1M8OB

Platelet integrin alfaiib-beta3 cytoplasmic domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
47
structure length
47
Chain Sequence
KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords platelet integrin alfaIIb subunit: cytoplasmic domain
publication title A Structural mechanism of integrin alfaiib beta3 "Inside-out" Activation as regulated by its cytoplasmic face.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 5
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1m8oB00
1M8OB 1S4XA
chains in the Genus database with same CATH superfamily
3B5NC 2QIWA 2JKVA 1EDLA 2A45H 2WPRA 1VL2A 1LNQA 1JTHB 1SQXG 3TGUD 1GK6A 2M5AB 2IZ1A 4A7PA 3CX5D 3VMXA 4ZKUA 1HJBA 3L75E 2OYHA 1FOSF 1FJPA 3WUVA 4AYCA 4H13D 1AJYA 4RESB 5KLIB 3MD0A 1YTZI 4GT1A 1FOSE 1NOHA 2A06D 5AW0B 4UB8E 3HD7A 2WSEJ 3M0DA 1NTKD 4DOJA 1ZRTD 3AECC 1S5LH 5KAIH 4RJTA 5KAFH 3CC4P 3TNUB 3CXHE 2Q9IA 2QJYC 1OIPA 1L0LG 1BGYD 1E79H 1NTMJ 2FBWC 2K9JA 1HVVA 2YMYA 3CWBG 4YTPC 1Q7YQ 3PLNA 2HYNA 3K5BA 1FZGA 4IFMA 3AE5C 3HRNA 4CPGA 5AVXB 1DD4A 4IL6X 4IFDK 3NTNA 1PPJG 2O01J 2V7QH 1VQMP 2KUBA 1SQVE 4GOFA 3IFMA 1FZCB 4H13B 3KXDA 1YITP 4U3FE 1GL2C 1YJ9P 4R4LA 1LT9C 5AW9B 1M1KQ 2ZYAA 4D6TG 2UWJE 1YHQP 4PJ0E 3CPWO 2NPSC 3P8MC 2CK3H 3V4QA 3AE3C 1HGVA 2O01N 2LR2A 1ZP0C 3HE5B 2O1KA 2FYZA 1IFNA 1M57D 1ZMEC 1SQQJ 2ZXEB 1ZR4A 1ZW0A 3H1JJ 1FC2C 1N73B 5KJ7D 5CCGC 3KDPB 1SQQK 3M9HA 2PFXA 2GM4A 2KZJA 5B5EH 4L76A 1URQD 2FYNC 3MZWB 2IYOA 4NPDA 2M3EA 3L71D 3RK3E 3IR9A 1CW5A 3H32B 1PP9G 2KK7A 1SQXE 4QMAA 2ZXXA 4UB6H 1E5WA 3M9QA 3G9RA 1W2BO 3B5NB 2KZIA 1RF1C 1KN7A 1NU1E 2IBZG 5KLVJ 1RHZB 3PJSK 3LIEA 4JPZB 5APTA 3KZIH 2Q1KA 3AE8C 2WT7A 4H44D 1LTIC 2M0BA 3V6IA 2E74C 1M90Q 5H2FH 2J58A 2Y0EA 5B66E 2KLVA 3IAOA 4BXLA 1L0LE 3L75J 1BE3G 1URQB 3CWBE 4GDOA 3NXSA 1RE3A 3CCQP 4GKGA 3V2PA 4JYBA 2HODA 2N9BA 2QJYB 3L74D 4LLHA 1JUNA 1PPJE 1NJIQ 2R5BA 3RK3C 1NTZG 1G2CB 2H43A 5GTIH 3B71A 1RQUA 2AXCA 2B87A 2WWWA 1SQPG 5C39A 2FYUG 4U7JA 3TF5A 4I6MC 1JY3N 1KB9H 3H1ID 4W7YA 1GU4A 3CCMP 1MKMA 2OGUA 4D6TE 4N6JA 2E76C 4ASVA 2WZ7A 3GHGA 3GLMA 1M1JB 3Q1MA 2YMKA 1X0TA 1SQVJ 1KZUB 2IBZI 4JQ0D 3Q5RA 1ZOYC 1SFCA 1IFDA 3O8ZA 2O3JA 1SQBD 2C0XA 4U3FJ 3D70A 3Q2YA 2L5GB 1Z56A 1OVVA 2Y9YA 1NWQA 5E79E 5AW1B 3HD7D 2Q5UA 1FDOA 1SQBK 2IFNA 1JY2O 2KB7P 2Q3EA 2OYIB 1PP9E 2N1TA 5BU8B 1T3JA 3G71P 1NO4A 2K3RA 3ITKA 3L73G 2PGDA 5BU5A 1YQ3C 1K05A 2JR8A 4DZOA 2IBZE 5EFWB 4EOTA 4WBAA 2VRSA 3B5NA 3IF4A 2CPSA 2CPBA 1JMBA 1WRGA 2I8DA 5AVQB 2P7JA 1GZLA 1A02F 3RK2C 3D71A 2QM7A 1EXIA 3CCVP 1SQXJ 3GG2A 3AEFC 1GDTA 1NTKE 3P8CE 2A45G 3HD7B 2P58A 1K73Q 1BE3E 1U57A 1PGJA 1W2EA 1HBWA 3M91A 2JWAA 3E7KA 2E74B 3I5CA 4WVZA 1LTSC 3ABVC 1M7LA 2QJPB 