1M8OB

Platelet integrin alfaiib-beta3 cytoplasmic domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
47
structure length
47
Chain Sequence
KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural mechanism of integrin alfaiib beta3 "Inside-out" Activation as regulated by its cytoplasmic face.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords platelet integrin alfaIIb subunit: cytoplasmic domain
total genus 5
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1m8oB00
1M8OB 1S4XA
chains in the Genus database with same CATH superfamily
1SS1A 2E74B 1P84E 1OFCX 1ZN5A 3G4SP 4H13C 1HUCA 2K9JA 3JCUH 5AW5B 2W27A 1W2EA 1HVVA 4H13D 3MD0A 2WSEH 2AEJA 2E42A 3SSUA 2K37A 3TGUE 1SQVK 4JPZB 2JJLA 3CCMP 1KB9I 2W6JH 3CCSP 3L73G 4AUWA 3JC22 1JY2P 2ZXEB 1YYCA 3MP7B 5CCHA 3OA7A 5AW2B 2HPCB 3U1AA 1D7MA 1YQ4C 3IFMA 5H2FE 2RH0A 3S1KA 2C0XA 3CPWO 5CCGD 4GDOA 4U3FJ 2UWJE 3FXDA 2RKLA 1K9MQ 3WUVA 3H32B 2ZYDA 1KILA 1L4AC 2YXQB 2KK7A 2OTLP 1SQBK 2FXPA 4AYCA 2IZ1A 3O8ZA 1S72P 1KD1Q 3L75J 5KJ7D 2B87A 1VQKP 3ITKA 4RO0A 2WPRA 4WY4C 1FU1A 2N1TC 2PAJA 2W90A 2Y0DA 3A5TA 4OGQB 3IN6A 1LTIC 1IFNA 3LIEA 3NMDA 2GA1A 4NPFX 4WB4A 1X9VA 3AEGC 3HRNA 2WPSA 2H89C 1KYOI 2NPSC 2OYOA 2P2UA 4JYCA 3KHUA 1GW4A 1KYOD 3N4XA 1SQVG 1NU1J 1YTZI 2YIUB 3RL0C 2FFDC 2FYUK 4ASWA 1L0LK 3H1JE 2GM4A 3AEAC 1VQMP 4PD4E 1CZQA 1NTMD 3HUSC 1JTHB 1HGZA 2AXCA 3L72G 1N73B 2H7HA 1RF0A 1OWAA 4UB8E 3B71A 2HFED 2HYNA 1KILB 5AW7B 3T97B 1ZMEC 1L0LD 1NTKG 2IDBA 5KTBA 2R44A 2KLVA 1SQXJ 2FY8A 1BE3J 1URQB 3GG2A 3O6QB 4OVNF 1GK4A 1WMKA 5K5GB 3PRJA 1M1JB 1N7SD 3GHGA 2JDIH 2L5GB 1PP9E 1MKMA 1M7LA 1Z56A 1KYOH 3BATA 2M3EA 3AE7C 1NU1K 3SFEC 1OW8A 1SQXG 1N7LA 1S1CX 3B4SA 2FYUG 3L75E 4HB1A 4WY4A 4AQRD 3M91A 2ZYGA 3H1LD 2WSFH 5KKZB 2BCCE 1FZCB 2E76C 4ZKUA 1PFIA 1OZHA 1FZCA 3CX5I 4WWIA 1R5LA 4B86A 3HE4B 3L71J 1EQ7A 1CW5A 4IL6H 1MFTA 1ZXGA 4EIJA 2R5BA 1T2KD 2DW3A 4Y99C 4N78E 1S9KD 1IJDB 2N1TD 3PJSK 3CWBD 3D6YA 2KNCA 2FFDA 1KB9E 2Q9IA 1M90Q 1BDCA 2E76D 1U57A 1L4AD 3RK3D 2K9YA 2FBWC 1SQBD 2ZT9D 3F89A 4I7ZC 5AVUB 3V5BA 2J5UA 3CC7P 4HKZH 1LT9A 1S3JA 1ZW0A 2MKVA 2E76B 2YNYA 3H1KD 1L4AB 3HUSB 3CCQP 4PD4I 1IFJA 2OGUA 2PGDA 1PP9J 4PD4D 1L0LG 1IFMA 3ABVC 3HD7C 1KQSO 1VQNP 3H1LE 3L74D 1QVGO 1KILC 1YI2P 1N86A 4RKUJ 1KYOE 3P8MC 1JMBA 1YBKA 4RESB 2E5TA 2KLUA 3PLNA 4N3YB 3K5BA 5AW9B 1FDMA 1JY3P 1JY2O 5L8RJ 4HH2A 3V4QA 1RHZB 2K1AA 2WT7A 2WMMA 1YIJP 3GMAA 1GTWA 3F5HA 2YKOA 3BCCJ 1RE4A 1SFCC 3L73E 2IFMA 4GT1A 4HJGH 3W67A 4ZNCA 2MJZA 3G6EP 1NGMB 1R5SA 2ZVNB 2M5AB 2Q3IA 4L74A 3P8CD 1RH5B 3L72J 3E1RA 1QX8A 2R3SA 2Z5HA 4RJTA 4IFDK 1VDFA 3S4RA 2V7QJ 1S4XA 2AXTH 2PFXA 1SVFA 2FXOA 2SPZA 3A3YB 3KZIH 4PD4H 5KLVD 3V4WA 1NTKJ 