1GTWA

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the tom-1a promoter
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gtwA00
2XV5A 3HE5B 1FAVA 5AW1B 3A2AA 3A3YB 1J2JB 2W6AA 4JYBA 3VMYA 2P2UA 1GK4A 5AVVB 4GT1A 1CI6B 3HE4B 3A5TA 3L35A 4C7NB 2XU6A 2ZXEB 3M0DA 1A02J 4HYTB 3A7OA 3MGNA 3TNUB 2JJLA 1NWQA 2E43A 5AW9B 3TK1A 5AVWB 2H7HA 5AW7B 3NMDA 3P32A 1MFZA 2R32A 5APSA 1T2KD 1H88A 3IR9A 2ZFCA 1HBWA 3VTPC 1GU5A 2WWWA 3B8EB 3OAKA 5APXA 3V4QA 4DZOA 3TYYA 1GZLA 4JYCA 2KP8A 1A02F 2QM7A 4C46A 2WT7B 3VMZA 1CSBA 1OWAA 3LIDA 3M9BA 2Q5UA 1FOSE 1HWTC 5AVYB 3I5CA 3HE5A 1GTWA 2P67A 1NAFA 5AVUB 2YNYA 4AYCA 1CI6A 1S9KE 2Z5HA 3LIEA 2WPRA 3M9HA 5AVTB 5AW4B 4C7NA 3SWFA 5AW3B 3L36A 5AVRB 4XE5B 4M3LA 4RESB 1H8AA 4AUWA 2R5DA 2Q7CA 1T2KC 2Q3IA 1HJBA 3NFQA 3NXSA 5APYA 1CZQA 3TNUA 3O8ZA 5AW8B 1HUCA 3UIAA 5APTA 5AVQB 5AVSB 2Z5IA 1OXZA 2W27A 3T97A 5APWA 1GD2E 3P8MC 5APUA 5AVZB 1G2CB 5AW0B 5APQA 4EOTA 1SP4A 2C9NY 2P7JA 1GU4A 2XZRA 5APVA 2YO2A 2VRSA 4LC1A 2WTYA 2WPSA 2WT7A 3M91A 4I6MC 2R5BA 3VN0A 3HE4A 3V4WA 2IPPA 4GKGA 2BASA 3M06A 3KQGA 2R3CA 3MD0A 5CMZA 1GK6A 1KQLA 1IO4A 5AW6B 5AW5B 2WPQA 4I2LC 3HTKA 1JUNA 1SLQA 1X8YA 2N9BA 2QM8A 1JNMA 3VYIA 3V5BA 1S9KD 3VMXA 4AQRD 2C9LY 1DH3A 1YYCA 3KDPB 4KHXA 2E42A 1MUUA 5AVXB 5AW2B 4B86A 1H89A 1MV8A 3P7KA 3NTNA 1FOSF 2YO3A 3L37A 3M0AA
chains in the Genus database with same CATH superfamily
2KB7P 1FZEA 3CC2P 1OMIA 5AVVB 3H1IG 4UB6E 1JO5A 3RL0C 1EDLA 2XU6A 2JR8A 3V2PA 1SQQG 3B5ND 1ZXGA 1DD3A 1LJ2A 4H13C 1NWQA 3H32A 3CC4P 4PJ0H 1LT9B 2R44A 4IL6H 1DEEG 2E75D 2FBWC 1GU5A 1M90Q 2M5AA 4BWNA 3L71G 1FZGA 2ITAA 2FY8A 1PV3A 3L70J 5TISE 2D2CD 3Q1MA 1DIPA 2K9JA 1FJKA 5CCHA 4AUWA 1TU3F 3NXSA 3TGUE 1S4XA 3UIAA 3KPEA 2W27A 1BGYJ 5M1BA 4EOTA 1P84D 5APVA 5EFWB 3B5NC 4BXLA 3L73J 4DJGA 2FYUJ 2E5TA 4EI2A 1JTHA 1M7LA 1RF1C 3HTKA 2WITA 3I55P 3V5BA 2E76B 3CCMP 3K5BA 2N1TD 3FWNA 2K3RA 2RH0A 3JC22 5AVTB 1GL2B 1SFCC 2GUVA 2IZ1A 1J2JB 5GTHH 2M0BA 3GG2A 1OFCX 1ZR4A 3V2RA 1BGYD 3AE1C 1ZV8A 3PP5A 2PGDA 2BCCE 1A02J 2AEJA 5GTIE 3L73D 3SSUA 1QX8A 4ZNCA 3V4QA 5KLVG 1A02F 3U1CA 2E74D 1FOSE 2H8PD 3I5CA 3BCCD 1Y47A 1KILD 1P84H 1P84I 2H43A 3HUSB 5CJ4A 2N1TC 5KAIH 1RH5B 2Q7CA 2IBZE 2IDBA 4H0LB 1G2CB 2WVRA 1N7SA 1RHZB 1BCCE 3CC7P 2P1JA 2HFED 1RE4C 3VMAA 3IFMA 1L4AA 1LWUA 1ZMEC 4H44D 1YQ4C 1SLQA 1H0TA 2FFDC 2XDJA 4U3FD 2C9LY 4WY4B 1T8ZA 1EZVD 3P7KA 1GDTA 3L37A 3V2QA 1YJWP 2XV5A 1VQ4P 1FAVA 1NU1D 1KB9E 5B5EH 1PGOA 2ZVNB 3CWBD 3TF5A 1CI6B 1ZW0A 4C7NB 2Q3EA 3M0DA 2JJLA 3D6ZA 4WVZA 3HTKB 3NMDA 1ZRTD 3MP7B 1VQOP 5KJ7C 1VQ9P 3TGUJ 2WWWA 1W5CE 2BEQD 3O6QA 5CBOA 5KAFH 2I1JA 5C39A 1W2BO 1U7JA 1LT9C 3S9OA 1AVYA 1Q86Q 1BGYG 1L0LD 2Y0DA 2M3BA 1LTJC 2NRGA 1FZAA 1S3JA 2E76D 3L73G 1Q7YQ 3RK2B 3CCEP 3CLQA 1NAYA 3A0BH 1EZVI 2PP6A 3FGAD 3F89A 2WT7A 1VQ5P 2DW3A 3BCCG 3L74E 2BCCJ 5CCGA 1FJPA 2QJPB 1M57D 2AEFA 1JY3O 3CCSP 3G71P 4Y99B 1PP9E 2WSCH 2QJKB 1FC2C 1OX3A 1NTKE 1VQ8P 5CBNA 1URQD 2B87A 1L4AB 4C7RA 1Z56A 2E76C 1T6AA 4D6TD 1N86A 3TK1A 3T97B 1GL2C 4H13B 1K9MQ 2QA4P 1T2KD 3CI9A 2YIUB 4U3FG 3V2NA 2BCCD 1EZVG 1AFOA 1CSBA 1BCCJ 1S1CX 1HWTC 2FKWB 2P67A 1KYOH 1KYOI 1NU1G 2KI7B 1EC5A 1BDDA 1N73A 1QVFO 2XKMA 1S9KE 5AW4B 3KZIH 3L36A 3AE9C 4YPCA 1K04A 4U7JA 3AE5C 2WSSH 4WY4D 4GDOA 2Z5IA 5APQA 2C9NY 3O6QB 2OTLP 1GU4A 2PAJA 3HUSC 2H88C 2HPCB 1YJ9P 4LC1A 2OQQA 3HE4A 3V4WA 3QH9A 1KQLA 1FS0E 4H0LC 1X22A 2QM8A 2LKMA 3CPWO 3AE7C 3KYQA 3KDPB 1E5WA 1L0LG 3H1ID 1SQPE 1SQPK 1AV1A 1BSNA 1N8RQ 5CCHC 3A5TA 3GHGA 2IFNA 4HKZH 4TT3H 2KLUA 2E43A 4OGQB 5AW7B 1UIXA 1NTME 2NPSA 2WZ7A 2KUBA 5CJ0A 4GOFA 3FXDA 3HE5A 3CMEP 1HGVA 3SFEC 2B87B 1FDMA 1LTTC 3L75E 3L72E 3PHLA 4PV1B 5AW3B 1EDJA 2WSFJ 3L74J 1JY2N 3TSIA 5APYA 4D6TG 1OW7A 5K5GB 2L5GB 1Q81Q 4PD4H 4PD4I 1GD2E 2KIKA 3SWYA 2HYNA 2YKQA 3H1JE 1PP9J 4XA4A 2XZRA 2VRSA 4NPDA 3AE2C 2BCCG 1HF9A 1VF5C 1NTKJ 2BASA 2YKPA 2HODA 1NKNA 2ZAEB 3OJAB 3KHUA 3RL0D 3RK2C 3LW5H 3MTUE 1N2DC 2N9BA 4H13D 1XTGB 2JO1A 4O9BA 2POHA 2R3SA 1VQPP 4WB4A 4JYBA 2Q6QA 3HE4B 3H1HD 2J59M 2QJPC 1NTZE 3CXHH 3CXHI 4YTPC 1DX7A 1NTZK 1PP9D 3B4SA 2JWDA 4Y99C 1PFIA 5B66H 5E79H 3IR9A 2O01H 2ZYAA 1GZLA 