1GTWA

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the tom-1a promoter
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
total genus 31
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gtwA00
3B8EB 2Z5HA 1A02J 4AQRD 1HUCA 1H89A 1NAFA 1S9KE 3P7KA 1H8AA 1SLQA 2Z5IA 1GK6A 5AVTB 1G2CB 3OAKA 2E43A 3KQGA 4KHXA 1OWAA 3UIAA 2R3CA 2Q5UA 2KP8A 3M0AA 1FAVA 5AVYB 1CI6B 2Q7CA 4JYBA 2W6AA 1HWTC 5AW2B 1GZLA 3VTPC 2C9NY 4HYTB 4DZOA 3KDPB 1NWQA 1GD2E 2R5DA 4M3LA 3M0DA 4C46A 1CZQA 3M9HA 4C7NB 2WT7A 1KQLA 5AW5B 2YO2A 5AW7B 2BASA 5CMZA 1A02F 4XE5B 3HE4B 5AW6B 5AW4B 2WPQA 1IO4A 1YYCA 5AVZB 2IPPA 3O8ZA 3TNUA 5APVA 3VYIA 4LC1A 2P7JA 2WWWA 2YO3A 5APTA 5APUA 5AVXB 2VRSA 1FOSE 4AUWA 1MV8A 3MD0A 3TK1A 4I2LC 1J2JB 3SWFA 3L36A 3A5TA 5AW3B 1T2KD 3HE5A 3L35A 1HBWA 3NXSA 5APYA 2ZFCA 2QM8A 5APXA 2H7HA 4JYCA 2QM7A 3P8MC 5APQA 2WT7B 5AVQB 1X8YA 3L37A 1GU5A 1CI6A 3I5CA 3NMDA 2XV5A 3TNUB 3VMYA 5APSA 2WPRA 1JUNA 4GKGA 1GU4A 4AYCA 4EOTA 5AW1B 2JJLA 3T97A 2N9BA 3VN0A 1SP4A 3MGNA 1GK4A 3HE5B 1FOSF 2E42A 2XZRA 2P67A 5AVSB 5AVWB 3NFQA 1DH3A 3NTNA 3A2AA 1S9KD 3A7OA 5AVUB 5AVVB 3V5BA 5AW0B 5AW8B 3A3YB 2C9LY 2WPSA 4I6MC 3TYYA 3HTKA 2YNYA 3P32A 3M06A 1H88A 1T2KC 2W27A 4RESB 3VMZA 2WTYA 1MFZA 2Q3IA 3V4WA 1GTWA 1HJBA 3V4QA 5AW9B 4B86A 2XU6A 3VMXA 5AVRB 2P2UA 2ZXEB 3LIDA 5APWA 4C7NA 1CSBA 4GT1A 1OXZA 3HE4A 1JNMA 2R5BA 3LIEA 3M9BA 1MUUA 3M91A 2R32A 3IR9A
chains in the Genus database with same CATH superfamily
2KS1B 1FDIA 1SQXE 1VQMP 2XDJA 5CJ4A 4UB6E 3LW5J 3HTKB 1OW7A 1YITP 4JF7A 1LWUC 4PD4D 1AFOA 1CZQA 3V2NA 3TNUA 2YIUC 5APVA 4ZKPA 1MV8A 4D6TD 3G4SP 1SFCA 2FYUK 3CL3D 1N73A 1M90Q 5APXA 2IYOA 1GL2D 3BASA 3WUTA 1CW5A 3L73D 4OGQD 1X22A 1JCDA 3L37A 1M56D 2JDIH 2NPSC 2E75C 1NTME 2GA1A 1L0NK 1JUNA 4WY4D 4DCKA 1S3JA 1SP4A 5CBNA 1P84H 4GOFA 3E7KA 1NJIQ 1IFMA 2CPSA 3RK3D 1NU1D 4OVNF 5AW9B 2XU6A 1X0TA 1KQSO 4GIFA 3H1HJ 1SQBD 3H1LJ 5E79E 3PLNA 1JY3O 3B5NC 2PRRA 2ZFCA 3S1KA 2H7HA 1J1EC 1L0LD 1G2CB 3AE6C 2FYUJ 1AQ5A 4JYBA 2W6AA 3WUVA 2QJPB 2WPVB 2R5DA 2HODA 3L71D 1JCCA 3MP7B 1VF5B 3TF5A 1YQ3C 1Q2NA 2I1JA 2W6JH 5APUA 5AW3B 2HLOA 3L35A 4YXDC 2PAJA 1X79B 3H1HG 3P8MC 2HR3A 3IAOA 3H1LG 4PJ0E 2B87B 1LWUB 2WQYC 1EZVE 2E74C 2FYUG 5AW1B 1QL2A 3RL0C 1R8EA 4TLFA 1ZRTE 3TGUJ 4NPDA 1LTIC 3EQ2A 3U1AA 4GT1A 1OXZA 3AEEC 3D6ZA 3LIEA 2E75B 2KUBA 1ZR2A 3PP5A 3AEAC 1SVFA 1KB9E 4I1LA 3M0AA 1RF1A 1SQVJ 2WSCJ 5DJUB 1OZHA 2OARA 1MKMA 2KK7A 3VTPC 3KDPB 3HD7A 1DEBA 1BE3D 1VQ6P 1RE4C 2B9BA 5CHXA 5BU5A 2H89C 4H44C 1QVGO 1RE3A 2P7JA 5APTA 2YO3A 3TGUG 1EZVI 1KZUB 3SFDC 3B5NB 3HE5A 2Y9YA 2OYHC 4PD4E 2K9JA 2O01N 3C8VA 5CBOA 2FFDC 1L0LK 3AEFC 1GU5A 3MIWA 5KTBA 4D6TE 4YXWH 3CC7P 1VF5D 1DX7A 1L2PA 1SQVG 1FZCC 3KPEA 1FBMA 2WSEJ 2JP3A 2QA4P 3L73E 2AXCA 5KJ7D 1KB9I 4IFFA 1Y8AA 4EDFA 1H88A 1YBKA 2WTYA 2FY8A 1PP9J 4B86A 2IBZD 1YQ4C 4H0LD 4H13B 1GL2C 2UWJE 4OGQC 1MUUA 1DD3A 2RKLA 3L74E 5B66H 4WBAA 5KAFH 1NAFA 3RK3E 3O6QA 1SLQA 4WY4C 3GLMA 1KV4A 1NU1E 3RL0B 1AVOA 4N3YB 4PD4I 5AW2B 1K9MQ 1SQBE 2FBWC 3VOPA 4C7NB 3M9HA 1KQLA 1DD4A 2C0WA 1LP1A 3RK3C 1VQ9P 1IO4A 2NZ2A 1L0LE 5H2FE 3JSVC 3TK1A 3AE1C 3H1JJ 3M0DC 3H6PA 3G6EP 1E5WA 2ITAA 1LNQA 5BU8B 1PP9G 3L71E 4JYCA 3L4FA 3PJSK 1SQQJ 4WWIA 4AYCA 2I1KA 2YKQA 4H44B 3R4YA 4YTPC 1KILA 4BXLA 2OTLP 2HFED 1BGYJ 2KZIA 3AEGC 3ABVC 2V7QJ 1MZ9A 4RKUJ 2OYHB 1U7JA 4UB6H 1RH5B 1GTWA 5KLVJ 3VMXA 3CD6P 3BRVB 2K1AA 2QIWA 4W7YA 3H1JG 1KORA 1VQ4P 3C9IA 3HUSA 2OTJP 4WVZA 3IFMA 1OFCX 4GOEA 3PRJA 4C7RA 3KQGA 3QWOC 3UIAA 1SQQG 3FWLA 1JO5A 3L75J 3V2QA 2L5GB 3W68A 4OH8B 3MUDA 1VQOP 2KSJA 5AW7B 4XE5B 3AE9C 2SPZA 3GHGA 2N1TA 1BCCJ 3V2RA 1FZEA 5AVXB 4H13D 1GL2B 2IZ1A 5TISE 1HF9A 1BGYG 5K5GB 3BRTB 1LTSC 4OGQB 1NTKJ 1QL1A 3L36A 1T2KD 4LGDE 1VDFA 1BE3E 3BCCJ 5KLVG 1N86A 4WY4B 2MKVA 1FZAA 2AXTE 2WT7B 5B66E 1IC2A 4HB1A 2P58A 1SQXK 1IFPA 3CXHD 4W7ZA 1S4XA 3OA7A 3D6YA 3RK3B 1JOCA 2BCCD 1EQ7A 5E79H 3U1CA 3L75G 3NTNA 2J58A 2OGUA 2C9LY 2A06D 3H1ID 1BCCG 5CCHA 1URQA 1SS1A 2V4HA 2FYZA 4NPEA 1W2EA 1NTKG 1S72P 2R5BA 1S2EA 3M9BA 2QVAA 2HYNA 1IK7A 2Z5HA 3L72D 3BCCG 3JCUE 2K9YA 2JEEA 1L4AA 1H0TA 2KLVA 1EXIA 2ZVNB 1RQVA 2M3BA 1VF5C 2IBZE 