2IFNA 3TK1A 1FAVA 2H88C 1KC8Q 3B5ND 1NTZG 1HWTC 1J1EB 4NPEA 3L71E 2M3BA 2LR2A 1BDDA 1BGYE 1LJ2A 2AXTE 2QJPC 2Q3EA 2O1JA 1PGPA 2BEQD 1SQPG 4L73A 3LW5J 2BCCD 4U7JA 5EFWB 2HG5D 2RN0A 2E43A 4KHXA 3TNUA 2A06G 3AEBC 2P58A 3GF7A 3H1IE 2C9LY 4EYYQ 1NTZJ 4WBAA 1VQ7P 1RQUA 2IYPA 1FOSE 3I5CA 4U3FG 4C7RA 1DEEG 4ZKPA 1NTKK 4I1LA 2E5YA 1P84H 2OYIA 2FYZA 2QM8A 1VQLP 4YXWH 2FYNC 5APTA 3H1IG 1JTHA 2JWDA 1H0TA 3A0BH 1J1EC 3GW6A 1YITP 3FWLA 5CJ4A 2OYHA 5AVVB 3RL0D 3L35A 4M3LA 4XE5B 1JNMA 5AW3B 3L70G 1HBWA 1RE3C 1AVOA 1G2CB 1L0NG 1SQPD 1NVOA 2BCCG 2KP8A 4GOEA 5M1BA 3Q1MA 4JBZA 2WQYC 4OH8B 1JY3O 2I1JA 3AE1C 3M9BA 4DT0A 1GD2E 3G9RA 4WY4D 5GTHH 3WUUA 1M57D 1FZBA 3L36A 3GF3A 3WU2H 1N8RQ 2M0BA 1LTSC 1JEKA 1MZ9A 2OQQA 4XFJA 2YO2A 1PP9G 3L73D 1DX7A 4N78D 1S9KE 5CJ0A 3C8VA 2LKMA 4TLFA 3S9OA 4BRYA 1N7SA 1QL1A 4WY4B 4EOTA 1FJPA 1OW6A 3H1IJ 1CI6A 3MHVA 3R2PA 2JO1A 1L0NE 5APXA 1LT9B 1JOCA 3SFDC 2KZIA 2IYOA 1SQQJ 2NPSB 3AEDC 3L70D 1LTJA 1EZVD 2KB7P 2Y9ZA 1NU1D 3RL0B 1EZVI 1FOSF 3CL3D 2A06D 1AV1A 4PV1C 1LT1A 1LTGC 2CK3H 3PHLA 3SWKA 1U7JA 2J58A 3BRVB 1BCCJ 1NKNA 3C9IA 3PP5A 4I7ZB 4UB6E 4CPGA 2I8DA 4H0LB 3G71P 1KFMA 1BSHA 1RY3A 4PJ0E 4WVZA 3I56P 4IFFA 3CCLP 2O1KA 1LNQA 2N9YB 1BGYD 5APUA 3TGUJ 1MUUA 5B66H 1IZNB 2IZ0A 1KILE 3D6ZA 1VF5C 2ZAEB 2IBZI 4UB6H 1FDOA 5KAIE 2IPPA 5KJ7C 1SQXD 4KT0J 3VP8A 1NTMG 1SQQK 1X79B 3FXEA 1AJYA 5CHXA 4HYTB 1M1KQ 3H1LG 1IC2A 4OGQC 4DOJA 3H25A 1GL2C 1LGHB 1LP1A 3MZWB 1YQ3C 4KJMA 5E79E 3L70E 3H1HD 5KAFE 1KB9H 2JKVA 3L74G 3P8CE 4OGQD 3V2RA 2YIUC 1M56D 1JCCA 1OVRA 5DJTB 1S5LH 4JQ0D 1X0TA 1KQFB 1BE3G 3MGNA 3H1LJ 1RQVA 2OTJP 4YXDC 1GU4A 1FJKA 1P84D 1FBMA 4W7ZA 4R4MA 1SQPK 2KNCB 1PPJD 2H8PD 5APSA 2B9BA 1WRGA 3H1KE 1VF5B 3BRTB 4A7PA 1TU3F 1USDA 2RMZA 5TISE 2L91A 2D2CB 3MUDA 3CI9A 3IAOA 3CWBJ 1OVVA 1SQXE 2O01J 1OXZA 3AECC 3LW5H 3QWOC 1KILD 1GDTA 1MV8A 1K73Q 1KORA 2KS1B 2W6AA 1IO4A 1JY3N 3P32A 2QJKB 3A7OA 3GLMA 1DH3A 1KB9D 3A0BE 3D70A 1SQBJ 1YJ9P 1E5WA 5CCHC 1LTBC 1R8EA 1SQBE 1VQ4P 1ZRTD 2P10A 3CWBG 3CX5H 4Y28J 1FZAA 3RK3E 3CD6P 1G2CA 3M9HA 2WVRA 3P7KA 5AVSB 2KYVA 2A45I 1Q82Q 4I2LC 1G1JA 2POHA 2Y0EA 2P7JA 2Y9YA 2FYUJ 2HR3A 3CCRP 1J1DB 2W6BA 3AE9C 4D6TJ 2VRSA 3A0HH 5KLVK 1M1JC 1XTCC 2LXBA 1NOHA 1VPCA 2P67A 1NO4A 3H1KG 4LGDE 2KI7B 4Z1MH 3L37A 4GKGA 1ZOYC 2E75B 4O9BA 4TT3H 1SQVD 3HTKB 5APQA 1GL2B 4C7NB 1H89A 2KZJA 1DD4A 2W83C 2KS1A 1BE3E 1K04A 2AEFA 1UIIA 2JR8A 2YKPA 3AE5C 5AW4B 5TJHA 3WMM0 3Q5RA 3Q5SA 1KMIZ 1NTMJ 2GUVA 1ZRTE 3CX5D 1J2JB 3AE3C 3HE5B 4IL6X 2E74C 3FGAD 1KV4A 1ZV8A 3KQGA 2Q1KA 4DJGA 3U59A 4EDFA 3TDKA 5KLVJ 1FZGA 1NTKD 4H0LD 3OJAB 3HE4A 2O01H 5KLIB 1HGVA 1ZR2A 2P1JA 2A45G 2IBZD 2ZJSE 3AEFC 2BEZF 1Y47A 3TYYA 3KPEA 2Q5UA 3Q5PA 1GU5A 1SQPE 