1M8OB

Platelet integrin alfaiib-beta3 cytoplasmic domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
47
structure length
47
Chain Sequence
b'KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords platelet integrin alfaIIb subunit: cytoplasmic domain
publication title A Structural mechanism of integrin alfaiib beta3 "Inside-out" Activation as regulated by its cytoplasmic face.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 5
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1m8oB00
1S4XA 1M8OB
chains in the Genus database with same CATH superfamily
2BCCG 3GHGB 2Z5IA 3L74D 2NPSC 1Q2NA 3L4FA 3KQGA 1VF5C 4ZNCA 5AVVB 1N7SB 1L0LD 2CPSA 1ZRTE 1DD4A 3G3ZA 1LT9A 2WSEH 2WITA 2R5BA 3P32A 1S9KE 3CC4P 2M0BA 3L73G 3IR9A 3CI9A 1OFCX 4ASWA 1FZFA 2AXTE 5APTA 3L72J 1WT6A 4RKUJ 1H89A 1SQXJ 2E74D 2WQYC 1N86A 3B5NB 3H32A 3SWKA 1IFDA 2KLUA 3CWBD 3JCUH 2FFDB 2IFMA 3Q5RA 2D2CD 1OX3A 3O6QA 1GW4A 1FC2C 1KILC 3GW6A 2LKMA 4LGDE 2A06D 1PGJA 2V7QH 1SFCC 2A45I 1L0NG 1SQQJ 2L91A 1SQXE 3CCRP 1A02J 1IO4A 1SQXK 3L70J 1OMIA 1VQ9P 3USSA 2QVAA 3VMAA 4JBZA 5AVTB 2RMZA 1KILA 1OW6A 3U1CA 2ZJSE 2QJYC 1NKNA 3OW2O 1SFCA 3G4SP 3V2PA 1AA0A 2RN0A 1BDDA 3MIWA 1VL2A 3H1HG 1YTZI 4N78E 1SQQK 4GDOA 4LC1A 4KJMA 2H43A 4H44C 4D6TD 3V4QA 3ITKA 1RH5B 2OARA 1K05A 3W67A 1LTJB 3L75J 3AECC 2E43A 2HODB 3IAOA 2Z4EA 3AE2C 2R3CA 2JWAA 2KIKA 3D70A 5APWA 2E75D 3CCUP 3V2QA 4Y99C 3A2AA 2PAJA 4O9BA 2E5YA 1AVOA 1AJYA 3UIAA 3V5BA 3AEEC 3H1JG 1LTIC 5AW4B 2Q6QA 3VYIA 3EQ2A 5C39A 3L36A 1GL2B 2OGUA 1NTME 2OTLP 1QVGO 4ZKPA 4NPDA 3H1IG 4OH8B 1IC2A 1SQVG 4YTPC 3SFDC 1T3JA 1IFJA 2P7JA 1KTMA 4NPEA 4UB6H 2N9BA 3BCCG 1M8OB 1CI6B 1NU1J 3L72G 1Q86Q 3MHVA 4I2LC 3CD6P 1G1IA 4A7PA 3AE4C 2IBZI 1FZCB 5AVSB 1FE6A 1LT1A 2IX7C 1BGYE 1BE3E 4PV1D 2WSFH 5AW1B 2KYVA 1U7MA 1CZQA 5KJ7C 3SWYA 1VQKP 5KLVE 3IN6A 2VRSA 1OIPA 1VDFA 1USDA 5KTBA 1QVFO 3I55P 5AVRB 1JMMA 2YIUB 1S5LH 3O8ZA 1EZVG 1CW5A 1SQQG 2WPVB 2YO3A 