2BCCG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2bccG00
1SQVG 1NTMG 1PPJG 3BCCG 3CXHH 1BE3G 3H1JG 2BCCG 1L0LG 1NU1G 1PP9G 2A06G 1BGYG 1NTKG 1SQBG 2IBZG 1BCCG 3L71G 4D6TG 1L0NG 3L70G 3L74G 4PD4H 1SQQG 4U3FG 3CX5H 1KYOH 3CWBG 3H1HG 3H1LG 1SQXG 1SQPG 2FYUG 3TGUG 1EZVG 5KLVG 3L75G 3H1KG 1KB9H 3H1IG 1P84H 3L73G 1NTZG 3L72G
chains in the Genus database with same CATH superfamily
1GL2C 2QIWA 4GIFA 1ZN5A 3B4SA 1SFCC 3I55P 1ZRTE 1J1DB 1QLED 1VPCA 2WPSA 1JTHA 2R44A 2B9BA 1IFNA 1NTKD 2UWJE 2WSCJ 3BCCG 3KYQA 4B86A 1X22A 1S9KD 1KB9E 1KB9D 1FAVA 2I1KA 1VQ6P 2XNDH 4U3FD 3SSUA 1LT9B 1T3JA 3R2PA 1MKMA 1BSHA 1OVVA 3D6YA 3L75E 1ZRTD 2IBZG 1R5SA 2K3RA 4LLHA 3V4WA 2OQQA 3CCUP 1L0NG 4PD4H 4W7YA 1KQSO 1FZGA 3Q5RA 1VQNP 1VQ9P 3O6QA 3B5NA 2QG4A 2O3JA 5BU8B 5CCGC 1RE4A 2OTKE 3AE6C 2B87B 4N3YB 1N7SB 3L72J 1SQQE 2W6AA 4PV1C 1JY2N 1YHQP 3HE4A 5CHXA 1T2KD 1GU4A 3CC7P 2CK3H 1NYHA 1HGZA 1P84H 2K88A 2R3SA 3H1IE 3KQGA 5KJ7D 3L72G 3TSIA 1U7JA 2FXPA 2JO1A 3AE9C 2N1TD 1QGKB 3BCCJ 1YTZT 3H1KD 1SQXK 2IBZD 1USDA 2J58A 2Y0EA 3HTKA 4PD4D 2BASA 1G2CB 1L2PA 2AEJA 2DW3A 3HD7B 1YQ4C 4I7ZB 1FZBA 2GUVA 3G6EP 2Y9ZA 1AQ5A 1L0NJ 1AJYA 2JDIH 3A0HH 1QVFO 3L71G 3CWBD 5APUA 1VF5D 3L35A 1BE3D 1FDOA 1SLQA 4TLFA 1KQLA 3SFEC 3W68A 1LWUC 5AW8B 1VL2A 5CJ4A 1HJBA 2Q9IA 1SQVK 2KS1A 2HLOA 4LGDE 1URQC 3AEGC 2QSIA 3P8MC 1G1IA 1JNMA 4C7NA 1RE3A 2NZ2A 5AVSB 2E75D 2A06E 2M5AA 1DEBA 5DJUB 1NWQA 3GHGC 3D70A 3T97B 2OYHA 1NTKJ 3H1KG 2Z5HA 4BWNA 1GDTA 1W2BO 1M7LA 3MGNA 1DD3A 1SQPJ 2P7JA 2M3EA 3MHVA 4Y99B 4C46A 1VQKP 1NTMJ 2M8RA 1EDJA 1ZP0C 3JSVC 2A45I 1N7SD 1IZNB 1FJPA 1BE3G 3G9RA 3BRVB 1HF9A 1FE6A 2LXBA 2Z5IA 4Z1MH 1BCCG 3CC4P 1BCCE 3MUDC 1X79B 3MZWB 2QA4P 2MJZA 3CCEP 3AE1C 1R5LA 3BRTB 1Y8AA 1L0LD 1S5LE 2IPPA 3LW5J 1KILE 3HUSA 2IBZI 1OW6A 2WVRA 1YYCA 1NTMK 3JC22 4PD4I 2Q5UA 1J1EC 3VP9A 3WUVA 1ZR4A 1AFOA 2W27A 2XV5A 2WQYC 3S4RA 4AYCA 4DZOA 3V2QA 3GHGB 3V2PA 3CC2P 1BDCA 1SFCB 3U1CA 1SP4A 1L0LE 5TISH 1FDIA 2QM8A 1LTTC 1KB9H 3P32A 1JEKA 1SQQK 2E76C 1H0TB 2Y9YA 2M5AB 3AE8C 1LT1A 1P84I 2YKQA 1EC5A 1NTMG 1LWUB 4WY4A 1VF5C 1E5WA 1RH5B 2B88A 2YKOA 1UIXA 3VP8A 1JMBA 4L73A 1URQB 5E79E 2KS1B 1EDKA 2AEFA 5APQA 1L0LG 1K9MQ 1BCCJ 1P84E 1FC2C 1LP1A 3OA7A 1BGYJ 2OTLP 1LP1B 4N78E 3B8EB 3N7NA 2ZT9D 5AW1B 3H1HJ 5L8RJ 3MD0A 1KORA 1OW7A 2KZJA 1T6AA 1OVUA 4AUWA 1EZVD 2KI7B 3AEEC 3CCRP 1QEXA 4OWFA 3OW2O 1LWUA 1SQVE 2P67A 2W6BA 3EFGA 4U3FE 3A0BE 3AEAC 3BASA 1NTMD 1NTKK 4H44D 4PJ0H 3I56P 3CCMP 5DJTB 5AVTB 3H1IG 1NTKE 1YJ9P 5AVQB 4DJGA 2JEEA 1RE3C 1LTJA 1SFCA 2PFXA 1OW8A 2YKPA 3M0AA 3HUSB 1QVGO 2ZFCA 1IFDA 5AW5B 4GKGA 4BRYA 1GW4A 4N6JA 3O8ZA 4IL6E 1VQ7P 3G3ZA 3RL0D 2V7QH 2YIUB 4D6TE 1GTWA 2HR3A 3B5ND 4WB4A 1KQFB 2FBWC 4LC1A 3PJSK 2FYUK 1KFNA 2A06G 2RKLA 1BGYG 3KXDA 4GOFA 4YXWH 2KZIA 2WT7A 3L70G 3L74G 5APVA 3TGUJ 3VMYA 