1GTWA

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the tom-1a promoter
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gtwA00
2WPSA 5AW8B 5AVSB 1H89A 2JJLA 3LIEA 1DH3A 4GKGA 1HJBA 2IPPA 1CI6B 4C7NA 1T2KD 2QM7A 1GZLA 3M9HA 1GTWA 2Q7CA 1JUNA 2Z5IA 5APTA 5AVRB 1JNMA 1GK6A 2BASA 3HE4A 3L36A 2R32A 5AW1B 1H8AA 1CSBA 3TK1A 3A7OA 1X8YA 2C9NY 1FAVA 4JYCA 3V5BA 2WT7A 1OWAA 4B86A 5AW7B 2ZFCA 5CMZA 3L35A 5AVUB 1T2KC 2E42A 3VN0A 3L37A 3TYYA 1GD2E 5AVQB 4AUWA 5APSA 1SP4A 2KP8A 1S9KD 2XV5A 4GT1A 3HE5A 4C46A 2R5DA 3TNUB 1HUCA 3IR9A 3M0AA 5AVYB 1SLQA 1J2JB 2P67A 4JYBA 4KHXA 4M3LA 3VYIA 3VTPC 1HBWA 3M06A 4LC1A 3T97A 1CI6A 4DZOA 1IO4A 1MFZA 1S9KE 4I6MC 5AW6B 1GK4A 3M91A 2Z5HA 2WPQA 2YO3A 4RESB 5APVA 3HTKA 5AVWB 3VMZA 3P7KA 2W6AA 5AVTB 3MD0A 2E43A 4EOTA 3A5TA 1HWTC 2WWWA 2WPRA 2XU6A 3P8MC 3V4WA 1A02J 1FOSE 1CZQA 2XZRA 3UIAA 2P7JA 3LIDA 2QM8A 3NMDA 4I2LC 5AW3B 5AW9B 2Q3IA 3VMXA 4C7NB 3KDPB 2ZXEB 3NTNA 2H7HA 2Q5UA 5APYA 1YYCA 1GU5A 1A02F 2W27A 3O8ZA 1NWQA 3M0DA 5APUA 5AVXB 5AVZB 3HE4B 2WTYA 3A3YB 4HYTB 1MV8A 3P32A 3SWFA 2P2UA 5AW5B 1GU4A 2VRSA 3OAKA 2WT7B 5AVVB 3TNUA 1MUUA 3B8EB 3I5CA 3MGNA 3NFQA 5AW4B 2C9LY 1G2CB 3A2AA 1KQLA 1NAFA 3VMYA 5APQA 3KQGA 2YO2A 3V4QA 5AW0B 1H88A 4AQRD 5APXA 4XE5B 1FOSF 2N9BA 5APWA 5AW2B 3M9BA 4AYCA 2R5BA 2YNYA 3NXSA 1OXZA 3HE5B 2R3CA
chains in the Genus database with same CATH superfamily
3AE8C 2AXCA 1L4AC 2IFNA 3RK3D 3Q5SA 1BSHA 1KYOD 1ZRTD 1PL5A 3L36A 3TK1A 2ZXXA 1OWAA 5AW7B 2K3RA 3RGUA 1H0TA 2Q3EA 2QJPB 2FXMA 3AE3C 2FYUD 2ZYGA 2XV5A 4GT1A 3VYIA 3CXHE 1YBKA 3PLNA 1R8EA 2G8YA 1GDTA 1QL2A 3L75G 2C0XA 3E1RA 1CZQA 2QM8A 2YXRB 4OGQB 1KILD 3RK2B 1YIJP 3TGUE 1A02F 2B88A 1BCCD 3H1IG 1BGYE 1GL2B 5BU8B 1QVFO 3OAKA 3AE4C 4GOEA 1MUUA 1NU1D 2QRXA 1E5WA 5APQA 2YO2A 3VMAA 1FJPA 3B5NA 1H88A 2GM4A 2FFDB 5APXA 2KIKA 5AW2B 3VP9A 1IJDB 1WMKA 4NPDA 5AW8B 4PJ0H 3V2RA 2JJLA 3B4SA 1T2KD 2HODB 1GZLA 1BDCA 1HF9A 2Z4EA 3D6YA 1L0ND 3CCVP 1SQXG 1YQ3C 4ASVA 1JNMA 1GK6A 2KSEA 3M9QA 2R32A 1PGOA 3A7OA 4DT0A 2WSSH 3HUSC 1AVOA 3GF3A 1RQUA 1G2CA 4H13C 1OIPA 1NTZD 3GHGB 4IL6H 5CCHD 1SFCA 1FE6A 2B87A 3BCCE 4N78E 1PPJE 3VTPC 1NOHA 1BCCG 2OTKE 3T97A 2W8ZA 1MFZA 2ITAA 1PGPA 2UWJE 4LGDE 1OVRA 1VL2A 1IFIA 2KLVA 2W6AA 2W90A 1G1IA 3MD0A 4OWFA 2XU6A 2IBZG 4OVNF 3UIAA 3SFDC 3HD7D 1LTGC 5KJ7D 5GTIE 2J59M 2ZYDA 3L72D 3H32A 1Q82Q 1AJYA 2WPVB 4HH2A 1M7LA 4JPZB 1T8ZA 2HG5D 3M0DC 2QJPC 3L71D 1SQQJ 2SPZA 1ZP0C 3C8VA 1MV8A 3SWFA 1FZCA 3AECC 1RF0C 3B71A 1NYHA 5CCHA 1KQLA 3G3ZA 3CX5D 1N73B 2D2CB 3Q2YA 2BCCD 3KZIH 4XE5B 2QE7H 5E79E 3CC7P 1NTZG 3LIEA 1DH3A 4GKGA 4OGQC 4U3FD 3WUUA 1YJWP 4WY4D 3QWOC 3JCUE 3HD7A 2KB7P 3RK2C 4NPEA 1OVVA 1URQD 2M3BA 1Q86Q 1GL2C 4ZKPA 1Z56A 3N7NA 4JYCA 3O6QB 5CCGD 1BDDA 5CMZA 1IK7A 1KC8Q 3H1HE 3KXDA 1L0LJ 2FFDC 4ZKUA 2IZ1A 3VP8A 2MKVA 1VQ6P 4EYYQ 2WSCJ 4D6TD 1GK4A 1FBMA 1FZAA 4IFDK 2YO3A 2E76B 1M1JA 4WY4A 2WWWA 3V4WA 1FOSE 1N7SC 3CXHI 1KTMA 1W5CE 3CCMP 1URQA 2PP6A 2H88C 1RY3A 4YXWH 1IZNB 1YYCA 3TF5A 3GHGC 1X79B 4IFFA 1QVGO 3MZWB 2RKLA 2P2UA 2B9BA 1KORA 2IX7C 2QJYB 2NPSD 1VDFA 2BEZF 1YITP 2OYHA 1EQ7A 2XNDH 2YKPA 2AEMA 2Q1KA 1CI6B 2OYIA 1G1JA 1AQ5A 1ZR2A 2LKMA 3I56P 2KI7B 1NAYA 1FDMA 3IF4A 1DD4A 2M8RA 4ZNCA 2WSFJ 4B86A 1UIIA 3SWKA 2H89C 2R3SA 2D2CC 1N7SA 1JY3P 1XTCC 4K35A 1VQ5P 1SP4A 3MP7B 5DJTB 3VOPA 4JYBA 4KHXA 1ZXGA 1EC5A 1IO4A 3WU2H 3PTZA 2KUBA 4RESB 2Y9YA 3VMZA 1SQQE 3U1AA 1JY3N 1JB0J 1NTMD 2WITA 3P8MC 3G6EP 1JCCA 1LTTC 2IBZI 1SQVD 2Q5UA 1D7MA 2FXPA 5KKZC 1PGQA 1OMIA 1JTHB 3CCUP 3AE7C 1P84E 3B8EB 5AW4B 2Y9ZA 3II6A 4R4LA 5KLVD 2NZ2A 4I7ZB 3KQGA 3U59A 1SQQK 2K9YA 2ZAEB 2E76C 5APVA 4CPGA 1EDKA 1U57A 3EWKA 3JCUH 3HTKB 1ZLLA 1XTGB 1VPCA 1L0LG 3V5BA 1NTKD 2ZFCA 2E74D 2E42A 2QJYC 3L73D 3H1JD 5AVQB 2AXTE 1JM0A 2HPCB 1KV4A 1FDOA 3WUVA 3H25A 1VF5D 3HRNA 4I6MC 3CCSP 1KILB 1CW5A 3ABVC 1QGKB 1IFJA 1AV1A 4L75A 3G9RA 1SQPG 3RL0B 2KYVA 3RL0g 1S4XA 4H44B 4C7NB 1LT1A 1RE3A 2KLUA 2HR3A 4DOJA 5K5GB 4WWIA 3TDKA 3H1KE 4I1LA 3E7KA 1SVFA 3L74J 1M56D 3HE4B 4XFJA 3A3YB 5L8RJ 3CWBE 5KAIH 1NH4A 3PJSK 2G3AA 3BCCJ 1USDA 1SQBE 3LW5J 4HB1A 5AVSB 2LXBA 2I1JA 3AEGC 2Q7CA 3L75D 