3VP8A 1L4AC 3M9BA 4NPFX 1KZUB 3H1KE 2KNCA 4BRYA 1ZOYC 1S5LE 2Q1KA 5TJHA 1IK7A 3RGUA 2Y9ZA 2YIUC 1HJBA 2OARA 1URQA 1JMMA 2IYOA 2CK3H 3O8ZA 1LTJB 2QE7H 5H2FH 3P8MC 4ASVA 1SQPJ 1W2EA 1ZP0C 1SFCD 1SQBE 3VN0A 2JP3A 1R5SA 1SQBK 2WSFH 2YMYA 5CMZA 2AEMA 5AW5B 3GF3A 1JOCA 4WWIA 3WMM0 2Y0EA 4OGQD 4HB1A 2WSEJ 4KHXA 2J5UA 3PJSK 4YXWH 4OVNF 3CX5E 1NTMJ 1SS1A 1FDIA 1IFMA 1IFJA 1ZN5A 3VMYA 3R4YA 3G4SP 3W68A 4GOEA 2QEXP 3L70D 5KTBA 2HODB 2YMKA 3TNUB 1YI2P 3L75J 3L72J 1SQPD 3MIWA 5AVWB 3HD7B 1Y9BA 3U1AA 2ZYDA 4EDFA 3A0HE 1HH0A 4KT0J 2PRRA 3BRVB 1FZCA 3H1JJ 5AVYB 1QL1A 5CCGC 2A06E 1YHQP 1FBMA 3CCQP 4OGQC 2HLOA 3EQ2A 4DT0A 4A7PA 3MZWB 3H1HG 4IFMA 2FYUD 2KSJA 4M3LA 1PP9G 1QVGO 2HG5D 2FYNB 4ZKUA 2GUSA 4Z1MH 4KJMA 2CPBA 2YXQB 2KZIA 1RE3C 3L75D 3L72D 4JBZA 3PRJA 4PV1C 2QJYC 2AXTH 3CCRP 1IFPA 1RF0C 2SPZA 2QIWA 1NH4A 3H32B 1NTZJ 3RK3E 4UB8E 1FZBA 1PPJE 4L76A 2M5AB 1USDA 1MUUA 1MV8A 2OYIA 5KJ7D 2IYPA 2KXPB 1OVRA 2K9JB 3GMAA 3H1KJ 4DOJA 4N78D 4HH2A 1USEA 3A7OA 3MGNA 2Q9IA 1AQTA 3GLMA 2B88A 1JMBA 1NTZD 1M56D 3CCVP 1KD1Q 1YJNP 2BEZF 1GW4A 3RK3B 1QLED 4C46A 3VMZA 1OWAA 3EFFK 2B89A 1J1EC 2KS1A 1JTHB 2ZT9B 1J1DB 4JF7A 1HGZA 1SQBJ 1NAFA 5AVUB 1D7MA 4GIFA 4AYCA 1JY3P 3AE6C 4XE5B 1JY2O 3L71E 2W83C 3F5HA 3L70G 5AW8B 1SQPG 5APTA 4IFDK 4DCKA 1OXZA 1DEBA 2P7JA 3GHGC 3S4RA 3E7KA 4RJTA 3CCUP 4I6MC 3RBZA 3SWKA 3AE4C 1VF5B 1FZFA 1Q82Q 4NPEA 1IO4A 3MHVA 1LTSC 1XTCC 2WPQA 3B5NA 1SQBD 1L2PA 2FYUG 1E79H 1GL2D 2YO3A 1YTZT 3QWOC 1IJDB 4CPGA 3TGUD 1RF1A 3C1LA 3B71A 4PJ0E 4ZMDA 3L75G 3L72G 4IL6E 2P2UA 1SQVE 3WU2E 1SQVK 1KV4A 1EXJA 3JCUH 2OYHA 1SFCA 3W67A 4R4LA 2RMZA 2J58A 1N7SB 4UB6H 2M8RA 1NTKK 4EYYQ 2P58A 2Q5UA 2C0WA 1LWUB 1IFDA 2CPSA 3HD7C 1ZR2A 3FXEA 2XNDH 1KN7A 5KLVE 2Z5HA 2XNXA 5KLVK 1M1KQ 1H0TB 4H0LD 3I56P 3AEFC 3NFQA 1EXIA 2A06D 1S2EA 3E1RA 5TISH 2N1TA 2QVAA 1SP4A 1NTZG 2WPSA 1N7LA 2G8YA 2N9YB 1T3UA 5CCHD 2FYNC 1SVFA 3USSA 4WBAA 2PFXA 5GTHE 1LGHB 1HJ0A 2JDIH 3VYIA 3D6YA 2W90A 3H1KG 2IBZD 3VP9A 3A2AA 1PPJD 1PL5A 2K88A 2FFDA 4IFFA 1BCCD 1M1JA 1KILA 4IL6X 3AE3C 1YBKA 3L71J 1BDCA 1P84E 2KSEA 1IZNB 2UWJE 4IOIH 2ZFCA 2Y0CA 2GA1A 5KAIE 2QSIA 1HVVA 1SQBG 2WT7B 2E75B 1G1IA 2V7QJ 1PGQA 2IX7C 5GTIH 2FXMA 1Q2NA 3TGUG 3M9QA 3Q5PA 2ZXXA 1VF5D 1KB9D 5KKZB 4L74A 2D2CB 2WPRA 3SWFA 2OYHB 3RK3C 2I1KA 3RK2D 1BSHA 3AEGC 1NTMK 4OH8B 1YQ3C 1KC8Q 1LT9A 2ZT9C 1J1DC 5AVZB 1VL2A 5BU5A 3II6A 2R5BA 2IBZI 1LTIC 4R4MA 4QMAA 1SQVJ 2OTKE 2QJYB 3H1LE 5B5EE 1FZCC 2G3AA 3BRTB 1DH3A 3Q3DA 1N7SD 5AVXB 4K3AA 3BCCE 3Q5SA 2A06G 1OZHA 3R2PA 1KILE 1YIJP 1L0NE 2MJZA 1L0NK 2H89C 1L4AD 1N73B 1GK4A 4GT1A 4W7YA 1U7MA 1VDFA 1K73Q 5KAFE 5KLVJ 1LTAC 2C0XA 3RL0g 1KB9H 1KB9I 3L74D 1WT6A 4RO0A 2WPVB 2IBZG 2E74B 2YXRB 1PPJG 1J1EB 4HJGH 2YNYA 3A0BE 2W6BA 1N7SC 3LIEA 1NTKD 1EZVE 1KILB 1BCCG 2OYIC 1WRGA 1LP1A 1NU1E 1LWUC 1VQ7P 3CWBE 1JY3N 3RBXA 3Q5RA 3D71A 3M91A 3GHGB 4GODA 2JKVA 1GW3A 3AECC 1ZRTE 1BE3E 1NKZB 1JB0J 2O3JA 3CL3D 5AW6B 3HUSA 5L8RJ 4H44B 2IFMA 1S9KD 4AQRD 1VQLP 1YYCA 2NPSB 1X79B 2LXCB 2ZVOB 3M0DC 3TDKA 1OVUA 2WQYC 3HE5B 3WU2H 3ZDMA 1G2CA 1LNQA 1L0LE 3P8CE 5CCGD 1L0LK 4TLFA 2ZJSE 1KYOE 3CD6P 2Y9YA 3HRNA 1DD4A 2KYVA 3B8EB 3KZIE 4DZOA 4WY4A 2M3EA 2QM7A 2K37A 1KMIZ 1OW8A 1GTWA 2YKOA 4PV1D 2FYZA 1CI6A 2JEEA 3EFGA 1LTGC 3WUVA 4C7NA 1H8AA 4RESB 1AA0A 3H1LJ 2Q3IA 2E75C 1CZQA 3IN6A 2LXBA 2V4HA 1VPCA 5APUA 5KLIC 1SQVG 3BCCJ 1MFTA 3L74G 5KKZC 3PTZA 2D2CC 1AQ5A 1L0NJ 4D6TE 1NTMD 2OYHC 3AEEC 3ABVC 3M06A 1SQXE 1RY3A 1G1JA 1SQXK 1S5LX 2JWAA 2K9YA 2KOGA 1NTKG 1LP1B 3OW2O 5AW2B 3NTNA 1ZLLA 1MZ9A 3H1LD 2KNCB 4BRYB 3A3YB 3H25A 2W6AA 3H1JD 3MUDA 3CCJP 1JY2P 2KZJA 1T3JA 2B9BA 2ZXEB 1URQB 4LLHA 1HTLC 1IFIA 4U3FJ 1KFMA 1L0ND 1EDIA 2WMMA 5BVZA 5APSA 1QEXA 1H88A 3VTPC 1N73C 1NU1J 3OAKA 3CWBJ 2KP8A 3GW6A 3D70A 5CHXA 4PD4E 2WSEH 3Q2YA 2WSCJ 4LGDE 3PLNA 1BE3J 2MKVA 3H1IE 2R5DA 4XFJA 1SQQE 4K35A 1Y8AA 5AVQB 2NPSD 1SQQK 2A45H 2A45I 2E74C 3T97A 1JEKA 5AW0B 1M8OB 1M1JC 2WTYA 1KILC 2O01N 3AEDC 1NVOA 4GKGA 3PH0A 1EQ7A 2HR3A 1L0LJ 4RKUJ 3BATA 3H1KD 4I2LC 1LT1A 4JQ0D 2O1JA 1JCDA 3CXHE 1X9VA 1FZCB 3BASA 1Q90D 2E42A 1RQUA 4B86A 3JSVC 1BE3D 2QRXA 5B66E 5AW1B 2LR2A 