3AE9C 4C46A 3II6A 4C7NB 4WY4C 4Z1MH 4LGDE 1KYOH 1GMJA 1QVGO 1VQPP 2K9JB 5AW6B 3L72G 4N78E 4KJMA 1G1JA 3MGNA 1GU5A 1JM0A 3F89A 4EDFA 1NTZE 4LC1A 3PP5A 3H25A 1HJ0A 1L0LJ 3CWBJ 2FYUE 1WT6A 3BRVB 1SLQA 2C0WA 1K9MQ 3JC22 1SQVG 1ZV8A 4HH2A 2Y0CA 1PV3A 1AV1A 1BDDA 3OW2O 5CCHC 2V4HA 2N9YB 1Q82Q 1KMIZ 2HPCB 3H1LG 1GL2A 1LTJC 1CZQA 3RL0D 2D2CD 1LT9A 5AVVB 1L0ND 1P84I 2NPSA 3VMAA 2K37A 1KB9D 1OW7A 1K04A 3IN6A 3RL0g 4D6TJ 3AEAC 4XA4A 2ZT9C 2A45I 1BCCG 2WSCJ 2P67A 3N7NA 1VQKP 3H1HG 3R4YA 4DT0A 3MIWA 3BASA 3U1AA 3GW6A 4I7ZC 5CCGA 2QSIA 4NPEA 2C9NY 3LW5J 3L73E 2XKMA 1LTGC 3CXHI 1GK4A 3PTZA 4ZNCA 3H1KG 4IL6E 1VQLP 2YO2A 1J1EB 3RL0B 5KKZB 2D2CB 3W67A 1ZLLA 2KLUA 1P84E 5AVSB 1PP9J 4KHXA 3QH9A 1RF1A 2HFED 2GUSA 1OXZA 1PIXA 3BCCG 1NU1G 2WT7B 2QRXA 3GF7A 1CSBA 2KSJA 2JWDA 2W6JH 4UB8H 1LJ2A 1BSNA 4I2LC 1ZXGA 2BCCG 2WQYC 1KILE 4C7RA 1OMIA 1LWUC 1Y9BA 2PP6A 2BEZF 3L72E 1SFCD 4L74A 3W68A 2J59M 4C7NA 1YBKA 4EYYQ 1NTMD 2MKVA 2HODB 4OWFA 4WY4B 4GODA 3L70G 4HJGH 1BE3J 2B88A 3M06A 2QEXP 3L37A 2KI7B 3OA7A 3FXEA 3WU2H 1L4AC 2E43A 1NAYA 2XV5A 1NTMK 2OARA 1KYOD 2B87B 3FWNA 3L36A 3H1IE 2RKLA 2N1TD 1OWAA 1JY3P 2QJKB 2E75C 2P1JA 3H1LE 1EQ7A 4OH8B 1NTZJ 2WITA 3VN0A 1T2KD 2HPCA 5AW8B 2IFMA 3GHGB 3FX0A 4H44C 5BVZA 4PJ0H 1SQPJ 3A2AA 1XTGB 2FYUJ 2AEJA 1KQSO 1KQLA 3B5ND 4XFJA 1SFCB 1SQQD 4BRYB 2JO1A 1EC5A 1S9KE 1HWTC 3JCUH 1BCCE 3H1JD 2R3SA 1M8OB 1X9VA 2H88C 1KILC 1SQPK 2YKQA 3H1HE 2JEEA 3A0HE 2RMZA 3WUUA 3D6ZA 2ZT9B 1HH0A 1FAVA 1S5LX 2AEMA 1IFPA 3MHVA 3FGAD 1J1DB 3B4SA 1H88A 3AE4C 3HTKA 2KS1A 1EZVD 2N1TB 3H1KE 4I7ZB 3FWLA 1T8ZA 3R2PA 1N8RQ 1FZEA 3C1LA 5TISE 1KFNA 5B5EE 1FDIA 1NH4A 1UIXA 4HKZH 3CCLP 4TT3H 5AW3B 5KLVD 3S9OA 3L73J 3TGUG 3BCCE 1IJDB 1MUUA 2P10A 3AEBC 3V2NA 5APUA 3PHLA 2MJZA 3A5TA 2ZFCA 2OTKE 2BCCE 4ASWA 1JB0J 3FXDA 5KLVK 1VF5C 1FE6A 2A06G 1AVOA 4WB4A 3F5HA 1LP1A 1FZAA 1NTKG 2E5TA 2XDJA 5KTBA 3L75D 3KZIE 5AVUB 2NPSD 2AXTH 3EQ2A 1USDA 1VQ9P 2R3CA 3L70E 3CD6P 3VTPC 1QL1A 2GUVA 2LKMA 1VQ5P 1N7SC 1BGYG 4WY4A 2Q3IA 1GW4A 1JO5A 3MUDC 1FZBA 4PD4I 1JY2N 1S4XA 3L72J 1RF0C 5CCGD 3GMAA 1FBMA 2K9YA 2YO3A 4MN4C 3U1CA 2H7HA 1GD2E 1H0TB 1IFJA 1IC2A 3B8EB 1SQVD 1GL2B 1NKZB 1JEKA 4WWIA 2FKWB 5CCHA 1LT9B 1L0NE 3G4SP 3CX5I 1PFIA 4OGQC 1NYHA 1LTJA 2NPSB 3SFEC 2RH0A 4BRYA 1N86A 3LW5H 4U3FD 3H1LJ 1EDIA 2YIUC 4IFFA 5CBNA 4H0LC 3S1KA 3HUSC 1SQVK 1TU3F 5E79H 3OAKA 1LT1A 3OJAB 4GIFA 3C9IA 1EXJA 1SVFA 4HYTB 4PD4E 3EFFK 1NVOA 3VOPA 1MFTA 3U59A 2E74D 1HGZA 1USEA 1BCCJ 2E5YA 1DD3A 4Y28J 3H1HJ 2ZJSE 2WTYA 4PV1C 3ZDMA 1RQVA 3CCUP 2FYNB 3L71G 3M0AA 2LXCB 3CL3D 3CCEP 3WUTA 3SFDC 3TGUE 1RH5B 2HG5D 2WSEH 3CX5E 1QVFO 1OVUA 2FFDC 2H89C 3H1KJ 3V2QA 3RK3D 1RF1B 1OX3A 1N2DC 1SQXD 3GF3A 4IOIH 2A06E 