2G3AA 4HYTB 5CCGC 1NWQA 1FU1A 3PHLA 1SQXJ 1ZR4A 1ZXGA 1A02F 5KJ7C 2E76D 1YYCA 4PJ0H 3BATA 2P10A 5B5EE 4H0LC 1HGVA 1PPJG 3CC2P 2JWAA 1N8RQ 2M3EA 1FDMA 3CX5D 1SQVD 3Q5PA 1LTTC 2WSFH 1J1DC 1LTJA 2OYIA 1EDKA 5L8RJ 3L70D 1FDOA 1FS0E 4I7ZB 2WITA 2YXRB 1FOSF 1FJKA 1NTMJ 3MZWB 1U57A 1SQXG 1K8AQ 4I6MC 3TYYA 3M06A 4JQ0D 2BEZF 1KB9H 2IBZI 2W6BA 3QH9A 3IN6A 4HH2A 3T97B 2KXPB 3M91A 3L74D 1S5LE 2ZYDA 3AE2C 3PTZA 1BDCA 2NRGA 2POHA 4N78D 3CCLP 1N7SA 1ZV8A 4DZOA 1ZMEC 4PD4H 1KILD 4M3LA 1PP9D 3H32A 2Y0DA 1K04A 1USEA 3JC22 1D7MA 5TJHA 2HG5D 1NTMG 3AECC 3FWNA 2Q1KA 1PV3A 4LLHA 2NPSA 2I8DA 3H1KJ 1PGOA 1LT1A 3FXDA 1X9VA 1NO4A 2D2CD 4U7JA 5M1BA 1L0NJ 2AEFA 2FKWB 4PV1D 2XV5A 1NH4A 4O9BA 3TNUB 2WPRA 1IFDA 3WMM0 3E1IA 1NYHA 3D71A 2B88A 3VN0A 1SFCB 1N73B 1M57D 5AVSB 3RK2B 4H0LB 4H13C 1JY2N 3AE5C 3CXHE 1T2KC 1E79H 1SQQD 1HGZA 3V4QA 1XTGB 2WMMA 2WSFJ 2BCCE 1J1DB 2KOGA 1SQPD 2M8RA 2M5AB 1RF1C 3H1KG 1H89A 5H2FH 2A06E 3F89A 3H1IE 4U3FD 1LTGC 1XTCC 3N4XA 2A45H 3Q3DA 1NGMB 1L0NG 3CWBD 3GW6A 5BVZA 1RE3C 3KHUA 1LGHB 4JBZA 3CMEP 1OW8A 3L72E 3CLQA 1NTZD 4W80A 5AVZB 4ZKUA 2W90A 1KN7A 3PH0A 2E5YA 3CCSP 1EZVG 3C1LA 1JTHA 3Q5SA 3A5TA 1KYOD 2M0BA 4OWFA 3L75D 2QM7A 2HODB 3CXHI 3S4RA 1NU1K 3I5CA 3AE7C 4R4MA 3CC4P 3VMYA 3ITKA 5C39A 1SQBK 1YHQP 3CCQP 2E76C 3CX5E 1SQVE 1NTKD 4KJMA 2P67A 3I56P 1GW3A 2ZVOB 4CPGA 3G71P 2Q3IA 3L70E 1IFJA 4DJGA 1BDDA 2HPCA 1Q90D 5KLIC 5APWA 2QRXA 1RQUA 3HE4A 1FZGA 2R32A 1DEEG 2Y0CA 2KNCA 4K3AA 5TISH 1SFCD 3VP8A 3RK2D 1JY3N 1N2DC 1PPJD 1VQKP 4HJGH 1LJ2A 1PGQA 1NU1J 2AXTH 2WPQA 4IL6E 1OMIA 2VRSA 1EC5A 1SQBJ 2FFDA 3SWFA 1VQ7P 4N78E 2KIKA 1PGPA 1RF1B 1DIPA 3MTUE 1KILE 3CX5I 1HBWA 1L0LJ 1PP9E 1SQPK 2ZT9D 3HD7B 1LTBC 2DW3A 4ZMDA 1FZCA 1NKZB 3MHVA 1N7SD 1KILC 3L71J 1GU4A 1VQ8P 2O1JA 1M1JA 4BRYB 3HE5B 2E42A 1RF0A 2LXBA 2G8YA 1NTZK 4GDOA 1VPCA 1U7MA 1GL2A 2K9JB 1RHZB 3JCUH 1NU1G 1LT9A 1BSNA 2BEQD 2WSSH 2ZXEB 1SQBG 2C0XA 1M8OB 2D2CC 2Y9ZA 3B8EB 4PV1C 2WVRA 1L0LG 1G1JA 5B5EH 3H25A 1FZFA 2Z4EA 1SQQE 2KP8A 3MUDC 3N7NA 2E76B 4TT3H 1CI6B 2Q7CA 3AE8C 1ZOYC 3A0HE 2O3JA 5GTHE 1NKNA 3M0DA 3L71G 1PIXA 3WUUA 4IOIH 1SQPE 2Q3EA 5KLIB 3VYIA 1M1KQ 3F5HA 3HRNA 4U3FE 1FOSE 1IFNA 3FGAD 2XNDH 2A45I 3O6QB 1J2JB 3CMAP 3CWBE 3E1RA 2GUSA 1NAYA 3BVHA 2Y0EA 2QJYC 3H1HD 1NTZE 3H1LD 1LP1B 4I7ZC 2ZXXA 1BE3J 2H88C 1OVVA 1KYOE 2FYUD 2KS1A 3A0BH 3L75E 1S5LH 1T6AA 3H1KD 2ZYGA 3A3YB 2WPSA 3HTKA 1EDIA 3VMZA 1IZNB 1IJDB 1L0ND 3HD7D 1BSHA 2E74D 2KLUA 1QLED 1NTKE 1WMKA 1FJPA 2BASA 3IR9A 1NHLA 1KC8Q 4ASVA 3USSA 1KILB 1Q7YQ 1GMJA 1PZQA 1OWAA 1FAVA 5AVYB 2PGDA 1OIPA 1G1IA 1NVOA 1BE3G 1ZLLA 2B89A 1WT6A 2IPPA 1Q82Q 3O8ZA 3HUSB 5GTIE 4EYYQ 1S5LX 2AEJA 2KYVA 3TGUD 4NPFX 1YJ9P 1KYOI 2D2CB 1PPJE 4PV1B 3Q2YA 4RO0A 3NXSA 3AEDC 1LTJC 3I55P 2OYIC 3SWYA 1N7LA 1Z56A 2YMKA 2O01H 1KD1Q 3OW2O 1SFCC 3GHGB 2N1TB 1N73C 3CXHH 2Q9IA 2H8PD 3RK2C 2FYNC 4GKGA 2MJZA 5DJTB 2W83C 1GK4A 1P84D 2H43A 1VL2A 1G2CA 3OJAB 3W67A 5AVUB 5AVVB 3SSUA 4EIJA 3CCVP 3V4WA 2IBZG 1FZBA 2ZT9C 2QJYB 1CSBA 3CCRP 3KZIE 5CCGA 1FC2C 1RY3A 1N7SC 1EDJA 4KHXA 5KJ7A 2PP6A 3P8CD 3GF7A 3B71A 1URQB 1YI2P 3SWKA 2IFNA 2AEMA 4L73A 1Y47A 4WB4A 1KQGB 3A0BE 2YO2A 1GDTA 5AW6B 1K05A 2B87A 1LWUA 3AE4C 4L74A 2FXMA 4GODA 1AQTA 1KMIZ 1L4AB 3Q5RA 1FE6A 1H0TB 1YJWP 2JWDA 2M5AA 4MN4C 3CX5H 2XKMA 2WSCH 2IFMA 4BWNA 3TDKA 4Y99B 4HKZH 3NMDA 2JO1A 2ZYAA 1QEXA 1W5CE 2JJLA 2CPBA 5CJ0A 2IYPA 3V2PA 4L75A 3H1HE 3VP9A 3H1LE 3V5BA 2P1JA 5AW8B 1T8ZA 2O1KA 1JMBA 4RESB 1LTJB 2OYIB 1JMMA 2L91A 2P2UA 2FYUE 1UIIA 2O01J 3H1JD 2N1TD 3EFFK 2FYNB 3II6A 3H1KE 2LKMA 3P7KA 4IL6H 1R5SA 1OW6A 3B5NA 2WSEH 2BCCJ 4R4LA 3WU2E 1L0NE 2C9NY 4UB8H 1SQVK 4C46A 2QE7H 3H1IJ 4ASWA 4DT0A 4A7PA 1JB0J 1JY2P 2ZT9B 4YPCA 4AUWA 3RBXA 2XNXA 3HD7C 2ZJSE 1BGYD 2JR8A 1QGKB 3L72J 2YIUB 2IX7C 1N7SB 2W8ZA 3CCMP 5KLVD 3M9QA 4IFDK 3FX0A 3V6IA 5APQA 1X8YA 1VQNP 2J5UA 3H32B 1IK9A 5CCHD 4Z1MH 1URQD 5APSA 3TGUE 3AEBC 3FXEA 4IL6X 4EOTA 2BCCG 1K73Q 1HVVA 2N9YB 2E5TA 2NPSB 2XZRA 3NFQA 3A2AA 1R5LA 1S9KD 1L4AD 2A06G 3H1IG 3GG2A 2YNYA 3S9OA 3SFEC 1BCCD 3EWKA 3A0HH 4C7NA 2KSEA 5GTHH 1P84E 2YKPA 3L72G 4D6TJ 4AQRD 1HUCA 3L70J 1Q86Q 3BCCD 2J59M 2Z5IA 5AVTB 