4W7YA 2JP3A 1Q2NA 1K8AQ 3MTUE 1NWQA 2OTKE 3TNUB 1USEA 3W68A 1PPJE 3E7KA 1QL2A 1NJIQ 1LTTC 2QJKC 1L0NK 3A0HE 3H1JD 4NPDA 2Q7CA 1NTZD 2FXMA 4MN4C 1GL2D 3EQ2A 3B5NB 1LTJC 4BXLA 4H44C 5KAFH 2QE7H 1FZEA 5KKZC 1BSNA 1EDJA 2OYIC 4PJ0H 2KSEA 3HD7A 1U7MA 3WU2E 3BVHA 1HH0A 2FYNB 1FDIA 2YO3A 1A02F 2R32A 5C39A 5CCHD 2N1TB 3M0AA 4YTPC 2M8RA 1IK9A 1QEXA 1JMMA 3EWKA 5AVXB 4GIFA 1K05A 1EC5A 2XNDH 2C0WA 4YPCA 1L0NJ 1UIXA 1IFDA 1HJBA 1PZQA 4DZOA 1GMJA 3FX0A 2OYHB 4LC1A 4K3AA 4H44B 4N6JA 3V2QA 4D6TG 4ZMDA 3CXHI 2ZXXA 5KLVE 1L2PA 1LP1B 1RF0C 3H1KJ 1E79H 3L73J 4DCKA 1Q7YQ 3RK2B 3CLQA 3VMXA 3NFQA 2B87B 3R4YA 1N7SC 1NTME 1L0LJ 2N9BA 2V7QH 3CX5E 3HD7B 2Q6QA 2Y0CA 4L76A 1BE3D 5AW1B 3T97A 3AEEC 3CCUP 2R3CA 1LT9C 2WPQA 1OX3A 1KFNA 3U1CA 2FKWB 1Q86Q 1PL5A 1MFZA 3RK2D 3TGUG 2C9NY 1PPJG 3M9QA 3TSIA 1VQ8P 2M5AA 3KXDA 5AVWB 4PV1B 1AVYA 2B89A 3O6QA 1HF9A 4XA4A 1CI6B 1BCCD 2WSCJ 1M1JA 3GHGB 2QA4P 1GK6A 2QG4A 2CPSA 1LTAC 3CCVP 1KTMA 1NH4A 5AW0B 2XV5A 3VN0A 3CCJP 1YJWP 3L72D 1LTJB 3H6PA 1BGYJ 5CBNA 1VQ5P 2NPSD 3VTPC 4JYBA 1PV3A 3L71D 3VP9A 4GOFA 1VQ6P 1CSBA 2GUSA 2WSEJ 4D6TE 5KLVG 1NHLA 2D2CD 2FYUE 2K9JB 2YKQA 2K3RA 3EFGA 3FWNA 1T8ZA 3HE5A 3L75G 3MIWA 4Y99B 3E1IA 5BU8B 3CMAP 3HD7D 1SFCD 3RBXA 1PGJA 2ITAA 3SWFA 1JUNA 1AFOA 1SLQA 2QJYC 1JB0J 2W8ZA 3BCCG 1IFPA 5B5EH 1N2DC 1DEBA 5AVZB 2BCCJ 4LLHA 3CWBE 5APWA 1ZR4A 1LWUB 1DD3A 2KSJA 3GHGC 2QEXP 3KYQA 3B5NC 3RL0g 3M0DA 1S5LE 1BCCE 1KQLA 1T3UA 5DJUB 2KOGA 5AVTB 1KZUB 2OYIB 2A45H 4U3FD 4I6MC 5AW6B 2QVAA 1EZVE 4C7NA 3L72E 2LXCB 2KXPB 1PP9D 1NYHA 1SQQE 1IFIA 1Y9BA 3I55P 1AA0A 1L4AA 1ZLLA 1S2EA 2K88A 3H32A 1H0TB 1URQC 2D2CC 2WZ7A 3L75D 5H2FH 1OW7A 3L74E 3H1JG 4BWNA 5KAIH 4ASVA 5TISH 4JF7A 3CC4P 3RK3C 2WWWA 2V4HA 1PGOA 3KDPB 4IFMA 2BASA 5CBOA 3CMEP 3G3ZA 2O01N 1SFCB 3BCCD 1SQXK 5AW8B 1NU1G 1LWUC 1RE3A 1Y8AA 2O3JA 2YMKA 2WT7B 2QIWA 2XZRA 2ZVOB 4R4LA 1URQD 1GW3A 3L4FA 4C46A 1T2KC 1LWUA 3AE2C 2XU6A 4W80A 5E79H 2WSSH 5GTIH 1IK7A 3RK2C 3V2PA 4BRYB 5APYA 1EDIA 2G8YA 2KUBA 3CXHD 1S5LX 1X22A 3L71G 3QH9A 1KQGB 5B5EE 1FZFA 1OVUA 3V6IA 4H44D 2WTYA 3AE8C 1GZLA 5AVYB 3RK3B 2A06E 3AE4C 1Q81Q 3JSVC 1N73A 1NU1E 3OW2O 1VF5D 1RF1A 1PIXA 1GL2A 3NXSA 1SQQD 3JCUE 3RGUA 1T6AA 2J59M 2G3AA 2JEEA 3C1LA 3Q3DA 2E74D 3CCEP 1RE4C 1SFCA 2ZT9C 1RF1C 3VMZA 1NTZE 2WSCH 1NAYA 2OYHC 2OARA 2QSIA 1FC2C 1XTGB 2IBZG 3IF4A 3II6A 4H0LC 1W2BO 1H88A 3MUDC 4PV1D 5BU5A 3CXHH 5B66E 2ZFCA 2NZ2A 1QGKB 2QRXA 3CC2P 1SQBG 5KLIC 1EXIA 1BCCG 1QLED 5CMZA 1FS0E 2PRRA 1NTKE 2YXRB 2JWAA 1OMIA 3A2AA 3SWYA 3VOPA 3CXHE 3B5NA 2NRGA 2HODB 1SQQG 1NTMK 3HUSA 1SQPJ 2AEMA 3Q2YA 3ZDMA 5CCGC 1YJNP 2FFDB 2IBZE 4EI2A 3H1HJ 5GTHE 2E75C 1RF1B 1EXJA 3H1JJ 3V2NA 1EDLA 1NAFA 2PP6A 4OWFA 1W5CE 