1GTWA 2Z5IA 3CCRP 3BVHA 1ZRTE 3RGUA 2W90A 1FZFA 5KLIC 2E76D 1XTCC 3BCCJ 1NU1J 1VF5B 5GTHH 4HB1A 1GW3A 1SQXK 2O01H 3P32A 1Q81Q 4GOEA 5APXA 2YNYA 1BGYE 4NPFX 3EWKA 5CHXA 3H6PA 1LWUA 2BCCJ 2NRGA 1AFOA 5TJHA 1NU1K 2YXQB 3QWOC 3L74G 1L2PA 1N7SB 3VP9A 1L0LD 1VQ6P 3CC7P 3CWBD 4DJGA 5AVTB 3A3YB 3RK3B 2KP8A 3PH0A 1L4AA 3L70J 2ZYGA 3CMAP 4KT0J 1DEBA 1PPJD 3V2RA 1L0LK 3H1IG 1IK7A 5L8RJ 2YKOA 1H0TA 1FZCC 4H13C 2FXOA 5APVA 2E76B 4ZMDA 3AE7C 1J2JB 1SQQE 5DJUB 1CI6A 1KFMA 4D6TD 2LXBA 1QGKB 2R44A 1SQBG 2W6AA 3AEDC 3RK2D 1H89A 3HE4A 2OYOA 1KILA 3SWKA 2Z4EA 1HUCA 1N73C 5AVYB 1R8EA 3HTKB 2KS1B 1RY3A 3L71E 5CJ4A 2WVRA 4M3LA 1YYCA 1T6AA 4W80A 2YXRB 4IL6H 4WY4D 3E1IA 3MTUE 1Y8AA 1P84H 1PP9D 2KSEA 2KYVA 1KQFB 2J5UA 3A0BE 1YIJP 2FFDB 1FU1A 2H8PD 2POHA 3RBZA 1UIIA 3RK2B 2IBZD 2W27A 2ZVNB 3TGUJ 3UIAA 1IO4A 1PGQA 5KJ7C 1LP1B 2WPQA 3TDKA 5CCHD 3V4WA 1W5CE 3USSA 2Y0DA 3CXHH 1JNMA 2KNCA 2B89A 1A02J 1U7MA 1VPCA 3L74E 1JOCA 2B9BA 3P8CD 1NTKJ 1URQC 1BE3D 1S5LE 5KAIE 2I1KA 1U7JA 5KAFE 2ZT9D 1N7SA 5CBOA 1JY2P 3SSUA 2KOGA 3MUDA 3AE1C 2BEQD 1NTKK 1BGYJ 2KIKA 1S72P 4N78D 2IYPA 1RF0A 2DW3A 1SS1A 1FS0E 2WSSH 4L75A 1NTZD 3WU2E 2PAJA 3PRJA 2Q6QA 1LTBC 1KORA 4XE5B 1H8AA 1SQPD 1R5LA 2FYUD 2OTJP 3SWYA 2WSFJ 1LTJB 1SQBE 4JBZA 1M1JC 2G8YA 1NTZK 1WMKA 2G3AA 1SP4A 1X8YA 3Q3DA 1L0NG 1FDMA 1HTLC 1KQGB 2R32A 1RE4C 2FYUK 1VQOP 3A0HH 2M8RA 4I1LA 3HUSA 3CI9A 1YTZT 1Q2NA 1LTAC 2RN0A 3JCUE 2WMMA 2FXMA 1VQ7P 1PGOA 2C9LY 2WPSA 3O6QA 5TISH 4TLFA 2Y9ZA 2OYIC 1MV8A 2QVAA 1AQ5A 2KXPB 1PL5A 2W83C 2P2UA 1KV4A 3L73D 3D6YA 3CMEP 3L71J 3BRTB 1L4AD 2FFDA 2ZVOB 1NAFA 3KQGA 1G1IA 4UB6E 4OVNF 3N4XA 1JTHA 2OYHC 2QA4P 2M5AA 5AVZB 3AE2C 1LTTC 2E75D 1ZN5A 1P84D 5B66H 1GL2D 2O1JA 1NHLA 1X22A 4JYCA 3HD7C 3M0DC 3MP7B 3AE6C 1KB9I 3T97B 4B86A 1OW8A 3LIDA 1M56D 2QM8A 1LWUB 5H2FE 2JDIH 1NTMG 2QJPC 3G6EP 4AUWA 5AVWB 1D7MA 1OFCX 2XU6A 1KILD 1DEEG 2AXTE 3TNUA 3L72D 3CXHD 1KD1Q 2E42A 5AW2B 1L4AB 1DIPA 1MFZA 1S3JA 3L74J 1EDJA 1R5SA 4K3AA 2GA1A 4DCKA 5M1BA 1DH3A 2XNXA 3KHUA 2E75B 5GTIE 2IZ0A 2WSCH 2OTLP 1AQTA 3CCJP 1FJKA 3Q5PA 2L91A 2Z5HA 2HLOA 5AW4B 1FZCA 2JP3A 1OVRA 2QG4A 3G3ZA 1KB9E 4H44B 5APYA 4BWNA 2M3BA 3H1IJ 3P7KA 1NGMB 1CI6B 3H1LD 4AQRD 3S4RA 3VYIA 1Y47A 3A7OA 1SQQG 1YJWP 2XZRA 1S2EA 2V7QJ 3H1JG 2XNDH 3HE4B 3KPEA 3HE5A 1KILB 2W8ZA 4R4MA 1QL2A 4PD4H 1HF9A 3L4FA 3CC2P 1SQBJ 3E1RA 1S9KD 4O9BA 1PZQA 1BCCD 1VF5D 1N73A 3Q5SA 3VMYA 3H1HD 3TK1A 1VQ8P 4Y99C 1EZVG 3TYYA 2SPZA 4EI2A 4YPCA 1K8AQ 3I55P 1N7SD 3CX5H 3AEEC 4JF7A 3WMM0 3VMZA 1IFIA 3H1KD 5APQA 5K5GB 1KYOI 1YI2P 3TSIA 1JY3O 1J1EC 3RL0C 3H32A 5KKZC 5KLVG 2D2CC 1VDFA 4W7ZA 1IFMA 3KYQA 3EFGA 1ZR2A 1YQ4C 2IDBA 3CLQA 2NZ2A 1DX7A 2FXPA 4RKUJ 3M9BA 4YXWH 1X79B 2OYHB 