5E79E 3FX0A 2HPCA 3SFDC 2W6JH 1VQNP 1K8AQ 2RN0A 1NTMG 4H44C 2NPSC 3HD7D 2AXCA 1MKMA 5AW9B 1NOHA 2A45G 2QG4A 1HBWA 3P8CD 5APXA 3OA7A 4N6JA 5BU8B 4JYCA 1PIXA 4MN4C 3AEBC 1KYOD 3IAOA 5H2FE 3H1LG 3CX5D 4D6TJ 3VOPA 1VQMP 1QL2A 3H6PA 1R8EA 4I1LA 3H1JG 1SQXJ 1IFNA 1RQVA 2OYIB 3V6IA 1L0NG 3G9RA 1S5LH 1WMKA 3H1HE 2YO2A 1KQGB 3G6EP 1CW5A 4I7ZB 3KQGA 2L91A 1RE3A 1OVVA 2ZYGA 2OYOA 3RL0B 1X8YA 1JNMA 4N3YB 1RF0A 1SQXD 1FOSF 3AEAC 4OWFA 2KS1B 1LTBC 3E1IA 3KXDA 1JM0A 4W80A 1FE6A 1YITP 3CMAP 4L73A 1RE4A 3CX5H 1OIPA 3CX5I 3CWBG 3H1IJ 4L75A 3IF4A 1MFZA 2KK7A 2R32A 3RK3D 1SQQJ 4ZKPA 1OW6A 3L4FA 3LW5J 1KTMA 2ZT9D 1BE3G 1URQC 3WUUA 2FXOA 3N4XA 3A0HH 2IZ0A 1KORA 3B5NB 1FU1A 1S72P 1PZQA 2GM4A 1T2KC 2AXTE 3BVHA 1HUCA 4PD4D 3WUTA 1RF1B 5APWA 1VQ6P 1NJIQ 1KFNA 5KLIB 5KJ7A 1UIIA 3AE8C 3L70E 2O01J 1SQQD 1R5LA 1KQSO 3ITKA 2E5YA 3MD0A 1SFCB 1NO4A 2Z4EA 1JUNA 4WY4C 3N7NA 3S1KA 1BGYE 1KQFB 4EIJA 3L71D 3M0AA 1LTJA 1VQKP 4YXDC 1JCCA 4W7ZA 3L73E 4UB8H 1GMJA 2FYUE 3CXHD 3L35A 2FYUK 2RKLA 4HYTB 3C9IA 2H7HA 1AJYA 3P32A 2N1TB 3TYYA 3LIDA 3H1HJ 1SQXG 5DJUB 2O1KA 2I8DA 1PGJA 1IK9A 5DJTB 3G3ZA 2FXPA 1NHLA 1U57A 3C8VA 1FDOA 1NGMB 3M9HA 1X0TA 5AVRB 1SQVD 2OTJP 3GF7A 3TNUA 4Y28J 5AVSB 3U59A 3HD7A 4JPZB 3MUDC 4ASWA 1QGKB 1GL2A 2FFDB 1NYHA 4N78E 1EDKA 1PGPA 2OGUA 2KLVA 4U3FE 1M1JB 2IPPA 2R3CA 2K1AA 1K05A 1AVOA 2NZ2A 1GK6A 1IC2A 2W8ZA 2V7QH 1NU1K 1YTZI 3CCLP 5KLVD 3VMXA 3JCUE 3EWKA 1H89A 2P10A 3FWLA 4I7ZC 2QJKC
chains in the Genus database with same CATH topology
1IJDB 1MZ9A 1RF1A 2KB7P 1SQPK 3A3YB 1FZEA 2W6AA 2P2UA 5AVVB 5CCHC 3MUDA 1JY2P 3A5TA 1JO5A 1SQVK 1T3JA 3RL0C 2XU6A 2ZXEB 3GHGA 2IFNA 3V2PA 1URQB 3B5ND 4LLHA 1HTLC 2OYHA 1IFIA 1YTZT 1NWQA 3H32A 1KFMA 1SFCA 2E43A 5AW7B 5BVZA 1LT9B 5APSA 2J58A 1H88A 3VTPC 1N7SB 1N73C 1GU5A 2M8RA 3OAKA 2KP8A 2NPSA 2WZ7A 1NTKK 2Q5UA 5CJ0A 1FZGA 5CHXA 2C0WA 1LWUB 1IFDA 2CPSA 3HE5A 2WSEH 3HD7C 1ZR2A 1HGVA 1FDMA 1FJKA 4LGDE 1LTTC 2Z5HA 2XNXA 5KLVK 5AW3B 5CCHA 3TSIA 1JY2N 4AUWA 2R5DA 3NFQA 3NXSA 5APYA 2L5GB 3UIAA 5AVQB 2NPSD 3KPEA 1SQQK 2A45H 2A45I 2W27A 3T97A 1GD2E 3SWYA 2HYNA 2YKQA 2N1TA 5AW0B 4EOTA 1SP4A 4XA4A 2XZRA 5APVA 1M1JC 2VRSA 3B5NC 2WTYA 2WPSA 1N7LA 1KILC 4GKGA 2BASA 1T3UA 1EQ7A 5CCHD 1JTHA 1SVFA 2YKPA 4WBAA 2HODA 1NKNA 3BATA 3OJAB 3RL0D 1M7LA 3RK2C 3LW5H 1RF1C 4I2LC 3MTUE 1LGHB 3HTKA 1N2DC 2WITA 2O1JA 1JCDA 2N9BA 3VYIA 3V5BA 1XTGB 1X9VA 1FZCB 3BASA 2N1TD 2E42A 4B86A 5AVTB 4O9BA 2POHA 3VP9A 1GL2B 5AW1B 1SFCC 3A2AA 2GUVA 4WB4A 1J2JB 4JYBA 1ZR4A 2FFDA 2HPCA 4IFFA 3HE4B 3V2RA 2J59M 1ZV8A 3PP5A 1DX7A 1NTZK 1M1JA 2NPSC 3HD7D 1A02J 1KILA 4Y99C 1PFIA 5AW9B 1NOHA 2A45G 3IR9A 2ZFCA 2O01H 1HBWA 3P8CD 5APXA 3OA7A 4N6JA 3V4QA 1HVVA 5BU8B 1GZLA 4JYCA 3VP8A 1A02F 2WT7B 3U1CA 1L4AC 1G1IA 3M9BA 1FOSE 2IX7C 2H8PD 1KZUB 3I5CA 2FXMA 3M9QA 3VOPA 1KILD 1QL2A 2H43A 3H6PA 4I1LA 3HUSB 5CJ4A 2N1TC 2WPRA 1IFNA 3SWFA 2OYHB 2Q7CA 1HJBA 3RK3C 2OARA 1URQA 1JMMA 2I1KA 3RK2D 3O8ZA 2OYIB 1NTMK 4OH8B 1LTJB 1LT9A 1J1DC 3P8MC 5AVZB 1G2CB 1N7SA 5BU5A 2YO2A 2P1JA 1W2EA 2HFED 3II6A 1CW5A 1SFCD 2R5BA 1RE4C 1LTIC 3VN0A 1SQBK 3IFMA 2WSFH 3KQGA 1L4AA 1LWUA 2YMYA 5CMZA 1RE3A 5AW5B 1JOCA 3WMM0 1FZCC 1SLQA 1X8YA 3RL0B 2FFDC 2XDJA 1JNMA 3BRTB 2C9LY 4N3YB 4WY4B 1DH3A 1T8ZA 4KHXA 1RF0A 1N7SD 5AVXB 3P7KA 1FOSF 1GDTA 3L37A 3V2QA 2XV5A 3R2PA 1FAVA 1IFMA 1LTBC 1IFJA 1ZN5A 2MJZA 1L0NK 3VMYA 1L4AD 3E1IA 1GK4A 1N73B 4GT1A 1CI6B 4W7YA 4W80A 4C7NB 1VDFA 3M0DA 5KTBA 2HODB 3TNUB 2JJLA 1RE4A 3MIWA 1LTAC 2C0XA 3HTKB 5AVWB 3HD7B 3NMDA 1MFZA 2R32A 3RK3D 5KJ7C 3U1AA 1HH0A 4ZKPA 2WWWA 3BRVB 3L4FA 1WT6A 1FZCA 1URQC 5AVYB 2I1JA 1QL1A 5CCGC 1FBMA 1J1EB 1LT9C 2HLOA 3EQ2A 3N4XA 2YNYA 2W6BA 3B5NB 1N7SC 3LIEA 1FU1A 1KILB 4IFMA 2KSJA 4M3LA 2GM4A 2OYIC 1T2KC 2M3BA 1LTJC 3BVHA 1WRGA 2HG5D 1HUCA 1FZAA 4ZKUA 2GUSA 1LWUC 3RK2B 5APWA 1RF1B 2CPBA 1RE3C 3CLQA 1JY3N 1KFNA 5KJ7A 2PP6A 2WT7A 3M91A 3GHGB 1RF0C 1GW3A 3MD0A 1NH4A 3H32B 1NKZB 1SFCB 3CL3D 1NO4A 2Z4EA 5AW6B 5CCGA 1FZBA 1FJPA 3HUSA 1JUNA 4WY4C 2IFMA 1S9KD 4AQRD 3N7NA 1JY3O 1YYCA 2NPSB 1X79B 1MUUA 1MV8A 4Y99B 4EIJA 2OYIA 3M0DC 5KJ7D 2WSCH 3M0AA 1LTJA 1JCCA 3HE5B 4W7ZA 1G2CA 