1GK6A 3CCEP 2K3RA 2R3CA 4BRYA 2IDBA 1HWTC 2V7QH 1J1EB 3D70A 3L73J 2RN0A 1GD2E 3CI9A 3Q1MA 5CMZA 1OVRA 2QG4A 4LC1A 2KB7P 1RE4A 3MD0A 3P8CE 4I2LC 2QEXP 1VQ5P 1KYOH 3AE3C 3L74J 2FXPA 5CCGD 4KT0J 3RBZA 2R44A 1YIJP 2OYHA 3EFGA 5KKZC 1CI6A 2YKOA 1M1JC 4D6TG 1SQQK 3L70G 1RF0C 2YMYA 1JY3P 1JTHB 4XA4A 2N9BA 4UB8E 1P84I 2OQQA 1LT9C 1PGJA 2RMZA 4DOJA 3L73G 2E74B 1PL5A 1SQXD 2FXOA 1ZW0A 2LXCB 1HH0A 3P32A 1GW4A 4ZNCA 1HJBA 3RGUA 5AVRB 3ZDMA 5KLVK 1Y9BA 3R2PA 1M7LA 3L74G 1A02J 1YTZI 1H8AA 5GTIH 1NOHA 2CK3H 1AJYA 1ZN5A 3KYQA 2Q6QA 1AV1A 1OX3A 2NPSD 2E75D 1TU3F 2WZ7A 1GZLA 3HUSC 4WY4A 1JM0A 2HPCB 3TSIA 3H1JE 3U59A 2WT7A 4JPZB 1USDA 3HE4B 3KXDA 1T3UA 1KQFB 1S1CX 5KAIH 1NTMD 2KNCB 2A45G 2QJKC 1SQPJ 4K35A 3GHGC 2N1TC 1NTKK 4QMAA 5APYA 2QM8A 4U3FJ 4L76A 5AVQB 3B5ND 3CWBJ 1LTAC 2IZ0A 4IFMA 1BGYE 3B4SA 1YJNP 2FFDB 1T3JA 2K88A 1NTZJ 1OVUA 3LW5H 2QSIA 5KLVE 3CCUP 5AVWB 2K37A 3CPWO 1DH3A 3KZIH 1ZP0C 3RL0g 3A7OA 5AW0B 4Y28J 3G3ZA 2W27A 1FZCB 1MFZA 1Q81Q 1EDLA 3LIDA 1QX8A 1IFIA 5KKZB 1SQPG 3CCJP 1M1JB 5CCHC 1S9KE 1URQC 4U3FG 2OTKE 3OAKA 2E43A 5EFWB 2PFXA 2Q5UA 3VMAA 1LT9B 1BCCE 3CWBG 4N6JA 1HTLC 1KFMA 3IF4A 1KFNA 1QVFO 1L4AC 5AW5B 2RH0A 1HJ0A 3RL0D 3GF3A 5AW4B 1NTZG 5KAFE 3GMAA 3BCCE 1VQLP 2WWWA 1AVYA 1EZVD 4Y99C 1AA0A 4XFJA 2JKVA 4EI2A 2KI7B 1PFIA 2GUVA 1W2BO 1ZRTD 2R3SA 1JY2O 1YTZT 3G9RA 3T97A 2ZAEB 3MGNA 2QJPC 1KTMA 2GM4A 2OYOA 2QJKB 1NTMK 1VQPP 1JEKA 1KB9D 1EXJA 4H44D 5KAIE 3WU2H 2LR2A 1WRGA 1MFTA 4RJTA 2YXQB 1UIXA 2KZJA 1JNMA 3K5BA
chains in the Genus database with same CATH topology
3II6A 3IFMA 2LKMA 3P7KA 4C7RA 3KQGA 2XDJA 3B5NA 5CJ4A 3UIAA 2WSEH 1JO5A 1SFCD 3HTKB 3VP8A 3RK2D 1JY3N 1N2DC 4JF7A 3V2QA 2C9NY 1LWUC 2L5GB 1SQVK 4OH8B 4C46A 3MUDA 1AFOA 1CZQA 2KSJA 5AW7B 4XE5B 3V2NA 3GHGA 2N1TA 2WPQA 3V2RA 3TNUA 1FZEA 5APVA 5AVXB 1JY2P 2VRSA 4ZKPA 4AUWA 1MV8A 2XNXA 1GL2B 3HD7C 2FFDA 3BRTB 3SWFA 1LTSC 4N78E 1QL1A 3L36A 1T2KD 4LGDE 1SFCA 2FYUK 3CL3D 1RF1B 1N73A 1VDFA 3MTUE 1HBWA 2IX7C 1SQPK 1N7SB 1N86A 5APXA 3HD7B 3M9QA 4WY4B 4IFDK 1GL2D 3BASA 1LTBC 1CW5A 1FZAA 5APQA 2WT7B 1X8YA 1IC2A 3H32B 1IK9A 1SQXK 1JCDA 3L37A 1NKZB 1FZCA 5CCHD 2NPSC 1URQD 5APSA 4W7ZA 1N7SD 3OA7A 1L0NK 1JUNA 1KILC 4WY4D 1GU4A 4EOTA 3RK3B 2O1JA 1M1JA 1JOCA 1SP4A 1EQ7A 3HE5B 2E42A 3U1CA 1RF0A 1HVVA 2NPSB 2XZRA 3NFQA 3NTNA 1NTZK 3A2AA 1VPCA 1GL2A 1S9KD 1L4AD 2J58A 1IFMA 2CPSA 3RK3D 2C9LY 1LT9A 2YNYA 5CCHA 1URQA 5AW9B 2XU6A 2ZXEB 4GIFA 4C7NA 2FYZA 1W2EA 1JY3O 2R5BA 2C0XA 3M9BA 2YKPA 3B5NC 2ZFCA 2H7HA 2HYNA 3B8EB 2Z5HA 1J1EC 4AQRD 1HUCA 1G1JA 2J59M 2Z5IA 5AVTB 1GK6A 2JEEA 1G2CB 1L4AA 1AQ5A 2KLVA 2R3CA 1FZFA 2Z4EA 2KP8A 3N7NA 1CI6B 2M3BA 2Q7CA 4JYBA 2W6AA 1HWTC 1J1EB 4HYTB 5CCGC 1NWQA 1FU1A 1GD2E 2R5DA 3CI9A 1NKNA 2HODA 3M0DA 1ZR4A 1A02F 5CMZA 5KJ7C 1JCCA 1YYCA 2I1JA 3BATA 3VYIA 4LC1A 2KB7P 3HRNA 5APUA 1FOSE 1IFNA 1RE4A 3MD0A 3P8CE 2A45I 4I2LC 1J2JB 1HGVA 5AW3B 2HLOA 3L35A 1FDMA 5CCGD 2GUSA 2PAJA 1X79B 3BVHA 3P8MC 1LTTC 2OYHA 2WSFH 1J1DC 3EFGA 1CI6A 2YKOA 1LTJA 1M1JC 1LWUB 2OYIA 1SQQK 1RF0C 5AW1B 1QL2A 2YMYA 1JY3P 1JTHB 4XA4A 3RL0C 2N9BA 2WITA 1FOSF 1LT9C 1FJKA 4DOJA 1LTIC 3A3YB 2WPSA 4I6MC 3TYYA 3HTKA 1HH0A 3EQ2A 3P32A 3M06A 1GW4A 3VMZA 2W6BA 1HJBA 1IJDB 3HD7D 5AVRB 3U1AA 4GT1A 4HH2A 1OXZA 5KLVK 3R2PA 1M7LA 3LIEA 1FJPA 2BASA 3M91A 3IR9A 1A02J 1YTZI 1NHLA 1KILB 1ZR2A 3PP5A 1H8AA 2POHA 1SVFA 1NOHA 1OWAA 1ZN5A 4I1LA 3M0AA 1FAVA 1RF1A 5AVYB 4N78D 3KYQA 2NPSD 2OARA 2WZ7A 1G1IA 1GZLA 1N7SA 3HUSC 3VTPC 1ZV8A 4DZOA 3KDPB 1ZLLA 3HD7A 4WY4A 1DEBA 1KILD 2HPCB 4M3LA 3TSIA 3U59A 2WT7A 1RE4C 3H32A 1WT6A 3HE4B 5CHXA 5BU5A 2IPPA 3O8ZA 1RE3A 1T3UA 3HUSB 2HG5D 2P7JA 5APTA 2YO3A 2A45G 1KZUB 2KYVA 4LLHA 3B5NB 3HE5A 3GHGC 2OYHC 2N1TC 2NPSA 3NXSA 1NTKK 5APYA 1LTJC 2QM8A 2OYIC 3SWYA 1N7LA 2FFDC 1L0LK 1X9VA 1Z56A 5AVQB 3B5ND 1NO4A 2O01H 1LTAC 1GU5A 3MIWA 1SFCC 2FKWB 2N1TB 3GHGB 5KTBA 1N73C 4IFMA 2XV5A 2H8PD 2Q9IA 1NH4A 4O9BA 3TNUB 3RK2C 2WPRA 1IFDA 3WMM0 4GKGA 3E1IA 2FFDB 2MJZA 1T3JA 3VN0A 1DX7A 1GK4A 1SFCB 3LW5H 1FZCC 3KPEA 1N73B 5AVSB 5AVWB 1FBMA 3RK2B 2H43A 1DH3A 1G2CA 3OJAB 3A7OA 5AVUB 5AVVB 5AW0B 5KJ7D 1JY2N 3G3ZA 4IFFA 1H88A 