JB 3H1JG 2YKQA 2FY8A 3G4SP 1N73C 1M56D 3WUUA 2JR8A 4N78E 1JCDA 1KQSO 3RGUA 1GK4A 2KNCA 2PRRA 3M9HA 5KAIH 4EIJA 3NXSA 2Z5HA 1XTCC 3L74J 1PP9D 4WY4A 1L0LG 3OA7A 1MZ9A 1ZMEC 2IBZG 4C7NA 4YXDC 3L75G 2PGDA 1VQ6P 1FE6A 2JKVA 2Z4EA 1GTWA 2WPVB 4H13C 4N6JA 2QM7A 1FZBA 1VF5D 2UWJE 2N9YB 2WT7B 2Q3EA 2BCCG 1VF5B 2G8YA 4PD4H 2QJKB 5APTA 1NGMB 2O01H 5C39A 1AA0A 4DZOA 1L0ND 1LTAC 2AXTE 2FKWB 1FZFA 2IZ1A 5AW3B 3MD0A 2A06D 3CX5I 1KILE 5E79H 2Z5IA 1DD3A 5CJ0A 3AEGC 1M1JB 1JY3O 1YJNP 2R32A 1N73B 2KK7A 1IFNA 1PZQA 1KZUB 3EWKA 2O01J 1NTME 1KFNA 1Q2NA 3H1KG 2Y0DA 2ZJSE 1JTHB 1SQQG 2E76C 1NTZJ 2FFDC 3TYYA 3H1JJ 1GW3A 1K9MQ 3PLNA 3RL0B 3GLMA 1NU1E 4BRYA 1GU4A 4H13D 1JY3N 3Q5SA 1LWUB 1RF1B 4H13B 2E74C 5K5GB 1HF9A 1IO4A 5AW7B 4WBAA 3TGUE 2KI7B 1L0LJ 4ASVA 1S2EA 3L75J 1X9VA 5BVZA 3K5BA 3C8VA 1N7SB 3A0HH 2B89A 3CCMP 2KSEA 3H1LG 1VPCA 3TF5A 3KQGA 1H88A 2BCCJ 3Q5PA 3LW5J 4ZKPA 2M3EA 1SFCD 1N8RQ 2J59M 1SFCB 2QJPC 2ZXXA 3M91A 3CXHH 1JY2O 1M57D 1GD2E 2QJYC 3FX0A 2YMYA 4K35A 2HLOA 2HR3A 1EZVI 3H32B 1IC2A 2XDJA 3R4YA 4RJTA 3RK3C 3V5BA 1BCCJ 1QX8A 2YXQB 3H1KJ 3L74D 4RESB 1PFIA 1SQQJ 3S9OA 2WMMA 4R4LA 4WY4C 1BDDA 1EXIA 3CC7P 3GMAA 4GOFA 2K9JA 1YBKA 2JWDA 3P8CD 4JYCA 1JY2N 1AQ5A 1FZGA 2FYUJ 3LIDA 1CW5A 1BGYE 1KV4A 1GL2C 5APVA 1NTMG 5KJ7C 4KJMA 1KILA 4ZKUA 2P1JA 4PJ0H 1KMIZ 2KLVA 4I7ZC 1G1IA 2C9NY 4L74A 2Y9YA 1KB9E 3G71P 2HPCA 1H89A 1ZN5A 4LC1A 3PH0A 1KTMA 5AW8B 3PTZA 2W8ZA 2YXRB 1SQPK 4OGQD 2AXTH 1NHLA 3IF4A 3RK3D 4OGQB 2E75C 3CCJP 1FAVA 5APXA 1NTKE 2KNCB 3RK3B 1YQ4C 2PP6A 4WY4D 3H1JD 1L2PA 3H1ID 2KXPB 3ZDMA 4YXWH 2SPZA 1QVGO 4WY4B 5KAIE 2LR2A 4YPCA 4C7NB 3CC2P 2WTYA 3RL0g 3O6QA 3PHLA 1RQVA 1RF0A 1K8AQ 2E42A 4B86A 2IFMA 2QIWA 2BEQD 1NWQA 3A5TA 1L0LD 5KJ7D 4IFDK 2ZYAA 1OX3A 4PD4E 5B66H 3I5CA 2YO3A 2GUVA 1SQXK 1XTGB 5AVWB 2W90A 1IFDA 3HE5B 3OW2O 2BCCD 2R44A 2H89C 3KZIE 1J1EC 3EQ2A 3L4FA 1NTMJ 1FDMA 4A7PA 4WVZA 3TNUA 2JO1A 1T3JA 2ZXEB 1Q82Q 5KKZB 1OVVA 2V4HA 3FWNA 3L70E 3CX5E 1WRGA 1PGPA 3AE3C 3L75E 3QWOC 4JYBA 1BGYG 2XKMA 4IFFA 1FOSF 3TGUJ 1YYCA 4C7RA 1HUCA 1BCCD 3H1KD 1P84D 4Z1MH 4UB8E 3CWBE 3LIEA 1K73Q 1GU5A 1LTGC 2ZAEB 3VYIA 2R5DA 2FFDA 3B71A 1EDKA 2C9LY 1X22A 2ZVOB 2FYUD 2FXOA 2RKLA 1PPJD 3HD7C 3H32A 1Y8AA 1L0NK 2GM4A 3Q1MA 3O8ZA 1GK6A 