3RK3B 4OH8B 2KSJA 5AVZB 4BRYB 2KUBA 4GOEA 1NGMB 1EXJA 3L75D 1EZVI 1LTJB 2G3AA 2XKMA 1AA0A 2IYPA 1ZXGA 3BCCE 1SQXG 3FWNA 4O9BA 3U1AA 3VOPA 4AQRD 1MUUA 1VQ8P 2KK7A 1PP9E 3PRJA 1FBMA 4IFDK 5CCHC 3H1IJ 1L4AC 3G71P 1WRGA 3D6ZA 5CBNA 1SQBK 4L76A 1LNQA 4UB6E 4I1LA 1CW5A 4I2LC 1FU1A 3SWYA 1G1JA 3SFDC 5CBOA 3VMAA 4C7NB 1IFMA 1PGJA 3VMZA 2YIUC 2AXTH 1M1KQ 3M0DC 2E42A 3L36A 2H7HA 4WVZA 2W8ZA 5H2FH 3AEFC 3CXHH 2WPRA 4D6TJ 5CCHD 5AVUB 1SQVD 5KKZC 1HBWA 4L75A 4W7ZA 2PGDA 4A7PA 5KAFH 5B5EE 2ITAA 2FKWB 1YJWP 3C8VA 1VQLP 3HTKB 3L75J 4IFFA 3V2RA 1ZR2A 1M1JB 3N4XA 4EYYQ 1BE3J 3RK3C 1M90Q 1H89A 5AW0B 4ZNCA 1P84D 2GM4A 2G8YA 2J5UA 1BDDA 1NKNA 2WSFJ 2FYNC 2YXRB 5AW4B 3VTPC 1NTZJ 2FXOA 3KZIE 3IN6A 5KLIC 1N7SA 1GD2E 2HODB 3L71E 2VRSA 3H1HE 3H1JE 4W80A 2R32A 3V4QA 1J1DC 3BATA 3H1JJ 3O6QB 2KOGA 1KILA 1NVOA 1RY3A 3HE5A 3LIEA 2K37A 1PPJG 1PV3A 2R5BA 4UB6H 2SPZA 5APXA 1HVVA 2KLVA 1LTJC 3Q5PA 2C9NY 1FOSF 3W67A 1LJ2A 5B5EH 2BCCG 1SQPK 2YO3A 3VMXA 4UB8H 1Q7YQ 1FJKA 3E1RA 3CXHE 2Q6QA 3H1LD 2ZYDA 4H13B 1QX8A 2OYIC 3A0BH 1SQQG 2H8PD 2IDBA 3RK3E 1KZUB 3RK2C 2E43A 3SWKA 4H44B 2NPSB 4NPDA 3CL3D 1PGPA 1SQPG 3HE5B 1VQMP 1HWTC 5APTA 4JQ0D 3Q3DA 1N73C 5K5GB 1SQBJ 3PLNA 1PPJD 1FZCA 3CX5E 2ZT9B 4KT0J 3F89A 3HRNA 3LW5H 4MN4C 5KTBA 1NJIQ 2W6JH 1FZAA 1VQPP 4L74A 2E74D 1N7LA 3U59A 3D71A 2P2UA 3Q2YA 2KNCB 2O1KA 2WZ7A 3GF3A 1NTZE 1JY3N 1URQD 4UB8E 4XFJA 2FXMA 4H0LC 3FWLA 2Q1KA 4OGQD 1R8EA 1OMIA 1USEA 1NU1J 2C0XA 2M3BA 2WMMA 3VN0A 4DT0A 4RJTA 5GTIH 1JUNA 1PIXA 1JOCA 3CI9A 3CCSP 4D6TG 5AVRB 1OFCX 3TGUE 1BE3E 1GMJA 4OVNF 1KYOH 3L37A 5KLVD 2JR8A 2WSSH 4H13D 3IFMA 3PP5A 2IZ0A 1ZMEC 1N73B 1S3JA 3WU2E 1Q2NA 1Y47A 2AXTE 4CPGA 2FFDC 1YTZI 1FOSE 4NPEA 3H1KE 2ZT9C 2B87A 2BCCJ 2K1AA 2KYVA 1X8YA 3M06A 1JB0J 1D7MA 2A45G 2FYUD 2AEMA 3RK2B 1KC8Q 4OGQB 1MFZA 2A45H 1JY3P 3GMAA 3AECC 2LKMA 4JBZA 1S2EA 1IK9A 3M9QA 1DD4A 2H88C 2NPSC 3RGUA 1RQUA 2PRRA 3QWOC 1SQVJ 1MV8A 1NU1E 1KILC 1PZQA 2HG5D 1NU1G 3EFFK 3GLMA 1JMMA 4HKZH 2IFMA 2O01N 2V4HA 3IAOA 4JYCA 3RL0C 4U7JA 2BEZF 4HB1A 3V5BA 3P8CE 1JY3O 1YJNP 1RF1B 1XTGB 4PV1B 3P7KA 2IX7C 3TYYA 2ZVNB 1KILB 3TGUD 4XA4A 5KAIE 1SQBD 3PH0A 3CWBG 1IK7A 3L73E 3RL0g 1HJ0A 5CCGA 4KHXA 4IL6X 3WU2H 3CCJP 2KP8A 2YMKA 3EWKA 2FFDB 3V2NA 2H43A 1L4AA 2WSEH 2O01H 2Y0CA 3HD7C 5KLVE 5AVYB 1JM0A 1HUCA 1LTAC 4IOIH 3P8CD 4R4MA 3ITKA 2HYNA 1YITP 1HH0A 1IFIA 1VF5B 2XNXA 4N78D 4XE5B 1K04A 3M0DA 1BGYD 1M1JA 2GA1A 1M57D 1PPJE 2E5TA 2O01J 1LTGC 3MIWA 3HD7D 3L70D 3L74D 2M0BA 1NH4A 4GT1A 3II6A 4HJGH 1PP9G 1X0TA 1FS0E 4U3FJ 3TK1A 5KLVJ 2V7QJ 2YMYA 3L4FA 3A3YB 1DH3A 2GUSA 2QJPC 1EXIA 2RH0A 1Q82Q 3CWBJ 2RMZA 2QJKB 2R5DA 3RK3D 1IFPA 2JJLA 1K8AQ 1URQA 2FYNB 3LIDA 3H1LG 2BEQD 1KYOI 4KJMA 3CXHD 5AVWB 1FZCB 1LTIC 1Q81Q 1K73Q 2OYIA 5GTIE 3JCUH 2P58A 2QJKC 1U7MA 4DCKA 2FYZA 4IL6H 2J59M 1GZLA 