4EIJA 1T2KC 2W27A 2WTYA 1MFZA 3V4WA 1FZCB 1HGZA 3V4QA 4B86A 1XTGB 1FZBA 3LIDA 1GL2C 1IFIA 1CSBA 1J1DB 2KOGA 1M1JB 1MUUA 2M8RA 5CCGA 1RF1C 5CCHC 4WBAA 1RY3A 1NAFA 1S9KE 1H89A 1URQC 1N7SC 1SLQA 3OAKA 2E43A 4WY4C 1LTGC 4KHXA 1XTCC 3RL0B 5KJ7A 3N4XA 2PP6A 3P8CD 2Q5UA 1LT9B 2A45H 4N6JA 1HTLC 4N3YB 5AW2B 1KFMA 1URQB 2IFNA 5BVZA 1RE3C 1LGHB 3VOPA 1KFNA 4WB4A 1L4AC 3M9HA 4C7NB 1KQLA 5AW5B 2YO2A 2C0WA 1GDTA 3RL0D 3RK3C 5AW6B 5AW4B 1LWUA 3CLQA 1IO4A 4W80A 5AVZB 2FXMA 4ZKUA 2WWWA 3TK1A 3M0DC 1L4AB 1JTHA 4Y99C 3A5TA 3H6PA 1E5WA 5BU8B 2XKMA 2WSCH 2IFMA 4JYCA 3L4FA 2QM7A 1PFIA 2GUVA 2HODB 4Y99B 1NU1K 3I5CA 3NMDA 3VMYA 1JY2O 1YTZT 4AYCA 2JJLA 3T97A 2I1KA 2CPBA 1SQBK 2YKQA 3MGNA 5CJ0A 2P67A 1KILA 3V2PA 2GM4A 2HFED 1GW3A 3VP9A 3V5BA 2P1JA 5AW8B 1T8ZA 1MZ9A 1NTMK 2OYHB 2O1KA 4RESB 2Q3IA 1GTWA 1LTJB 1IFJA 2OYIB 3VMXA 2HPCA 3BRVB 1JMMA 2P2UA 5APWA 4W7YA 1WRGA 3HE4A 1JNMA 2N1TD 1FZGA 3C9IA 2R32A 3HUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8E B;  2Z5H A;  1A02 J;  4AQR D;  1HUC A;  1H89 A;  1NAF A;  1S9K E;  3P7K A;  1H8A A;  1SLQ A;  2Z5I A;  1GK6 A;  5AVT B;  1G2C B;  3OAK A;  2E43 A;  3KQG A;  4KHX A;  1OWA A;  3UIA A;  2R3C A;  2Q5U A;  2KP8 A;  3M0A A;  1FAV A;  5AVY B;  1CI6 B;  2Q7C A;  4JYB A;  2W6A A;  1HWT C;  5AW2 B;  1GZL A;  3VTP C;  2C9N Y;  4HYT B;  4DZO A;  3KDP B;  1NWQ A;  1GD2 E;  2R5D A;  4M3L A;  3M0D A;  4C46 A;  1CZQ A;  3M9H A;  4C7N B;  2WT7 A;  1KQL A;  5AW5 B;  2YO2 A;  5AW7 B;  2BAS A;  5CMZ A;  1A02 F;  4XE5 B;  3HE4 B;  5AW6 B;  5AW4 B;  2WPQ A;  1IO4 A;  1YYC A;  5AVZ B;  2IPP A;  3O8Z A;  3TNU A;  5APV A;  3VYI A;  4LC1 A;  2P7J A;  2WWW A;  2YO3 A;  5APT A;  5APU A;  5AVX B;  2VRS A;  1FOS E;  4AUW A;  1MV8 A;  3MD0 A;  3TK1 A;  4I2L C;  1J2J B;  3SWF A;  3L36 A;  3A5T A;  5AW3 B;  1T2K D;  3HE5 A;  3L35 A;  1HBW A;  3NXS A;  5APY A;  2ZFC A;  2QM8 A;  5APX A;  2H7H A;  4JYC A;  2QM7 A;  3P8M C;  5APQ A;  2WT7 B;  5AVQ B;  1X8Y A;  3L37 A;  1GU5 A;  1CI6 A;  3I5C A;  3NMD A;  2XV5 A;  3TNU B;  3VMY A;  5APS A;  2WPR A;  1JUN A;  4GKG A;  1GU4 A;  4AYC A;  4EOT A;  5AW1 B;  2JJL A;  3T97 A;  2N9B A;  3VN0 A;  1SP4 A;  3MGN A;  1GK4 A;  3HE5 B;  1FOS F;  2E42 A;  2XZR A;  2P67 A;  5AVS B;  5AVW B;  3NFQ A;  1DH3 A;  3NTN A;  3A2A A;  1S9K D;  3A7O A;  5AVU B;  5AVV B;  3V5B A;  5AW0 B;  5AW8 B;  3A3Y B;  2C9L Y;  2WPS A;  4I6M C;  3TYY A;  3HTK A;  2YNY A;  3P32 A;  3M06 A;  1H88 A;  1T2K C;  2W27 A;  4RES B;  3VMZ A;  2WTY A;  1MFZ A;  2Q3I A;  3V4W A;  1GTW A;  1HJB A;  3V4Q A;  5AW9 B;  4B86 A;  2XU6 A;  3VMX A;  5AVR B;  2P2U A;  2ZXE B;  3LID A;  5APW A;  4C7N A;  1CSB A;  4GT1 A;  1OXZ A;  3HE4 A;  1JNM A;  2R5B A;  3LIE A;  3M9B A;  1MUU A;  3M91 A;  2R32 A;  3IR9 A; 
#chains in the Genus database with same CATH topology
 2KS1 B;  1FDI A;  1SQX E;  1VQM P;  2XDJ A;  5CJ4 A;  4UB6 E;  3LW5 J;  3HTK B;  1OW7 A;  1YIT P;  4JF7 A;  1LWU C;  4PD4 D;  1AFO A;  1CZQ A;  3V2N A;  3TNU A;  2YIU C;  5APV A;  4ZKP A;  1MV8 A;  4D6T D;  3G4S P;  1SFC A;  2FYU K;  3CL3 D;  1N73 A;  1M90 Q;  5APX A;  2IYO A;  1GL2 D;  3BAS A;  3WUT A;  1CW5 A;  3L73 D;  4OGQ D;  1X22 A;  1JCD A;  3L37 A;  1M56 D;  2JDI H;  2NPS C;  2E75 C;  1NTM E;  2GA1 A;  1L0N K;  1JUN A;  4WY4 D;  4DCK A;  1S3J A;  1SP4 A;  5CBN A;  1P84 H;  4GOF A;  3E7K A;  1NJI Q;  1IFM A;  2CPS A;  3RK3 D;  1NU1 D;  4OVN F;  5AW9 B;  2XU6 A;  1X0T A;  1KQS O;  4GIF A;  3H1H J;  1SQB D;  3H1L J;  5E79 E;  3PLN A;  1JY3 O;  3B5N C;  2PRR A;  2ZFC A;  3S1K A;  2H7H A;  1J1E C;  1L0L D;  1G2C B;  3AE6 C;  2FYU J;  1AQ5 A;  4JYB A;  2W6A A;  3WUV A;  2QJP B;  2WPV B;  2R5D A;  2HOD A;  3L71 D;  1JCC A;  3MP7 B;  1VF5 B;  3TF5 A;  1YQ3 C;  1Q2N A;  2I1J A;  2W6J H;  5APU A;  5AW3 B;  2HLO A;  3L35 A;  4YXD C;  2PAJ A;  1X79 B;  3H1H G;  3P8M C;  2HR3 A;  3IAO A;  3H1L G;  4PJ0 E;  2B87 B;  1LWU B;  2WQY C;  1EZV E;  2E74 C;  2FYU G;  5AW1 B;  1QL2 A;  3RL0 C;  1R8E A;  4TLF A;  1ZRT E;  3TGU J;  4NPD A;  1LTI C;  3EQ2 A;  3U1A A;  4GT1 A;  1OXZ A;  3AEE C;  3D6Z A;  3LIE A;  2E75 B;  