1ZOYC 1VQOP 2QEXP 2ZT9D 2RN0A 1HJBA 4KT0J 1H0TB 2XNXA 1LP1A 2ZT9B 1J1DC 3P7KA 4GOEA 1SQVD 1SQQE 3FWLA 5AVUB 1OW8A 3CXHE 2IZ0A 2QM8A 3AECC 1JMMA 4ASWA 5AVXB 3B4SA 3CCUP 1G1JA 2M5AB 1JM0A 1SQPE 3AEEC 1EDJA 1OIPA 1LNQA 1KB9H 2QRXA 3A3YB 3MP7B 3C1LA 3SWYA 2QVAA 3NTNA 5AVYB 1FZCA 1X8YA 3L37A 1U7JA 1BGYJ 1KYOH 1RF0C 3AEBC 3HD7D 1OVUA 1N7LA 1VQLP 3GF3A 3H1LE 3HD7B 1LTJA 3D6ZA 3TDKA 5CCHC 1QL1A 5GTHH 3AE5C 1KILD 3EFFK 1FDIA 4W7ZA 1JB0J 4LLHA 1KILB 3M0DC 4DT0A 1EC5A 3L70G 3EFGA 2K9YA 1Q81Q 1DEBA 2Q3IA 4PJ0E 4NPFX 4U3FE 2HPCB 1W2EA 3HRNA 2IYOA 3H25A 1HVVA 2CPBA 1SQXE 1NTMD 2I8DA 2FXMA 2G3AA 1K04A 1NOHA 1NTKJ 1GL2A 3E1RA 2IFNA 3CWBG 3T97A 5KJ7A 1FJPA 5TISH 4IL6H 3BCCE 1NU1D 5AVZB 4XFJA 1FOSE 2FYNC 2E5TA 3KZIH 5AW2B 3HE5A 2O01N 3SFEC 2R5BA 2Q5UA 4IFMA 3TGUD 3O6QB 1E5WA 1IZNB 3GG2A 3AE2C 2AEFA 1FC2C 2J58A 1BE3E 4D6TE 1YHQP 2IYPA 2WWWA 4AYCA 1OFCX 3G9RA 3CX5H 5GTIH 4AUWA 2XNDH 3SFDC 3CCVP 3V4WA 5B66E 2KS1B 3CCQP 3BATA 2PAJA 1M90Q 1SQPG 3F89A 4UB8H 3H6PA 4H44C 3PP5A 1N86A 3FXEA 3TNUB 2AEMA 2V7QH 2JJLA 4CPGA 4HJGH 3L70J 3JC22 2ITAA 2ZFCA 2W6BA 1USEA 4JPZB 4IL6X 2FYNB 2JEEA 1FDOA 2R3SA 1GMJA 1SQBK 1PIXA 2YO2A 1LGHB 4OVNF 1PV3A 1P84I 3UIAA 3KPEA 1H0TA 1WT6A 1BSNA 3D71A 3CWBJ 4PV1C 2QA4P 2J5UA 1JNMA 2E76D 1OXZA 1YJWP 3CCLP 3MHVA 2E76B 2FFDB 4U3FG 1AVYA 1ZR2A 1FZCC 1SQXG 1ZP0C 2OQQA 4XA4A 1DX7A 4IOIH 2YNYA 1YIJP 2E74D 2KYVA 1LTJC 2M5AA 2O3JA 4H44D 2E74B 3BCCG 2KSJA 3BRVB 4H44B 2P7JA 1QLED 2K3RA 1LP1B 2HODA 2C0XA 2WSFH 3RBXA 1L4AC 3I56P 1W5CE 2N9BA 5AW6B 2B87A 1SQPJ 1BE3G 1NTKD 3AEAC 3HD7A 4D6TG 4UB6E 2XU6A 3CLQA 2YKOA 1PP9G 4PV1D 1VQPP 1JCCA 2OYOA 1HWTC 4PV1B 3E7KA 2N1TC 1NJIQ 3A7OA 2WSFJ 4OH8B 2QJPB 1FZEA 4KHXA 3AE7C 3L35A 2E43A 1PGOA 1NO4A 1ZRTE 3H1LJ 1FZCB 4GDOA 2H8PD 2QJYB 2KLUA 1MFTA 4PD4D 1KYOE 1L0NG 1SLQA 1S3JA 1IFPA 1VQ7P 1GDTA 3NFQA 1LTJB 1WMKA 2D2CC 1EDLA 2A06G 1BDCA 3E1IA 1NTZD 1DD4A 5KLIC 1YJ9P 2FYUK 5GTHE 4U3FJ 1AFOA 1SQXJ 5DJTB 1X0TA 3KHUA
chains in the Genus database with same CATH topology