2N1TB 2QJYB 1KQGB 1EQ7A 4WBAA 5EFWB 5AVXB 1OVRA 1SQPD 2NPSA 2OYHC 2HFED 1JY2P 3KZIH 2FY8A 1HGVA 1SVFA 1S9KE 2K9JB 1KN7A 1PL5A 2KB7P 2WT7B 1AQTA 4I6MC 2Q7CA 1S4XA 5APYA 3TF5A 1KYOE 3KDPB 1NAFA 2BCCE 1VDFA 5B66E 5BU5A 4ZMDA 2WITA 3GW6A 1AVOA 1LTSC 3MTUE 3AE7C 5KJ7C 1AV1A 1SQXJ 1AVYA 3H1LJ 1EDLA 3HUSC 4RKUJ 3AE4C 3MP7B 4WY4D 3CCVP 5AVVB 5AW7B 1LTBC 2JWAA 2KSEA 1A02J 3H1HG 4NPFX 2K9YA 2HPCA 3NFQA 1KYOD 2NRGA 3ZDMA 1NOHA 2HODA 4OGQC 1GW3A 1PGQA 5KLVG 1GL2B 2WSFH 1QL1A 2C0WA 3M9HA 4JPZB 2OYHB 5AW2B 3RK2D 2LR2A 2Q3IA 1SQPE 5CMZA 4K3AA 2BCCD 3RBXA 1N86A 1GU5A 3CXHI 2L5GB 3TNUA 3E1IA 2WWWA 2IYOA 2D2CD 3L72E 5CCGD 2Z4EA 2OTJP 2ZJSE 5B66H 3USSA 1Z56A 1SFCD 4H0LB 5KLVK 2E74B 4I7ZC 4JYBA 1IC2A 1UIIA 4EI2A 1NTKG 3BCCD 1K05A 1MZ9A 3H1KJ 5CCHA 2XDJA 3TDKA 2N1TC 2QJYC 3TNUB 3CMEP 3WUUA 3AE2C 4PV1D 3CX5H 1IFJA 4U3FG 4WY4B 5C39A 4ASWA 1EDIA 1G2CA 1TU3F 2B89A 3A2AA 5TJHA 2P10A 3NMDA 1T2KC 3CCLP 1KTMA 2ZAEB 1L0NE 1WT6A 2CPBA 2RN0A 3L75G 3I5CA 1NU1K 4QMAA 1H88A 2E76B 1H0TA 3MUDA 2HPCB 1CSBA 1M8OB 1L4AB 3M9BA 1NAYA 1L0NK 2ZYAA 4HYTB 1HTLC 1XTCC 2O1JA 4H0LD 4PJ0E 2YNYA 2QEXP 3G4SP 1DEEG 3A0HE 1NKZB 4D6TD 3AEDC 2P1JA 1N2DC 1YBKA 1SQQJ 2PP6A 2E75B 1LT9C 3AEBC 3JCUE 4C7RA 5KLIB 2NPSD 1SQBE 1RF0A 1FZCC 2R3CA 2XZRA 4Y28J 2Q3EA 2QVAA 4IFMA 1OXZA 1RQVA 2ZVOB 3C9IA 3R4YA 1VQ4P 1NTZK 4RESB 1GL2D 1PP9D 1YI2P 4WY4C 2E75C 5M1BA 4YXDC 1LGHB 4EOTA 3WUTA 3B5NC 2K9JA 4K35A 4EIJA 1ZV8A 3L73D 1W2EA 2E74C 2FYUG 5KAIH 1U57A 3GF7A 1YQ3C 5BVZA 1GK6A 3CPWO 1EZVE 3A7OA 3RBZA 3KPEA 4EDFA 4H13C 2OGUA 3WMM0 5GTHE 1NTZG 2E5YA 2IFNA 2FYUE 3GG2A 2YXQB 3Q1MA 1RHZB 3M91A 1NU1D 2PAJA 3H25A 1M1JC 2QM7A 4WWIA 3OAKA 4ASVA 1L0ND 2YO2A 3F5HA 3VYIA 3AE5C 3CMAP 1H8AA 3L70J 3L74J 1JCDA 1PP9J 3L71J 1SQBG 2H89C 2WSCH 1VQOP 3E7KA 4BXLA 1KV4A 1J1EB 3PHLA 1SQXD 3ABVC 2JP3A 4JF7A 3V6IA 1NTME 5AW6B 5APSA 1BSNA 2OARA 2ZYGA 4ZKPA 1BCCD 1SS1A 1Q90D 1FZFA 1QL2A 1NTZD 2W83C 2CPSA 3FXDA 1CZQA 1GL2A 2KLUA 3L72D 1Y9BA 3SWFA 2WPVB 2FFDA 3C1LA 3GHGA 4DOJA 1MFTA 3HE4B 1NO4A 3IF4A 1S5LH 3B71A 3Q5SA 1OWAA 2N9YB 1SQVG 3CX5D 1W5CE 4Y99C 3NXSA 1KFMA 2WPQA 2LXCB 1ZW0A 1PGOA 5KKZB 1FZEA 1CI6B 2QRXA 2KIKA 3L71D 3B5NB 1RF1A 4H44C 3H1JG 3RL0B 1X9VA 5APWA 5TISE 1FDMA 2D2CC 2W90A 3QH9A 4YPCA 3UIAA 3CCQP 1DX7A 5KJ7A 3OJAB 1JY2O 2POHA 1NHLA 2OYOA 1S1CX 4RO0A 1JTHB 1LT9A 2AXCA 2WSEJ 3FX0A 4TT3H 2E76D 1OX3A 1OZHA 5AW3B 4GDOA 1Q86Q 1GK4A 5E79H 1CI6A 1S72P 3FGAD 2N1TA 2N9BA 3T97A 3NTNA 2WTYA 1WMKA 1KILD 1KB9I 1EZVG 1T3UA 1L0LK 3KHUA 4GODA 2KXPB 1N73A 2OYIB 1IJDB 1RF1C 1T8ZA 2IBZE 2IZ1A 3H32A 3EQ2A 3H1LE 4PD4E 1KMIZ 4R4LA 1SQXE 4ZKUA 1IO4A 2FYUJ 1L4AD 3H1JD 5CJ0A 1OIPA 3S1KA 3H6PA 5H2FE 2Y0DA 3H1ID 1N8RQ 3S9OA 3BVHA 1A02F 1ZOYC 1PFIA 1SQQD 2QE7H 2ZXEB 3CLQA 1N7SC 2JWDA 1JO5A 1L0LJ 3CD6P 5GTHH 1YIJP 2JKVA 2I8DA 3HD7A 4YTPC 3H1HD 2KNCA 1ZLLA 2ZXXA 3CX5I 4M3LA 5AW9B 1VQ5P 3IR9A 2A06D 1DIPA 1KD1Q 2XU6A 5KAFE 1RF0C 3AE3C 3PTZA 3FXEA 3L73J 4HH2A 2MKVA 3L74E 3L70E 2D2CB 3TGUG 1S5LX 1BGYE 1JCCA 2L91A 1J2JB 3A5TA 1M56D 2QJPB 3H32B 2I1JA 3CWBE 3L73G 2C9LY 3K5BA 1RE4C 1E79H