2KUB A;  1ZR2 A;  3PP5 A;  3AEA C;  1SVF A;  1KB9 E;  4I1L A;  3M0A A;  1RF1 A;  1SQV J;  2WSC J;  5DJU B;  1OZH A;  2OAR A;  1MKM A;  2KK7 A;  3VTP C;  3KDP B;  3HD7 A;  1DEB A;  1BE3 D;  1VQ6 P;  1RE4 C;  2B9B A;  5CHX A;  5BU5 A;  2H89 C;  4H44 C;  1QVG O;  1RE3 A;  2P7J A;  5APT A;  2YO3 A;  3TGU G;  1EZV I;  1KZU B;  3SFD C;  3B5N B;  3HE5 A;  2Y9Y A;  2OYH C;  4PD4 E;  2K9J A;  2O01 N;  3C8V A;  5CBO A;  2FFD C;  1L0L K;  3AEF C;  1GU5 A;  3MIW A;  5KTB A;  4D6T E;  4YXW H;  3CC7 P;  1VF5 D;  1DX7 A;  1L2P A;  1SQV G;  1FZC C;  3KPE A;  1FBM A;  2WSE J;  2JP3 A;  2QA4 P;  3L73 E;  2AXC A;  5KJ7 D;  1KB9 I;  4IFF A;  1Y8A A;  4EDF A;  1H88 A;  1YBK A;  2WTY A;  2FY8 A;  1PP9 J;  4B86 A;  2IBZ D;  1YQ4 C;  4H0L D;  4H13 B;  1GL2 C;  2UWJ E;  4OGQ C;  1MUU A;  1DD3 A;  2RKL A;  3L74 E;  5B66 H;  4WBA A;  5KAF H;  1NAF A;  3RK3 E;  3O6Q A;  1SLQ A;  4WY4 C;  3GLM A;  1KV4 A;  1NU1 E;  3RL0 B;  1AVO A;  4N3Y B;  4PD4 I;  5AW2 B;  1K9M Q;  1SQB E;  2FBW C;  3VOP A;  4C7N B;  3M9H A;  1KQL A;  1DD4 A;  2C0W A;  1LP1 A;  3RK3 C;  1VQ9 P;  1IO4 A;  2NZ2 A;  1L0L E;  5H2F E;  3JSV C;  3TK1 A;  3AE1 C;  3H1J J;  3M0D C;  3H6P A;  3G6E P;  1E5W A;  2ITA A;  1LNQ A;  5BU8 B;  1PP9 G;  3L71 E;  4JYC A;  3L4F A;  3PJS K;  1SQQ J;  4WWI A;  4AYC A;  2I1K A;  2YKQ A;  4H44 B;  3R4Y A;  4YTP C;  1KIL A;  4BXL A;  2OTL P;  2HFE D;  1BGY J;  2KZI A;  3AEG C;  3ABV C;  2V7Q J;  1MZ9 A;  4RKU J;  2OYH B;  1U7J A;  4UB6 H;  1RH5 B;  1GTW A;  5KLV J;  3VMX A;  3CD6 P;  3BRV B;  2K1A A;  2QIW A;  4W7Y A;  3H1J G;  1KOR A;  1VQ4 P;  3C9I A;  3HUS A;  2OTJ P;  4WVZ A;  3IFM A;  1OFC X;  4GOE A;  3PRJ A;  4C7R A;  3KQG A;  3QWO C;  3UIA A;  1SQQ G;  3FWL A;  1JO5 A;  3L75 J;  3V2Q A;  2L5G B;  3W68 A;  4OH8 B;  3MUD A;  1VQO P;  2KSJ A;  5AW7 B;  4XE5 B;  3AE9 C;  2SPZ A;  3GHG A;  2N1T A;  1BCC J;  3V2R A;  1FZE A;  5AVX B;  4H13 D;  1GL2 B;  2IZ1 A;  5TIS E;  1HF9 A;  1BGY G;  5K5G B;  3BRT B;  1LTS C;  4OGQ B;  1NTK J;  1QL1 A;  3L36 A;  1T2K D;  4LGD E;  1VDF A;  1BE3 E;  3BCC J;  5KLV G;  1N86 A;  4WY4 B;  2MKV A;  1FZA A;  2AXT E;  2WT7 B;  5B66 E;  1IC2 A;  4HB1 A;  2P58 A;  1SQX K;  1IFP A;  3CXH D;  4W7Z A;  1S4X A;  3OA7 A;  3D6Y A;  3RK3 B;  1JOC A;  2BCC D;  1EQ7 A;  5E79 H;  3U1C A;  3L75 G;  3NTN A;  2J58 A;  2OGU A;  2C9L Y;  2A06 D;  3H1I D;  1BCC G;  5CCH A;  1URQ A;  1SS1 A;  2V4H A;  2FYZ A;  4NPE A;  1W2E A;  1NTK G;  1S72 P;  2R5B A;  1S2E A;  3M9B A;  2QVA A;  2HYN A;  1IK7 A;  2Z5H A;  3L72 D;  3BCC G;  3JCU E;  2K9Y A;  2JEE A;  1L4A A;  1H0T A;  2KLV A;  1EXI A;  2ZVN B;  1RQV A;  2M3B A;  1VF5 C;  2IBZ E;  2G3A A;  4HYT B;  5CCG C;  1NWQ A;  1FU1 A;  3PHL A;  1SQX J;  1ZR4 A;  1ZXG A;  1A02 F;  5KJ7 C;  2E76 D;  1YYC A;  4PJ0 H;  3BAT A;  2P10 A;  5B5E E;  4H0L C;  1HGV A;  1PPJ G;  3CC2 P;  2JWA A;  1N8R Q;  2M3E A;  1FDM A;  3CX5 D;  1SQV D;  3Q5P A;  1LTT C;  2WSF H;  1J1D C;  1LTJ A;  2OYI A;  1EDK A;  5L8R J;  3L70 D;  1FDO A;  1FS0 E;  4I7Z B;  2WIT A;  2YXR B;  1FOS F;  1FJK A;  1NTM J;  3MZW B;  1U57 A;  1SQX G;  1K8A Q;  4I6M C;  3TYY A;  3M06 A;  4JQ0 D;  2BEZ F;  1KB9 H;  2IBZ I;  2W6B A;  3QH9 A;  3IN6 A;  4HH2 A;  3T97 B;  2KXP B;  3M91 A;  3L74 D;  1S5L E;  2ZYD A;  3AE2 C;  3PTZ A;  1BDC A;  2NRG A;  2POH A;  4N78 D;  3CCL P;  1N7S A;  1ZV8 A;  4DZO A;  1ZME C;  4PD4 H;  1KIL D;  4M3L A;  1PP9 D;  3H32 A;  2Y0D A;  1K04 A;  1USE A;  3JC2 2;  1D7M A;  5TJH A;  2HG5 D;  1NTM G;  3AEC C;  3FWN A;  2Q1K A;  1PV3 A;  4LLH A;  2NPS A;  2I8D A;  3H1K J;  1PGO A;  1LT1 A;  3FXD A;  1X9V A;  1NO4 A;  2D2C D;  4U7J A;  5M1B A;  1L0N J;  2AEF A;  2FKW B;  4PV1 D;  2XV5 A;  1NH4 A;  4O9B A;  3TNU B;  2WPR A;  1IFD A;  3WMM 0;  3E1I A;  1NYH A;  3D71 A;  2B88 A;  3VN0 A;  1SFC B;  1N73 B;  1M57 D;  5AVS B;  3RK2 B;  4H0L B;  4H13 C;  1JY2 N;  3AE5 C;  3CXH E;  1T2K C;  1E79 H;  1SQQ D;  1HGZ A;  3V4Q A;  1XTG B;  2WMM A;  2WSF J;  2BCC E;  1J1D B;  2KOG A;  1SQP D;  2M8R A;  2M5A B;  1RF1 C;  3H1K G;  1H89 A;  5H2F H;  2A06 E;  3F89 A;  3H1I