3WUTA 3KZIE 2HLOA 3PTZA 3TF5A 2E75D 1H8AA 5AVRB 1SQVE 1URQA 3NTNA 3IR9A 1AQTA 3LIDA 1N73C 4L75A 4IOIH 1P84I 2N1TA 1HTLC 1FE6A 3EFFK 2H43A 1JY2N 3H1ID 3L74J 2KIKA 1VQPP 1FZCC 1A02J 2B88A 3VYIA 1T3JA 1QVFO 1SP4A 1ZP0C 2QM7A 3D71A 2QJPB 1YHQP 3AE6C 1L0LE 2ZYAA 3L70J 2QJYB 4U3FE 1L0ND 2XDJA 4UB8H 3USSA 1G1IA 2R5DA 1EDKA 1NKZB 1X8YA 2HODA 2CPBA 5CCGA 3PH0A 2ZT9B 2NPSA 3B8EB 3RBZA 1AQ5A 5KJ7A 2Z5IA 1KN7A 1HJ0A 1DIPA 3TGUD 1BGYG 1VL2A 2XKMA 1N7SB 4H13B 1NTZK 3VMYA 3BASA 3M06A 1VQ9P 5GTIE 2FYUD 5BVZA 2Z4EA 1J1DC 3OAKA 4D6TD 2XNXA 2YMYA 3BCCE 1JO5A 1JCDA 1YTZT 3HTKA 4QMAA 5AVQB 1M8OB 1EZVG 2WPVB 3UIAA 3N7NA 3M0DC 1Q90D 2HPCA 5APVA 3H1HG 1SQVJ 4GODA 1JM0A 1PGQA 1WT6A 2WITA 4IL6E 2WSFJ 4K35A 2I1KA 1VQOP 1OIPA 2IX7C 3H1HE 3VMAA
chains in the Genus database with same CATH topology
1M8OB 1S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8O B;  1S4X A; 
#chains in the Genus database with same CATH topology
 1SS1 A;  2E74 B;  1P84 E;  1OFC X;  1ZN5 A;  3G4S P;  4H13 C;  1HUC A;  2K9J A;  3JCU H;  5AW5 B;  2W27 A;  1W2E A;  1HVV A;  4H13 D;  3MD0 A;  2WSE H;  2AEJ A;  2E42 A;  3SSU A;  2K37 A;  3TGU E;  1SQV K;  4JPZ B;  2JJL A;  3CCM P;  1KB9 I;  2W6J H;  3CCS P;  3L73 G;  4AUW A;  3JC2 2;  1JY2 P;  2ZXE B;  1YYC A;  3MP7 B;  5CCH A;  3OA7 A;  5AW2 B;  2HPC B;  3U1A A;  1D7M A;  1YQ4 C;  3IFM A;  5H2F E;  2RH0 A;  3S1K A;  2C0X A;  3CPW O;  5CCG D;  4GDO A;  4U3F J;  2UWJ E;  3FXD A;  2RKL A;  1K9M Q;  3WUV A;  3H32 B;  2ZYD A;  1KIL A;  1L4A C;  2YXQ B;  2KK7 A;  2OTL P;  1SQB K;  2FXP A;  4AYC A;  2IZ1 A;  3O8Z A;  1S72 P;  1KD1 Q;  3L75 J;  5KJ7 D;  2B87 A;  1VQK P;  3ITK A;  4RO0 A;  2WPR A;  4WY4 C;  1FU1 A;  2N1T C;  2PAJ A;  2W90 A;  2Y0D A;  3A5T A;  4OGQ B;  3IN6 A;  1LTI C;  1IFN A;  3LIE A;  3NMD A;  2GA1 A;  4NPF X;  4WB4 A;  1X9V A;  3AEG C;  3HRN A;  2WPS A;  2H89 C;  1KYO I;  2NPS C;  2OYO A;  2P2U A;  4JYC A;  3KHU A;  1GW4 A;  1KYO D;  3N4X A;  1SQV G;  1NU1 J;  1YTZ I;  2YIU B;  3RL0 C;  2FFD C;  2FYU K;  4ASW A;  1L0L K;  3H1J E;  2GM4 A;  3AEA C;  1VQM P;  4PD4 E;  1CZQ A;  1NTM D;  3HUS C;  1JTH B;  1HGZ A;  2AXC A;  3L72 G;  1N73 B;  2H7H A;  1RF0 A;  1OWA A;  4UB8 E;  3B71 A;  2HFE D;  2HYN A;  1KIL B;  5AW7 B;  3T97 B;  1ZME C;  1L0L D;  1NTK G;  2IDB A;  5KTB A;  2R44 A;  2KLV A;  1SQX J;  2FY8 A;  1BE3 J;  1URQ B;  3GG2 A;  3O6Q B;  4OVN F;  1GK4 A;  1WMK A;  5K5G B;  3PRJ A;  1M1J B;  1N7S D;  3GHG A;  2JDI H;  2L5G B;  1PP9 E;  1MKM A;  1M7L A;  1Z56 A;  1KYO H;  3BAT A;  2M3E A;  3AE7 C;  1NU1 K;  3SFE C;  1OW8 A;  1SQX G;  1N7L A;  1S1C X;  3B4S A;  2FYU G;  3L75 E;  4HB1 A;  4WY4 A;  4AQR D;  3M91 A;  2ZYG