chains in the Genus database with same CATH topology
1SQVG 1NTMG 1PPJG 3BCCG 3CXHH 1BE3G 3H1JG 2BCCG 1L0LG 1NU1G 1PP9G 2A06G 1BGYG 1NTKG 1SQBG 2IBZG 1BCCG 3L71G 4D6TG 1L0NG 3L70G 3L74G 4PD4H 1SQQG 4U3FG 3CX5H 1KYOH 3CWBG 3H1HG 3H1LG 1SQXG 1SQPG 2FYUG 3TGUG 1EZVG 5KLVG 3L75G 3H1KG 1KB9H 3H1IG 1P84H 3L73G 1NTZG 3L72G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV G;  1NTM G;  1PPJ G;  3BCC G;  3CXH H;  1BE3 G;  3H1J G;  2BCC G;  1L0L G;  1NU1 G;  1PP9 G;  2A06 G;  1BGY G;  1NTK G;  1SQB G;  2IBZ G;  1BCC G;  3L71 G;  4D6T G;  1L0N G;  3L70 G;  3L74 G;  4PD4 H;  1SQQ G;  4U3F G;  3CX5 H;  1KYO H;  3CWB G;  3H1H G;  3H1L G;  1SQX G;  1SQP G;  2FYU G;  3TGU G;  1EZV G;  5KLV G;  3L75 G;  3H1K G;  1KB9 H;  3H1I G;  1P84 H;  3L73 G;  1NTZ G;  3L72 G; 
#chains in the Genus database with same CATH topology
 1GL2 C;  2QIW A;  4GIF A;  1ZN5 A;  3B4S A;  1SFC C;  3I55 P;  1ZRT E;  1J1D B;  1QLE D;  1VPC A;  2WPS A;  1JTH A;  2R44 A;  2B9B A;  1IFN A;  1NTK D;  2UWJ E;  2WSC J;  3BCC G;  3KYQ A;  4B86 A;  1X22 A;  1S9K D;  1KB9 E;  1KB9 D;  1FAV A;  2I1K A;  1VQ6 P;  2XND H;  4U3F D;  3SSU A;  1LT9 B;  1T3J A;  3R2P A;  1MKM A;  1BSH A;  1OVV A;  3D6Y A;  3L75 E;  1ZRT D;  2IBZ G;  1R5S A;  2K3R A;  4LLH A;  3V4W A;  2OQQ A;  3CCU P;  1L0N G;  4PD4 H;  4W7Y A;  1KQS O;  1FZG A;  3Q5R A;  1VQN P;  1VQ9 P;  3O6Q A;  3B5N A;  2QG4 A;  2O3J A;  5BU8 B;  5CCG C;  1RE4 A;  2OTK E;  3AE6 C;  2B87 B;  4N3Y B;  1N7S B;  3L72 J;  1SQQ E;  2W6A A;  4PV1 C;  1JY2 N;  1YHQ P;  3HE4 A;  5CHX A;  1T2K D;  1GU4 A;  3CC7 P;  2CK3 H;  1NYH A;  1HGZ A;  1P84 H;  2K88 A;  2R3S A;  3H1I E;  3KQG A;  5KJ7 D;  3L72 G;  3TSI A;  1U7J A;  2FXP A;  2JO1 A;  3AE9 C;  2N1T D;  1QGK B;  3BCC J;  1YTZ T;  3H1K D;  1SQX K;  2IBZ D;  1USD A;  2J58 A;  2Y0E A;  3HTK A;  4PD4 D;  2BAS A;  1G2C B;  1L2P A;  2AEJ A;  2DW3 A;  3HD7 B;  1YQ4 C;  4I7Z B;  1FZB A;  2GUV A;  3G6E P;  2Y9Z A;  1AQ5 A;  1L0N J;  1AJY A;  2JDI H;  3A0H H;  1QVF O;  3L71 G;  3CWB D;  5APU A;  1VF5 D;  3L35 A;  1BE3 D;  1FDO A;  1SLQ A;  4TLF A;  1KQL A;  3SFE C;  3W68 A;  1LWU C;  5AW8 B;  1VL2 A;  5CJ4 A;  1HJB A;  2Q9I A;  1SQV K;  2KS1 A;  2HLO A;  4LGD E;  1URQ C;  3AEG C;  2QSI A;  3P8M C;  1G1I A;  1JNM A;  4C7N A;  1RE3 A;  2NZ2 A;  5AVS B;  2E75 D;  2A06 E;  2M5A A;  1DEB A;  5DJU B;  1NWQ A;  3GHG C;  3D70 A;  3T97 B;  2OYH A;  1NTK J;  3H1K G;  2Z5H A;  4BWN A;  1GDT A;  1W2B O;  1M7L A;  3MGN A;  1DD3 A;  1SQP J;  2P7J A;  2M3E A;  3MHV A;  4Y99 B;  