1NU1J 1ZW0A 5AW1B 2N1TD 2LR2A 2C9NY 1QEXA 3H1ID 4I7ZC 1JO5A 1SQBK 3CC4P 3TGUD 3L70J 1VQ8P 1AQTA 3MUDA 1EZVE 1HH0A 4U7JA 3FWLA 2KOGA 3P8CE 5CBNA 1QL1A 1L4AD 2P7JA 1PFIA 1LTJA 2ZVNB 4L73A 1NO4A 1RE4C 5CJ0A 1SQXD 2N1TA 3B5ND 5B5EH 2V4HA 4QMAA 3N4XA 1AFOA 1RF1A 2POHA 1S5LX 3A0BE 1KQSO 3JSVC 3P32A 3H1HJ 3ITKA 3NFQA 2M5AA 2KK7A 3V6IA 3A0HE 1IFDA 1KILC 2NRGA 1FS0E 3CI9A 1VQ4P 1LT9B 1FZBA 4UB6E 3CMEP 1LTIC 3RL0C 4GOFA 4H44C 3S4RA 2IPPA 1S3JA 1L4AA 3TGUG 1KB9H 1JY2P 5GTHE 1JUNA 1BGYG 1FC2C 1RHZB 1N2DC 1AA0A 1U7MA 2IBZD 3RK3E 1SFCD 1KZUB 3FGAD 2Y0CA 1ZRTE 1KB9I 1EDJA 2WT7A 2PGDA 2WSCH 1T2KC 1JY2N 3TYYA 5DJUB 1LP1B 3BASA 2O1JA 2IYPA 3L74E 1Q7YQ 3K5BA 3W68A 5C39A 3IFMA 3L74G 2WZ7A 3R4YA 2KSJA 2NPSB 1JEKA 4L74A 1QX8A 1KILE 2WTYA 3BCCG 1PPJG 3PRJA 4H13D 2FYUK 3I5CA 2XDJA 5KJ7C 1X0TA 2JWDA 4H0LD 2K9JB 1K9MQ 1NU1E 5APWA 3BRVB 5TISE 2PRRA 2OYOA 4BRYA 2WSFH 4UB8E 4YTPC 3AEDC 2KS1B 2KNCB 4RJTA 1DEEG 3OW2O 3L70E 2CPSA 3CL3D 4PD4E 3PH0A 4BXLA 1X8YA 1FAVA 3HUSA 3L70G 1NU1K 1HGZA 3Q1MA 3RBXA 1LT9C 2KZIA 4K3AA 3AE1C 5CCGC 5CJ4A 4HJGH 2JR8A 4EIJA 1L0NK 2WPRA 1A02J 3RK2D 5B66E 4O9BA 1JY3O 1M8OB 1LJ2A 1FDIA 2RN0A 3H1HG 2GUVA 3CXHH 3H6PA 1GL2D 1LGHB 3L72E 3O8ZA 1NWQA 3M0DA 5AVXB 3SSUA 3L4FA 1NTZK 2IZ0A 1S72P 1RF0A 1NAFA 2OARA 1IFNA 2Y0DA 4HKZH 1DEBA 3CX5E 4Y28J 3HE5B 3BRTB 1OVUA 1DIPA 2PFXA 3IN6A 3GLMA 1HJ0A 2QM7A 2E74B 1N7SD 1UIXA 2ZYAA 1GTWA 4PV1D 3KHUA 4U3FE 2NPSC 1KN7A 1BE3J 1USEA 3H1KJ 3D71A 1GL2A 2OTJP 1L2PA 1VF5B 3IAOA 3CWBJ 4DCKA 2FFDA 1S1CX 1W2EA 2E5TA 1S9KD 2V7QJ 1T3JA 3TNUB 3OA7A 1J2JB 1SLQA 2CK3H 2IDBA 5CHXA 1LWUB 1SQBJ 3H1LJ 5AW6B 2HODA 1NKZB 2WPQA 4LLHA 1N73C 4D6TE 2E75B 1GW3A 1Y47A 3LIDA 1N86A 4I2LC 5AW9B 3Q5PA 1PP9J 4W80A 3GMAA 3EQ2A 1ZV8A 3LW5H 1KB9D 1K05A 3GHGA 3AE2C 1EDIA 1L0LD 1YI2P 1DX7A 3EFFK 2D2CD 2C9LY 3AEEC 2Q6QA 3PHLA 3FX0A 5GTIH 1LTBC 1SQQG 2BEQD 2FYNB 1H0TB 1LTAC 2FYZA 2N9BA 4AYCA 2YNYA 2FBWC 2WSEJ 4IFMA 2QJKB 1YHQP 1HJBA 1VQ9P 2MJZA 4WBAA 1SQPD 3RK3B 1K8AQ 4PD4H 2QA4P 3AE6C 4TLFA 1YTZT 2DW3A 5E79H 4L76A 2A06E 4A7PA 1N73A 4PD4I 2HFED 2A06G 3M06A 4YXDC 3GW6A 2AEJA 2E74C 3B5NB 2W6BA 2Q9IA 4N3YB 3P7KA 4JBZA 3EFGA 2YKQA 1KFMA 2XZRA 3FWNA 4Z1MH 2K1AA 1R5SA 3O6QA 1VF5C 1KQFB 2PAJA 4PJ0E 4EDFA 1N8RQ 2O3JA 3Q5RA 1LWUC 1G2CB 3W67A 1JMMA 5KTBA 2FYUJ 1BE3E 1PIXA 1FOSF 3TSIA 1Y8AA 3CX5H 1SFCB 2R5BA 3S9OA 1SQXJ 2B87B 2E75C 2R44A 1BE3G 1NTMK 3T97B 3H1KG 3M9HA 3F89A 4IL6E 3CX5I 2Z5IA 1HVVA 2QVAA 3CCLP 1SQVK 2WVRA 1S5LE 4NPFX 1SS1A 1MFTA 3CWBG 2I1KA 1ZMEC 3H32B 3H1LE 2H43A 1HGVA 2FYNC 1BCCJ 2P58A 3MHVA 1KQGB 1SQBG 1NTKE 1J1DB 3H1LG 2AEFA 5KLVK 3CXHD 5H2FE 1J1EB 5APSA 1JY2O 1FZCB 1NGMB 3L73E 1FZGA 3H1JE 4WVZA 2QJKC 1PP9E 2JDIH 1RH5B 3Q3DA 1CI6A 2ZT9D 2O01J 1IC2A 3M91A 2Z5HA 1FZEA 2P10A 1PP9G 3RK3C 1M90Q 1VQPP 3A5TA 4DJGA 1OW6A 2Q3IA 4H13B 1WRGA 3NTNA 3CD6P 1L0NJ 1BGYD 3HD7B 1IFPA 3KZIE 3CCEP 3F5HA 1NTKK 4H0LB 1EZVG 3GG2A 5CBOA 1VQLP 3BVHA 3MIWA 3MGNA 1NTZJ 1OFCX 3B5NC 1E79H 4RKUJ 4IL6X 2QG4A 2R3CA 2KZJA 2QIWA 1KMIZ 1P84H 3C1LA 2O01N 1M1JB 4WY4B 1JTHA 3L74D 2L91A 1YJNP 1KD1Q 3L75E 1URQB 3L72J 1LNQA 1P84I 1VQNP 4KJMA 1RQVA 1BSNA 3L71J 3RBZA 3I55P 3BCCD 4N78D 2OQQA 1OZHA 1PPJD 3SWYA 3D70A 1YTZI 1SFCC 3H1IE 4LC1A 1KYOE 1MKMA 2BCCJ 2W83C 3RL0D 1NKNA 2CPBA 2OYHB 3HTKA 4H44D 3CLQA 2E43A 1HWTC 2E5YA 2AXTH 4U3FJ 1VQMP 2QSIA 5AW3B 2K88A 1YQ4C 2OYIB 3KYQA 4WB4A 1RE4A 2FYUE 3D6ZA 1LTSC 1J1DC 1NHLA 2HPCA 3CC2P 1SQXE 1J1EC 1FZCC 2FYUG 3L70D 1X22A 2YMYA 4N6JA 4PD4D 1FJKA 2IFMA 5CCHC 1JCDA 3VMYA 1ZOYC 1N7SB 1KILA 4PV1B 5AW0B 2JWAA 3SFEC 5KLIB 3NXSA 2JEEA 2XNXA 2JO1A 4C7NA 4D6TJ 3HD7C 1BCCE 4H0LC 4RO0A 4GIFA 1S5LH 1SQXK 1ZR4A 2FXOA 2HYNA 2V7QH 1PGJA 1KFNA 3OJAB 3CCQP 3HE4A 1H8AA 1IFMA 3BATA 1QLED 2IBZE 1GMJA 3H1HD 3AEBC 3WU2E 2ZJSE 1NU1G 1GD2E 2J5UA 3AE5C 1Y9BA 5H2FH 4MN4C 4TT3H 3IR9A 2P67A 2YIUB 2O1KA 1L0NE 3U1CA 2N9YB 4W7ZA 1L0NG 1M1JC 4Y99B 4WY4C 2YKOA 1URQC 2ZXEB 1NTZE 2W27A 2W6JH 2WSEH 3CCRP 5AW5B 4OGQD 1EZVI 1Q90D 5EFWB 5KJ7A 2ZVOB 5BVZA 2JKVA 2OYHC 1PZQA 3A0BH 4GODA 3AEFC 3E1IA 5KKZB 2P1JA 2HLOA 2OYIC 2OGUA 3L72G 3R2PA 3L71E 1NTMJ 3A0HH 2BASA 1U7JA 3L71G 3USSA 1Q2NA 