A;  3H1L D;  2WSF H;  5KKZ B;  2BCC E;  1FZC B;  2E76 C;  4ZKU A;  1PFI A;  1OZH A;  1FZC A;  3CX5 I;  4WWI A;  1R5L A;  4B86 A;  3HE4 B;  3L71 J;  1EQ7 A;  1CW5 A;  4IL6 H;  1MFT A;  1ZXG A;  4EIJ A;  2R5B A;  1T2K D;  2DW3 A;  4Y99 C;  4N78 E;  1S9K D;  1IJD B;  2N1T D;  3PJS K;  3CWB D;  3D6Y A;  2KNC A;  2FFD A;  1KB9 E;  2Q9I A;  1M90 Q;  1BDC A;  2E76 D;  1U57 A;  1L4A D;  3RK3 D;  2K9Y A;  2FBW C;  1SQB D;  2ZT9 D;  3F89 A;  4I7Z C;  5AVU B;  3V5B A;  2J5U A;  3CC7 P;  4HKZ H;  1LT9 A;  1S3J A;  1ZW0 A;  2MKV A;  2E76 B;  2YNY A;  3H1K D;  1L4A B;  3HUS B;  3CCQ P;  4PD4 I;  1IFJ A;  2OGU A;  2PGD A;  1PP9 J;  4PD4 D;  1L0L G;  1IFM A;  3ABV C;  3HD7 C;  1KQS O;  1VQN P;  3H1L E;  3L74 D;  1QVG O;  1KIL C;  1YI2 P;  1N86 A;  4RKU J;  1KYO E;  3P8M C;  1JMB A;  1YBK A;  4RES B;  2E5T A;  2KLU A;  3PLN A;  4N3Y B;  3K5B A;  5AW9 B;  1FDM A;  1JY3 P;  1JY2 O;  5L8R J;  4HH2 A;  3V4Q A;  1RHZ B;  2K1A A;  2WT7 A;  2WMM A;  1YIJ P;  3GMA A;  1GTW A;  3F5H A;  2YKO A;  3BCC J;  1RE4 A;  1SFC C;  3L73 E;  2IFM A;  4GT1 A;  4HJG H;  3W67 A;  4ZNC A;  2MJZ A;  3G6E P;  1NGM B;  1R5S A;  2ZVN B;  2M5A B;  2Q3I A;  4L74 A;  3P8C D;  1RH5 B;  3L72 J;  3E1R A;  1QX8 A;  2R3S A;  2Z5H A;  4RJT A;  4IFD K;  1VDF A;  3S4R A;  2V7Q J;  1S4X A;  2AXT H;  2PFX A;  1SVF A;  2FXO A;  2SPZ A;  3A3Y B;  3KZI H;  4PD4 H;  5KLV D;  3V4W A;  1NTK J;  2IFN A;  3TK1 A;  1FAV A;  2H88 C;  1KC8 Q;  3B5N D;  1NTZ G;  1HWT C;  1J1E B;  4NPE A;  3L71 E;  2M3B A;  2LR2 A;  1BDD A;  1BGY E;  1LJ2 A;  2AXT E;  2QJP C;  2Q3E A;  2O1J A;  1PGP A;  2BEQ D;  1SQP G;  4L73 A;  3LW5 J;  2BCC D;  4U7J A;  5EFW B;  2HG5 D;  2RN0 A;  2E43 A;  4KHX A;  3TNU A;  2A06 G;  3AEB C;  2P58 A;  3GF7 A;  3H1I E;  2C9L Y;  4EYY Q;  1NTZ J;  4WBA A;  1VQ7 P;  1RQU A;  2IYP A;  1FOS E;  3I5C A;  4U3F G;  4C7R A;  1DEE G;  4ZKP A;  1NTK K;  4I1L A;  2E5Y A;  1P84 H;  2OYI A;  2FYZ A;  2QM8 A;  1VQL P;  4YXW H;  2FYN C;  5APT A;  3H1I G;  1JTH A;  2JWD A;  1H0T A;  3A0B H;  1J1E C;  3GW6 A;  1YIT P;  3FWL A;  5CJ4 A;  2OYH A;  5AVV B;  3RL0 D;  3L35 A;  4M3L A;  4XE5 B;  1JNM A;  5AW3 B;  3L70 G;  1HBW A;  1RE3 C;  1AVO A;  1G2C B;  1L0N G;  1SQP D;  1NVO A;  2BCC G;  2KP8 A;  4GOE A;  5M1B A;  3Q1M A;  4JBZ A;  2WQY C;  4OH8 B;  1JY3 O;  2I1J A;  3AE1 C;  3M9B A;  4DT0 A;  1GD2 E;  3G9R A;  4WY4 D;  5GTH H;  3WUU A;  1M57 D;  1FZB A;  3L36 A;  3GF3 A;  3WU2 H;  1N8R Q;  2M0B A;  1LTS C;  1JEK A;  1MZ9 A;  2OQQ A;  4XFJ A;  2YO2 A;  1PP9 G;  3L73 D;  1DX7 A;  4N78 D;  1S9K E;  5CJ0 A;  3C8V A;  2LKM A;  4TLF A;  3S9O A;  4BRY A;  1N7S A;  1QL1 A;  4WY4 B;  4EOT A;  1FJP A;  