E;  4U3F D;  1LTG C;  1XTC C;  3N4X A;  2A45 H;  3Q3D A;  1NGM B;  1L0N G;  3CWB D;  3GW6 A;  5BVZ A;  1RE3 C;  3KHU A;  1LGH B;  4JBZ A;  3CME P;  1OW8 A;  3L72 E;  3CLQ A;  1NTZ D;  4W80 A;  5AVZ B;  4ZKU A;  2W90 A;  1KN7 A;  3PH0 A;  2E5Y A;  3CCS P;  1EZV G;  3C1L A;  1JTH A;  3Q5S A;  3A5T A;  1KYO D;  2M0B A;  4OWF A;  3L75 D;  2QM7 A;  2HOD B;  3CXH I;  3S4R A;  1NU1 K;  3I5C A;  3AE7 C;  4R4M A;  3CC4 P;  3VMY A;  3ITK A;  5C39 A;  1SQB K;  1YHQ P;  3CCQ P;  2E76 C;  3CX5 E;  1SQV E;  1NTK D;  4KJM A;  2P67 A;  3I56 P;  1GW3 A;  2ZVO B;  4CPG A;  3G71 P;  2Q3I A;  3L70 E;  1IFJ A;  4DJG A;  1BDD A;  2HPC A;  1Q90 D;  5KLI C;  5APW A;  2QRX A;  1RQU A;  3HE4 A;  1FZG A;  2R32 A;  1DEE G;  2Y0C A;  2KNC A;  4K3A A;  5TIS H;  1SFC D;  3VP8 A;  3RK2 D;  1JY3 N;  1N2D C;  1PPJ D;  1VQK P;  4HJG H;  1LJ2 A;  1PGQ A;  1NU1 J;  2AXT H;  2WPQ A;  4IL6 E;  1OMI A;  2VRS A;  1EC5 A;  1SQB J;  2FFD A;  3SWF A;  1VQ7 P;  4N78 E;  2KIK A;  1PGP A;  1RF1 B;  1DIP A;  3MTU E;  1KIL E;  3CX5 I;  1HBW A;  1L0L J;  1PP9 E;  1SQP K;  2ZT9 D;  3HD7 B;  1LTB C;  2DW3 A;  4ZMD A;  1FZC A;  1NKZ B;  3MHV A;  1N7S D;  1KIL C;  3L71 J;  1GU4 A;  1VQ8 P;  2O1J A;  1M1J A;  4BRY B;  3HE5 B;  2E42 A;  1RF0 A;  2LXB A;  2G8Y A;  1NTZ K;  4GDO A;  1VPC A;  1U7M A;  1GL2 A;  2K9J B;  1RHZ B;  3JCU H;  1NU1 G;  1LT9 A;  1BSN A;  2BEQ D;  2WSS H;  2ZXE B;  1SQB G;  2C0X A;  1M8O B;  2D2C C;  2Y9Z A;  3B8E B;  4PV1 C;  2WVR A;  1L0L G;  1G1J A;  5B5E H;  3H25 A;  1FZF A;  2Z4E A;  1SQQ E;  2KP8 A;  3MUD C;  3N7N A;  2E76 B;  4TT3 H;  1CI6 B;  2Q7C A;  3AE8 C;  1ZOY C;  3A0H E;  2O3J A;  5GTH E;  1NKN A;  3M0D A;  3L71 G;  1PIX A;  3WUU A;  4IOI H;  1SQP E;  2Q3E A;  5KLI B;  3VYI A;  1M1K Q;  3F5H A;  3HRN A;  4U3F E;  1FOS E;  1IFN A;  3FGA D;  2XND H;  2A45 I;  3O6Q B;  1J2J B;  3CMA P;  3CWB E;  3E1R A;  2GUS A;  1NAY A;  3BVH A;  2Y0E A;  2QJY C;  3H1H D;  1NTZ E;  3H1L D;  1LP1 B;  4I7Z C;  2ZXX A;  1BE3 J;  2H88 C;  1OVV A;  1KYO E;  2FYU D;  2KS1 A;  3A0B H;  3L75 E;  1S5L H;  1T6A A;  3H1K D;  2ZYG A;  3A3Y B;  2WPS A;  3HTK A;  1EDI A;  3VMZ A;  1IZN B;  1IJD B;  1L0N D;  3HD7 D;  1BSH A;  2E74 D;  2KLU A;  1QLE D;  1NTK E;  1WMK A;  1FJP A;  2BAS A;  3IR9 A;  1NHL A;  1KC8 Q;  4ASV A;  3USS A;  1KIL B;  1Q7Y Q;  1GMJ A;  1PZQ A;  1OWA A;  1FAV A;  5AVY B;  2PGD A;  1OIP A;  1G1I A;  1NVO A;  1BE3 G;  1ZLL A;  2B89 A;  1WT6 A;  2IPP A;  1Q82 Q;  3O8Z A;  3HUS B;  5GTI E;  4EYY Q;  1S5L X;  2AEJ A;  2KYV A;  3TGU D;  4NPF X;  1YJ9 P;  1KYO I;  2D2C B;  1PPJ E;  4PV1 B;  3Q2Y A;  4RO0 A;  3NXS A;  3AED C;  1LTJ C;  3I55 P;  2OYI C;  3SWY A;  1N7L A;  1Z56 A;  2YMK A;  2O01 H;  1KD1 Q;  3OW2 O;  1SFC C;  3GHG B;  2N1T B;  1N73 C;  3CXH H;  2Q9I A;  2H8P D;  3RK2 C;  2FYN C;  4GKG A;  2MJZ A;  5DJT B;  2W83 C;  1GK4 A;  1P84 D;  2H43 A;  1VL2 A;  1G2C A;  3OJA B;  3W67 A;  5AVU B;  5AVV B;  3SSU A;  4EIJ A;  3CCV P;  3V4W A;  2IBZ G;  1FZB A;  2ZT9 C;  2QJY B;  1CSB A;  3CCR P;  3KZI E;  5CCG A;  1FC2 C;  1RY3 A;  1N7S C;  1EDJ A;  4KHX A;  5KJ7 A;  2PP6 A;  3P8C D;  3GF7 A;  3B71 A;  1URQ B;  1YI2 P;  3SWK A;  2IFN A;  2AEM A;  4L73 A;  1Y47 A;  4WB4 A;  1KQG B;  3A0B E;  2YO2 A;  1GDT A;  5AW6 B;  1K05 A;  2B87 A;  1LWU A;  3AE4 C;  4L74 A;  2FXM A;  4GOD A;  1AQT A;  1KMI Z;  1L4A B;  3Q5R A;  1FE6 A;  1H0T B;  1YJW P;  2JWD A;  2M5A A;  4MN4 C;  3CX5 H;  2XKM A;  2WSC H;  2IFM A;  4BWN A;  3TDK A;  4Y99 B;  4HKZ H;  3NMD A;  2JO1 A;  2ZYA A;  1QEX A;  1W5C E;  2JJL A;  2CPB A;  5CJ0 A;  2IYP A;  3V2P A;  4L75 A;  3H1H E;  3VP9 A;  3H1L E;  3V5B A;  2P1J A;  5AW8 B;  1T8Z A;  2O1K A;  1JMB A;  4RES B;  1LTJ B;  2OYI B;  1JMM A;  2L91 A;  2P2U A;  2FYU E;  1UII A;  2O01 J;  3H1J D;  2N1T D;  3EFF K;  2FYN B;  3II6 A;  3H1K E;  2LKM A;  3P7K A;  4IL6 H;  1R5S A;  1OW6 A;  3B5N A;  2WSE H;  2BCC J;  4R4L A;  3WU2 E;  1L0N E;  2C9N Y;  4UB8 H;  1SQV K;  4C46 A;  2QE7 H;  3H1I J;  4ASW A;  4DT0 A;  4A7P A;  1JB0 J;  1JY2 P;  2ZT9 B;  4YPC A;  4AUW A;  3RBX A;  2XNX A;  3HD7 