4C46 A;  1VQK P;  1NTM J;  2M8R A;  1EDJ A;  1ZP0 C;  3JSV C;  2A45 I;  1N7S D;  1IZN B;  1FJP A;  1BE3 G;  3G9R A;  3BRV B;  1HF9 A;  1FE6 A;  2LXB A;  2Z5I A;  4Z1M H;  1BCC G;  3CC4 P;  1BCC E;  3MUD C;  1X79 B;  3MZW B;  2QA4 P;  2MJZ A;  3CCE P;  3AE1 C;  1R5L A;  3BRT B;  1Y8A A;  1L0L D;  1S5L E;  2IPP A;  3LW5 J;  1KIL E;  3HUS A;  2IBZ I;  1OW6 A;  2WVR A;  1YYC A;  1NTM K;  3JC2 2;  4PD4 I;  2Q5U A;  1J1E C;  3VP9 A;  3WUV A;  1ZR4 A;  1AFO A;  2W27 A;  2XV5 A;  2WQY C;  3S4R A;  4AYC A;  4DZO A;  3V2Q A;  3GHG B;  3V2P A;  3CC2 P;  1BDC A;  1SFC B;  3U1C A;  1SP4 A;  1L0L E;  5TIS H;  1FDI A;  2QM8 A;  1LTT C;  1KB9 H;  3P32 A;  1JEK A;  1SQQ K;  2E76 C;  1H0T B;  2Y9Y A;  2M5A B;  3AE8 C;  1LT1 A;  1P84 I;  2YKQ A;  1EC5 A;  1NTM G;  1LWU B;  4WY4 A;  1VF5 C;  1E5W A;  1RH5 B;  2B88 A;  2YKO A;  1UIX A;  3VP8 A;  1JMB A;  4L73 A;  1URQ B;  5E79 E;  2KS1 B;  1EDK A;  2AEF A;  5APQ A;  1L0L G;  1K9M Q;  1BCC J;  1P84 E;  1FC2 C;  1LP1 A;  3OA7 A;  1BGY J;  2OTL P;  1LP1 B;  4N78 E;  3B8E B;  3N7N A;  2ZT9 D;  5AW1 B;  3H1H J;  5L8R J;  3MD0 A;  1KOR A;  1OW7 A;  2KZJ A;  1T6A A;  1OVU A;  4AUW A;  1EZV D;  2KI7 B;  3AEE C;  3CCR P;  1QEX A;  4OWF A;  3OW2 O;  1LWU A;  1SQV E;  2P67 A;  2W6B A;  3EFG A;  4U3F E;  3A0B E;  3AEA C;  3BAS A;  1NTM D;  1NTK K;  4H44 D;  4PJ0 H;  3I56 P;  3CCM P;  5DJT B;  5AVT B;  3H1I G;  1NTK E;  1YJ9 P;  5AVQ B;  4DJG A;  2JEE A;  1RE3 C;  1LTJ A;  1SFC A;  2PFX A;  1OW8 A;  2YKP A;  3M0A A;  3HUS B;  1QVG O;  2ZFC A;  1IFD A;  5AW5 B;  4GKG A;  4BRY A;  1GW4 A;  4N6J A;  3O8Z A;  4IL6 E;  1VQ7 P;  3G3Z A;  3RL0 D;  2V7Q H;  2YIU B;  4D6T E;  1GTW A;  2HR3 A;  3B5N D;  4WB4 A;  1KQF B;  2FBW C;  4LC1 A;  3PJS K;  2FYU K;  1KFN A;  2A06 G;  2RKL A;  1BGY G;  3KXD A;  4GOF A;  4YXW H;  2KZI A;  2WT7 A;  3L70 G;  3L74 G;  5APV A;  3TGU J;  3VMY A;  3RK3 B;  4OH8 B;  2KSJ A;  5AVZ B;  4BRY B;  2KUB A;  4GOE A;  1NGM B;  1EXJ A;  3L75 D;  1EZV I;  1LTJ B;  2G3A A;  2XKM A;  1AA0 A;  2IYP A;  1ZXG A;  3BCC E;  1SQX G;  3FWN A;  4O9B A;  3U1A A;  3VOP A;  4AQR D;  1MUU A;  1VQ8 P;  2KK7 A;  1PP9 E;  3PRJ A;  1FBM A;  4IFD K;  5CCH C;  3H1I J;  1L4A C;  3G71 P;  1WRG A;  3D6Z A;  5CBN A;  1SQB K;  4L76 A;  1LNQ A;  4UB6 E;  4I1L A;  1CW5 A;  4I2L C;  1FU1 A;  3SWY A;  1G1J A;  3SFD C;  5CBO A;  3VMA A;  4C7N B;  1IFM A;  1PGJ A;  3VMZ A;  2YIU C;  2AXT H;  1M1K Q;  3M0D C;  2E42 A;  3L36 A;  2H7H A;  4WVZ A;  2W8Z A;  5H2F H;  3AEF C;  3CXH H;  2WPR A;  4D6T J;  5CCH D;  5AVU B;  1SQV D;  5KKZ C;  1HBW A;  4L75 A;  4W7Z A;  2PGD A;  4A7P A;  5KAF H;  5B5E E;  2ITA A;  2FKW B;  1YJW P;  3C8V A;  1VQL P;  3HTK B;  3L75 J;  4IFF A;  3V2R A;  1ZR2 A;  1M1J B;  3N4X A;  4EYY Q;  1BE3 J;  3RK3 C;  