1OW6 A;  3H1I J;  1CI6 A;  3MHV A;  3R2P A;  2JO1 A;  1L0N E;  5APX A;  1LT9 B;  1JOC A;  3SFD C;  2KZI A;  2IYO A;  1SQQ J;  2NPS B;  3AED C;  3L70 D;  1LTJ A;  1EZV D;  2KB7 P;  2Y9Z A;  1NU1 D;  3RL0 B;  1EZV I;  1FOS F;  3CL3 D;  2A06 D;  1AV1 A;  4PV1 C;  1LT1 A;  1LTG C;  2CK3 H;  3PHL A;  3SWK A;  1U7J A;  2J58 A;  3BRV B;  1BCC J;  1NKN A;  3C9I A;  3PP5 A;  4I7Z B;  4UB6 E;  4CPG A;  2I8D A;  4H0L B;  3G71 P;  1KFM A;  1BSH A;  1RY3 A;  4PJ0 E;  4WVZ A;  3I56 P;  4IFF A;  3CCL P;  2O1K A;  1LNQ A;  2N9Y B;  1BGY D;  5APU A;  3TGU J;  1MUU A;  5B66 H;  1IZN B;  2IZ0 A;  1KIL E;  3D6Z A;  1VF5 C;  2ZAE B;  2IBZ I;  4UB6 H;  1FDO A;  5KAI E;  2IPP A;  5KJ7 C;  1SQX D;  4KT0 J;  3VP8 A;  1NTM G;  1SQQ K;  1X79 B;  3FXE A;  1AJY A;  5CHX A;  4HYT B;  1M1K Q;  3H1L G;  1IC2 A;  4OGQ C;  4DOJ A;  3H25 A;  1GL2 C;  1LGH B;  1LP1 A;  3MZW B;  1YQ3 C;  4KJM A;  5E79 E;  3L70 E;  3H1H D;  5KAF E;  1KB9 H;  2JKV A;  3L74 G;  3P8C E;  4OGQ D;  3V2R A;  2YIU C;  1M56 D;  1JCC A;  1OVR A;  5DJT B;  1S5L H;  4JQ0 D;  1X0T A;  1KQF B;  1BE3 G;  3MGN A;  3H1L J;  1RQV A;  2OTJ P;  4YXD C;  1GU4 A;  1FJK A;  1P84 D;  1FBM A;  4W7Z A;  4R4M A;  1SQP K;  2KNC B;  1PPJ D;  2H8P D;  5APS A;  2B9B A;  1WRG A;  3H1K E;  1VF5 B;  3BRT B;  4A7P A;  1TU3 F;  1USD A;  2RMZ A;  5TIS E;  2L91 A;  2D2C B;  3MUD A;  3CI9 A;  3IAO A;  3CWB J;  1OVV A;  1SQX E;  2O01 J;  1OXZ A;  3AEC C;  3LW5 H;  3QWO C;  1KIL D;  1GDT A;  1MV8 A;  1K73 Q;  1KOR A;  2KS1 B;  2W6A A;  1IO4 A;  1JY3 N;  3P32 A;  2QJK B;  3A7O A;  3GLM A;  1DH3 A;  1KB9 D;  3A0B E;  3D70 A;  1SQB J;  1YJ9 P;  1E5W A;  5CCH C;  1LTB C;  1R8E A;  1SQB E;  1VQ4 P;  1ZRT D;  2P10 A;  3CWB G;  3CX5 H;  4Y28 J;  1FZA A;  3RK3 E;  3CD6 P;  1G2C A;  3M9H A;  2WVR A;  3P7K A;  5AVS B;  2KYV A;  2A45 I;  1Q82 Q;  4I2L C;  1G1J A;  2POH A;  2Y0E A;  2P7J A;  2Y9Y A;  2FYU J;  2HR3 A;  3CCR P;  1J1D B;  2W6B A;  3AE9 C;  4D6T J;  2VRS A;  3A0H H;  5KLV K;  1M1J C;  1XTC C;  2LXB A;  1NOH A;  1VPC A;  2P67 A;  1NO4 A;  3H1K G;  4LGD E;  2KI7 B;  4Z1M H;  3L37 A;  4GKG A;  1ZOY C;  2E75 B;  4O9B A;  4TT3 H;  1SQV D;  3HTK B;  5APQ A;  1GL2 B;  4C7N B;  1H89 A;  2KZJ A;  1DD4 A;  2W83 C;  2KS1 A;  1BE3 E;  1K04 A;  2AEF A;  1UII A;  2JR8 A;  2YKP A;  3AE5 C;  5AW4 B;  5TJH A;  3WMM 0;  3Q5R A;  3Q5S A;  1KMI Z;  1NTM J;  2GUV A;  1ZRT E;  3CX5 D;  1J2J B;  3AE3 C;  3HE5 B;  4IL6 X;  2E74 C;  3FGA D;  1KV4 A;  1ZV8 A;  3KQG A;  2Q1K A;  4DJG A;  3U59 A;  4EDF A;  3TDK A;  5KLV J;  1FZG A;  1NTK D;  4H0L D;  3OJA B;  3HE4 A;  2O01 H;  5KLI B;  1HGV A;  1ZR2 A;  2P1J A;  2A45 G;  2IBZ D;  2ZJS E;  3AEF