1URQD 3L35A 2FYUK 4DOJA 3P8CE 5CCGD 1L0LK 1L4AB 4C7RA 1Z56A 4N78D 4HH2A 4HYTB 3C9IA 3A7OA 1N86A 3MGNA 2Q9IA 3TK1A 2H7HA 1GL2C 3P32A 1T2KD 2N1TB 3CI9A 3HRNA 2KYVA 3B8EB 4DZOA 3TYYA 1GW4A 3V2NA 3RK3B 4WY4A 2QM7A 4C46A 1AFOA 3VMZA 1CSBA 1OWAA 3LIDA 2O1KA 1HWTC 2FKWB 1IK9A 1J1EC 1JTHB 1J1DB 3G3ZA 2P67A 4JF7A 1GTWA 1HGZA 2YKOA 1NAFA 5AVUB 1NHLA 1N73A 2FYZA 4GIFA 4AYCA 1CI6A 2XKMA 2JEEA 1S9KE 3EFGA 1LTGC 3M9HA 1JY3P 5AW4B 4C7NA 3L36A 5AVRB 4XE5B 1H8AA 1JY2O 4RESB 2Q3IA 1CZQA 3TNUA 5AW8B 5APTA 4WY4D 4IFDK 5AVSB 3U59A 3HD7A 2Z5IA 1OXZA 1DEBA 1VPCA 5APUA 5APQA 2C9NY 1GL2A 2P7JA 2PAJA 1GU4A 2FFDB 3GHGC 3HUSC 2HPCB 4N78E 4LC1A 1AQ5A 2OYHC 4I6MC 2KLVA 1M1JB 3HE4A 2IPPA 3V4WA 3M06A 2R3CA 1FZFA 1RY3A 1G1JA 1SQXK 1GK6A 1IC2A 1KQLA 1IO4A 1LTSC 1XTCC 2WPQA 1NU1K 1YTZI 2KOGA 3B5NA 2QM8A 2LKMA 3VMXA 3KYQA 3KDPB 1E5WA 5AW2B 1GL2D 1H89A 3NTNA 2YO3A 1ZLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV5 A;  3HE5 B;  1FAV A;  5AW1 B;  3A2A A;  3A3Y B;  1J2J B;  2W6A A;  4JYB A;  3VMY A;  2P2U A;  1GK4 A;  5AVV B;  4GT1 A;  1CI6 B;  3HE4 B;  3A5T A;  3L35 A;  4C7N B;  2XU6 A;  2ZXE B;  3M0D A;  1A02 J;  4HYT B;  3A7O A;  3MGN A;  3TNU B;  2JJL A;  1NWQ A;  2E43 A;  5AW9 B;  3TK1 A;  5AVW B;  2H7H A;  5AW7 B;  3NMD A;  3P32 A;  1MFZ A;  2R32 A;  5APS A;  1T2K D;  1H88 A;  3IR9 A;  2ZFC A;  1HBW A;  3VTP C;  1GU5 A;  2WWW A;  3B8E B;  3OAK A;  5APX A;  3V4Q A;  4DZO A;  3TYY A;  1GZL A;  4JYC A;  2KP8 A;  1A02 F;  2QM7 A;  4C46 A;  2WT7 B;  3VMZ A;  1CSB A;  1OWA A;  3LID A;  3M9B A;  2Q5U A;  1FOS E;  1HWT C;  5AVY B;  3I5C A;  3HE5 A;  1GTW A;  2P67 A;  1NAF A;  5AVU B;  2YNY A;  4AYC A;  1CI6 A;  1S9K E;  2Z5H A;  3LIE A;  2WPR A;  3M9H A;  5AVT B;  5AW4 B;  4C7N A;  3SWF A;  5AW3 B;  3L36 A;  5AVR B;  4XE5 B;  4M3L A;  4RES B;  1H8A A;  4AUW A;  2R5D A;  2Q7C A;  1T2K C;  2Q3I A;  1HJB A;  3NFQ A;  3NXS A;  5APY A;  1CZQ A;  3TNU A;  3O8Z A;  5AW8 B;  1HUC A;  3UIA A;  5APT A;  5AVQ B;  5AVS B;  2Z5I A;  1OXZ A;  2W27 A;  3T97 A;  5APW A;  1GD2 E;  3P8M C;  5APU A;  5AVZ B;  1G2C B;  5AW0 B;  5APQ A;  4EOT A;  1SP4 A;  2C9N Y;  2P7J A;  1GU4 A;  2XZR A;  5APV A;  2YO2 A;  2VRS A;  4LC1 A;  2WTY A;  2WPS A;  2WT7 A;  3M91 A;  4I6M C;  2R5B A;  3VN0 A;  3HE4 A;  3V4W A;  2IPP A;  4GKG A;  2BAS A;  3M06 A;  3KQG A;  2R3C A;  3MD0 A;  5CMZ A;  1GK6 A;  1KQL A;  1IO4 A;  5AW6 B;  5AW5 B;  2WPQ A;  4I2L C;  3HTK A;  1JUN A;  1SLQ A;  1X8Y A;  2N9B A;  2QM8 A;  1JNM A;  3VYI A;  3V5B A;  1S9K D;  3VMX A;  4AQR D;  2C9L Y;  1DH3 A;  1YYC A;  3KDP B;  4KHX A;  2E42 A;  1MUU A;  5AVX B;  5AW2 B;  4B86 A;  1H89 A;  1MV8 A;  3P7K A;  3NTN A;  1FOS F;  2YO3 A;  3L37 A;  3M0A A; 
#chains in the Genus database with same CATH topology
 2KB7 P;  1FZE A;  3CC2 P;  1OMI A;  5AVV B;  3H1I G;  4UB6 E;  1JO5 A;  3RL0 C;  1EDL A;  2XU6 A;  2JR8 A;  3V2P A;  1SQQ G;  3B5N D;  1ZXG A;  1DD3 A;  1LJ2 A;  4H13 C;  1NWQ A;  3H32 A;  3CC4 P;  4PJ0 H;  1LT9 B;  2R44 A;  4IL6 H;  1DEE G;  2E75 D;  2FBW C;  1GU5 A;  1M90 Q;  2M5A A;  4BWN A;  3L71 G;  1FZG A;  2ITA A;  2FY8 A;  1PV3 A;  3L70 J;  5TIS E;  2D2C D;  3Q1M A;  1DIP A;  2K9J A;  1FJK A;  5CCH A;  4AUW A;  1TU3 F;  3NXS A;  3TGU E;  1S4X A;  3UIA A;  3KPE A;  2W27 A;  1BGY J;  5M1B A;  4EOT A;  1P84 D;  5APV A;  5EFW B;  3B5N C;  4BXL A;  3L73 J;  4DJG A;  2FYU J;  2E5T A;  4EI2 A;  1JTH A;  1M7L A;  1RF1 C;  3HTK A;  2WIT A;  3I55 P;  3V5B A;  2E76 B;  3CCM P;  3K5B A;  2N1T D;  3FWN A;  2K3R A;  2RH0 A;  3JC2 2;  5AVT B;  1GL2 B;  1SFC C;  2GUV A;  2IZ1 A;  1J2J B;  5GTH H;  2M0B A;  3GG2 A;  1OFC X;  1ZR4 A;  3V2R A;  1BGY D;  3AE1 C;  1ZV8 A;  3PP5 A;  2PGD A;  2BCC E;  1A02 J;  2AEJ A;  5GTI E;  3L73 D;  3SSU A;  1QX8 A;  4ZNC A;  3V4Q A;  5KLV G;  1A02 F;  3U1C A;  2E74 D;  1FOS E;  2H8P D;  3I5C A;  3BCC D;  1Y47 A;  1KIL D;  1P84 H;  1P84 I;  2H43 A;  3HUS B;  5CJ4 A;  2N1T C;  5KAI H;  1RH5 B;  2Q7C A;  2IBZ E;  2IDB A;  4H0L B;  1G2C B;  2WVR A;  1N7S A;  1RHZ B;  1BCC E;  3CC7 P;  2P1J A;  2HFE D;  1RE4 C;  3VMA A;  