C;  2ZJS E;  1BGY D;  2JR8 A;  1QGK B;  3L72 J;  2YIU B;  2IX7 C;  1N7S B;  2W8Z A;  3CCM P;  5KLV D;  3M9Q A;  4IFD K;  3FX0 A;  3V6I A;  5APQ A;  1X8Y A;  1VQN P;  2J5U A;  3H32 B;  1IK9 A;  5CCH D;  4Z1M H;  1URQ D;  5APS A;  3TGU E;  3AEB C;  3FXE A;  4IL6 X;  4EOT A;  2BCC G;  1K73 Q;  1HVV A;  2N9Y B;  2E5T A;  2NPS B;  2XZR A;  3NFQ A;  3A2A A;  1R5L A;  1S9K D;  1L4A D;  2A06 G;  3H1I G;  3GG2 A;  2YNY A;  3S9O A;  3SFE C;  1BCC D;  3EWK A;  3A0H H;  4C7N A;  2KSE A;  5GTH H;  1P84 E;  2YKP A;  3L72 G;  4D6T J;  4AQR D;  1HUC A;  3L70 J;  1Q86 Q;  3BCC D;  2J59 M;  2Z5I A;  5AVT B;  1GK6 A;  3CCE P;  2K3R A;  2R3C A;  4BRY A;  2IDB A;  1HWT C;  2V7Q H;  1J1E B;  3D70 A;  3L73 J;  2RN0 A;  1GD2 E;  3CI9 A;  3Q1M A;  5CMZ A;  1OVR A;  2QG4 A;  4LC1 A;  2KB7 P;  1RE4 A;  3MD0 A;  3P8C E;  4I2L C;  2QEX P;  1VQ5 P;  1KYO H;  3AE3 C;  3L74 J;  2FXP A;  5CCG D;  4KT0 J;  3RBZ A;  2R44 A;  1YIJ P;  2OYH A;  3EFG A;  5KKZ C;  1CI6 A;  2YKO A;  1M1J C;  4D6T G;  1SQQ K;  3L70 G;  1RF0 C;  2YMY A;  1JY3 P;  1JTH B;  4XA4 A;  2N9B A;  4UB8 E;  1P84 I;  2OQQ A;  1LT9 C;  1PGJ A;  2RMZ A;  4DOJ A;  3L73 G;  2E74 B;  1PL5 A;  1SQX D;  2FXO A;  1ZW0 A;  2LXC B;  1HH0 A;  3P32 A;  1GW4 A;  4ZNC A;  1HJB A;  3RGU A;  5AVR B;  3ZDM A;  5KLV K;  1Y9B A;  3R2P A;  1M7L A;  3L74 G;  1A02 J;  1YTZ I;  1H8A A;  5GTI H;  1NOH A;  2CK3 H;  1AJY A;  1ZN5 A;  3KYQ A;  2Q6Q A;  1AV1 A;  1OX3 A;  2NPS D;  2E75 D;  1TU3 F;  2WZ7 A;  1GZL A;  3HUS C;  4WY4 A;  1JM0 A;  2HPC B;  3TSI A;  3H1J E;  3U59 A;  2WT7 A;  4JPZ B;  1USD A;  3HE4 B;  3KXD A;  1T3U A;  1KQF B;  1S1C X;  5KAI H;  1NTM D;  2KNC B;  2A45 G;  2QJK C;  1SQP J;  4K35 A;  3GHG C;  2N1T C;  1NTK K;  4QMA A;  5APY A;  2QM8 A;  4U3F J;  4L76 A;  5AVQ B;  3B5N D;  3CWB J;  1LTA C;  2IZ0 A;  4IFM A;  1BGY E;  3B4S A;  1YJN P;  2FFD B;  1T3J A;  2K88 A;  1NTZ J;  1OVU A;  3LW5 H;  2QSI A;  5KLV E;  3CCU P;  5AVW B;  2K37 A;  3CPW O;  1DH3 A;  3KZI H;  1ZP0 C;  3RL0 g;  3A7O A;  5AW0 B;  4Y28 J;  3G3Z A;  2W27 A;  1FZC B;  1MFZ A;  1Q81 Q;  1EDL A;  3LID A;  1QX8 A;  1IFI A;  5KKZ B;  1SQP G;  3CCJ P;  1M1J B;  5CCH C;  1S9K E;  1URQ C;  4U3F G;  2OTK E;  3OAK A;  2E43 A;  5EFW B;  2PFX A;  2Q5U A;  3VMA A;  1LT9 B;  1BCC E;  3CWB G;  4N6J A;  1HTL C;  1KFM A;  3IF4 A;  1KFN A;  1QVF O;  1L4A C;  5AW5 B;  2RH0 A;  1HJ0 A;  3RL0 D;  3GF3 A;  5AW4 B;  1NTZ G;  5KAF E;  3GMA A;  3BCC E;  1VQL P;  2WWW A;  1AVY A;  1EZV D;  4Y99 C;  1AA0 A;  4XFJ A;  2JKV A;  4EI2 A;  2KI7 B;  1PFI A;  2GUV A;  1W2B O;  1ZRT D;  2R3S A;  1JY2 O;  1YTZ T;  3G9R A;  3T97 A;  2ZAE B;  3MGN A;  2QJP C;  1KTM A;  2GM4 A;  2OYO A;  2QJK B;  1NTM K;  1VQP P;  1JEK A;  1KB9 D;  1EXJ A;  4H44 D;  5KAI E;  3WU2 H;  2LR2 A;  1WRG A;  1MFT A;  4RJT A;  2YXQ B;  1UIX A;  2KZJ A;  1JNM A;  3K5B A; 
#chains in the Genus database with same CATH homology
 3II6 A;  3IFM A;  2LKM A;  3P7K A;  4C7R A;  3KQG A;  2XDJ A;  3B5N A;  5CJ4 A;  3UIA A;  2WSE H;  1JO5 A;  1SFC D;  3HTK B;  3VP8 A;  3RK2 D;  1JY3 N;  1N2D C;  4JF7 A;  3V2Q A;  2C9N Y;  1LWU C;  2L5G B;  1SQV K;  4OH8 B;  4C46 A;  3MUD A;  1AFO A;  1CZQ A;  2KSJ A;  5AW7 B;  4XE5 B;  3V2N A;  3GHG A;  2N1T A;  2WPQ A;  3V2R A;  3TNU A;  1FZE A;  5APV A;  5AVX B;  1JY2 P;  2VRS A;  4ZKP A;  4AUW A;  1MV8 A;  2XNX A;  1GL2 B;  3HD7 C;  2FFD A;  3BRT B;  3SWF A;  1LTS C;  4N78 E;  1QL1 A;  3L36 A;  1T2K D;  4LGD E;  1SFC A;  2FYU K;  3CL3 D;  1RF1 B;  1N73 A;  1VDF A;  3MTU E;  1HBW A;  2IX7 C;  1SQP K;  1N7S B;  1N86 A;  5APX A;  3HD7 B;  3M9Q A;  4WY4 B;  4IFD K;  1GL2 D;  3BAS A;  1LTB C;  1CW5 A;  1FZA A;  5APQ A;  2WT7 B;  1X8Y A;  1IC2 A;  3H32 B;  1IK9 A;  1SQX K;  1JCD A;  3L37 A;  1NKZ B;  1FZC A;  5CCH D;  2NPS C;  1URQ D;  5APS A;  4W7Z A;  1N7S D;  3OA7 A;  1L0N K;  1JUN A;  1KIL C;  4WY4 D;  1GU4 A;  4EOT A;  3RK3 B;  2O1J A;  1M1J A;  1JOC A;  1SP4 A;  1EQ7 A;  3HE5 B;  2E42 A;  3U1C A;  1RF0 A;  1HVV A;  2NPS B;  2XZR A;  3NFQ A;  3NTN A;  1NTZ K;  3A2A A;  1VPC A;  1GL2 A;  1S9K D;  