C;  2BEZ F;  1Y47 A;  3TYY A;  3KPE A;  2Q5U A;  3Q5P A;  1GU5 A;  1SQP E;  4W7Y A;  2JP3 A;  1Q2N A;  1K8A Q;  3MTU E;  1NWQ A;  2OTK E;  3TNU B;  1USE A;  3W68 A;  1PPJ E;  3E7K A;  1QL2 A;  1NJI Q;  1LTT C;  2QJK C;  1L0N K;  3A0H E;  3H1J D;  4NPD A;  2Q7C A;  1NTZ D;  2FXM A;  4MN4 C;  1GL2 D;  3EQ2 A;  3B5N B;  1LTJ C;  4BXL A;  4H44 C;  5KAF H;  2QE7 H;  1FZE A;  5KKZ C;  1BSN A;  1EDJ A;  2OYI C;  4PJ0 H;  2KSE A;  3HD7 A;  1U7M A;  3WU2 E;  3BVH A;  1HH0 A;  2FYN B;  1FDI A;  2YO3 A;  1A02 F;  2R32 A;  5C39 A;  5CCH D;  2N1T B;  3M0A A;  4YTP C;  2M8R A;  1IK9 A;  1QEX A;  1JMM A;  3EWK A;  5AVX B;  4GIF A;  1K05 A;  1EC5 A;  2XND H;  2C0W A;  4YPC A;  1L0N J;  1UIX A;  1IFD A;  1HJB A;  1PZQ A;  4DZO A;  1GMJ A;  3FX0 A;  2OYH B;  4LC1 A;  4K3A A;  4H44 B;  4N6J A;  3V2Q A;  4D6T G;  4ZMD A;  3CXH I;  2ZXX A;  5KLV E;  1L2P A;  1LP1 B;  1RF0 C;  3H1K J;  1E79 H;  3L73 J;  4DCK A;  1Q7Y Q;  3RK2 B;  3CLQ A;  3VMX A;  3NFQ A;  2B87 B;  3R4Y A;  1N7S C;  1NTM E;  1L0L J;  2N9B A;  2V7Q H;  3CX5 E;  3HD7 B;  2Q6Q A;  2Y0C A;  4L76 A;  1BE3 D;  5AW1 B;  3T97 A;  3AEE C;  3CCU P;  2R3C A;  1LT9 C;  2WPQ A;  1OX3 A;  1KFN A;  3U1C A;  2FKW B;  1Q86 Q;  1PL5 A;  1MFZ A;  3RK2 D;  3TGU G;  2C9N Y;  1PPJ G;  3M9Q A;  3TSI A;  1VQ8 P;  2M5A A;  3KXD A;  5AVW B;  4PV1 B;  1AVY A;  2B89 A;  3O6Q A;  1HF9 A;  4XA4 A;  1CI6 B;  1BCC D;  2WSC J;  1M1J A;  3GHG B;  2QA4 P;  1GK6 A;  2QG4 A;  2CPS A;  1LTA C;  3CCV P;  1KTM A;  1NH4 A;  5AW0 B;  2XV5 A;  3VN0 A;  3CCJ P;  1YJW P;  3L72 D;  1LTJ B;  3H6P A;  1BGY J;  5CBN A;  1VQ5 P;  2NPS D;  3VTP C;  4JYB A;  1PV3 A;  3L71 D;  3VP9 A;  4GOF A;  1VQ6 P;  1CSB A;  2GUS A;  2WSE J;  4D6T E;  5KLV G;  1NHL A;  2D2C D;  2FYU E;  2K9J B;  2YKQ A;  2K3R A;  3EFG A;  3FWN A;  1T8Z A;  3HE5 A;  3L75 G;  3MIW A;  4Y99 B;  3E1I A;  5BU8 B;  3CMA P;  3HD7 D;  1SFC D;  3RBX A;  1PGJ A;  2ITA A;  3SWF A;  1JUN A;  1AFO A;  1SLQ A;  2QJY C;  1JB0 J;  2W8Z A;  3BCC G;  1IFP A;  5B5E H;  1N2D C;  1DEB A;  5AVZ B;  2BCC J;  4LLH A;  3CWB E;  5APW A;  1ZR4 A;  1LWU B;  1DD3 A;  2KSJ A;  3GHG C;  2QEX P;  3KYQ A;  3B5N C;  3RL0 g;  3M0D A;  1S5L E;  1BCC E;  1KQL A;  1T3U A;  5DJU B;  2KOG A;  5AVT B;  1KZU B;  2OYI B;  2A45 H;  4U3F D;  4I6M C;  5AW6 B;  2QVA A;  1EZV E;  4C7N A;  3L72 E;  2LXC B;  2KXP B;  1PP9 D;  1NYH A;  1SQQ E;  1IFI A;  1Y9B A;  3I55 P;  1AA0 A;  1L4A A;  1ZLL A;  1S2E A;  2K88 A;  3H32 A;  1H0T B;  1URQ C;  2D2C C;  2WZ7 A;  3L75 D;  5H2F H;  1OW7 A;  3L74 E;  3H1J G;  4BWN A;  5KAI H;  4ASV A;  5TIS H;  4JF7 A;  3CC4 P;  3RK3 C;  2WWW A;  2V4H A;  1PGO A;  3KDP B;  4IFM A;  