3IFM A;  1L4A A;  1LWU A;  1ZME C;  4H44 D;  1YQ4 C;  1SLQ A;  1H0T A;  2FFD C;  2XDJ A;  4U3F D;  2C9L Y;  4WY4 B;  1T8Z A;  1EZV D;  3P7K A;  1GDT A;  3L37 A;  3V2Q A;  1YJW P;  2XV5 A;  1VQ4 P;  1FAV A;  1NU1 D;  1KB9 E;  5B5E H;  1PGO A;  2ZVN B;  3CWB D;  3TF5 A;  1CI6 B;  1ZW0 A;  4C7N B;  2Q3E A;  3M0D A;  2JJL A;  3D6Z A;  4WVZ A;  3HTK B;  3NMD A;  1ZRT D;  3MP7 B;  1VQO P;  5KJ7 C;  1VQ9 P;  3TGU J;  2WWW A;  1W5C E;  2BEQ D;  3O6Q A;  5CBO A;  5KAF H;  2I1J A;  5C39 A;  1W2B O;  1U7J A;  1LT9 C;  3S9O A;  1AVY A;  1Q86 Q;  1BGY G;  1L0L D;  2Y0D A;  2M3B A;  1LTJ C;  2NRG A;  1FZA A;  1S3J A;  2E76 D;  3L73 G;  1Q7Y Q;  3RK2 B;  3CCE P;  3CLQ A;  1NAY A;  3A0B H;  1EZV I;  2PP6 A;  3FGA D;  3F89 A;  2WT7 A;  1VQ5 P;  2DW3 A;  3BCC G;  3L74 E;  2BCC J;  5CCG A;  1FJP A;  2QJP B;  1M57 D;  2AEF A;  1JY3 O;  3CCS P;  3G71 P;  4Y99 B;  1PP9 E;  2WSC H;  2QJK B;  1FC2 C;  1OX3 A;  1NTK E;  1VQ8 P;  5CBN A;  1URQ D;  2B87 A;  1L4A B;  4C7R A;  1Z56 A;  2E76 C;  1T6A A;  4D6T D;  1N86 A;  3TK1 A;  3T97 B;  1GL2 C;  4H13 B;  1K9M Q;  2QA4 P;  1T2K D;  3CI9 A;  2YIU B;  4U3F G;  3V2N A;  2BCC D;  1EZV G;  1AFO A;  1CSB A;  1BCC J;  1S1C X;  1HWT C;  2FKW B;  2P67 A;  1KYO H;  1KYO I;  1NU1 G;  2KI7 B;  1EC5 A;  1BDD A;  1N73 A;  1QVF O;  2XKM A;  1S9K E;  5AW4 B;  3KZI H;  3L36 A;  3AE9 C;  4YPC A;  1K04 A;  4U7J A;  3AE5 C;  2WSS H;  4WY4 D;  4GDO A;  2Z5I A;  5APQ A;  2C9N Y;  3O6Q B;  2OTL P;  1GU4 A;  2PAJ A;  3HUS C;  2H88 C;  2HPC B;  1YJ9 P;  4LC1 A;  2OQQ A;  3HE4 A;  3V4W A;  3QH9 A;  1KQL A;  1FS0 E;  4H0L C;  1X22 A;  2QM8 A;  2LKM A;  3CPW O;  3AE7 C;  3KYQ A;  3KDP B;  1E5W A;  1L0L G;  3H1I D;  1SQP E;  1SQP K;  1AV1 A;  1BSN A;  1N8R Q;  5CCH C;  3A5T A;  3GHG A;  2IFN A;  4HKZ H;  4TT3 H;  2KLU A;  2E43 A;  4OGQ B;  5AW7 B;  1UIX A;  1NTM E;  2NPS A;  2WZ7 A;  2KUB A;  5CJ0 A;  4GOF A;  3FXD A;  3HE5 A;  3CME P;  1HGV A;  3SFE C;  2B87 B;  1FDM A;  1LTT C;  3L75 E;  3L72 E;  3PHL A;  4PV1 B;  5AW3 B;  1EDJ A;  2WSF J;  3L74 J;  1JY2 N;  3TSI A;  5APY A;  4D6T G;  1OW7 A;  5K5G B;  2L5G B;  1Q81 Q;  4PD4 H;  4PD4 I;  1GD2 E;  2KIK A;  3SWY A;  2HYN A;  2YKQ A;  3H1J E;  1PP9 J;  4XA4 A;  2XZR A;  2VRS A;  4NPD A;  3AE2 C;  2BCC G;  1HF9 A;  1VF5 C;  1NTK J;  2BAS A;  2YKP A;  2HOD A;  1NKN A;  2ZAE B;  3OJA B;  3KHU A;  3RL0 D;  3RK2 C;  3LW5 H;  3MTU E;  1N2D C;  2N9B A;  4H13 D;  1XTG B;  2JO1 A;  4O9B A;  2POH A;  2R3S A;  1VQP P;  4WB4 A;  4JYB A;  2Q6Q A;  3HE4 B;  3H1H D;  2J59 M;  2QJP C;  1NTZ E;  3CXH H;  3CXH I;  4YTP C;  1DX7 A;  1NTZ K;  1PP9 D;  3B4S A;  2JWD A;  4Y99 C;  1PFI A;  5B66 H;  5E79 H;  3IR9 A;  2O01 H;  2ZYA A;  1GZL A;  3VP8 A;  1L4A C;  3M9B A;  4NPF X;  1KZU B;  3H1K E;  2KNC A;  4BRY A;  1ZOY C;  1S5L E;  2Q1K A;  5TJH A;  1IK7 A;  3RGU A;  2Y9Z A;  2YIU C;  1HJB A;  2OAR A;  1URQ A;  1JMM A;  2IYO A;  2CK3 H;  3O8Z A;  1LTJ B;  2QE7 H;  5H2F H;  3P8M C;  4ASV A;  1SQP J;  1W2E A;  1ZP0 C;  1SFC D;  1SQB E;  3VN0 A;  2JP3 A;  1R5S A;  1SQB K;  2WSF H;  2YMY A;  5CMZ A;  2AEM A;  5AW5 B;  3GF3 A;  1JOC A;  4WWI A;  3WMM 0;  2Y0E A;  4OGQ D;  4HB1 A;  2WSE J;  4KHX A;  2J5U A;  3PJS K;  4YXW H;  4OVN F;  3CX5 E;  1NTM J;  1SS1 A;  1FDI A;  1IFM A;  1IFJ A;  1ZN5 A;  3VMY A;  3R4Y A;  3G4S P;  3W68 A;  4GOE A;  2QEX P;  3L70 D;  5KTB A;  2HOD B;  2YMK A;  3TNU B;  1YI2 P;  3L75 J;  3L72 J;  1SQP D;  3MIW A;  5AVW B;  3HD7 B;  1Y9B A;  3U1A A;  2ZYD A;  4EDF A;  3A0H E;  1HH0 A;  4KT0 J;  2PRR A;  3BRV B;  1FZC A;  3H1J J;  5AVY B;  1QL1 A;  5CCG C;  2A06 E;  1YHQ P;  1FBM A;  3CCQ P;  4OGQ C;  2HLO A;  3EQ2 A;  4DT0 A;  4A7P A;  3MZW B;  3H1H G;  4IFM A;  2FYU D;  2KSJ A;  4M3L A;  1PP9 G;  1QVG O;  2HG5 D;  2FYN B;  4ZKU A;  2GUS A;  4Z1M H;  4KJM A;  2CPB A;  2YXQ B;  2KZI A;  1RE3 C;  3L75 D;  3L72 D;  4JBZ A;  3PRJ A;  4PV1 C;  2QJY C;  2AXT H;  3CCR P;  1IFP A;  1RF0 C;  2SPZ A;  2QIW A;  1NH4 A;  3H32 B;  1NTZ J;  3RK3 E;  4UB8 E;  1FZB A;  1PPJ E;  4L76 A;  2M5A B;  1USD A;  1MUU A;  1MV8 