3BCCD 1NU1D 2IPPA 2WPVB 1IK9A 1IZNB 3L75G 3T97A 5KJ7A 4L73A 1NTME 1KC8Q 2KNCB 1N7LA 4OGQD 2K1AA 2BCCD 2AEFA 4H0LD 1LGHB 5GTHE 1RE3C 1S1CX 3BATA 1PGPA 1VQ4P 1URQA 2PRRA 1JCCA 1JCDA 1KYOE 2R5DA 3JSVC 5APSA 1EDKA 3L70D 5CMZA 1EZVI 3SWFA 5DJTB 2WSFH 2IX7C 3NMDA 2JJLA 2BASA 5AVRB 2I1JA 2ZYDA 4ZKPA 2QE7H 1QEXA 4EIJA 3CCSP 3L35A 1SQPE 3RBXA 3VP8A 1G2CA 4K35A 1QX8A 2QJKC 4PV1D 3AEGC 2ZAEB 2FY8A 1JMMA 1OW6A 1KTMA 3GHGC 1YJNP 3H1JE 1BSHA 2K88A 4OGQB 2HR3A 4U3FG 1QLED 1M1JA 1SFCC 4RO0A 3NFQA 2YIUB 4H0LB 1T3UA 1AA0A 2W6BA 3HUSB 1RE4A 1L0NJ 1AVYA 1VQNP 1MZ9A 3C8VA 1EZVE 3O6QB 2ITAA 1J1DC 1L0NK 5CJ0A 2Q7CA 3I56P 1Q86Q 4PD4D 2N1TC 4Y99B 3V5BA 4PV1B 5APWA 2YKPA 1T2KC 1OZHA 2OYIA 5KLVE 5AW5B 5AW7B 4YXDC 3A0BH 4N3YB 1Q90D 2OQQA 1NKNA 1BDCA
chains in the Genus database with same CATH topology
1M8OB 1S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8O B;  1S4X A; 
#chains in the Genus database with same CATH topology
 3B5N C;  2QIW A;  2JKV A;  1EDL A;  2A45 H;  2WPR A;  1VL2 A;  1LNQ A;  1JTH B;  1SQX G;  3TGU D;  1GK6 A;  2M5A B;  2IZ1 A;  4A7P A;  3CX5 D;  3VMX A;  4ZKU A;  1HJB A;  3L75 E;  2OYH A;  1FOS F;  1FJP A;  3WUV A;  4AYC A;  4H13 D;  1AJY A;  4RES B;  5KLI B;  3MD0 A;  1YTZ I;  4GT1 A;  1FOS E;  1NOH A;  2A06 D;  5AW0 B;  4UB8 E;  3HD7 A;  2WSE J;  3M0D A;  1NTK D;  4DOJ A;  1ZRT D;  3AEC C;  1S5L H;  5KAI H;  4RJT A;  5KAF H;  3CC4 P;  3TNU B;  3CXH E;  2Q9I A;  2QJY C;  1OIP A;  1L0L G;  1BGY D;  1E79 H;  1NTM J;  2FBW C;  2K9J A;  1HVV A;  2YMY A;  3CWB G;  4YTP C;  1Q7Y Q;  3PLN A;  2HYN A;  3K5B A;  1FZG A;  4IFM A;  3AE5 C;  3HRN A;  4CPG A;  5AVX B;  1DD4 A;  4IL6 X;  4IFD K;  3NTN A;  1PPJ G;  2O01 J;  2V7Q H;  1VQM P;  2KUB A;  1SQV E;  4GOF A;  3IFM A;  1FZC B;  4H13 B;  3KXD A;  1YIT P;  4U3F E;  1GL2 C;  1YJ9 P;  4R4L A;  1LT9 C;  5AW9 B;  1M1K Q;  2ZYA A;  4D6T G;  2UWJ E;  1YHQ P;  4PJ0 E;  3CPW O;  2NPS C;  3P8M C;  2CK3 H;  3V4Q A;  3AE3 C;  1HGV A;  2O01 N;  2LR2 A;  1ZP0 C;  3HE5 B;  2O1K A;  2FYZ A;  1IFN A;  1M57 D;  1ZME C;  1SQQ J;  2ZXE B;  1ZR4 A;  1ZW0 A;  3H1J J;  1FC2 C;  1N73 B;  5KJ7 D;  5CCG C;  3KDP B;  1SQQ K;  3M9H A;  2PFX A;  2GM4 A;  2KZJ A;  5B5E H;  4L76 A;  1URQ D;  2FYN C;  3MZW B;  2IYO A;  4NPD A;  2M3E A;  3L71 D;  3RK3 E;  3IR9 A;  1CW5 A;  3H32 B;  1PP9 G;  2KK7 A;  1SQX E;  4QMA A;  2ZXX A;  4UB6 H;  1E5W A;  3M9Q A;  3G9R A;  1W2B O;  3B5N B;  2KZI A;  1RF1 C;  1KN7 A;  1NU1 E;  2IBZ G;  5KLV J;  1RHZ B;  3PJS K;  3LIE A;  4JPZ B;  5APT A;  3KZI H;  2Q1K A;  3AE8 C;  2WT7 A;  4H44 D;  1LTI C;  2M0B A;  3V6I A;  2E74 C;  1M90 Q;  5H2F H;  2J58 A;  2Y0E A;  5B66 E;  2KLV A;  3IAO