1CSBA 2FY8A 2JP3A 4UB6H 2YXQB 2GA1A 1M1KQ 1SQVJ 5AVUB 2BCCE 3L35A 3V2PA 3L37A 2A45G 4PV1C 5GTHH 2IYOA 2BCCG 5BU5A 4AUWA 5KLIC 1LT9A 4IOIH 1PV3A 2QEXP 1SQPJ 1SQQD 5KLVJ 1KYOH 4U3FG 5CCGA 3FXEA 1R5LA 5KAFE 4GDOA 2H8PD 1W2BO 1KYOI 5KAIE 4W7YA 3VMXA 2WQYC 1HTLC 4R4MA 1DD3A 1NJIQ 3PP5A 1P84D 5APUA 1LP1A 4HYTB 5TJHA 3G71P 4XA4A 1NTKJ 4JQ0D 3V2NA 3GF7A 2YIUC 1N7LA 1IK9A 3L73J 1OW8A 3H1JJ 2K37A 3C9IA 4D6TG 1JOCA 2A06D 4Y99C 2WPSA 3AE9C 4BWNA 1H89A 1ZN5A 1K04A 1T3UA 1MZ9A 2NPSA 2WMMA 1VQKP 5AVRB 2B89A 3ZDMA 1LTJB 3KPEA 5TISH 1EXIA 2O01H 1T6AA 2N1TB 4UB8H 1FZFA 4C7RA 3V2QA 2ZT9B 1AVYA 2K9JA 1RF1B 3G4SP 4KT0J 2R5DA 3M0AA 2M5AB 3WUTA 5B5EE 2M3EA 4DZOA 2KS1A 1S9KE 2KNCA 2L5GB 2YMKA 1GW4A 5AVTB 1BE3D 2RMZA 3H1KD 3NMDA 1K73Q 1L4AB 1RE3C 1FU1A 1EXJA 3L75J 4JF7A 1JMBA 2FKWB 2E76D 2XKMA 3WMM0 3CWBD 1TU3F 2VRSA 1NVOA 1KB9E 2M0BA 2WT7B 2OTLP 2RH0A 1L0LE 5B66H 4ASWA 3H1IJ 1SQBD 1EDLA 3H1LD 3V4QA 1NTME 3TGUJ 4AQRD 2KXPB 4YPCA 1OXZA 1BGYJ 3CMAP 1NTMG 1SQVE 1PP9D 1SQVG 5APTA 1M57D 3MTUE 1SQPE 2A45H 2J58A 1X9VA 5KLVE 1L0LK 2Y0EA 1VQ7P 3VN0A 5KLVG 1EZVD 1WT6A 1OW7A 2A45I 2KP8A 1S2EA 3MUDC 3HE5A 4C46A 1HUCA 5AVYB 3S1KA 4M3LA 1HBWA 3P8CD 3QH9A 2E75D 5AVWB 1YJ9P 5KAFH 1Q81Q 4EOTA 4BRYB 4ZMDA 1OX3A 1SQPK 2LXCB 1LTJC 3KDPB 3FXDA 3CPWO 2N1TC 1NTKG 2H7HA 5APYA 2ZT9C 1GU5A 1VQOP 5M1BA 2I8DA 1RF1C 3L73G 5AVZB 3H1JG 4OH8B 1GU4A 3HUSB 5AVVB 3TNUA 4EI2A 3A2AA 1LWUA 2GUSA 2C0WA 3JC22 3CCJP 3M9BA 3AEAC
chains in the Genus database with same CATH topology
2XNXA 3BRTB 1L4AC 2IFNA 4C7NA 3RK3D 2QM7A 3HD7C 1N7SD 1GTWA 3HTKB 2NPSC 4GIFA 1SQXK 1ZLLA 1ZR4A 2HYNA 1XTGB 1KFNA 3OJAB 1VPCA 3HE4A 3L36A 1H8AA 1GL2A 1IFMA 3TK1A 3BATA 3V5BA 1OWAA 5AW7B 2ZFCA 2E42A 1GD2E 5AVQB 2HPCB 2FXMA 2FFDA 1W2EA 1S9KD 2XV5A 4GT1A 1T3JA 3TNUB 3IR9A 3OA7A 1J2JB 1SLQA 2P67A 3VYIA 2O1KA 5CHXA 1LWUB 3HRNA 4I6MC 5AW6B 3U1CA 2HODA 1KILB 1CW5A 1IFJA 1NKZB 4W7ZA 2WPQA 1GDTA 1QL2A 4LLHA 1M1JC 4Y99B 4WY4C 1N73C 2C0XA 1CZQA 1GW3A 2KYVA 3LIDA 2YKOA 2QM8A 3RL0B 1N86A 4I2LC 1URQC 5AW9B 4C7NB 2ZXEB 1RE3A 4DOJA 4W80A 1KILD 3RK2B 4I1LA 3EQ2A 1ZV8A 1A02F 2W27A 1SVFA 3LW5H 3GHGA 3HE4B 2WSEH 3A3YB 1GL2B 1DX7A 5AW5B 5BU8B 3OAKA 1MUUA 2C9LY 5KJ7A 1NH4A 1LTBC 1E5WA 5APQA 2YO2A 1LTAC 5BVZA 3B5NA 1H88A 2GM4A 1FJPA 2FFDB 5APXA 2OYHC 2FYZA 2N9BA 5AW2B 4AYCA 3VP9A 2YNYA 1IJDB 5AW8B 3V2RA 5AVSB 4IFMA 2JJLA 2I1JA 3E1IA 1HJBA 2P1JA 2HLOA 2OYIC 1T2KD 2HODB 1GZLA 2Z4EA 2MJZA 3R2PA 2Q7CA 4WBAA 3RK3B 1JNMA 1GK6A 2BASA 3M9QA 2R32A 2N1TD 5AW1B 1CSBA 1YTZT 3A7OA 2C9NY 3HUSC 5AVUB 3L35A 3V2PA 1G2CA 3L37A 1N73A 1JO5A 2A45G 3GHGB 1SQBK 5BU5A 4AUWA 5CCHD 2HFED 1SFCA 3MUDA 1LT9A 4N78E 3VTPC 1NOHA 3M06A 3T97A 1HH0A 1MFZA 5CCGA 3B5NB 2W6BA 2Q9IA 4LGDE 2KOGA 3P8CE 1IFIA 4N3YB 2KLVA 3P7KA 2W6AA 1QL1A 1G1IA 1L4AD 3MD0A 3EFGA 2YKQA 1KFMA 2XU6A 2XZRA 2H8PD 3UIAA 2P7JA 3HD7D 1LTGC 1PFIA 4W7YA 3VMXA 1HTLC 1LTJA 5KJ7D 2J59M 3H32A 1NO4A 1RE4C 5CJ0A 3B5ND 2N1TA 4HH2A 1M7LA 3PP5A 1T8ZA 3N4XA 1AFOA 2HG5D 2PAJA 3M0DC 5APUA 1RF1A 2POHA 4HYTB 1MV8A 3P32A 3SWFA 1FZCA 4XA4A 3V2NA 3NFQA 1RF0C 1N7LA 1IK9A 1LWUC 5CCHA 1G2CB 1KQLA 1IFDA 3G3ZA 1N73B 1JMMA 3C9IA 1KILC 5KTBA 1JOCA 4XE5B 1FOSF 3TSIA 1SFCB 2R5BA 3CI9A 4Y99C 1LT9B 1FZBA 2WPSA 1LTIC 3RL0C 1H89A 3LIEA 1DH3A 4GKGA 1NTMK 2IPPA 1ZN5A 1L4AA 1T3UA 3M9HA 4WY4D 1JY2P 3HD7A 2KB7P 3RK2C 1JUNA 1URQD 1MZ9A 2NPSA 1N2DC 2M3BA 2Z5IA 1HVVA 1SFCD 1SQVK 5AVRB 1KZUB 1GL2C 4ZKPA 1LTJB 2I1KA 3KPEA 1Z56A 3N7NA 3H32B 4JYCA 2WT7A 5CCGD 2WSCH 2O01H 2H43A 5CMZA 2N1TB 1FZFA 4C7RA 3V2QA 1T2KC 1JY2N 3TYYA 1HGVA 1J1DB 1RF1B 2FFDC 4ZKUA 5KLVK 1J1EB 5APSA 1JY2O 1FZCB 3VP8A 1FZGA 2R5DA 3BASA 3M0AA 1CI6A 4DZOA 1S9KE 2O1JA 1IC2A 1GK4A 2L5GB 1FBMA 3M91A 1FZAA 2Z5HA 1FZEA 4IFDK 2YO3A 1GW4A 3RK3C 5AVTB 1M1JA 4WY4A 3A5TA 2WWWA 3V4WA 1FOSE 1N7SC 3IFMA 3NMDA 1URQA 2PP6A 2Q3IA 2WZ7A 1L4AB 1RY3A 1RE3C 1WRGA 3NTNA 1FU1A 3HD7B 4JF7A 2KSJA 1YYCA 2NPSB 1NTKK 2FKWB 3GHGC 1X79B 2XKMA 4IFFA 3WMM0 2WTYA 2P2UA 2VRSA 3BVHA 2FYUK 2WT7B 3I5CA 2XDJA 3MGNA 3MIWA 5KJ7C 2IX7C 2NPSD 3B5NC 3V4QA 4AQRD 1VDFA 2OYHA 5APWA 1EQ7A 3BRVB 1OXZA 2R3CA 2YKPA 2WSFH 1CI6B 2OYIA 1G1JA 1AQ5A 