2BAS A;  5CBO A;  3CME P;  3G3Z A;  2O01 N;  1SFC B;  3BCC D;  1SQX K;  5AW8 B;  1NU1 G;  1LWU C;  1RE3 A;  1Y8A A;  2O3J A;  2YMK A;  2WT7 B;  2QIW A;  2XZR A;  2ZVO B;  4R4L A;  1URQ D;  1GW3 A;  3L4F A;  4C46 A;  1T2K C;  1LWU A;  3AE2 C;  2XU6 A;  4W80 A;  5E79 H;  2WSS H;  5GTI H;  1IK7 A;  3RK2 C;  3V2P A;  4BRY B;  5APY A;  1EDI A;  2G8Y A;  2KUB A;  3CXH D;  1S5L X;  1X22 A;  3L71 G;  3QH9 A;  1KQG B;  5B5E E;  1FZF A;  1OVU A;  3V6I A;  4H44 D;  2WTY A;  3AE8 C;  1GZL A;  5AVY B;  3RK3 B;  2A06 E;  3AE4 C;  1Q81 Q;  3JSV C;  1N73 A;  1NU1 E;  3OW2 O;  1VF5 D;  1RF1 A;  1PIX A;  1GL2 A;  3NXS A;  1SQQ D;  3JCU E;  3RGU A;  1T6A A;  2J59 M;  2G3A A;  2JEE A;  3C1L A;  3Q3D A;  2E74 D;  3CCE P;  1RE4 C;  1SFC A;  2ZT9 C;  1RF1 C;  3VMZ A;  1NTZ E;  2WSC H;  1NAY A;  2OYH C;  2OAR A;  2QSI A;  1FC2 C;  1XTG B;  2IBZ G;  3IF4 A;  3II6 A;  4H0L C;  1W2B O;  1H88 A;  3MUD C;  4PV1 D;  5BU5 A;  3CXH H;  5B66 E;  2ZFC A;  2NZ2 A;  1QGK B;  2QRX A;  3CC2 P;  1SQB G;  5KLI C;  1EXI A;  1BCC G;  1QLE D;  5CMZ A;  1FS0 E;  2PRR A;  1NTK E;  2YXR B;  2JWA A;  1OMI A;  3A2A A;  3SWY A;  3VOP A;  3CXH E;  3B5N A;  2NRG A;  2HOD B;  1SQQ G;  1NTM K;  3HUS A;  1SQP J;  2AEM A;  3Q2Y A;  3ZDM A;  5CCG C;  1YJN P;  2FFD B;  2IBZ E;  4EI2 A;  3H1H J;  5GTH E;  2E75 C;  1RF1 B;  1EXJ A;  3H1J J;  3V2N A;  1EDL A;  1NAF A;  2PP6 A;  4OWF A;  1W5C E;  3WUT A;  3KZI E;  2HLO A;  3PTZ A;  3TF5 A;  2E75 D;  1H8A A;  5AVR B;  1SQV E;  1URQ A;  3NTN A;  3IR9 A;  1AQT A;  3LID A;  1N73 C;  4L75 A;  4IOI H;  1P84 I;  2N1T A;  1HTL C;  1FE6 A;  3EFF K;  2H43 A;  1JY2 N;  3H1I D;  3L74 J;  2KIK A;  1VQP P;  1FZC C;  1A02 J;  2B88 A;  3VYI A;  1T3J A;  1QVF O;  1SP4 A;  1ZP0 C;  2QM7 A;  3D71 A;  2QJP B;  1YHQ P;  3AE6 C;  1L0L E;  2ZYA A;  3L70 J;  2QJY B;  4U3F E;  1L0N D;  2XDJ A;  4UB8 H;  3USS A;  1G1I A;  2R5D A;  1EDK A;  1NKZ B;  1X8Y A;  2HOD A;  2CPB A;  5CCG A;  3PH0 A;  2ZT9 B;  2NPS A;  3B8E B;  3RBZ A;  1AQ5 A;  5KJ7 A;  2Z5I A;  1KN7 A;  1HJ0 A;  1DIP A;  3TGU D;  1BGY G;  1VL2 A;  2XKM A;  1N7S B;  4H13 B;  1NTZ K;  3VMY A;  3BAS A;  3M06 A;  1VQ9 P;  5GTI E;  2FYU D;  5BVZ A;  2Z4E A;  1J1D C;  3OAK A;  4D6T D;  2XNX A;  2YMY A;  3BCC E;  1JO5 A;  1JCD A;  1YTZ T;  3HTK A;  4QMA A;  5AVQ B;  1M8O B;  1EZV G;  2WPV B;  3UIA A;  3N7N A;  3M0D C;  1Q90 D;  2HPC A;  5APV A;  3H1H G;  1SQV J;  4GOD A;  1JM0 A;  1PGQ A;  1WT6 A;  2WIT A;  4IL6 E;  2WSF J;  4K35 A;  2I1K A;  1VQO P;  1OIP A;  2IX7 C;  3H1H E;  3VMA A; 
#chains in the Genus database with same CATH homology
 1M8O B;  1S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...