A;  2OYI A;  5KJ7 D;  2IYP A;  2KXP B;  1OVR A;  2K9J B;  3GMA A;  3H1K J;  4DOJ A;  4N78 D;  4HH2 A;  1USE A;  3A7O A;  3MGN A;  2Q9I A;  1AQT A;  3GLM A;  2B88 A;  1JMB A;  1NTZ D;  1M56 D;  3CCV P;  1KD1 Q;  1YJN P;  2BEZ F;  1GW4 A;  3RK3 B;  1QLE D;  4C46 A;  3VMZ A;  1OWA A;  3EFF K;  2B89 A;  1J1E C;  2KS1 A;  1JTH B;  2ZT9 B;  1J1D B;  4JF7 A;  1HGZ A;  1SQB J;  1NAF A;  5AVU B;  1D7M A;  4GIF A;  4AYC A;  1JY3 P;  3AE6 C;  4XE5 B;  1JY2 O;  3L71 E;  2W83 C;  3F5H A;  3L70 G;  5AW8 B;  1SQP G;  5APT A;  4IFD K;  4DCK A;  1OXZ A;  1DEB A;  2P7J A;  3GHG C;  3S4R A;  3E7K A;  4RJT A;  3CCU P;  4I6M C;  3RBZ A;  3SWK A;  3AE4 C;  1VF5 B;  1FZF A;  1Q82 Q;  4NPE A;  1IO4 A;  3MHV A;  1LTS C;  1XTC C;  2WPQ A;  3B5N A;  1SQB D;  1L2P A;  2FYU G;  1E79 H;  1GL2 D;  2YO3 A;  1YTZ T;  3QWO C;  1IJD B;  4CPG A;  3TGU D;  1RF1 A;  3C1L A;  3B71 A;  4PJ0 E;  4ZMD A;  3L75 G;  3L72 G;  4IL6 E;  2P2U A;  1SQV E;  3WU2 E;  1SQV K;  1KV4 A;  1EXJ A;  3JCU H;  2OYH A;  1SFC A;  3W67 A;  4R4L A;  2RMZ A;  2J58 A;  1N7S B;  4UB6 H;  2M8R A;  1NTK K;  4EYY Q;  2P58 A;  2Q5U A;  2C0W A;  1LWU B;  1IFD A;  2CPS A;  3HD7 C;  1ZR2 A;  3FXE A;  2XND H;  1KN7 A;  5KLV E;  2Z5H A;  2XNX A;  5KLV K;  1M1K Q;  1H0T B;  4H0L D;  3I56 P;  3AEF C;  3NFQ A;  1EXI A;  2A06 D;  1S2E A;  3E1R A;  5TIS H;  2N1T A;  2QVA A;  1SP4 A;  1NTZ G;  2WPS A;  1N7L A;  2G8Y A;  2N9Y B;  1T3U A;  5CCH D;  2FYN C;  1SVF A;  3USS A;  4WBA A;  2PFX A;  5GTH E;  1LGH B;  1HJ0 A;  2JDI H;  3VYI A;  3D6Y A;  2W90 A;  3H1K G;  2IBZ D;  3VP9 A;  3A2A A;  1PPJ D;  1PL5 A;  2K88 A;  2FFD A;  4IFF A;  1BCC D;  1M1J A;  1KIL A;  4IL6 X;  3AE3 C;  1YBK A;  3L71 J;  1BDC A;  1P84 E;  2KSE A;  1IZN B;  2UWJ E;  4IOI H;  2ZFC A;  2Y0C A;  2GA1 A;  5KAI E;  2QSI A;  1HVV A;  1SQB G;  2WT7 B;  2E75 B;  1G1I A;  2V7Q J;  1PGQ A;  2IX7 C;  5GTI H;  2FXM A;  1Q2N A;  3TGU G;  3M9Q A;  3Q5P A;  2ZXX A;  1VF5 D;  1KB9 D;  5KKZ B;  4L74 A;  2D2C B;  2WPR A;  3SWF A;  2OYH B;  3RK3 C;  2I1K A;  3RK2 D;  1BSH A;  3AEG C;  1NTM K;  4OH8 B;  1YQ3 C;  1KC8 Q;  1LT9 A;  2ZT9 C;  1J1D C;  5AVZ B;  1VL2 A;  5BU5 A;  3II6 A;  2R5B A;  2IBZ I;  1LTI C;  4R4M A;  4QMA A;  1SQV J;  2OTK E;  2QJY B;  3H1L E;  5B5E E;  1FZC C;  2G3A A;  3BRT B;  1DH3 A;  3Q3D A;  1N7S D;  5AVX B;  4K3A A;  3BCC E;  3Q5S A;  2A06 G;  1OZH A;  3R2P A;  1KIL E;  1YIJ P;  1L0N E;  2MJZ A;  1L0N K;  2H89 C;  1L4A D;  1N73 B;  1GK4 A;  4GT1 A;  4W7Y A;  1U7M A;  1VDF A;  1K73 Q;  5KAF E;  5KLV J;  1LTA C;  2C0X A;  3RL0 g;  1KB9 H;  1KB9 I;  3L74 D;  1WT6 A;  4RO0 A;  2WPV B;  2IBZ G;  2E74 B;  2YXR B;  1PPJ G;  1J1E B;  4HJG H;  2YNY A;  3A0B E;  2W6B A;  1N7S C;  3LIE A;  1NTK D;  1EZV E;  1KIL B;  1BCC G;  2OYI C;  1WRG A;  1LP1 A;  1NU1 E;  1LWU C;  1VQ7 P;  3CWB E;  1JY3 N;  3RBX A;  3Q5R A;  3D71 A;  3M91 A;  3GHG B;  4GOD A;  2JKV A;  1GW3 A;  3AEC C;  1ZRT E;  1BE3 E;  1NKZ B;  1JB0 J;  2O3J A;  3CL3 D;  5AW6 B;  3HUS A;  5L8R J;  4H44 B;  2IFM A;  1S9K D;  4AQR D;  1VQL P;  1YYC A;  2NPS B;  1X79 B;  2LXC B;  2ZVO B;  3M0D C;  3TDK A;  1OVU A;  2WQY C;  3HE5 B;  3WU2 H;  3ZDM A;  1G2C A;  1LNQ A;  1L0L E;  3P8C E;  5CCG D;  1L0L K;  4TLF A;  2ZJS E;  1KYO E;  3CD6 P;  2Y9Y A;  3HRN A;  1DD4 A;  2KYV A;  3B8E B;  3KZI E;  4DZO A;  4WY4 A;  2M3E A;  2QM7 A;  2K37 A;  1KMI Z;  1OW8 A;  1GTW A;  2YKO A;  4PV1 D;  2FYZ A;  1CI6 A;  2JEE A;  3EFG A;  1LTG C;  3WUV A;  4C7N A;  1H8A A;  4RES B;  1AA0 A;  3H1L J;  2Q3I A;  2E75 C;  1CZQ A;  3IN6 A;  2LXB A;  2V4H A;  1VPC A;  5APU A;  5KLI C;  1SQV G;  3BCC J;  1MFT A;  3L74 G;  5KKZ C;  3PTZ A;  2D2C C;  1AQ5 A;  1L0N J;  4D6T E;  1NTM D;  2OYH C;  3AEE C;  3ABV C;  3M06 A;  1SQX E;  1RY3 A;  1G1J A;  1SQX K;  1S5L X;  2JWA A;  2K9Y A;  2KOG A;  1NTK G;  1LP1 B;  3OW2 O;  5AW2 B;  3NTN A;  1ZLL A;  1MZ9 A;  3H1L D;  2KNC B;  4BRY B;  3A3Y B;  3H25 A;  2W6A A;  3H1J D;  3MUD A;  3CCJ P;  1JY2 P;  2KZJ A;  1T3J A;  2B9B A;  2ZXE B;  1URQ B;  4LLH A;  1HTL C;  1IFI A;  4U3F J;  1KFM A;  1L0N