2FYUG 2BCCG 4PD4H 1P84H 2A06G 3L70G 1SQQG 1SQBG 1BGYG 1NTMG 2IBZG 1PPJG 1SQPG 3L74G 3CX5H 1SQVG 1KB9H 1PP9G 1NTKG 3CWBG 3H1HG 3L75G 3L71G 5KLVG 3L72G 1SQXG 3H1LG 1NTZG 3L73G 3CXHH 4D6TG 3TGUG 3H1JG 3H1IG 3BCCG 1L0NG 1EZVG 4U3FG 1NU1G 1BCCG 1BE3G 1KYOH 1L0LG 3H1KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  2BCC G;  4PD4 H;  1P84 H;  2A06 G;  3L70 G;  1SQQ G;  1SQB G;  1BGY G;  1NTM G;  2IBZ G;  1PPJ G;  1SQP G;  3L74 G;  3CX5 H;  1SQV G;  1KB9 H;  1PP9 G;  1NTK G;  3CWB G;  3H1H G;  3L75 G;  3L71 G;  5KLV G;  3L72 G;  1SQX G;  3H1L G;  1NTZ G;  3L73 G;  3CXH H;  4D6T G;  3TGU G;  3H1J G;  3H1I G;  3BCC G;  1L0N G;  1EZV G;  4U3F G;  1NU1 G;  1BCC G;  1BE3 G;  1KYO H;  1L0L G;  3H1K G; 
#chains in the Genus database with same CATH topology
 3CI9 A;  5AVR B;  2Q6Q A;  1LT1 A;  1ZXG A;  4BWN A;  1GL2 D;  1OMI A;  5KLV K;  3BCC J;  1MV8 A;  1OWA A;  3VMZ A;  5CCH A;  1Y9B A;  1GL2 B;  1SQV K;  1USD A;  3L70 D;  1LJ2 A;  2IBZ D;  3T97 B;  1VQ5 P;  3L75 D;  3M0D A;  2WZ7 A;  2B88 A;  2O1J A;  3IN6 A;  3SSU A;  3VTP C;  5TIS E;  2KS1 A;  4I7Z B;  4IL6 E;  4ZMD A;  3R2P A;  2KZI A;  4L73 A;  4Y99 C;  2O1K A;  1R8E A;  1BE3 J;  4D6T J;  2QSI A;  1DEE G;  3CWB D;  1SQB E;  2IDB A;  3GHG C;  1G2C A;  2E75 D;  1M7L A;  2D2C D;  1NKZ B;  3H1I E;  3OJA B;  2E75 B;  3M06 A;  1S4X A;  3WU2 H;  1RE4 A;  1LTB C;  5CCG C;  3VMX A;  3HE4 A;  2KB7 P;  3Q3D A;  3VOP A;  3H1H E;  5GTI E;  1GW4 A;  1JEK A;  5B5E H;  4JQ0 D;  3L73 E;  2KZJ A;  1MKM A;  1U57 A;  1BSH A;  2ZVN B;  1R5S A;  1SQQ D;  1GZL A;  3SWF A;  2H7H A;  1QEX A;  2R3C A;  1OW7 A;  3CXH D;  4DJG A;  1Q86 Q;  4RKU J;  1AJY A;  3F5H A;  3V2P A;  2P2U A;  3HUS C;  2RH0 A;  3RK2 C;  1SQP D;  3AE8 C;  1HJ0 A;  5CJ4 A;  4U7J A;  1EQ7 A;  2A45 I;  3W67 A;  2ZYD A;  1J1E B;  1NU1 K;  2OTK E;  3V2Q A;  3OAK A;  1OW6 A;  3VP8 A;  1EDI A;  1J2J B;  1LT9 A;  1S9K E;  3GHG B;  3CMA P;  3VMY A;  5CCG D;  2MKV A;  4WWI A;  1K05 A;  4HH2 A;  1U7M A;  4O9B A;  3H1L D;  4N78 D;  2FXP A;  4UB6 H;  2H88 C;  1NYH A;  1JOC A;  2XZR A;  1N2D C;  3G6E P;  4GIF A;  3M0A A;  4MN4 C;  3WMM 0;  3Q5R A;  4DCK A;  2Q7C A;  2Y0C A;  2KIK A;  2WPQ A;  3C9I A;  2K37 A;  3L71 E;  1S5L H;  2IPP A;  1URQ A;  3KXD A;  1DIP A;  3U1C A;  3L72 E;  4EDF A;  4U3F D;  3CCR P;  5BU8 B;  1SQX D;  2HOD B;  2YIU C;  2WQY C;  2P67 A;  5APY A;  2LXC B;  1YTZ T;  1SQB G;  2B87 B;  2OYI C;  1RQU A;  3MZW B;  2L5G B;  2JDI