1M90 Q;  1H89 A;  5AW0 B;  4ZNC A;  1P84 D;  2GM4 A;  2G8Y A;  2J5U A;  1BDD A;  1NKN A;  2WSF J;  2FYN C;  2YXR B;  5AW4 B;  3VTP C;  1NTZ J;  2FXO A;  3KZI E;  3IN6 A;  5KLI C;  1N7S A;  1GD2 E;  2HOD B;  3L71 E;  2VRS A;  3H1H E;  3H1J E;  4W80 A;  2R32 A;  3V4Q A;  1J1D C;  3BAT A;  3H1J J;  3O6Q B;  2KOG A;  1KIL A;  1NVO A;  1RY3 A;  3HE5 A;  3LIE A;  2K37 A;  1PPJ G;  1PV3 A;  2R5B A;  4UB6 H;  2SPZ A;  5APX A;  1HVV A;  2KLV A;  1LTJ C;  3Q5P A;  2C9N Y;  1FOS F;  3W67 A;  1LJ2 A;  5B5E H;  2BCC G;  1SQP K;  2YO3 A;  3VMX A;  4UB8 H;  1Q7Y Q;  1FJK A;  3E1R A;  3CXH E;  2Q6Q A;  3H1L D;  2ZYD A;  4H13 B;  1QX8 A;  2OYI C;  3A0B H;  1SQQ G;  2H8P D;  2IDB A;  3RK3 E;  1KZU B;  3RK2 C;  2E43 A;  3SWK A;  4H44 B;  2NPS B;  4NPD A;  3CL3 D;  1PGP A;  1SQP G;  3HE5 B;  1VQM P;  1HWT C;  5APT A;  4JQ0 D;  3Q3D A;  1N73 C;  5K5G B;  1SQB J;  3PLN A;  1PPJ D;  1FZC A;  3CX5 E;  2ZT9 B;  4KT0 J;  3F89 A;  3HRN A;  3LW5 H;  4MN4 C;  5KTB A;  1NJI Q;  2W6J H;  1FZA A;  1VQP P;  4L74 A;  2E74 D;  1N7L A;  3U59 A;  3D71 A;  2P2U A;  3Q2Y A;  2KNC B;  2O1K A;  2WZ7 A;  3GF3 A;  1NTZ E;  1JY3 N;  1URQ D;  4UB8 E;  4XFJ A;  2FXM A;  4H0L C;  3FWL A;  2Q1K A;  4OGQ D;  1R8E A;  1OMI A;  1USE A;  1NU1 J;  2C0X A;  2M3B A;  2WMM A;  3VN0 A;  4DT0 A;  4RJT A;  5GTI H;  1JUN A;  1PIX A;  1JOC A;  3CI9 A;  3CCS P;  4D6T G;  5AVR B;  1OFC X;  3TGU E;  1BE3 E;  1GMJ A;  4OVN F;  1KYO H;  3L37 A;  5KLV D;  2JR8 A;  2WSS H;  4H13 D;  3IFM A;  3PP5 A;  2IZ0 A;  1ZME C;  1N73 B;  1S3J A;  3WU2 E;  1Q2N A;  1Y47 A;  2AXT E;  4CPG A;  2FFD C;  1YTZ I;  1FOS E;  4NPE A;  3H1K E;  2ZT9 C;  2B87 A;  2BCC J;  2K1A A;  2KYV A;  1X8Y A;  3M06 A;  1JB0 J;  1D7M A;  2A45 G;  2FYU D;  2AEM A;  3RK2 B;  1KC8 Q;  4OGQ B;  1MFZ A;  2A45 H;  1JY3 P;  3GMA A;  3AEC C;  2LKM A;  4JBZ A;  1S2E A;  1IK9 A;  3M9Q A;  1DD4 A;  2H88 C;  2NPS C;  3RGU A;  1RQU A;  2PRR A;  3QWO C;  1SQV J;  1MV8 A;  1NU1 E;  1KIL C;  1PZQ A;  2HG5 D;  1NU1 G;  3EFF K;  3GLM A;  1JMM A;  4HKZ H;  2IFM A;  2O01 N;  2V4H A;  3IAO A;  4JYC A;  3RL0 C;  4U7J A;  2BEZ F;  4HB1 A;  3V5B A;  3P8C E;  1JY3 O;  1YJN P;  1RF1 B;  1XTG B;  4PV1 B;  3P7K A;  2IX7 C;  3TYY A;  2ZVN B;  1KIL B;  3TGU D;  4XA4 A;  5KAI E;  1SQB D;  3PH0 A;  3CWB G;  1IK7 A;  3L73 E;  3RL0 g;  1HJ0 A;  5CCG A;  4KHX A;  4IL6 X;  3WU2 H;  3CCJ P;  2KP8 A;  2YMK A;  3EWK A;  2FFD B;  3V2N A;  2H43 A;  1L4A A;  2WSE H;  2O01 H;  2Y0C A;  3HD7 C;  5KLV E;  5AVY B;  1JM0 A;  1HUC A;  1LTA C;  4IOI H;  3P8C D;  4R4M A;  3ITK A;  2HYN A;  1YIT P;  1HH0 A;  1IFI A;  1VF5 B;  2XNX A;  4N78 D;  4XE5 B;  1K04 A;  3M0D A;  1BGY D;  1M1J A;  2GA1 A;  1M57 D;  1PPJ E;  2E5T A;  2O01 J;  1LTG C;  3MIW A;  3HD7 D;  3L70 D;  3L74 D;  2M0B