1ZR2A 2LKMA 1FDMA 1M1JB 4WY4B 5APTA 1JTHA 2CPSA 3CL3D 1URQB 3MTUE 2A45H 2M8RA 2J58A 1X8YA 1FAVA 1X9VA 1L0LK 3HUSA 4B86A 3VN0A 1NU1K 1N7SA 1JY3P 4N78D 1WT6A 1HGZA 1XTCC 3SWYA 1YTZI 2A45I 1SFCC 1SP4A 2KP8A 1LT9C 3HE5A 4C46A 1HUCA 3VOPA 5AVYB 4JYBA 4KHXA 4M3LA 1HBWA 3P8CD 4LC1A 1IO4A 5CCGC 5CJ4A 3RL0D 1NKNA 2CPBA 2OYHB 4RESB 5AVWB 3VMZA 3U1AA 3HTKA 1JY3N 4EIJA 3CLQA 2E43A 1L0NK 2WITA 4EOTA 1HWTC 3P8MC 2WPRA 1A02J 1SQPK 3RK2D 4O9BA 5AW3B 1LTJC 1JY3O 1JCCA 1LTTC 3KDPB 2OYIB 3KYQA 4WB4A 1RE4A 2N1TC 2H7HA 2GUVA 2Q5UA 5APYA 3H6PA 1GU5A 1GL2D 1LGHB 1LTSC 1JTHB 1J1DC 3O8ZA 1NWQA 1RF1C 3M0DA 5AVXB 1NHLA 3L4FA 5AVZB 2HPCA 1NTZK 1J1EC 1FZCC 4OH8B 1GU4A 3HUSB 5AVVB 3TNUA 2YMYA 3B8EB 4N6JA 5AW4B 1FJKA 2IFMA 5CCHC 1RF0A 3A2AA 1LWUA 1JCDA 3II6A 1NAFA 3VMYA 2GUSA 3KQGA 3U59A 2OARA 1N7SB 1IFNA 1SQQK 1KILA 5AW0B 2C0WA 1DEBA 3M9BA 3NXSA 5APVA 2JEEA 3HE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPS A;  5AW8 B;  5AVS B;  1H89 A;  2JJL A;  3LIE A;  1DH3 A;  4GKG A;  1HJB A;  2IPP A;  1CI6 B;  4C7N A;  1T2K D;  2QM7 A;  1GZL A;  3M9H A;  1GTW A;  2Q7C A;  1JUN A;  2Z5I A;  5APT A;  5AVR B;  1JNM A;  1GK6 A;  2BAS A;  3HE4 A;  3L36 A;  2R32 A;  5AW1 B;  1H8A A;  1CSB A;  3TK1 A;  3A7O A;  1X8Y A;  2C9N Y;  1FAV A;  4JYC A;  3V5B A;  2WT7 A;  1OWA A;  4B86 A;  5AW7 B;  2ZFC A;  5CMZ A;  3L35 A;  5AVU B;  1T2K C;  2E42 A;  3VN0 A;  3L37 A;  3TYY A;  1GD2 E;  5AVQ B;  4AUW A;  5APS A;  1SP4 A;  2KP8 A;  1S9K D;  2XV5 A;  4GT1 A;  3HE5 A;  4C46 A;  2R5D A;  3TNU B;  1HUC A;  3IR9 A;  3M0A A;  5AVY B;  1SLQ A;  1J2J B;  2P67 A;  4JYB A;  4KHX A;  4M3L A;  3VYI A;  3VTP C;  1HBW A;  3M06 A;  4LC1 A;  3T97 A;  1CI6 A;  4DZO A;  1IO4 A;  1MFZ A;  1S9K E;  4I6M C;  5AW6 B;  1GK4 A;  3M91 A;  2Z5H A;  2WPQ A;  2YO3 A;  4RES B;  5APV A;  3HTK A;  5AVW B;  3VMZ A;  3P7K A;  2W6A A;  5AVT B;  3MD0 A;  2E43 A;  4EOT A;  3A5T A;  1HWT C;  2WWW A;  2WPR A;  2XU6 A;  3P8M C;  3V4W A;  1A02 J;  1FOS E;  1CZQ A;  2XZR A;  3UIA A;  2P7J A;  3LID A;  2QM8 A;  3NMD A;  4I2L C;  5AW3 B;  5AW9 B;  2Q3I A;  3VMX A;  4C7N B;  3KDP B;  2ZXE B;  3NTN A;  2H7H A;  2Q5U A;  5APY A;  1YYC A;  1GU5 A;  1A02 F;  2W27 A;  3O8Z A;  1NWQ A;  3M0D A;  5APU A;  5AVX B;  5AVZ B;  3HE4 B;  2WTY A;  3A3Y B;  4HYT B;  1MV8 A;  3P32 A;  3SWF A;  2P2U A;  5AW5 B;  1GU4 A;  2VRS A;  3OAK A;  2WT7 B;  5AVV B;  3TNU A;  1MUU A;  3B8E B;  3I5C A;  3MGN A;  3NFQ A;  5AW4 B;  2C9L Y;  1G2C B;  3A2A A;  1KQL A;  1NAF A;  3VMY A;  5APQ A;  3KQG A;  2YO2 A;  3V4Q A;  5AW0 B;  1H88 A;  4AQR D;  5APX A;  4XE5 B;  1FOS F;  2N9B A;  5APW A;  5AW2 B;  3M9B A;  4AYC A;  2R5B A;  2YNY A;  3NXS A;  1OXZ A;  3HE5 B;  2R3C A; 
#chains in the Genus database with same CATH topology
 3AE8 C;  2AXC A;  1L4A C;  2IFN A;  3RK3 D;  3Q5S A;  1BSH A;  1KYO D;  1ZRT D;  1PL5 A;  3L36 A;  3TK1 A;  2ZXX A;  1OWA A;  5AW7 B;  2K3R A;  3RGU A;  1H0T A;  2Q3E A;  2QJP B;  2FXM A;  3AE3 C;  2FYU D;  2ZYG A;  2XV5 A;  4GT1 A;  3VYI A;  3CXH E;  1YBK A;  3PLN A;  1R8E A;  2G8Y A;  1GDT A;  1QL2 A;  3L75 G;  2C0X A;  3E1R A;  1CZQ A;  2QM8 A;  2YXR B;  4OGQ B;  1KIL D;  3RK2 B;  1YIJ P;  3TGU E;  1A02 F;  2B88 A;  1BCC D;  3H1I G;  1BGY E;  1GL2 B;  5BU8 B;  1QVF O;  3OAK A;  3AE4 C;  4GOE A;  1MUU A;  1NU1 D;  2QRX A;  1E5W A;  5APQ A;  2YO2 A;  3VMA A;  1FJP A;  3B5N A;  1H88 A;  2GM4 A;  2FFD B;  5APX A;  2KIK A;  5AW2 B;  3VP9 A;  1IJD B;  1WMK A;  4NPD A;  5AW8 B;  4PJ0 H;  3V2R A;  2JJL A;  3B4S A;  1T2K D;  2HOD B;  1GZL A;  1BDC A;  1HF9 A;  2Z4E A;  3D6Y A;  1L0N D;  3CCV P;  1SQX G;  1YQ3 C;  4ASV A;  1JNM A;  1GK6 A;  2KSE A;  3M9Q A;  2R32 A;  1PGO A;  3A7O A;  4DT0 A;  2WSS H;  3HUS C;  1AVO A;  3GF3 A;  1RQU A;  1G2C A;  4H13 C;  1OIP A;  1NTZ D;  3GHG B;  4IL6 H;  5CCH D;  1SFC A;  1FE6 A;  2B87 A;  3BCC E;  4N78 E;  1PPJ E;  3VTP C;  1NOH A;  1BCC G;  2OTK E;  3T97 A;  2W8Z A;  1MFZ A;  2ITA A;  1PGP A;  2UWJ E;  4LGD E;  1OVR A;  1VL2 A;  1IFI A;  2KLV A;  2W6A A;  2W90 A;  1G1I A;  3MD0 A;  4OWF A;  2XU6 A;  2IBZ G;  