H;  2NRG A;  1EZV E;  2RMZ A;  4NPE A;  1HGV A;  3H1I G;  3AE1 C;  3SWK A;  1YIT P;  1FU1 A;  2I1J A;  3MUD C;  1RH5 B;  5KLV E;  4I2L C;  1SQV E;  4N3Y B;  1W2B O;  4RO0 A;  2I1K A;  1L4A A;  4R4M A;  2OTJ P;  1J1D B;  3H1H G;  1SS1 A;  4XE5 B;  1VQK P;  1CZQ A;  1LTS C;  3CD6 P;  1JO5 A;  5EFW B;  1BE3 D;  3L73 G;  4D6T D;  2MJZ A;  2POH A;  1IK7 A;  1Q7Y Q;  3M9Q A;  4PD4 I;  4OWF A;  1RE3 C;  1JY2 P;  1FJK A;  3RL0 C;  3VMA A;  3CME P;  5TJH A;  1E79 H;  2WIT A;  3S4R A;  2H43 A;  2AXC A;  2YKP A;  2W6A A;  1A02 F;  1LWU C;  2OYH A;  1RF1 C;  1ZR4 A;  3JCU H;  3II6 A;  2N1T A;  1RE4 C;  2KOG A;  1S5L X;  5AW4 B;  2P58 A;  1VQM P;  3BAS A;  2ZYG A;  2GA1 A;  3I55 P;  2BAS A;  3W68 A;  1IFJ A;  2YIU B;  1T6A A;  2OTL P;  1HGZ A;  1Q90 D;  2HYN A;  5CHX A;  5CMZ A;  1N7S C;  2WPS A;  2L91 A;  5CCH D;  1VQ4 P;  5H2F E;  2IBZ I;  2GUS A;  2OYI B;  3IR9 A;  2M0B A;  1PP9 E;  3M9B A;  3BVH A;  1AV1 A;  5AVV B;  3MTU E;  4NPD A;  3B5N A;  2VRS A;  1VDF A;  3A2A A;  2KUB A;  1NTK K;  1M1K Q;  1SFC C;  5M1B A;  1SQB J;  1KQG B;  1D7M A;  1T3U A;  1BCC G;  1H8A A;  2M8R A;  1LTT C;  4I6M C;  3IFM A;  4H0L C;  1IFM A;  3RL0 D;  3L71 G;  3H1I J;  4L75 A;  2WSS H;  3L72 G;  1AQT A;  3U1A A;  1L0N E;  1LT9 C;  2Y9Z A;  1KOR A;  1G2C B;  1LTI C;  2A06 E;  3H1H J;  2FYU G;  3P8M C;  3N7N A;  3LW5 H;  1PPJ G;  3L73 J;  3HE4 B;  1VL2 A;  1UIX A;  3WU2 E;  2OGU A;  3CL3 D;  3D6Y A;  1ZV8 A;  5AW9 B;  1EZV G;  5AW1 B;  1Y47 A;  1KFM A;  1N7S D;  1NTZ K;  3MIW A;  5KLV G;  5B5E E;  3GW6 A;  2NPS A;  2OAR A;  1CI6 B;  3JSV C;  3FXD A;  3GHG A;  1PGQ A;  2LKM A;  1URQ C;  1SQV G;  3CXH I;  1RY3 A;  1NAY A;  2LXB A;  1PL5 A;  2V7Q J;  1NKN A;  4EI2 A;  4TT3 H;  4JF7 A;  5CCG A;  1BGY D;  2CPS A;  1P84 H;  5AW5 B;  5BU5 A;  4JBZ A;  1NH4 A;  3HTK A;  1L0L K;  1KC8 Q;  4H0L D;  1ZW0 A;  4H0L B;  1KB9 D;  5DJU B;  4BXL A;  1ZRT D;  2WSE H;  1IK9 A;  1VQ8 P;  1LT9 B;  3KYQ A;  1QL2 A;  3U59 A;  4OGQ C;  2FYZ A;  1KYO D;  1JMB A;  3HUS A;  1UII A;  3A0B H;  1MUU A;  3PRJ A;  2IX7 C;  3L71 J;  1OZH A;  5KAF E;  1X79 B;  3L36 A;  3L72 J;  4M3L A;  1FS0 E;  3V4Q A;  5APQ A;  3WUT A;  1URQ D;  4C46 A;  2K88 A;  2OYH C;  1SVF A;  3ITK