A;  1NH4 A;  4GT1 A;  3II6 A;  4HJG H;  1PP9 G;  1X0T A;  1FS0 E;  4U3F J;  3TK1 A;  5KLV J;  2V7Q J;  2YMY A;  3L4F A;  3A3Y B;  1DH3 A;  2GUS A;  2QJP C;  1EXI A;  2RH0 A;  1Q82 Q;  3CWB J;  2RMZ A;  2QJK B;  2R5D A;  3RK3 D;  1IFP A;  2JJL A;  1K8A Q;  1URQ A;  2FYN B;  3LID A;  3H1L G;  2BEQ D;  1KYO I;  4KJM A;  3CXH D;  5AVW B;  1FZC B;  1LTI C;  1Q81 Q;  1K73 Q;  2OYI A;  5GTI E;  3JCU H;  2P58 A;  2QJK C;  1U7M A;  4DCK A;  2FYZ A;  4IL6 H;  2J59 M;  1GZL A;  2N1T B;  2QJY B;  1KQG B;  1EQ7 A;  4WBA A;  5EFW B;  5AVX B;  1OVR A;  1SQP D;  2NPS A;  2OYH C;  2HFE D;  1JY2 P;  3KZI H;  2FY8 A;  1HGV A;  1SVF A;  1S9K E;  2K9J B;  1KN7 A;  1PL5 A;  2KB7 P;  2WT7 B;  1AQT A;  4I6M C;  2Q7C A;  1S4X A;  5APY A;  3TF5 A;  1KYO E;  3KDP B;  1NAF A;  2BCC E;  1VDF A;  5B66 E;  5BU5 A;  4ZMD A;  2WIT A;  3GW6 A;  1AVO A;  1LTS C;  3MTU E;  3AE7 C;  5KJ7 C;  1AV1 A;  1SQX J;  1AVY A;  3H1L J;  1EDL A;  3HUS C;  4RKU J;  3AE4 C;  3MP7 B;  4WY4 D;  3CCV P;  5AVV B;  5AW7 B;  1LTB C;  2JWA A;  2KSE A;  1A02 J;  3H1H G;  4NPF X;  2K9Y A;  2HPC A;  3NFQ A;  1KYO D;  2NRG A;  3ZDM A;  1NOH A;  2HOD A;  4OGQ C;  1GW3 A;  1PGQ A;  5KLV G;  1GL2 B;  2WSF H;  1QL1 A;  2C0W A;  3M9H A;  4JPZ B;  2OYH B;  5AW2 B;  3RK2 D;  2LR2 A;  2Q3I A;  1SQP E;  5CMZ A;  4K3A A;  2BCC D;  3RBX A;  1N86 A;  1GU5 A;  3CXH I;  2L5G B;  3TNU A;  3E1I A;  2WWW A;  2IYO A;  2D2C D;  3L72 E;  5CCG D;  2Z4E A;  2OTJ P;  2ZJS E;  5B66 H;  3USS A;  1Z56 A;  1SFC D;  4H0L B;  5KLV K;  2E74 B;  4I7Z C;  4JYB A;  1IC2 A;  1UII A;  4EI2 A;  1NTK G;  3BCC D;  1K05 A;  1MZ9 A;  3H1K J;  5CCH A;  2XDJ A;  3TDK A;  2N1T C;  2QJY C;  3TNU B;  3CME P;  3WUU A;  3AE2 C;  4PV1 D;  3CX5 H;  1IFJ A;  4U3F G;  4WY4 B;  5C39 A;  4ASW A;  1EDI A;  1G2C A;  1TU3 F;  2B89 A;  3A2A A;  5TJH A;  2P10 A;  3NMD A;  1T2K C;  3CCL P;  1KTM A;  2ZAE B;  1L0N E;  1WT6 A;  2CPB A;  2RN0 A;  3L75 G;  3I5C A;  1NU1 K;  4QMA A;  1H88 A;  2E76 B;  1H0T A;  3MUD A;  2HPC B;  1CSB A;  1M8O B;  1L4A B;  3M9B A;  1NAY A;  1L0N K;  2ZYA A;  4HYT B;  1HTL C;  1XTC C;  2O1J A;  4H0L D;  4PJ0 E;  2YNY A;  2QEX P;  3G4S P;  1DEE G;  3A0H E;  1NKZ B;  4D6T D;  3AED C;  2P1J A;  1N2D C;  1YBK A;  1SQQ J;  2PP6 A;  2E75 B;  1LT9 C;  3AEB C;  3JCU E;  4C7R A;  5KLI B;  2NPS D;  1SQB E;  1RF0 A;  1FZC C;  2R3C A;  2XZR A;  4Y28 J;  2Q3E A;  2QVA A;  4IFM A;  1OXZ A;  1RQV A;  2ZVO B;  3C9I A;  3R4Y A;  1VQ4 P;  1NTZ K;  4RES B;  1GL2 D;  1PP9 D;  1YI2 P;  4WY4 C;  2E75 C;  5M1B A;  4YXD C;  1LGH B;  4EOT A;  3WUT A;  3B5N C;  2K9J A;  4K35 A;  4EIJ A;  1ZV8 A;  3L73 D;  1W2E A;  2E74 C;  2FYU G;  5KAI H;  1U57 A;  3GF7 A;  1YQ3 C;  5BVZ A;  1GK6 A;  3CPW O;  1EZV E;  3A7O A;  3RBZ A;  3KPE A;  4EDF A;  4H13 