D;  1EDI A;  2WMM A;  5BVZ A;  5APS A;  1QEX A;  1H88 A;  3VTP C;  1N73 C;  1NU1 J;  3OAK A;  3CWB J;  2KP8 A;  3GW6 A;  3D70 A;  5CHX A;  4PD4 E;  2WSE H;  3Q2Y A;  2WSC J;  4LGD E;  3PLN A;  1BE3 J;  2MKV A;  3H1I E;  2R5D A;  4XFJ A;  1SQQ E;  4K35 A;  1Y8A A;  5AVQ B;  2NPS D;  1SQQ K;  2A45 H;  2A45 I;  2E74 C;  3T97 A;  1JEK A;  5AW0 B;  1M8O B;  1M1J C;  2WTY A;  1KIL C;  2O01 N;  3AED C;  1NVO A;  4GKG A;  3PH0 A;  1EQ7 A;  2HR3 A;  1L0L J;  4RKU J;  3BAT A;  3H1K D;  4I2L C;  1LT1 A;  4JQ0 D;  2O1J A;  1JCD A;  3CXH E;  1X9V A;  1FZC B;  3BAS A;  1Q90 D;  2E42 A;  1RQU A;  4B86 A;  3JSV C;  1BE3 D;  2QRX A;  5B66 E;  5AW1 B;  2LR2 A;  5E79 E;  3FX0 A;  2HPC A;  3SFD C;  2W6J H;  1VQN P;  1K8A Q;  2RN0 A;  1NTM G;  4H44 C;  2NPS C;  3HD7 D;  2AXC A;  1MKM A;  5AW9 B;  1NOH A;  2A45 G;  2QG4 A;  1HBW A;  3P8C D;  5APX A;  3OA7 A;  4N6J A;  5BU8 B;  4JYC A;  1PIX A;  4MN4 C;  3AEB C;  1KYO D;  3IAO A;  5H2F E;  3H1L G;  3CX5 D;  4D6T J;  3VOP A;  1VQM P;  1QL2 A;  3H6P A;  1R8E A;  4I1L A;  3H1J G;  1SQX J;  1IFN A;  1RQV A;  2OYI B;  3V6I A;  1L0N G;  3G9R A;  1S5L H;  1WMK A;  3H1H E;  2YO2 A;  1KQG B;  3G6E P;  1CW5 A;  4I7Z B;  3KQG A;  2L91 A;  1RE3 A;  1OVV A;  2ZYG A;  2OYO A;  3RL0 B;  1X8Y A;  1JNM A;  4N3Y B;  1RF0 A;  1SQX D;  1FOS F;  3AEA C;  4OWF A;  2KS1 B;  1LTB C;  3E1I A;  3KXD A;  1JM0 A;  4W80 A;  1FE6 A;  1YIT P;  3CMA P;  4L73 A;  1RE4 A;  3CX5 H;  1OIP A;  3CX5 I;  3CWB G;  3H1I J;  4L75 A;  3IF4 A;  1MFZ A;  2KK7 A;  2R32 A;  3RK3 D;  1SQQ J;  4ZKP A;  1OW6 A;  3L4F A;  3LW5 J;  1KTM A;  2ZT9 D;  1BE3 G;  1URQ C;  3WUU A;  2FXO A;  3N4X A;  3A0H H;  2IZ0 A;  1KOR A;  3B5N B;  1FU1 A;  1S72 P;  1PZQ A;  2GM4 A;  1T2K C;  2AXT E;  3BVH A;  1HUC A;  4PD4 D;  3WUT A;  1RF1 B;  5APW A;  1VQ6 P;  1NJI Q;  1KFN A;  5KLI B;  5KJ7 A;  1UII A;  3AE8 C;  3L70 E;  2O01 J;  1SQQ D;  1R5L A;  1KQS O;  3ITK A;  2E5Y A;  3MD0 A;  1SFC B;  1NO4 A;  2Z4E A;  1JUN A;  4WY4 C;  3N7N A;  3S1K A;  1BGY E;  1KQF B;  4EIJ A;  3L71 D;  3M0A A;  1LTJ A;  1VQK P;  4YXD C;  1JCC A;  4W7Z A;  3L73 E;  4UB8 H;  1GMJ A;  2FYU E;  3CXH D;  3L35 A;  2FYU K;  2RKL A;  4HYT B;  3C9I A;  2H7H A;  1AJY A;  3P32 A;  2N1T B;  3TYY A;  3LID A;  3H1H J;  1SQX G;  5DJU B;  2O1K A;  2I8D A;  1PGJ A;  1IK9 A;  5DJT B;  3G3Z A;  2FXP A;  1NHL A;  1U57 A;  3C8V A;  1FDO A;  1NGM B;  3M9H A;  1X0T A;  5AVR B;  1SQV D;  2OTJ P;  3GF7 A;  3TNU A;  4Y28 J;  5AVS B;  3U59 A;  3HD7 A;  4JPZ B;  3MUD C;  4ASW A;  1QGK B;  1GL2 A;  2FFD B;  1NYH A;  4N78 E;  1EDK A;  1PGP A;  2OGU A;  2KLV A;  4U3F E;  1M1J B;  2IPP A;  2R3C A;  2K1A A;  1K05 A;  1AVO A;  2NZ2 A;  1GK6 A;  1IC2 A;  2W8Z A;  2V7Q H;  1NU1 K;  1YTZ I;  3CCL P;  5KLV D;  3VMX A;  3JCU E;  3EWK A;  1H89 A;  2P10 A;  3FWL A;  4I7Z C;  2QJK C; 
#chains in the Genus database with same CATH homology
 1IJD B;  1MZ9 A;  1RF1 A;  2KB7 P;  1SQP K;  3A3Y B;  1FZE A;  2W6A A;  2P2U A;  5AVV B;  5CCH C;  3MUD A;  1JY2 P;  3A5T A;  1JO5 A;  1SQV K;  1T3J A;  3RL0 C;  2XU6 A;  2ZXE B;  3GHG A;  2IFN A;  3V2P A;  1URQ B;  3B5N D;  4LLH A;  1HTL C;  2OYH A;  1IFI A;  1YTZ T;  1NWQ A;  3H32 A;  1KFM A;  1SFC A;  2E43 A;  5AW7 B;  5BVZ A;  1LT9 B;  5APS A;  2J58 A;  1H88 A;  3VTP C;  1N7S B;  1N73 C;  1GU5 A;  2M8R A;  3OAK A;  2KP8 A;  2NPS A;  2WZ7 A;  1NTK K;  2Q5U A;  5CJ0 A;  1FZG A;  5CHX A;  2C0W A;  1LWU B;  1IFD A;  2CPS A;  3HE5 A;  2WSE H;  3HD7 C;  1ZR2 A;  1HGV A;  1FDM A;  1FJK A;  4LGD E;  1LTT C;  2Z5H A;  2XNX A;  5KLV K;  5AW3 B;  5CCH A;  3TSI A;  1JY2 N;  4AUW A;  2R5D A;  3NFQ A;  3NXS A;  5APY A;  2L5G B;  3UIA A;  5AVQ B;  2NPS D;  3KPE A;  1SQQ K;  2A45 H;  2A45 I;  2W27 A;  3T97 A;  1GD2 E;  3SWY A;  2HYN A;  2YKQ A;  2N1T A;  5AW0 B;  4EOT A;  1SP4 A;  4XA4 A;  2XZR A;  5APV A;  1M1J C;  2VRS A;  3B5N C;  2WTY A;  2WPS A;  1N7L A;  1KIL C;  4GKG A;  2BAS A;  1T3U A;  1EQ7 A;  5CCH D;  1JTH A;  1SVF A;  2YKP A;  4WBA A;  2HOD A;  1NKN A;  3BAT A;  3OJA B;  3RL0 D;  1M7L A;  3RK2 C;  3LW5 H;  