A;  1ZLL A;  1URQ B;  2WSE J;  1S5L E;  3TK1 A;  3TSI A;  1YTZ I;  2BEZ F;  5APW A;  1RHZ B;  2M3B A;  2Q1K A;  1SQQ K;  4DOJ A;  5KLV J;  1AVO A;  2JP3 A;  4AQR D;  3S1K A;  1NU1 G;  1SQV J;  3G3Z A;  3L74 E;  1PGJ A;  2Q9I A;  1JUN A;  5L8R J;  1KQF B;  3D70 A;  2WT7 A;  3B5N C;  1IJD B;  1L4A D;  3P8C E;  4YTP C;  1NVO A;  3TGU G;  1SQB D;  1L4A B;  2E5Y A;  1KN7 A;  5AW0 B;  5H2F H;  5KKZ C;  4HB1 A;  5KTB A;  2W6J H;  2OYI A;  4I1L A;  2B9B A;  1M1J A;  4GT1 A;  1R5L A;  4W80 A;  4Y28 J;  1CSB A;  3MUD A;  1S1C X;  3CX5 D;  1N73 A;  3H1H D;  2FBW C;  3MGN A;  2N1T D;  4GOD A;  3IAO A;  2OYH B;  3KDP B;  3L73 D;  2N1T B;  1Z56 A;  3WUV A;  3AEF C;  3JCU E;  3V2N A;  2QE7 H;  1TU3 F;  1JTH A;  2WSC H;  3VN0 A;  1VQN P;  1RE3 A;  5CBN A;  2CK3 H;  1PP9 J;  1IFI A;  2WPR A;  3RK3 E;  2NPS C;  4TLF A;  3PJS K;  5AVT B;  1NTZ E;  1HTL C;  3H1J E;  1LWU A;  1RF1 A;  1DH3 A;  2D2C B;  5E79 E;  3B5N D;  2C0W A;  3CCS P;  4QMA A;  5KLI B;  3N4X A;  2DW3 A;  3VP9 A;  2Y0E A;  5AVS B;  3B5N B;  2ZT9 C;  3CC4 P;  1NAF A;  1SP4 A;  3Q2Y A;  2WSC J;  2A45 G;  1S9K D;  1KD1 Q;  1L0N J;  1NU1 J;  1CI6 A;  3V6I A;  1N7S A;  1L0L E;  1FBM A;  3CCE P;  4EOT A;  2XV5 A;  2IBZ E;  1M8O B;  2HG5 D;  1YQ3 C;  1T2K C;  2JWA A;  1QVF O;  4BRY B;  4ZNC A;  1NTM K;  2WVR A;  3FGA D;  1OVR A;  1SFC A;  2BCC E;  3P32 A;  3L71 D;  3AE6 C;  3AE4 C;  3L72 D;  4Y99 B;  3AE9 C;  3L74 G;  1FZA A;  2W27 A;  2QG4 A;  1KQL A;  4K3A A;  5APU A;  2NPS D;  3B8E B;  1JY3 P;  2P10 A;  2NPS B;  5CBO A;  3NMD A;  4GKG A;  5APS A;  2YMK A;  3GF7 A;  3A0H E;  4EYY Q;  2NZ2 A;  1NTK G;  5KAF H;  3ABV C;  3V2R A;  1EZV D;  1KIL C;  2A45 H;  2K1A A;  5KLV D;  2HFE D;  2AEJ A;  1QGK B;  1BCC E;  3H1K E;  1HBW A;  1P84 E;  3HTK B;  1KB9 I;  4HKZ H;  2KP8 A;  1T2K D;  3CPW O;  2W83 C;  3BRT B;  1VF5 C;  1KYO I;  1EXJ A;  2QJK C;  3USS A;  4LGD E;  2PFX A;  1A02 J;  2FYU E;  1MFZ A;  5AVQ B;  3RK2 D;  1PPJ E;  4W7Y A;  3HUS B;  1YI2 P;  3AED C;  4L76 A;  3RK2 B;  1S72 P;  3QH9 A;  3BCC D;  1HH0 A;  4WB4 A;  1VQ9 P;  1T8Z A;  1NTZ G;  3RBZ A;  3A0B E;  4HYT B;  1M1J C;  2K9J B;  3H1J G;  2YKQ A;  2FY8 A;  3G4S P;  1N73 C;  1M56 D;  3WUU A;  2JR8 A;  4N78 