C;  2OGU A;  3WMM 0;  5GTH E;  1NTZ G;  2E5Y A;  2IFN A;  2FYU E;  3GG2 A;  2YXQ B;  3Q1M A;  1RHZ B;  3M91 A;  1NU1 D;  2PAJ A;  3H25 A;  1M1J C;  2QM7 A;  4WWI A;  3OAK A;  4ASV A;  1L0N D;  2YO2 A;  3F5H A;  3VYI A;  3AE5 C;  3CMA P;  1H8A A;  3L70 J;  3L74 J;  1JCD A;  1PP9 J;  3L71 J;  1SQB G;  2H89 C;  2WSC H;  1VQO P;  3E7K A;  4BXL A;  1KV4 A;  1J1E B;  3PHL A;  1SQX D;  3ABV C;  2JP3 A;  4JF7 A;  3V6I A;  1NTM E;  5AW6 B;  5APS A;  1BSN A;  2OAR A;  2ZYG A;  4ZKP A;  1BCC D;  1SS1 A;  1Q90 D;  1FZF A;  1QL2 A;  1NTZ D;  2W83 C;  2CPS A;  3FXD A;  1CZQ A;  1GL2 A;  2KLU A;  3L72 D;  1Y9B A;  3SWF A;  2WPV B;  2FFD A;  3C1L A;  3GHG A;  4DOJ A;  1MFT A;  3HE4 B;  1NO4 A;  3IF4 A;  1S5L H;  3B71 A;  3Q5S A;  1OWA A;  2N9Y B;  1SQV G;  3CX5 D;  1W5C E;  4Y99 C;  3NXS A;  1KFM A;  2WPQ A;  2LXC B;  1ZW0 A;  1PGO A;  5KKZ B;  1FZE A;  1CI6 B;  2QRX A;  2KIK A;  3L71 D;  3B5N B;  1RF1 A;  4H44 C;  3H1J G;  3RL0 B;  1X9V A;  5APW A;  5TIS E;  1FDM A;  2D2C C;  2W90 A;  3QH9 A;  4YPC A;  3UIA A;  3CCQ P;  1DX7 A;  5KJ7 A;  3OJA B;  1JY2 O;  2POH A;  1NHL A;  2OYO A;  1S1C X;  4RO0 A;  1JTH B;  1LT9 A;  2AXC A;  2WSE J;  3FX0 A;  4TT3 H;  2E76 D;  1OX3 A;  1OZH A;  5AW3 B;  4GDO A;  1Q86 Q;  1GK4 A;  5E79 H;  1CI6 A;  1S72 P;  3FGA D;  2N1T A;  2N9B A;  3T97 A;  3NTN A;  2WTY A;  1WMK A;  1KIL D;  1KB9 I;  1EZV G;  1T3U A;  1L0L K;  3KHU A;  4GOD A;  2KXP B;  1N73 A;  2OYI B;  1IJD B;  1RF1 C;  1T8Z A;  2IBZ E;  2IZ1 A;  3H32 A;  3EQ2 A;  3H1L E;  4PD4 E;  1KMI Z;  4R4L A;  1SQX E;  4ZKU A;  1IO4 A;  2FYU J;  1L4A D;  3H1J D;  5CJ0 A;  1OIP A;  3S1K A;  3H6P A;  5H2F E;  2Y0D A;  3H1I D;  1N8R Q;  3S9O A;  3BVH A;  1A02 F;  1ZOY C;  1PFI A;  1SQQ D;  2QE7 H;  2ZXE B;  3CLQ A;  1N7S C;  2JWD A;  1JO5 A;  1L0L J;  3CD6 P;  5GTH H;  1YIJ P;  2JKV A;  2I8D A;  3HD7 A;  4YTP C;  3H1H D;  2KNC A;  1ZLL A;  2ZXX A;  3CX5 I;  4M3L A;  5AW9 B;  1VQ5 P;  3IR9 A;  2A06 D;  1DIP A;  1KD1 Q;  2XU6 A;  5KAF E;  1RF0 C;  3AE3 C;  3PTZ A;  3FXE A;  3L73 J;  4HH2 A;  2MKV A;  3L74 E;  3L70 E;  2D2C B;  3TGU G;  1S5L X;  1BGY E;  1JCC A;  2L91 A;  1J2J B;  3A5T A;  1M56 D;  2QJP B;  3H32 B;  2I1J A;  3CWB E;  3L73 G;  2C9L Y;  3K5B A;  1RE4 C;  1E79 H; 
#chains in the Genus database with same CATH homology
 1SQV G;  1NTM G;  1PPJ G;  3BCC G;  3CXH H;  1BE3 G;  3H1J G;  2BCC G;  1L0L G;  1NU1 G;  1PP9 G;  2A06 G;  1BGY G;  1NTK G;  1SQB G;  2IBZ G;  1BCC G;  3L71 G;  4D6T G;  1L0N G;  3L70 G;  3L74 G;  4PD4 H;  1SQQ G;  4U3F G;  3CX5 H;  1KYO H;  3CWB G;  3H1H G;  3H1L G;  1SQX G;  1SQP G;  2FYU G;  3TGU G;  1EZV G;  5KLV G;  3L75 G;  3H1K G;  1KB9 H;  3H1I G;  1P84 H;  3L73 G;  1NTZ G;  3L72 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...