1NU1K 3FXDA 1FS0E 3AE8C 3TK1A 5CJ0A 3EWKA 1A02F 3GG2A 3L70G 4OGQB 1VQLP 3LIEA 3RL0g 2W27A 2CPBA 4WY4A 1SQBJ 2Y0CA 3A3YB 2AXCA 5KLIC 2E76C 5KKZB 1NGMB 1JTHA 3H1KG 5KAIH 4L73A 1KD1Q 3CL3D 1FU1A 4Y28J 1NOHA 1JMBA 1NTKD 4BRYB 2J59M 1AQ5A 2FYUJ 4C46A 1X0TA 1EC5A 3CCJP 3S1KA 2O3JA 2XZRA 3L75G 1EXJA 3RL0D 1GU5A 5TISE 1SQBK 4ZKUA 1BDCA 2HLOA 1HTLC 2YO2A 3CC2P 3RK3C 3SFEC 1JUNA 1GL2C 3WUUA 1JCCA 1S5LX 5AVZB 3V2RA 2YMYA 2Y0EA 1IFNA 3L71J 2QM7A 1NKZB 3P7KA 2W83C 1WRGA 4XE5B 3CWBG 2FYUK 2HG5D 1PP9J 3W68A 4MN4C 4H0LB 1KYOH 1LT9B 1T6AA 4IFFA 1FAVA 1L4AD 1S1CX 2KS1A 2O1JA 4PD4E 2E5TA 3H25A 2NPSB 1SQPJ 2O01J 3G6EP 1BCCD 1VF5B 2GA1A 1LTTC 1URQD 1N73A 2ZAEB 2QJKC 4W80A 4PJ0H 2G8YA 3HE5A 2BCCE 1NU1G 1YHQP 2NRGA 3H32B 4N6JA 4WY4D 1N2DC 2HPCB 3O6QB 1HF9A 3HUSC 3M0DA 4JQ0D 5B66E 2IYOA 2K9YA 2B87B 4I6MC 1ZRTD 2J58A 1FDIA 3A7OA 2OYIA 1S9KD 3QWOC 1U57A 1EDLA 1SQPK 1HVVA 5AW5B 5CJ4A 3L73E 4WB4A 3A5TA 1YQ3C 5GTIH 4DT0A 2E74C 2H88C 4L74A 3RBZA 3HUSA 4C7NA 4D6TG 2D2CC 5KKZC 3CMEP 1KILB 3CXHE 1CSBA 3AEDC 2H8PD 1JCDA 3D6ZA 1TU3F 1SFCB 1JY2N 1SQBG 1S3JA 5E79E 2L5GB 2RH0A 1KYOI 4DJGA 1PPJD 4GOEA 2PFXA 1Q7YQ 3E1IA 4UB8E 3F89A 1RQUA 1ZOYC 1HGZA 3MZWB 1VQPP 1IJDB 1NYHA 1L0NE 1XTCC 3H1HJ 2QJYB 2IDBA 4GODA 2FYUG 1G2CA 2KSEA 2M5AB 1RQVA 4U3FJ 1YJNP 1GDTA 1H88A 3A0HH 4H44B 4B86A 2JR8A 3MTUE 1M7LA 4N78D 3H1HE 3CCSP 3P8CE 2BASA 2IBZD 1Q82Q 2KNCA 2K9JA 3L71G 5B5EE 3H1JJ 4Y99B 2ITAA 2KZJA 5AVUB 2Y0DA 2E75C 3CXHI 1PP9G 1GZLA 2N1TA 2FXMA 5APUA 3H1IJ 1OWAA 3AEBC 1PZQA 1LTAC 1WMKA 1SQPG 1SQVJ 3V6IA 3VOPA 3AE1C 1GW3A 2FBWC 1OW7A 1NTMD 3AE6C 3BCCJ 1FBMA 3GMAA 2AXTH 4GOFA 1GMJA 1YIJP 1HH0A 1IFIA 3H1IE 1YTZT 2IYPA 2CK3H 2V7QJ 2YXQB 4C7RA 4GT1A 3AE5C 4BXLA 2QM8A 1SQVK 3CCMP 3Q5PA 2PGDA 3TGUD 1KV4A 2QRXA 5CBNA 1KQSO 3AEGC 1M1JC 3BCCE 3L72E 4PV1C 1IK9A 3Q2YA 1FZBA 1BGYD 1BE3D 4H13D 1Q81Q 1HJ0A 3T97A 3BRVB 1JTHB 4RESB 1OW8A 5GTHE 4EIJA 1NTZD 5KLVD 2QIWA 2LXCB 2P67A 1W5CE 1GU4A 1ZW0A 