E;  1JCD A;  1KQS O;  3RGU A;  1GK4 A;  2KNC A;  2PRR A;  3M9H A;  5KAI H;  4EIJ A;  3NXS A;  2Z5H A;  1XTC C;  3L74 J;  1PP9 D;  4WY4 A;  1L0L G;  3OA7 A;  1MZ9 A;  1ZME C;  2IBZ G;  4C7N A;  4YXD C;  3L75 G;  2PGD A;  1VQ6 P;  1FE6 A;  2JKV A;  2Z4E A;  1GTW A;  2WPV B;  4H13 C;  4N6J A;  2QM7 A;  1FZB A;  1VF5 D;  2UWJ E;  2N9Y B;  2WT7 B;  2Q3E A;  2BCC G;  1VF5 B;  2G8Y A;  4PD4 H;  2QJK B;  5APT A;  1NGM B;  2O01 H;  5C39 A;  1AA0 A;  4DZO A;  1L0N D;  1LTA C;  2AXT E;  2FKW B;  1FZF A;  2IZ1 A;  5AW3 B;  3MD0 A;  2A06 D;  3CX5 I;  1KIL E;  5E79 H;  2Z5I A;  1DD3 A;  5CJ0 A;  3AEG C;  1M1J B;  1JY3 O;  1YJN P;  2R32 A;  1N73 B;  2KK7 A;  1IFN A;  1PZQ A;  1KZU B;  3EWK A;  2O01 J;  1NTM E;  1KFN A;  1Q2N A;  3H1K G;  2Y0D A;  2ZJS E;  1JTH B;  1SQQ G;  2E76 C;  1NTZ J;  2FFD C;  3TYY A;  3H1J J;  1GW3 A;  1K9M Q;  3PLN A;  3RL0 B;  3GLM A;  1NU1 E;  4BRY A;  1GU4 A;  4H13 D;  1JY3 N;  3Q5S A;  1LWU B;  1RF1 B;  4H13 B;  2E74 C;  5K5G B;  1HF9 A;  1IO4 A;  5AW7 B;  4WBA A;  3TGU E;  2KI7 B;  1L0L J;  4ASV A;  1S2E A;  3L75 J;  1X9V A;  5BVZ A;  3K5B A;  3C8V A;  1N7S B;  3A0H H;  2B89 A;  3CCM P;  2KSE A;  3H1L G;  1VPC A;  3TF5 A;  3KQG A;  1H88 A;  2BCC J;  3Q5P A;  3LW5 J;  4ZKP A;  2M3E A;  1SFC D;  1N8R Q;  2J59 M;  1SFC B;  2QJP C;  2ZXX A;  3M91 A;  3CXH H;  1JY2 O;  1M57 D;  1GD2 E;  2QJY C;  3FX0 A;  2YMY A;  4K35 A;  2HLO A;  2HR3 A;  1EZV I;  3H32 B;  1IC2 A;  2XDJ A;  3R4Y A;  4RJT A;  3RK3 C;  3V5B A;  1BCC J;  1QX8 A;  2YXQ B;  3H1K J;  3L74 D;  4RES B;  1PFI A;  1SQQ J;  3S9O A;  2WMM A;  4R4L A;  4WY4 C;  1BDD A;  1EXI A;  3CC7 P;  3GMA A;  4GOF A;  2K9J A;  1YBK A;  2JWD A;  3P8C D;  4JYC A;  1JY2 N;  1AQ5 A;  1FZG A;  2FYU J;  3LID A;  1CW5 A;  1BGY E;  1KV4 A;  1GL2 C;  5APV A;  1NTM G;  5KJ7 C;  4KJM A;  1KIL A;  4ZKU A;  2P1J A;  4PJ0 H;  1KMI Z;  2KLV A;  4I7Z C;  1G1I A;  2C9N Y;  4L74 A;  2Y9Y A;  1KB9 E;  3G71 P;  2HPC A;  1H89 A;  1ZN5 A;  4LC1 A;  3PH0 A;  1KTM A;  5AW8 B;  3PTZ A;  2W8Z A;  2YXR B;  1SQP K;  4OGQ D;  2AXT H;  1NHL A;  3IF4 A;  3RK3 D;  4OGQ B;  2E75 C;  3CCJ P;  1FAV A;  5APX A;  1NTK E;  2KNC B;  3RK3 B;  1YQ4 C;  2PP6 A;  4WY4 D;  3H1J D;  1L2P A;  3H1I