4OVN F;  3UIA A;  3SFD C;  3HD7 D;  1LTG C;  5KJ7 D;  5GTI E;  2J59 M;  2ZYD A;  3L72 D;  3H32 A;  1Q82 Q;  1AJY A;  2WPV B;  4HH2 A;  1M7L A;  4JPZ B;  1T8Z A;  2HG5 D;  3M0D C;  2QJP C;  3L71 D;  1SQQ J;  2SPZ A;  1ZP0 C;  3C8V A;  1MV8 A;  3SWF A;  1FZC A;  3AEC C;  1RF0 C;  3B71 A;  1NYH A;  5CCH A;  1KQL A;  3G3Z A;  3CX5 D;  1N73 B;  2D2C B;  3Q2Y A;  2BCC D;  3KZI H;  4XE5 B;  2QE7 H;  5E79 E;  3CC7 P;  1NTZ G;  3LIE A;  1DH3 A;  4GKG A;  4OGQ C;  4U3F D;  3WUU A;  1YJW P;  4WY4 D;  3QWO C;  3JCU E;  3HD7 A;  2KB7 P;  3RK2 C;  4NPE A;  1OVV A;  1URQ D;  2M3B A;  1Q86 Q;  1GL2 C;  4ZKP A;  1Z56 A;  3N7N A;  4JYC A;  3O6Q B;  5CCG D;  1BDD A;  5CMZ A;  1IK7 A;  1KC8 Q;  3H1H E;  3KXD A;  1L0L J;  2FFD C;  4ZKU A;  2IZ1 A;  3VP8 A;  2MKV A;  1VQ6 P;  4EYY Q;  2WSC J;  4D6T D;  1GK4 A;  1FBM A;  1FZA A;  4IFD K;  2YO3 A;  2E76 B;  1M1J A;  4WY4 A;  2WWW A;  3V4W A;  1FOS E;  1N7S C;  3CXH I;  1KTM A;  1W5C E;  3CCM P;  1URQ A;  2PP6 A;  2H88 C;  1RY3 A;  4YXW H;  1IZN B;  1YYC A;  3TF5 A;  3GHG C;  1X79 B;  4IFF A;  1QVG O;  3MZW B;  2RKL A;  2P2U A;  2B9B A;  1KOR A;  2IX7 C;  2QJY B;  2NPS D;  1VDF A;  2BEZ F;  1YIT P;  2OYH A;  1EQ7 A;  2XND H;  2YKP A;  2AEM A;  2Q1K A;  1CI6 B;  2OYI A;  1G1J A;  1AQ5 A;  1ZR2 A;  2LKM A;  3I56 P;  2KI7 B;  1NAY A;  1FDM A;  3IF4 A;  1DD4 A;  2M8R A;  4ZNC A;  2WSF J;  4B86 A;  1UII A;  3SWK A;  2H89 C;  2R3S A;  2D2C C;  1N7S A;  1JY3 P;  1XTC C;  4K35 A;  1VQ5 P;  1SP4 A;  3MP7 B;  5DJT B;  3VOP A;  4JYB A;  4KHX A;  1ZXG A;  1EC5 A;  1IO4 A;  3WU2 H;  3PTZ A;  2KUB A;  4RES B;  2Y9Y A;  3VMZ A;  1SQQ E;  3U1A A;  1JY3 N;  1JB0 J;  1NTM D;  2WIT A;  3P8M C;  3G6E P;  1JCC A;  1LTT C;  2IBZ I;  1SQV D;  2Q5U A;  1D7M A;  2FXP A;  5KKZ C;  1PGQ A;  1OMI A;  1JTH B;  3CCU P;  3AE7 C;  1P84 E;  3B8E B;  5AW4 B;  2Y9Z A;  3II6 A;  4R4L A;  5KLV D;  2NZ2 A;  4I7Z B;  3KQG A;  3U59 A;  1SQQ K;  2K9Y A;  2ZAE B;  2E76 C;  5APV A;  4CPG A;  1EDK A;  1U57 A;  3EWK A;  3JCU H;  3HTK B;  1ZLL A;  1XTG B;  1VPC A;  1L0L G;  3V5B A;  1NTK D;  2ZFC A;  2E74 D;  2E42 A;  2QJY C;  3L73 D;  3H1J D;  5AVQ B;  2AXT E;  1JM0 A;  2HPC B;  1KV4 A;  1FDO A;  3WUV A;  3H25 A;  1VF5 D;  3HRN A;  4I6M C;  3CCS P;  1KIL B;  1CW5 A;  3ABV C;  1QGK B;  1IFJ A;  1AV1 A;  4L75 A;  3G9R A;  1SQP G;  3RL0 B;  2KYV A;  3RL0 g;  1S4X A;  4H44 B;  4C7N B;  1LT1 A;  1RE3 A;  2KLU A;  2HR3 A;  4DOJ A;  5K5G B;  4WWI A;  3TDK A;  3H1K E;  4I1L A;  3E7K A;  1SVF A;  3L74 J;  1M56 D;  3HE4 B;  4XFJ A;  3A3Y B;  5L8R J;  3CWB E;  5KAI H;  1NH4 A;  3PJS K;  2G3A A;  3BCC J;  1USD A;  1SQB E;  3LW5 J;  4HB1 A;  5AVS B;  2LXB A;  2I1J A;  3AEG C;  2Q7C A;  3L75 D;  1NU1 J;  1ZW0 A;  5AW1 B;  2N1T D;  2LR2 A;  2C9N Y;  1QEX A;  3H1I D;  4I7Z C;  1JO5 A;  1SQB K;  3CC4 P;  3TGU D;  3L70 J;  1VQ8 P;  1AQT A;  3MUD A;  1EZV E;  1HH0 A;  4U7J A;  3FWL A;  2KOG A;  3P8C E;  5CBN A;  1QL1 A;  1L4A D;  2P7J A;  1PFI A;  1LTJ A;  2ZVN B;  4L73 A;  1NO4 A;  1RE4 C;  5CJ0 A;  1SQX D;  2N1T A;  3B5N D;  5B5E H;  2V4H A;  4QMA A;  3N4X A;  1AFO A;  1RF1 A;  2POH A;  1S5L X;  3A0B E;  1KQS O;  3JSV C;  3P32 A;  3H1H J;  3ITK A;  3NFQ A;  2M5A A;  2KK7 A;  3V6I A;  3A0H E;  1IFD A;  1KIL C;  2NRG A;  1FS0 E;  3CI9 A;  1VQ4 P;  1LT9 B;  1FZB A;  4UB6 E;  3CME P;  1LTI C;  3RL0 C;  4GOF A;  4H44 C;  3S4R A;  2IPP A;  1S3J A;  1L4A A;  3TGU G;  1KB9 H;  1JY2 P;  5GTH E;  1JUN A;  1BGY G;  1FC2 C;  1RHZ B;  1N2D C;  1AA0 A;  1U7M A;  2IBZ D;  3RK3 E;  1SFC D;  1KZU B;  3FGA D;  2Y0C A;  1ZRT E;  1KB9 I;  1EDJ A;  2WT7 A;  2PGD A;  2WSC H;  1T2K C;  1JY2 N;  3TYY A;  5DJU B;  1LP1 B;  3BAS A;  2O1J A;  2IYP A;  3L74 E;  1Q7Y Q;  3K5B A;  3W68 A;  5C39 A;  3IFM A;  3L74 G;  2WZ7 A;  3R4Y A;  2KSJ A;  2NPS B;  1JEK A;  4L74 A;  1QX8 A;  1KIL E;  2WTY A;  3BCC G;  1PPJ G;  3PRJ A;  4H13 D;  2FYU K;  3I5C A;  2XDJ A;  5KJ7 C;  1X0T A;  2JWD A;  4H0L D;  2K9J B;  1K9M Q;  1NU1 E;  5APW A;  3BRV B;  5TIS E;  2PRR A;  2OYO A;  4BRY A;  2WSF H;  4UB8 E;  4YTP C;  3AED