A;  4BXL A;  1L0L E;  3L75 J;  1BE3 G;  1URQ B;  3CWB E;  4GDO A;  3NXS A;  1RE3 A;  3CCQ P;  4GKG A;  3V2P A;  4JYB A;  2HOD A;  2N9B A;  2QJY B;  3L74 D;  4LLH A;  1JUN A;  1PPJ E;  1NJI Q;  2R5B A;  3RK3 C;  1NTZ G;  1G2C B;  2H43 A;  5GTI H;  3B71 A;  1RQU A;  2AXC A;  2B87 A;  2WWW A;  1SQP G;  5C39 A;  2FYU G;  4U7J A;  3TF5 A;  4I6M C;  1JY3 N;  1KB9 H;  3H1I D;  4W7Y A;  1GU4 A;  3CCM P;  1MKM A;  2OGU A;  4D6T E;  4N6J A;  2E76 C;  4ASV A;  2WZ7 A;  3GHG A;  3GLM A;  1M1J B;  3Q1M A;  2YMK A;  1X0T A;  1SQV J;  1KZU B;  2IBZ I;  4JQ0 D;  3Q5R A;  1ZOY C;  1SFC A;  1IFD A;  3O8Z A;  2O3J A;  1SQB D;  2C0X A;  4U3F J;  3D70 A;  3Q2Y A;  2L5G B;  1Z56 A;  1OVV A;  2Y9Y A;  1NWQ A;  5E79 E;  5AW1 B;  3HD7 D;  2Q5U A;  1FDO A;  1SQB K;  2IFN A;  1JY2 O;  2KB7 P;  2Q3E A;  2OYI B;  1PP9 E;  2N1T A;  5BU8 B;  1T3J A;  3G71 P;  1NO4 A;  2K3R A;  3ITK A;  3L73 G;  2PGD A;  5BU5 A;  1YQ3 C;  1K05 A;  2JR8 A;  4DZO A;  2IBZ E;  5EFW B;  4EOT A;  4WBA A;  2VRS A;  3B5N A;  3IF4 A;  2CPS A;  2CPB A;  1JMB A;  1WRG A;  2I8D A;  5AVQ B;  2P7J A;  1GZL A;  1A02 F;  3RK2 C;  3D71 A;  2QM7 A;  1EXI A;  3CCV P;  1SQX J;  3GG2 A;  3AEF C;  1GDT A;  1NTK E;  3P8C E;  2A45 G;  3HD7 B;  2P58 A;  1K73 Q;  1BE3 E;  1U57 A;  1PGJ A;  1W2E A;  1HBW A;  3M91 A;  2JWA A;  3E7K A;  2E74 B;  3I5C A;  4WVZ A;  1LTS C;  3ABV C;  1M7L A;  2QJP B;  3AE9 C;  4C46 A;  3II6 A;  4C7N B;  4WY4 C;  4Z1M H;  4LGD E;  1KYO H;  1GMJ A;  1QVG O;  1VQP P;  2K9J B;  5AW6 B;  3L72 G;  4N78 E;  4KJM A;  1G1J A;  3MGN A;  1GU5 A;  1JM0 A;  3F89 A;  4EDF A;  1NTZ E;  4LC1 A;  3PP5 A;  3H25 A;  1HJ0 A;  1L0L J;  3CWB J;  2FYU E;  1WT6 A;  3BRV B;  1SLQ A;  2C0W A;  1K9M Q;  3JC2 2;  1SQV G;  1ZV8 A;  4HH2 A;  2Y0C A;  1PV3 A;  1AV1 A;  1BDD A;  3OW2 O;  5CCH C;  2V4H A;  2N9Y B;  1Q82 Q;  1KMI Z;  2HPC B;  3H1L G;  1GL2 A;  1LTJ C;  1CZQ A;  3RL0 D;  2D2C D;  1LT9 A;  5AVV B;  1L0N D;  1P84 I;  2NPS A;  3VMA A;  2K37 A;  1KB9 D;  1OW7 A;  1K04 A;  3IN6 A;  3RL0 g;  4D6T J;  3AEA C;  4XA4 A;  2ZT9 C;  2A45 I;  1BCC G;  2WSC J;  2P67 A;  3N7N A;  1VQK P;  3H1H G;  3R4Y A;  4DT0 A;  3MIW A;  3BAS A;  3U1A A;  3GW6 A;  4I7Z C;  5CCG A;  2QSI A;  4NPE A;  2C9N Y;  3LW5 J;  3L73 E;  2XKM A;  1LTG C;  3CXH I;  1GK4 A;  3PTZ A;  4ZNC A;  3H1K G;  4IL6 E;  1VQL P;  2YO2 A;  1J1E B;  3RL0 B;  5KKZ B;  2D2C B;  3W67 A;  1ZLL A;  2KLU A;  1P84 E;  5AVS B;  1PP9 J;  4KHX A;  3QH9 A;  1RF1 A;  2HFE D;  2GUS A;  1OXZ A;  1PIX A;  3BCC G;  1NU1 G;  2WT7 B;  2QRX A;  3GF7 A;  1CSB A;  2KSJ A;  2JWD A;  2W6J H;  4UB8 H;  1LJ2 A;  1BSN A;  4I2L C;  1ZXG A;  2BCC G;  2WQY C;  1KIL E;  4C7R A;  1OMI A;  1LWU C;  1Y9B A;  2PP6 A;  2BEZ F;  3L72 E;  1SFC D;  4L74 A;  3W68 A;  2J59 M;  4C7N A;  1YBK A;  4EYY Q;  1NTM D;  2MKV A;  2HOD B;  4OWF A;  4WY4 B;  4GOD A;  3L70 G;  4HJG H;  1BE3 J;  2B88 A;  3M06 A;  2QEX P;  3L37 A;  2KI7 B;  3OA7 A;  3FXE A;  3WU2 H;  1L4A C;  2E43 A;  1NAY A;  2XV5 A;  1NTM K;  2OAR A;  1KYO D;  2B87 B;  3FWN A;  3L36 A;  3H1I E;  2RKL A;  2N1T D;  1OWA A;  1JY3 P;  2QJK B;  2E75 C;  2P1J A;  3H1L E;  1EQ7 A;  4OH8 B;  1NTZ J;  2WIT A;  3VN0 A;  1T2K D;  2HPC A;  5AW8 B;  2IFM A;  3GHG B;  3FX0 A;  4H44 C;  5BVZ A;  4PJ0 H;  1SQP J;  3A2A A;  1XTG B;  2FYU J;  2AEJ A;  1KQS O;  1KQL A;  3B5N D;  4XFJ A;  1SFC B;  1SQQ D;  4BRY B;  2JO1 A;  1EC5 A;  1S9K E;  1HWT C;  3JCU H;  1BCC E;  3H1J D;  2R3S A;  1M8O B;  1X9V A;  2H88 C;  1KIL C;  1SQP K;  2YKQ A;  3H1H E;  2JEE A;  3A0H E;  2RMZ A;  3WUU A;  3D6Z A;  2ZT9 B;  1HH0 A;  1FAV A;  1S5L X;  2AEM A;  1IFP A;  3MHV A;  3FGA D;  1J1D B;  3B4S A;  1H88 A;  3AE4 C;  3HTK A;  2KS1 A;  1EZV D;  2N1T B;  3H1K E;  4I7Z B;  3FWL A;  1T8Z A;  3R2P A;  1N8R Q;  1FZE A;  3C1L A;  5TIS E;  1KFN A;  5B5E E;  1FDI A;  1NH4 A;  1UIX A;  4HKZ H;  3CCL P;  4TT3 H;  5AW3 B;  5KLV D;  3S9O A;  3L73 J;  3TGU G;  3BCC E;  1IJD B;  1MUU A;  2P10 A;  3AEB C;  3V2N A;  5APU A;  3PHL A;  2MJZ A;  3A5T A;  2ZFC A;  2OTK E;  2BCC E;  4ASW A;  1JB0 J;  3FXD A;  5KLV K;  1VF5 C;  1FE6 A;  2A06 G;  1AVO A;  4WB4 A;  3F5H A;  1LP1 A;  1FZA A;  1NTK G;  2E5T A;  2XDJ A;  5KTB A;  3L75 D;  3KZI E;  5AVU B;  2NPS D;  2AXT H;  3EQ2 A;  1USD A;  1VQ9 P;  2R3C A;  3L70 E;  3CD6 P;  3VTP C;  1QL1 A;  2GUV A;  2LKM A;  1VQ5 P;  1N7S C;  1BGY G;  4WY4 A;  2Q3I A;  1GW4 A;  1JO5 A;  3MUD C;  1FZB A;  4PD4 I;  1JY2 N;  1S4X A;  3L72 J;  1RF0 C;  5CCG D;  3GMA A;  1FBM A;  2K9Y A;  2YO3 A;  4MN4 C;  3U1C A;  2H7H A;  1GD2 E;  1H0T B;  1IFJ A;  1IC2 A;  3B8E B;  1SQV D;  1GL2 B;  1NKZ B;  1JEK A;  4WWI A;  2FKW B;  5CCH A;  1LT9 B;  1L0N E;  3G4S P;  3CX5 I;  1PFI A;  4OGQ C;  1NYH A;  1LTJ A;  2NPS B;  3SFE C;  2RH0 A;  4BRY A;  1N86 A;  3LW5 H;  4U3F D;  3H1L J;  1EDI A;  2YIU C;  4IFF A;  5CBN A;  4H0L C;  3S1K A;  3HUS C;  1SQV K;  1TU3 F;  5E79 H;  3OAK A;  1LT1 A;  3OJA B;  4GIF A;  3C9I A;  1EXJ A;  1SVF A;  4HYT B;  4PD4 E;  3EFF K;  1NVO A;  3VOP A;  1MFT A;  3U59 A;  2E74 D;  1HGZ A;  1USE A;  1BCC J;  2E5Y A;  1DD3 A;  4Y28 J;  3H1H J;  2ZJS E;  2WTY A;  4PV1 C;  3ZDM A;  1RQV A;  3CCU P;  2FYN B;  3L71 G;  3M0A A;  2LXC B;  3CL3 D;  3CCE P;  3WUT A;  3SFD C;  3TGU E;  1RH5 B;  2HG5 D;  2WSE H;  3CX5 E;  1QVF O;  1OVU A;  2FFD C;  2H89 C;  3H1K J;  3V2Q A;  3RK3 D;  