D;  2KXP B;  3ZDM A;  4YXW H;  2SPZ A;  1QVG O;  4WY4 B;  5KAI E;  2LR2 A;  4YPC A;  4C7N B;  3CC2 P;  2WTY A;  3RL0 g;  3O6Q A;  3PHL A;  1RQV A;  1RF0 A;  1K8A Q;  2E42 A;  4B86 A;  2IFM A;  2QIW A;  2BEQ D;  1NWQ A;  3A5T A;  1L0L D;  5KJ7 D;  4IFD K;  2ZYA A;  1OX3 A;  4PD4 E;  5B66 H;  3I5C A;  2YO3 A;  2GUV A;  1SQX K;  1XTG B;  5AVW B;  2W90 A;  1IFD A;  3HE5 B;  3OW2 O;  2BCC D;  2R44 A;  2H89 C;  3KZI E;  1J1E C;  3EQ2 A;  3L4F A;  1NTM J;  1FDM A;  4A7P A;  4WVZ A;  3TNU A;  2JO1 A;  1T3J A;  2ZXE B;  1Q82 Q;  5KKZ B;  1OVV A;  2V4H A;  3FWN A;  3L70 E;  3CX5 E;  1WRG A;  1PGP A;  3AE3 C;  3L75 E;  3QWO C;  4JYB A;  1BGY G;  2XKM A;  4IFF A;  1FOS F;  3TGU J;  1YYC A;  4C7R A;  1HUC A;  1BCC D;  3H1K D;  1P84 D;  4Z1M H;  4UB8 E;  3CWB E;  3LIE A;  1K73 Q;  1GU5 A;  1LTG C;  2ZAE B;  3VYI A;  2R5D A;  2FFD A;  3B71 A;  1EDK A;  2C9L Y;  1X22 A;  2ZVO B;  2FYU D;  2FXO A;  2RKL A;  1PPJ D;  3HD7 C;  3H32 A;  1Y8A A;  1L0N K;  2GM4 A;  3Q1M A;  3O8Z A;  1GK6 A;  1ZOY C;  1VQO P;  2QEX P;  2ZT9 D;  2RN0 A;  1HJB A;  4KT0 J;  1H0T B;  2XNX A;  1LP1 A;  2ZT9 B;  1J1D C;  3P7K A;  4GOE A;  1SQV D;  1SQQ E;  3FWL A;  5AVU B;  1OW8 A;  3CXH E;  2IZ0 A;  2QM8 A;  3AEC C;  1JMM A;  4ASW A;  5AVX B;  3B4S A;  3CCU P;  1G1J A;  2M5A B;  1JM0 A;  1SQP E;  3AEE C;  1EDJ A;  1OIP A;  1LNQ A;  1KB9 H;  2QRX A;  3A3Y B;  3MP7 B;  3C1L A;  3SWY A;  2QVA A;  3NTN A;  5AVY B;  1FZC A;  1X8Y A;  3L37 A;  1U7J A;  1BGY J;  1KYO H;  1RF0 C;  3AEB C;  3HD7 D;  1OVU A;  1N7L A;  1VQL P;  3GF3 A;  3H1L E;  3HD7 B;  1LTJ A;  3D6Z A;  3TDK A;  5CCH C;  1QL1 A;  5GTH H;  3AE5 C;  1KIL D;  3EFF K;  1FDI A;  4W7Z A;  1JB0 J;  4LLH A;  1KIL B;  3M0D C;  4DT0 A;  1EC5 A;  3L70 G;  3EFG A;  2K9Y A;  1Q81 Q;  1DEB A;  2Q3I A;  4PJ0 E;  4NPF X;  4U3F E;  2HPC B;  1W2E A;  3HRN A;  2IYO A;  3H25 A;  1HVV A;  2CPB A;  1SQX E;  1NTM D;  2I8D A;  2FXM A;  2G3A A;  1K04 A;  1NOH A;  1NTK J;  1GL2 A;  3E1R A;  2IFN A;  3CWB G;  3T97 A;  5KJ7 A;  1FJP A;  5TIS H;  4IL6 H;  3BCC E;  1NU1 D;  5AVZ B;  4XFJ A;  1FOS E;  2FYN C;  2E5T A;  3KZI H;  5AW2 B;  3HE5 A;  2O01 N;  3SFE C;  2R5B A;  2Q5U A;  4IFM A;  3TGU D;  3O6Q B;  1E5W A;  1IZN