1RF1 C;  4I2L C;  3MTU E;  1LGH B;  3HTK A;  1N2D C;  2WIT A;  2O1J A;  1JCD A;  2N9B A;  3VYI A;  3V5B A;  1XTG B;  1X9V A;  1FZC B;  3BAS A;  2N1T D;  2E42 A;  4B86 A;  5AVT B;  4O9B A;  2POH A;  3VP9 A;  1GL2 B;  5AW1 B;  1SFC C;  3A2A A;  2GUV A;  4WB4 A;  1J2J B;  4JYB A;  1ZR4 A;  2FFD A;  2HPC A;  4IFF A;  3HE4 B;  3V2R A;  2J59 M;  1ZV8 A;  3PP5 A;  1DX7 A;  1NTZ K;  1M1J A;  2NPS C;  3HD7 D;  1A02 J;  1KIL A;  4Y99 C;  1PFI A;  5AW9 B;  1NOH A;  2A45 G;  3IR9 A;  2ZFC A;  2O01 H;  1HBW A;  3P8C D;  5APX A;  3OA7 A;  4N6J A;  3V4Q A;  1HVV A;  5BU8 B;  1GZL A;  4JYC A;  3VP8 A;  1A02 F;  2WT7 B;  3U1C A;  1L4A C;  1G1I A;  3M9B A;  1FOS E;  2IX7 C;  2H8P D;  1KZU B;  3I5C A;  2FXM A;  3M9Q A;  3VOP A;  1KIL D;  1QL2 A;  2H43 A;  3H6P A;  4I1L A;  3HUS B;  5CJ4 A;  2N1T C;  2WPR A;  1IFN A;  3SWF A;  2OYH B;  2Q7C A;  1HJB A;  3RK3 C;  2OAR A;  1URQ A;  1JMM A;  2I1K A;  3RK2 D;  3O8Z A;  2OYI B;  1NTM K;  4OH8 B;  1LTJ B;  1LT9 A;  1J1D C;  3P8M C;  5AVZ B;  1G2C B;  1N7S A;  5BU5 A;  2YO2 A;  2P1J A;  1W2E A;  2HFE D;  3II6 A;  1CW5 A;  1SFC D;  2R5B A;  1RE4 C;  1LTI C;  3VN0 A;  1SQB K;  3IFM A;  2WSF H;  3KQG A;  1L4A A;  1LWU A;  2YMY A;  5CMZ A;  1RE3 A;  5AW5 B;  1JOC A;  3WMM 0;  1FZC C;  1SLQ A;  1X8Y A;  3RL0 B;  2FFD C;  2XDJ A;  1JNM A;  3BRT B;  2C9L Y;  4N3Y B;  4WY4 B;  1DH3 A;  1T8Z A;  4KHX A;  1RF0 A;  1N7S D;  5AVX B;  3P7K A;  1FOS F;  1GDT A;  3L37 A;  3V2Q A;  2XV5 A;  3R2P A;  1FAV A;  1IFM A;  1LTB C;  1IFJ A;  1ZN5 A;  2MJZ A;  1L0N K;  3VMY A;  1L4A D;  3E1I A;  1GK4 A;  1N73 B;  4GT1 A;  1CI6 B;  4W7Y A;  4W80 A;  4C7N B;  1VDF A;  3M0D A;  5KTB A;  2HOD B;  3TNU B;  2JJL A;  1RE4 A;  3MIW A;  1LTA C;  2C0X A;  3HTK B;  5AVW B;  3HD7 B;  3NMD A;  1MFZ A;  2R32 A;  3RK3 D;  5KJ7 C;  3U1A A;  1HH0 A;  4ZKP A;  2WWW A;  3BRV B;  3L4F A;  1WT6 A;  1FZC A;  1URQ C;  5AVY B;  2I1J A;  1QL1 A;  5CCG C;  1FBM A;  1J1E B;  1LT9 C;  2HLO A;  3EQ2 A;  3N4X A;  2YNY A;  2W6B A;  3B5N B;  1N7S C;  3LIE A;  1FU1 A;  1KIL B;  4IFM A;  2KSJ A;  4M3L A;  2GM4 A;  2OYI C;  1T2K C;  2M3B A;  1LTJ C;  3BVH A;  1WRG A;  2HG5 D;  1HUC A;  1FZA A;  4ZKU A;  2GUS A;  1LWU C;  3RK2 B;  5APW A;  1RF1 B;  2CPB A;  1RE3 C;  3CLQ A;  1JY3 N;  1KFN A;  5KJ7 A;  2PP6 A;  2WT7 A;  3M91 A;  3GHG B;  1RF0 C;  1GW3 A;  3MD0 A;  1NH4 A;  3H32 B;  1NKZ B;  1SFC B;  3CL3 D;  1NO4 A;  2Z4E A;  5AW6 B;  5CCG A;  1FZB A;  1FJP A;  3HUS A;  1JUN A;  4WY4 C;  2IFM A;  1S9K D;  4AQR D;  3N7N A;  1JY3 O;  1YYC A;  2NPS B;  1X79 B;  1MUU A;  1MV8 A;  4Y99 B;  4EIJ A;  2OYI A;  3M0D C;  5KJ7 D;  2WSC H;  3M0A A;  1LTJ A;  1JCC A;  3HE5 B;  4W7Z A;  1G2C A;  1URQ D;  3L35 A;  2FYU K;  4DOJ A;  3P8C E;  5CCG D;  1L0L K;  1L4A B;  4C7R A;  1Z56 A;  4N78 D;  4HH2 A;  4HYT B;  3C9I A;  3A7O A;  1N86 A;  3MGN A;  2Q9I A;  3TK1 A;  2H7H A;  1GL2 C;  3P32 A;  1T2K D;  2N1T B;  3CI9 A;  3HRN A;  2KYV A;  3B8E B;  4DZO A;  3TYY A;  1GW4 A;  3V2N A;  3RK3 B;  4WY4 A;  2QM7 A;  4C46 A;  1AFO A;  3VMZ A;  1CSB A;  1OWA A;  3LID A;  2O1K A;  1HWT C;  2FKW B;  1IK9 A;  1J1E C;  1JTH B;  1J1D B;  3G3Z A;  2P67 A;  4JF7 A;  1GTW A;  1HGZ A;  2YKO A;  1NAF A;  5AVU B;  1NHL A;  1N73 A;  2FYZ A;  4GIF A;  4AYC A;  1CI6 A;  2XKM A;  2JEE A;  1S9K E;  3EFG A;  1LTG C;  3M9H A;  1JY3 P;  5AW4 B;  4C7N A;  3L36 A;  5AVR B;  4XE5 B;  1H8A A;  1JY2 O;  4RES B;  2Q3I A;  1CZQ A;  3TNU A;  5AW8 B;  5APT A;  4WY4 D;  4IFD K;  5AVS B;  3U59 A;  3HD7 A;  2Z5I A;  1OXZ A;  1DEB A;  1VPC A;  5APU A;  5APQ A;  2C9N Y;  1GL2 A;  2P7J A;  2PAJ A;  1GU4 A;  2FFD B;  3GHG C;  3HUS C;  2HPC B;  4N78 E;  4LC1 A;  1AQ5 A;  2OYH C;  4I6M C;  2KLV A;  1M1J B;  3HE4 A;  2IPP A;  3V4W A;  3M06 A;  2R3C A;  1FZF A;  1RY3 A;  1G1J A;  1SQX K;  1GK6 A;  1IC2 A;  1KQL A;  1IO4 A;  1LTS C;  1XTC C;  2WPQ A;  1NU1 K;  1YTZ I;  2KOG A;  3B5N A;  2QM8 A;  2LKM A;  3VMX A;  3KYQ A;  3KDP B;  1E5W A;  5AW2 B;  1GL2 D;  1H89 A;  3NTN A;  2YO3 A;  1ZLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...