1RF1 B;  1OX3 A;  1N2D C;  1SQX D;  3GF3 A;  4IOI H;  2A06 E;  1GTW A;  2Z5I A;  3CCR P;  3BVH A;  1ZRT E;  3RGU A;  2W90 A;  1FZF A;  5KLI C;  2E76 D;  1XTC C;  3BCC J;  1NU1 J;  1VF5 B;  5GTH H;  4HB1 A;  1GW3 A;  1SQX K;  2O01 H;  3P32 A;  1Q81 Q;  4GOE A;  5APX A;  2YNY A;  1BGY E;  4NPF X;  3EWK A;  5CHX A;  3H6P A;  1LWU A;  2BCC J;  2NRG A;  1AFO A;  5TJH A;  1NU1 K;  2YXQ B;  3QWO C;  3L74 G;  1L2P A;  1N7S B;  3VP9 A;  1L0L D;  1VQ6 P;  3CC7 P;  3CWB D;  4DJG A;  5AVT B;  3A3Y B;  3RK3 B;  2KP8 A;  3PH0 A;  1L4A A;  3L70 J;  2ZYG A;  3CMA P;  4KT0 J;  1DEB A;  1PPJ D;  3V2R A;  1L0L K;  3H1I G;  1IK7 A;  5L8R J;  2YKO A;  1H0T A;  1FZC C;  4H13 C;  2FXO A;  5APV A;  2E76 B;  4ZMD A;  3AE7 C;  1J2J B;  1SQQ E;  5DJU B;  1CI6 A;  1KFM A;  4D6T D;  2LXB A;  1QGK B;  2R44 A;  1SQB G;  2W6A A;  3AED C;  3RK2 D;  1H89 A;  3HE4 A;  2OYO A;  1KIL A;  3SWK A;  2Z4E A;  1HUC A;  1N73 C;  5AVY B;  1R8E A;  3HTK B;  2KS1 B;  1RY3 A;  3L71 E;  5CJ4 A;  2WVR A;  4M3L A;  1YYC A;  1T6A A;  4W80 A;  2YXR B;  4IL6 H;  4WY4 D;  3E1I A;  3MTU E;  1Y8A A;  1P84 H;  1PP9 D;  2KSE A;  2KYV A;  1KQF B;  2J5U A;  3A0B E;  1YIJ P;  2FFD B;  1FU1 A;  2H8P D;  2POH A;  3RBZ A;  1UII A;  3RK2 B;  2IBZ D;  2W27 A;  2ZVN B;  3TGU J;  3UIA A;  1IO4 A;  1PGQ A;  5KJ7 C;  1LP1 B;  2WPQ A;  3TDK A;  5CCH D;  3V4W A;  1W5C E;  3USS A;  2Y0D A;  3CXH H;  1JNM A;  2KNC A;  2B89 A;  1A02 J;  1U7M A;  1VPC A;  3L74 E;  1JOC A;  2B9B A;  3P8C D;  1NTK J;  1URQ C;  1BE3 D;  1S5L E;  5KAI E;  2I1K A;  1U7J A;  5KAF E;  2ZT9 D;  1N7S A;  5CBO A;  1JY2 P;  3SSU A;  2KOG A;  3MUD A;  3AE1 C;  2BEQ D;  1NTK K;  1BGY J;  2KIK A;  1S72 P;  4N78 D;  2IYP A;  1RF0 A;  2DW3 A;  1SS1 A;  1FS0 E;  2WSS H;  4L75 A;  1NTZ D;  3WU2 E;  2PAJ A;  3PRJ A;  2Q6Q A;  1LTB C;  1KOR A;  4XE5 B;  1H8A A;  1SQP D;  1R5L A;  2FYU D;  2OTJ P;  3SWY A;  2WSF J;  1LTJ B;  1SQB E;  4JBZ A;  1M1J C;  2G8Y A;  1NTZ K;  1WMK A;  2G3A A;  1SP4 A;  1X8Y A;  3Q3D A;  1L0N G;  1FDM A;  1HTL C;  1KQG B;  2R32 A;  1RE4 C;  2FYU K;  1VQO P;  3A0H H;  2M8R A;  4I1L A;  3HUS A;  3CI9 A;  1YTZ T;  1Q2N A;  1LTA C;  2RN0 A;  3JCU E;  2WMM A;  2FXM A;  1VQ7 P;  1PGO A;  2C9L Y;  2WPS A;  3O6Q A;  5TIS H;  4TLF A;  2Y9Z A;  2OYI C;  1MV8 A;  2QVA A;  1AQ5 A;  2KXP B;  1PL5 A;  2W83 C;  2P2U A;  1KV4 A;  3L73 D;  3D6Y A;  3CME P;  3L71 J;  3BRT B;  1L4A D;  2FFD A;  2ZVO B;  1NAF A;  3KQG A;  1G1I A;  4UB6 E;  4OVN F;  3N4X A;  1JTH A;  2OYH C;  2QA4 P;  2M5A A;  5AVZ B;  3AE2 C;  1LTT C;  2E75 D;  1ZN5 A;  1P84 D;  5B66 H;  1GL2 D;  2O1J A;  1NHL A;  1X22 A;  4JYC A;  3HD7 C;  3M0D C;  3MP7 B;  3AE6 C;  