B;  3GG2 A;  3AE2 C;  2AEF A;  1FC2 C;  2J58 A;  1BE3 E;  4D6T E;  1YHQ P;  2IYP A;  2WWW A;  4AYC A;  1OFC X;  3G9R A;  3CX5 H;  5GTI H;  4AUW A;  2XND H;  3SFD C;  3CCV P;  3V4W A;  5B66 E;  2KS1 B;  3CCQ P;  3BAT A;  2PAJ A;  1M90 Q;  1SQP G;  3F89 A;  4UB8 H;  3H6P A;  4H44 C;  3PP5 A;  1N86 A;  3FXE A;  3TNU B;  2AEM A;  2V7Q H;  2JJL A;  4CPG A;  4HJG H;  3L70 J;  3JC2 2;  2ITA A;  2ZFC A;  2W6B A;  1USE A;  4JPZ B;  4IL6 X;  2FYN B;  2JEE A;  1FDO A;  2R3S A;  1GMJ A;  1SQB K;  1PIX A;  2YO2 A;  1LGH B;  4OVN F;  1PV3 A;  1P84 I;  3UIA A;  3KPE A;  1H0T A;  1WT6 A;  1BSN A;  3D71 A;  3CWB J;  4PV1 C;  2QA4 P;  2J5U A;  1JNM A;  2E76 D;  1OXZ A;  1YJW P;  3CCL P;  3MHV A;  2E76 B;  2FFD B;  4U3F G;  1AVY A;  1ZR2 A;  1FZC C;  1SQX G;  1ZP0 C;  2OQQ A;  4XA4 A;  1DX7 A;  4IOI H;  2YNY A;  1YIJ P;  2E74 D;  2KYV A;  1LTJ C;  2M5A A;  2O3J A;  4H44 D;  2E74 B;  3BCC G;  2KSJ A;  3BRV B;  4H44 B;  2P7J A;  1QLE D;  2K3R A;  1LP1 B;  2HOD A;  2C0X A;  2WSF H;  3RBX A;  1L4A C;  3I56 P;  1W5C E;  2N9B A;  5AW6 B;  2B87 A;  1SQP J;  1BE3 G;  1NTK D;  3AEA C;  3HD7 A;  4D6T G;  4UB6 E;  2XU6 A;  3CLQ A;  2YKO A;  1PP9 G;  4PV1 D;  1VQP P;  1JCC A;  2OYO A;  1HWT C;  4PV1 B;  3E7K A;  2N1T C;  1NJI Q;  3A7O A;  2WSF J;  4OH8 B;  2QJP B;  1FZE A;  4KHX A;  3AE7 C;  3L35 A;  2E43 A;  1PGO A;  1NO4 A;  1ZRT E;  3H1L J;  1FZC B;  4GDO A;  2H8P D;  2QJY B;  2KLU A;  1MFT A;  4PD4 D;  1KYO E;  1L0N G;  1SLQ A;  1S3J A;  1IFP A;  1VQ7 P;  1GDT A;  3NFQ A;  1LTJ B;  1WMK A;  2D2C C;  1EDL A;  2A06 G;  1BDC A;  3E1I A;  1NTZ D;  1DD4 A;  5KLI C;  1YJ9 P;  2FYU K;  5GTH E;  4U3F J;  1AFO A;  1SQX J;  5DJT B;  1X0T A;  3KHU A; 
#chains in the Genus database with same CATH homology
 2FYU G;  2BCC G;  4PD4 H;  1P84 H;  2A06 G;  3L70 G;  1SQQ G;  1SQB G;  1BGY G;  1NTM G;  2IBZ G;  1PPJ G;  1SQP G;  3L74 G;  3CX5 H;  1SQV G;  1KB9 H;  1PP9 G;  1NTK G;  3CWB G;  3H1H G;  3L75 G;  3L71 G;  5KLV G;  3L72 G;  1SQX G;  3H1L G;  1NTZ G;  3L73 G;  3CXH H;  4D6T G;  3TGU G;  3H1J G;  3H1I G;  3BCC G;  1L0N G;  1EZV G;  4U3F G;  1NU1 G;  1BCC G;  1BE3 G;  1KYO H;  1L0L G;  3H1K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...