C;  2KS1 B;  2KNC B;  4RJT A;  1DEE G;  3OW2 O;  3L70 E;  2CPS A;  3CL3 D;  4PD4 E;  3PH0 A;  4BXL A;  1X8Y A;  1FAV A;  3HUS A;  3L70 G;  1NU1 K;  1HGZ A;  3Q1M A;  3RBX A;  1LT9 C;  2KZI A;  4K3A A;  3AE1 C;  5CCG C;  5CJ4 A;  4HJG H;  2JR8 A;  4EIJ A;  1L0N K;  2WPR A;  1A02 J;  3RK2 D;  5B66 E;  4O9B A;  1JY3 O;  1M8O B;  1LJ2 A;  1FDI A;  2RN0 A;  3H1H G;  2GUV A;  3CXH H;  3H6P A;  1GL2 D;  1LGH B;  3L72 E;  3O8Z A;  1NWQ A;  3M0D A;  5AVX B;  3SSU A;  3L4F A;  1NTZ K;  2IZ0 A;  1S72 P;  1RF0 A;  1NAF A;  2OAR A;  1IFN A;  2Y0D A;  4HKZ H;  1DEB A;  3CX5 E;  4Y28 J;  3HE5 B;  3BRT B;  1OVU A;  1DIP A;  2PFX A;  3IN6 A;  3GLM A;  1HJ0 A;  2QM7 A;  2E74 B;  1N7S D;  1UIX A;  2ZYA A;  1GTW A;  4PV1 D;  3KHU A;  4U3F E;  2NPS C;  1KN7 A;  1BE3 J;  1USE A;  3H1K J;  3D71 A;  1GL2 A;  2OTJ P;  1L2P A;  1VF5 B;  3IAO A;  3CWB J;  4DCK A;  2FFD A;  1S1C X;  1W2E A;  2E5T A;  1S9K D;  2V7Q J;  1T3J A;  3TNU B;  3OA7 A;  1J2J B;  1SLQ A;  2CK3 H;  2IDB A;  5CHX A;  1LWU B;  1SQB J;  3H1L J;  5AW6 B;  2HOD A;  1NKZ B;  2WPQ A;  4LLH A;  1N73 C;  4D6T E;  2E75 B;  1GW3 A;  1Y47 A;  3LID A;  1N86 A;  4I2L C;  5AW9 B;  3Q5P A;  1PP9 J;  4W80 A;  3GMA A;  3EQ2 A;  1ZV8 A;  3LW5 H;  1KB9 D;  1K05 A;  3GHG A;  3AE2 C;  1EDI A;  1L0L D;  1YI2 P;  1DX7 A;  3EFF K;  2D2C D;  2C9L Y;  3AEE C;  2Q6Q A;  3PHL A;  3FX0 A;  5GTI H;  1LTB C;  1SQQ G;  2BEQ D;  2FYN B;  1H0T B;  1LTA C;  2FYZ A;  2N9B A;  4AYC A;  2YNY A;  2FBW C;  2WSE J;  4IFM A;  2QJK B;  1YHQ P;  1HJB A;  1VQ9 P;  2MJZ A;  4WBA A;  1SQP D;  3RK3 B;  1K8A Q;  4PD4 H;  2QA4 P;  3AE6 C;  4TLF A;  1YTZ T;  2DW3 A;  5E79 H;  4L76 A;  2A06 E;  4A7P A;  1N73 A;  4PD4 I;  2HFE D;  2A06 G;  3M06 A;  4YXD C;  3GW6 A;  2AEJ A;  2E74 C;  3B5N B;  2W6B A;  2Q9I A;  4N3Y B;  3P7K A;  4JBZ A;  3EFG A;  2YKQ A;  1KFM A;  2XZR A;  3FWN A;  4Z1M H;  2K1A A;  1R5S A;  3O6Q A;  1VF5 C;  1KQF B;  2PAJ A;  4PJ0 E;  4EDF A;  1N8R Q;  2O3J A;  3Q5R A;  1LWU C;  1G2C B;  3W67 A;  1JMM A;  5KTB A;  2FYU J;  1BE3 E;  1PIX A;  1FOS F;  3TSI A;  1Y8A A;  3CX5 H;  1SFC B;  2R5B A;  3S9O A;  1SQX J;  2B87 B;  2E75 C;  2R44 A;  1BE3 G;  1NTM K;  3T97 B;  3H1K G;  3M9H A;  3F89 A;  4IL6 E;  3CX5 I;  2Z5I A;  1HVV A;  2QVA A;  3CCL P;  1SQV K;  2WVR A;  1S5L E;  4NPF X;  1SS1 A;  1MFT A;  3CWB G;  2I1K A;  1ZME C;  3H32 B;  3H1L E;  2H43 A;  1HGV A;  2FYN C;  1BCC J;  2P58 A;  3MHV A;  1KQG B;  1SQB G;  1NTK E;  1J1D B;  3H1L G;  2AEF A;  5KLV K;  3CXH D;  5H2F E;  1J1E B;  5APS A;  1JY2 O;  1FZC B;  1NGM B;  3L73 E;  1FZG A;  3H1J E;  4WVZ A;  2QJK C;  1PP9 E;  2JDI H;  1RH5 B;  3Q3D A;  1CI6 A;  2ZT9 D;  2O01 J;  1IC2 A;  3M91 A;  2Z5H A;  1FZE A;  2P10 A;  1PP9 G;  3RK3 C;  1M90 Q;  1VQP P;  3A5T A;  4DJG A;  1OW6 A;  2Q3I A;  4H13 B;  1WRG A;  3NTN A;  3CD6 P;  1L0N J;  1BGY D;  3HD7 B;  1IFP A;  3KZI E;  3CCE P;  3F5H A;  1NTK K;  4H0L B;  1EZV G;  3GG2 A;  5CBO A;  1VQL P;  3BVH A;  3MIW A;  3MGN A;  1NTZ J;  1OFC X;  3B5N C;  1E79 H;  4RKU J;  4IL6 X;  2QG4 A;  2R3C A;  2KZJ A;  2QIW A;  1KMI Z;  1P84 H;  3C1L A;  2O01 N;  1M1J B;  4WY4 B;  1JTH A;  3L74 D;  2L91 A;  1YJN P;  1KD1 Q;  3L75 E;  1URQ B;  3L72 J;  1LNQ A;  1P84 I;  1VQN P;  4KJM A;  1RQV A;  1BSN A;  3L71 J;  3RBZ A;  3I55 P;  3BCC D;  4N78 D;  2OQQ A;  1OZH A;  1PPJ D;  3SWY A;  3D70 A;  1YTZ I;  1SFC C;  3H1I E;  4LC1 A;  1KYO E;  1MKM A;  2BCC J;  2W83 C;  3RL0 D;  1NKN A;  2CPB A;  2OYH B;  3HTK A;  4H44 D;  3CLQ A;  2E43 A;  1HWT C;  2E5Y A;  2AXT H;  4U3F J;  1VQM P;  2QSI A;  5AW3 B;  2K88 A;  1YQ4 C;  2OYI B;  3KYQ A;  4WB4 A;  1RE4 A;  2FYU E;  3D6Z A;  1LTS C;  1J1D C;  1NHL A;  2HPC A;  3CC2 P;  1SQX E;  1J1E C;  1FZC C;  2FYU G;  3L70 D;  1X22 A;  2YMY A;  4N6J A;  4PD4 D;  1FJK A;  2IFM A;  5CCH C;  1JCD A;  3VMY A;  1ZOY C;  1N7S B;  1KIL A;  4PV1 B;  5AW0 B;  2JWA A;  3SFE C;  5KLI B;  3NXS A;  2JEE A;  2XNX A;  2JO1 A;  4C7N A;  4D6T J;  3HD7 C;  1BCC E;  4H0L C;  4RO0 A;  4GIF A;  1S5L H;  1SQX K;  1ZR4 A;  2FXO A;  2HYN A;  2V7Q H;  1PGJ A;  1KFN A;  3OJA B;  3CCQ P;  3HE4 A;  1H8A A;  1IFM A;  3BAT A;  1QLE D;  2IBZ E;  1GMJ A;  3H1H D;  3AEB C;  3WU2 E;  2ZJS E;  1NU1 G;  1GD2 E;  2J5U A;  3AE5 C;  1Y9B A;  5H2F H;  4MN4 C;  4TT3 H;  3IR9 A;  2P67 A;  2YIU B;  2O1K A;  1L0N E;  3U1C A;  2N9Y B;  4W7Z A;  1L0N G;  1M1J C;  4Y99 B;  4WY4 C;  2YKO A;  1URQ C;  2ZXE B;  1NTZ E;  2W27 A;  2W6J H;  2WSE H;  3CCR P;  5AW5 B;  4OGQ D;  1EZV I;  1Q90 D;  5EFW B;  5KJ7 A;  2ZVO B;  5BVZ A;  2JKV A;  2OYH C;  1PZQ A;  3A0B H;  4GOD A;  3AEF C;  3E1I A;  5KKZ B;  2P1J A;  2HLO A;  2OYI C;  2OGU A;  3L72 G;  3R2P A;  3L71 E;  1NTM J;  3A0H H;  2BAS A;  1U7J A;  3L71 G;  3USS A;  1Q2N A;  1CSB A;  2FY8 A;  2JP3 A;  4UB6 H;  2YXQ B;  2GA1 A;  1M1K Q;  1SQV J;  5AVU B;  2BCC E;  3L35 A;  3V2P A;  3L37 A;  2A45 G;  4PV1 C;  5GTH H;  2IYO A;  2BCC G;  5BU5 A;  4AUW A;  5KLI C;  1LT9 A;  4IOI H;  1PV3 A;  2QEX P;  1SQP J;  1SQQ D;  5KLV J;  1KYO H;  4U3F G;  5CCG A;  3FXE A;  1R5L A;  5KAF E;  4GDO A;  2H8P D;  1W2B O;  1KYO I;  5KAI E;  4W7Y A;  3VMX A;  2WQY C;  1HTL C;  4R4M A;  1DD3 A;  1NJI Q;  3PP5 A;  1P84 D;  5APU A;  1LP1 A;  4HYT B;  5TJH A;  3G71 P;  4XA4 A;  1NTK J;  4JQ0 D;  3V2N A;  3GF7 A;  2YIU C;  1N7L A;  1IK9 A;  3L73 J;  1OW8 A;  3H1J J;  2K37 A;  3C9I A;  4D6T G;  1JOC A;  2A06 D;  4Y99 C;  2WPS A;  3AE9 C;  4BWN A;  1H89 A;  1ZN5 A;  1K04 A;  1T3U A;  1MZ9 A;  2NPS A;  2WMM A;  1VQK P;  5AVR B;  2B89 A;  3ZDM A;  1LTJ B;  3KPE A;  5TIS H;  1EXI A;  2O01 H;  1T6A A;  2N1T B;  4UB8 H;  1FZF A;  4C7R A;  3V2Q A;  2ZT9 B;  1AVY A;  2K9J A;  1RF1 B;  3G4S P;  4KT0 J;  2R5D A;  3M0A A;  2M5A B;  3WUT A;  5B5E E;  2M3E A;  4DZO A;  2KS1 A;  1S9K E;  2KNC A;  2L5G B;  2YMK A;  1GW4 A;  5AVT B;  1BE3 D;  2RMZ A;  3H1K D;  3NMD A;  1K73 Q;  1L4A B;  1RE3 C;  1FU1 A;  1EXJ A;  3L75 J;  4JF7 A;  1JMB A;  2FKW B;  2E76 D;  2XKM A;  3WMM 0;  3CWB D;  1TU3 F;  2VRS A;  1NVO A;  1KB9 E;  2M0B A;  2WT7 B;  2OTL P;  2RH0 A;  1L0L E;  5B66 H;  4ASW A;  3H1I J;  1SQB D;  1EDL A;  3H1L D;  3V4Q A;  1NTM E;  3TGU J;  4AQR D;  2KXP B;  4YPC A;  1OXZ A;  1BGY J;  3CMA P;  1NTM G;  1SQV E;  1PP9 D;  1SQV G;  5APT A;  1M57 D;  3MTU E;  1SQP E;  2A45 H;  2J58 A;  1X9V A;  5KLV E;  1L0L K;  2Y0E A;  1VQ7 P;  3VN0 A;  5KLV G;  1EZV D;  1WT6 A;  1OW7 A;  2A45 I;  2KP8 A;  1S2E A;  3MUD C;  3HE5 A;  4C46 A;  1HUC A;  5AVY B;  3S1K A;  4M3L A;  1HBW A;  3P8C D;  3QH9 A;  2E75 D;  5AVW B;  1YJ9 P;  5KAF H;  1Q81 Q;  4EOT A;  4BRY B;  4ZMD A;  1OX3 A;  1SQP K;  2LXC B;  1LTJ C;  3KDP B;  3FXD A;  3CPW O;  2N1T C;  1NTK G;  2H7H A;  5APY A;  2ZT9 C;  1GU5 A;  1VQO P;  5M1B A;  2I8D A;  1RF1 C;  3L73 G;  5AVZ B;  3H1J G;  4OH8 B;  1GU4 A;  3HUS B;  5AVV B;  3TNU A;  4EI2 A;  3A2A A;  1LWU A;  2GUS A;  2C0W A;  3JC2 2;  3CCJ P;  3M9B A;  3AEA C; 
#chains in the Genus database with same CATH homology
 2XNX A;  3BRT B;  1L4A C;  2IFN A;  4C7N A;  3RK3 D;  2QM7 A;  3HD7 C;  1N7S D;  1GTW A;  3HTK B;  2NPS C;  4GIF A;  1SQX K;  1ZLL A;  1ZR4 A;  2HYN A;  1XTG B;  1KFN A;  3OJA B;  1VPC A;  3HE4 A;  3L36 A;  1H8A A;  1GL2 A;  1IFM A;  3TK1 A;  3BAT A;  3V5B A;  1OWA A;  5AW7 B;  2ZFC A;  2E42 A;  1GD2 E;  5AVQ B;  2HPC B;  2FXM A;  2FFD A;  1W2E A;  1S9K D;  2XV5 A;  4GT1 A;  1T3J A;  3TNU B;  3IR9 A;  3OA7 A;  1J2J B;  1SLQ A;  2P67 A;  3VYI A;  2O1K A;  5CHX A;  1LWU B;  3HRN A;  4I6M C;  5AW6 B;  3U1C A;  2HOD A;  1KIL B;  1CW5 A;  1IFJ A;  1NKZ B;  4W7Z A;  2WPQ A;  1GDT A;  1QL2 A;  4LLH A;  1M1J C;  4Y99 B;  4WY4 C;  1N73 C;  2C0X A;  1CZQ A;  1GW3 A;  2KYV A;  3LID A;  2YKO A;  2QM8 A;  3RL0 B;  1N86 A;  4I2L C;  1URQ C;  5AW9 B;  4C7N B;  2ZXE B;  1RE3 A;  4DOJ A;  4W80 A;  1KIL D;  3RK2 B;  4I1L A;  3EQ2 A;  1ZV8 A;  1A02 F;  2W27 A;  1SVF A;  3LW5 H;  3GHG A;  3HE4 B;  2WSE H;  3A3Y B;  1GL2 B;  1DX7 A;  5AW5 B;  5BU8 B;  3OAK A;  1MUU A;  2C9L Y;  5KJ7 A;  1NH4 A;  1LTB C;  1E5W A;  5APQ A;  2YO2 A;  1LTA C;  5BVZ A;  3B5N A;  1H88 A;  2GM4 A;  1FJP A;  2FFD B;  5APX A;  2OYH C;  2FYZ A;  2N9B A;  