1KB9 I;  3T97 B;  4B86 A;  1OW8 A;  3LID A;  1M56 D;  2QM8 A;  1LWU B;  5H2F E;  2JDI H;  1NTM G;  2QJP C;  3G6E P;  4AUW A;  5AVW B;  1D7M A;  1OFC X;  2XU6 A;  1KIL D;  1DEE G;  2AXT E;  3TNU A;  3L72 D;  3CXH D;  1KD1 Q;  2E42 A;  5AW2 B;  1L4A B;  1DIP A;  1MFZ A;  1S3J A;  3L74 J;  1EDJ A;  1R5S A;  4K3A A;  2GA1 A;  4DCK A;  5M1B A;  1DH3 A;  2XNX A;  3KHU A;  2E75 B;  5GTI E;  2IZ0 A;  2WSC H;  2OTL P;  1AQT A;  3CCJ P;  1FJK A;  3Q5P A;  2L91 A;  2Z5H A;  2HLO A;  5AW4 B;  1FZC A;  2JP3 A;  1OVR A;  2QG4 A;  3G3Z A;  1KB9 E;  4H44 B;  5APY A;  4BWN A;  2M3B A;  3H1I J;  3P7K A;  1NGM B;  1CI6 B;  3H1L D;  4AQR D;  3S4R A;  3VYI A;  1Y47 A;  3A7O A;  1SQQ G;  1YJW P;  2XZR A;  1S2E A;  2V7Q J;  3H1J G;  2XND H;  3HE4 B;  3KPE A;  3HE5 A;  1KIL B;  2W8Z A;  4R4M A;  1QL2 A;  4PD4 H;  1HF9 A;  3L4F A;  3CC2 P;  1SQB J;  3E1R A;  1S9K D;  4O9B A;  1PZQ A;  1BCC D;  1VF5 D;  1N73 A;  3Q5S A;  3VMY A;  3H1H D;  3TK1 A;  1VQ8 P;  4Y99 C;  1EZV G;  3TYY A;  2SPZ A;  4EI2 A;  4YPC A;  1K8A Q;  3I55 P;  1N7S D;  3CX5 H;  3AEE C;  4JF7 A;  3WMM 0;  3VMZ A;  1IFI A;  3H1K D;  5APQ A;  5K5G B;  1KYO I;  1YI2 P;  3TSI A;  1JY3 O;  1J1E C;  3RL0 C;  3H32 A;  5KKZ C;  5KLV G;  2D2C C;  1VDF A;  4W7Z A;  1IFM A;  3KYQ A;  3EFG A;  1ZR2 A;  1YQ4 C;  2IDB A;  3CLQ A;  2NZ2 A;  1DX7 A;  2FXP A;  4RKU J;  3M9B A;  4YXW H;  1X79 B;  2OYH B;  3BCC D;  1NU1 D;  2IPP A;  2WPV B;  1IK9 A;  1IZN B;  3L75 G;  3T97 A;  5KJ7 A;  4L73 A;  1NTM E;  1KC8 Q;  2KNC B;  1N7L A;  4OGQ D;  2K1A A;  2BCC D;  2AEF A;  4H0L D;  1LGH B;  5GTH E;  1RE3 C;  1S1C X;  3BAT A;  1PGP A;  1VQ4 P;  1URQ A;  2PRR A;  1JCC A;  1JCD A;  1KYO E;  2R5D A;  3JSV C;  5APS A;  1EDK A;  3L70 D;  5CMZ A;  1EZV I;  3SWF A;  5DJT B;  2WSF H;  2IX7 C;  3NMD A;  2JJL A;  2BAS A;  5AVR B;  2I1J A;  2ZYD A;  4ZKP A;  2QE7 H;  1QEX A;  4EIJ A;  3CCS P;  3L35 A;  1SQP E;  3RBX A;  3VP8 A;  1G2C A;  4K35 A;  1QX8 A;  2QJK C;  4PV1 D;  3AEG C;  2ZAE B;  2FY8 A;  1JMM A;  1OW6 A;  1KTM A;  3GHG C;  1YJN P;  3H1J E;  1BSH A;  2K88 A;  4OGQ B;  2HR3 A;  4U3F G;  1QLE D;  1M1J A;  1SFC C;  4RO0 A;  3NFQ A;  2YIU B;  4H0L B;  1T3U A;  1AA0 A;  2W6B A;  3HUS B;  1RE4 A;  1L0N J;  1AVY A;  1VQN P;  1MZ9 A;  3C8V A;  1EZV E;  3O6Q B;  2ITA A;  1J1D C;  1L0N K;  5CJ0 A;  2Q7C A;  3I56 P;  1Q86 Q;  4PD4 D;  2N1T C;  4Y99 B;  3V5B A;  4PV1 B;  5APW A;  2YKP A;  1T2K C;  1OZH A;  2OYI A;  5KLV E;  5AW5 B;  5AW7 B;  4YXD C;  3A0B H;  4N3Y B;  1Q90 D;  2OQQ A;  1NKN A;  1BDC A; 
#chains in the Genus database with same CATH homology
 1M8O B;  1S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...