1L4A D;  2J58 A;  1IFM A;  2CPS A;  3RK3 D;  2C9L Y;  1LT9 A;  2YNY A;  5CCH A;  1URQ A;  5AW9 B;  2XU6 A;  2ZXE B;  4GIF A;  4C7N A;  2FYZ A;  1W2E A;  1JY3 O;  2R5B A;  2C0X A;  3M9B A;  2YKP A;  3B5N C;  2ZFC A;  2H7H A;  2HYN A;  3B8E B;  2Z5H A;  1J1E C;  4AQR D;  1HUC A;  1G1J A;  2J59 M;  2Z5I A;  5AVT B;  1GK6 A;  2JEE A;  1G2C B;  1L4A A;  1AQ5 A;  2KLV A;  2R3C A;  1FZF A;  2Z4E A;  2KP8 A;  3N7N A;  1CI6 B;  2M3B A;  2Q7C A;  4JYB A;  2W6A A;  1HWT C;  1J1E B;  4HYT B;  5CCG C;  1NWQ A;  1FU1 A;  1GD2 E;  2R5D A;  3CI9 A;  1NKN A;  2HOD A;  3M0D A;  1ZR4 A;  1A02 F;  5CMZ A;  5KJ7 C;  1JCC A;  1YYC A;  2I1J A;  3BAT A;  3VYI A;  4LC1 A;  2KB7 P;  3HRN A;  5APU A;  1FOS E;  1IFN A;  1RE4 A;  3MD0 A;  3P8C E;  2A45 I;  4I2L C;  1J2J B;  1HGV A;  5AW3 B;  2HLO A;  3L35 A;  1FDM A;  5CCG D;  2GUS A;  2PAJ A;  1X79 B;  3BVH A;  3P8M C;  1LTT C;  2OYH A;  2WSF H;  1J1D C;  3EFG A;  1CI6 A;  2YKO A;  1LTJ A;  1M1J C;  1LWU B;  2OYI A;  1SQQ K;  1RF0 C;  5AW1 B;  1QL2 A;  2YMY A;  1JY3 P;  1JTH B;  4XA4 A;  3RL0 C;  2N9B A;  2WIT A;  1FOS F;  1LT9 C;  1FJK A;  4DOJ A;  1LTI C;  3A3Y B;  2WPS A;  4I6M C;  3TYY A;  3HTK A;  1HH0 A;  3EQ2 A;  3P32 A;  3M06 A;  1GW4 A;  3VMZ A;  2W6B A;  1HJB A;  1IJD B;  3HD7 D;  5AVR B;  3U1A A;  4GT1 A;  4HH2 A;  1OXZ A;  5KLV K;  3R2P A;  1M7L A;  3LIE A;  1FJP A;  2BAS A;  3M91 A;  3IR9 A;  1A02 J;  1YTZ I;  1NHL A;  1KIL B;  1ZR2 A;  3PP5 A;  1H8A A;  2POH A;  1SVF A;  1NOH A;  1OWA A;  1ZN5 A;  4I1L A;  3M0A A;  1FAV A;  1RF1 A;  5AVY B;  4N78 D;  3KYQ A;  2NPS D;  2OAR A;  2WZ7 A;  1G1I A;  1GZL A;  1N7S A;  3HUS C;  3VTP C;  1ZV8 A;  4DZO A;  3KDP B;  1ZLL A;  3HD7 A;  4WY4 A;  1DEB A;  1KIL D;  2HPC B;  4M3L A;  3TSI A;  3U59 A;  2WT7 A;  1RE4 C;  3H32 A;  1WT6 A;  3HE4 B;  5CHX A;  5BU5 A;  2IPP A;  3O8Z A;  1RE3 A;  1T3U A;  3HUS B;  2HG5 D;  2P7J A;  5APT A;  2YO3 A;  2A45 G;  1KZU B;  2KYV A;  4LLH A;  3B5N B;  3HE5 A;  3GHG C;  2OYH C;  2N1T C;  2NPS A;  3NXS A;  1NTK K;  5APY A;  1LTJ C;  2QM8 A;  2OYI C;  3SWY A;  1N7L A;  2FFD C;  1L0L K;  1X9V A;  1Z56 A;  5AVQ B;  3B5N D;  1NO4 A;  2O01 H;  1LTA C;  1GU5 A;  3MIW A;  1SFC C;  2FKW B;  2N1T B;  3GHG B;  5KTB A;  1N73 C;  4IFM A;  2XV5 A;  2H8P D;  2Q9I A;  1NH4 A;  4O9B A;  3TNU B;  3RK2 C;  2WPR A;  1IFD A;  3WMM 0;  4GKG A;  3E1I A;  2FFD B;  2MJZ A;  1T3J A;  3VN0 A;  1DX7 A;  1GK4 A;  1SFC B;  3LW5 H;  1FZC C;  3KPE A;  1N73 B;  5AVS B;  5AVW B;  1FBM A;  3RK2 B;  2H43 A;  1DH3 A;  1G2C A;  3OJA B;  3A7O A;  5AVU B;  5AVV B;  5AW0 B;  5KJ7 D;  1JY2 N;  3G3Z A;  4IFF A;  1H88 A;  4EIJ A;  1T2K C;  2W27 A;  2WTY A;  1MFZ A;  3V4W A;  1FZC B;  1HGZ A;  3V4Q A;  4B86 A;  1XTG B;  1FZB A;  3LID A;  1GL2 C;  1IFI A;  1CSB A;  1J1D B;  2KOG A;  1M1J B;  1MUU A;  2M8R A;  5CCG A;  1RF1 C;  5CCH C;  4WBA A;  1RY3 A;  1NAF A;  1S9K E;  1H89 A;  1URQ C;  1N7S C;  1SLQ A;  3OAK A;  2E43 A;  4WY4 C;  1LTG C;  4KHX A;  1XTC C;  3RL0 B;  5KJ7 A;  3N4X A;  2PP6 A;  3P8C D;  2Q5U A;  1LT9 B;  2A45 H;  4N6J A;  1HTL C;  4N3Y B;  5AW2 B;  1KFM A;  1URQ B;  2IFN A;  5BVZ A;  1RE3 C;  1LGH B;  3VOP A;  1KFN A;  4WB4 A;  1L4A C;  3M9H A;  4C7N B;  1KQL A;  5AW5 B;  2YO2 A;  2C0W A;  1GDT A;  3RL0 D;  3RK3 C;  5AW6 B;  5AW4 B;  1LWU A;  3CLQ A;  1IO4 A;  4W80 A;  5AVZ B;  2FXM A;  4ZKU A;  2WWW A;  3TK1 A;  3M0D C;  1L4A B;  1JTH A;  4Y99 C;  3A5T A;  3H6P A;  1E5W A;  5BU8 B;  2XKM A;  2WSC H;  2IFM A;  4JYC A;  3L4F A;  2QM7 A;  1PFI A;  2GUV A;  2HOD B;  4Y99 B;  1NU1 K;  3I5C A;  3NMD A;  3VMY A;  1JY2 O;  1YTZ T;  4AYC A;  2JJL A;  3T97 A;  2I1K A;  2CPB A;  1SQB K;  2YKQ A;  3MGN A;  5CJ0 A;  2P67 A;  1KIL A;  3V2P A;  2GM4 A;  2HFE D;  1GW3 A;  3VP9 A;  3V5B A;  2P1J A;  5AW8 B;  1T8Z A;  1MZ9 A;  1NTM K;  2OYH B;  2O1K A;  4RES B;  2Q3I A;  1GTW A;  1LTJ B;  1IFJ A;  2OYI B;  3VMX A;  2HPC A;  3BRV B;  1JMM A;  2P2U A;  5APW A;  4W7Y A;  1WRG A;  3HE4 A;  1JNM A;  2N1T D;  1FZG A;  3C9I A;  2R32 A;  3HUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...