5AW2 B;  4AYC A;  3VP9 A;  2YNY A;  1IJD B;  5AW8 B;  3V2R A;  5AVS B;  4IFM A;  2JJL A;  2I1J A;  3E1I A;  1HJB A;  2P1J A;  2HLO A;  2OYI C;  1T2K D;  2HOD B;  1GZL A;  2Z4E A;  2MJZ A;  3R2P A;  2Q7C A;  4WBA A;  3RK3 B;  1JNM A;  1GK6 A;  2BAS A;  3M9Q A;  2R32 A;  2N1T D;  5AW1 B;  1CSB A;  1YTZ T;  3A7O A;  2C9N Y;  3HUS C;  5AVU B;  3L35 A;  3V2P A;  1G2C A;  3L37 A;  1N73 A;  1JO5 A;  2A45 G;  3GHG B;  1SQB K;  5BU5 A;  4AUW A;  5CCH D;  2HFE D;  1SFC A;  3MUD A;  1LT9 A;  4N78 E;  3VTP C;  1NOH A;  3M06 A;  3T97 A;  1HH0 A;  1MFZ A;  5CCG A;  3B5N B;  2W6B A;  2Q9I A;  4LGD E;  2KOG A;  3P8C E;  1IFI A;  4N3Y B;  2KLV A;  3P7K A;  2W6A A;  1QL1 A;  1G1I A;  1L4A D;  3MD0 A;  3EFG A;  2YKQ A;  1KFM A;  2XU6 A;  2XZR A;  2H8P D;  3UIA A;  2P7J A;  3HD7 D;  1LTG C;  1PFI A;  4W7Y A;  3VMX A;  1HTL C;  1LTJ A;  5KJ7 D;  2J59 M;  3H32 A;  1NO4 A;  1RE4 C;  5CJ0 A;  3B5N D;  2N1T A;  4HH2 A;  1M7L A;  3PP5 A;  1T8Z A;  3N4X A;  1AFO A;  2HG5 D;  2PAJ A;  3M0D C;  5APU A;  1RF1 A;  2POH A;  4HYT B;  1MV8 A;  3P32 A;  3SWF A;  1FZC A;  4XA4 A;  3V2N A;  3NFQ A;  1RF0 C;  1N7L A;  1IK9 A;  1LWU C;  5CCH A;  1G2C B;  1KQL A;  1IFD A;  3G3Z A;  1N73 B;  1JMM A;  3C9I A;  1KIL C;  5KTB A;  1JOC A;  4XE5 B;  1FOS F;  3TSI A;  1SFC B;  2R5B A;  3CI9 A;  4Y99 C;  1LT9 B;  1FZB A;  2WPS A;  1LTI C;  3RL0 C;  1H89 A;  3LIE A;  1DH3 A;  4GKG A;  1NTM K;  2IPP A;  1ZN5 A;  1L4A A;  1T3U A;  3M9H A;  4WY4 D;  1JY2 P;  3HD7 A;  2KB7 P;  3RK2 C;  1JUN A;  1URQ D;  1MZ9 A;  2NPS A;  1N2D C;  2M3B A;  2Z5I A;  1HVV A;  1SFC D;  1SQV K;  5AVR B;  1KZU B;  1GL2 C;  4ZKP A;  1LTJ B;  2I1K A;  3KPE A;  1Z56 A;  3N7N A;  3H32 B;  4JYC A;  2WT7 A;  5CCG D;  2WSC H;  2O01 H;  2H43 A;  5CMZ A;  2N1T B;  1FZF A;  4C7R A;  3V2Q A;  1T2K C;  1JY2 N;  3TYY A;  1HGV A;  1J1D B;  1RF1 B;  2FFD C;  4ZKU A;  5KLV K;  1J1E B;  5APS A;  1JY2 O;  1FZC B;  3VP8 A;  1FZG A;  2R5D A;  3BAS A;  3M0A A;  1CI6 A;  4DZO A;  1S9K E;  2O1J A;  1IC2 A;  1GK4 A;  2L5G B;  1FBM A;  3M91 A;  1FZA A;  2Z5H A;  1FZE A;  4IFD K;  2YO3 A;  1GW4 A;  3RK3 C;  5AVT B;  1M1J A;  4WY4 A;  3A5T A;  2WWW A;  3V4W A;  1FOS E;  1N7S C;  3IFM A;  3NMD A;  1URQ A;  2PP6 A;  2Q3I A;  2WZ7 A;  1L4A B;  1RY3 A;  1RE3 C;  1WRG A;  3NTN A;  1FU1 A;  3HD7 B;  4JF7 A;  2KSJ A;  1YYC A;  2NPS B;  1NTK K;  2FKW B;  3GHG C;  1X79 B;  2XKM A;  4IFF A;  3WMM 0;  2WTY A;  2P2U A;  2VRS A;  3BVH A;  2FYU K;  2WT7 B;  3I5C A;  2XDJ A;  3MGN A;  3MIW A;  5KJ7 C;  2IX7 C;  2NPS D;  3B5N C;  3V4Q A;  4AQR D;  1VDF A;  2OYH A;  5APW A;  1EQ7 A;  3BRV B;  1OXZ A;  2R3C A;  2YKP A;  2WSF H;  1CI6 B;  2OYI A;  1G1J A;  1AQ5 A;  1ZR2 A;  2LKM A;  1FDM A;  1M1J B;  4WY4 B;  5APT A;  1JTH A;  2CPS A;  3CL3 D;  1URQ B;  3MTU E;  2A45 H;  2M8R A;  2J58 A;  1X8Y A;  1FAV A;  1X9V A;  1L0L K;  3HUS A;  4B86 A;  3VN0 A;  1NU1 K;  1N7S A;  1JY3 P;  4N78 D;  1WT6 A;  1HGZ A;  1XTC C;  3SWY A;  1YTZ I;  2A45 I;  1SFC C;  1SP4 A;  2KP8 A;  1LT9 C;  3HE5 A;  4C46 A;  1HUC A;  3VOP A;  5AVY B;  4JYB A;  4KHX A;  4M3L A;  1HBW A;  3P8C D;  4LC1 A;  1IO4 A;  5CCG C;  5CJ4 A;  3RL0 D;  1NKN A;  2CPB A;  2OYH B;  4RES B;  5AVW B;  3VMZ A;  3U1A A;  3HTK A;  1JY3 N;  4EIJ A;  3CLQ A;  2E43 A;  1L0N K;  2WIT A;  4EOT A;  1HWT C;  3P8M C;  2WPR A;  1A02 J;  1SQP K;  3RK2 D;  4O9B A;  5AW3 B;  1LTJ C;  1JY3 O;  1JCC A;  1LTT C;  3KDP B;  2OYI B;  3KYQ A;  4WB4 A;  1RE4 A;  2N1T C;  2H7H A;  2GUV A;  2Q5U A;  5APY A;  3H6P A;  1GU5 A;  1GL2 D;  1LGH B;  1LTS C;  1JTH B;  1J1D C;  3O8Z A;  1NWQ A;  1RF1 C;  3M0D A;  5AVX B;  1NHL A;  3L4F A;  5AVZ B;  2HPC A;  1NTZ K;  1J1E C;  1FZC C;  4OH8 B;  1GU4 A;  3HUS B;  5AVV B;  3TNU A;  2YMY A;  3B8E B;  4N6J A;  5AW4 B;  1FJK A;  2IFM A;  5CCH C;  1RF0 A;  3A2A A;  1LWU A;  1JCD A;  3II6 A;  1NAF A;  3VMY A;  2GUS A;  3KQG A;  3U59 A;  2OAR A;  1N7S B;  1IFN A;  1SQQ K;  1KIL A;  5AW0 B;  2C0W A;  1DEB A;  3M9B A;  3NXS A;  5APV A;  2JEE A;  3HE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...