2WMMA 4N3YB 2YKQA 1K04A 1M1JA 4R4LA 3V2NA 3EFGA 3H1KJ 1ZR4A 4HYTB 2WPRA 1EZVE 1SQQE 2N1TD 1KC8Q 3L74J 4HH2A 5KLIB 2E76B 3SSUA 3WUTA 3D71A 3CCEP 3TF5A 3L70E 4U3FG 2XU6A 1T3UA 3KHUA 5AW7B 3RK2D 2A45G 1L0LJ 1BCCG 2QG4A 1LTSC 1EDKA 3I5CA 2WVRA 1DEBA 4DCKA 1JY3N 1X79B 1Q90D 3RL0C 1OXZA 3PLNA 2J5UA 4CPGA 3RK3B 2P10A 3KZIE 2AEJA 2V4HA 3VP8A 3CWBJ 3L75E 1KMIZ 1JY3P 2I8DA 1J1DC 4U7JA 1U7JA 1RHZB 3KPEA 2Y9YA 2HFED 1L0LK 1N73B 1J1EC 2K88A 1FJPA 3HE5B 2ZT9D 3HD7D 3D6YA 2WSFJ 2W6JH 1LNQA 1R8EA 3WUVA 1KYOD 2JDIH 2JJLA 1N7SA 1PPJG 4PD4D 4Z1MH 2QJKB 4ZMDA 3PJSK 1KQLA 5DJTB 1URQC 2ZFCA 3C1LA 4WVZA 4HKZH 1PGPA 1EXIA 1SP4A 4WY4C 3HUSB 2BCCD 3AEAC 5AW6B 1X9VA 1H8AA 5APYA 1L4AA 4XA4A 3HRNA 1NU1E 1Y8AA 1H0TA 2IPPA 1Y9BA 4D6TJ 2WT7A 3B5NA 1URQA 1VPCA 2NZ2A 2I1JA 1NHLA 3CLQA 3TNUA 2E74B 1RF0A 2W8ZA 1SS1A 4TT3H 3MD0A 2D2CB 1DH3A 3F5HA 5H2FE 3NXSA 2IBZG 1G2CB 3L74G 2JKVA 3CXHD 4D6TE 2DW3A 2GUVA 4K35A 5AVWB 2B9BA 2QJPC 3M91A 1SQBE 4GKGA 1X22A 1L0LG 2OYHC 4WWIA 5TISH 2ZYAA 1LTBC 2PRRA 2KNCB 5K5GB 1HBWA 1L0ND 2FKWB 4RO0A 1R5SA 4OVNF 1DIPA 2Q1KA 2R5DA 1N7SD 5APQA 3B8EB 2FYUE 3VN0A 2G3AA 1FDOA 4QMAA 1N73C 3LW5H 1LTJA 2OYHA 3HTKA 4JYCA 1VQOP 3K5BA 1BSHA 4EYYQ 2M3BA 3M0DC 3FXEA 4PD4H 3H1LD 3TGUG 3EFFK 2ZVNB 1NVOA 2A06G 2XKMA 3P8CD 1FZAA 2E75B 3P8MC 4JPZB 3B5ND 1KILE 2OYIC 3E7KA 2JWDA 3L71E 2GM4A 1BGYG 2JP3A 4JYBA 2K37A 4OWFA 2WSCH 3VTPC 2YXRB 1PP9E 3VMZA 1NTZG 2HR3A 1P84E 1UIXA 2KZIA 5M1BA 5B66H 1ZMEC 1KQGB 2FXPA 1GTWA 3JSVC 1SQPE 4L76A 1T2KD 1KB9E 1ZR2A 1ZLLA 4IFMA 2JEEA 1YBKA 1RF1A 1JY3O 1CI6A 1VQMP 4IL6E 3WMM0 4JF7A 1ZP0C 3CX5E 1NTKJ 1D7MA 3T97B 2OTJP 1FZGA 1S72P 1KFNA 3CXHH 1W2EA 2K1AA 5CCGD 1NJIQ 3BRTB 1M1JB 4PV1B 5E79H 5AVXB 2C0XA 4IFDK 3OJAB 3WU2E 2QE7H 3QH9A 4PD4I 4UB8H 1EQ7A 3L72D 4H13C 3L35A 4W7ZA 5KAFE 1JY2P 3GF3A 1SQXD 1KFMA 1NTKK 3C9IA 2I1KA 1M1KQ 1M56D 2R3SA 3FWNA 1P84I 3AE9C 2KP8A 2POHA 1IK7A 2N1TC 1MKMA 2XV5A 1BCCJ 4I7ZC 3N4XA 5APXA 1VQNP 3Q1MA 5APSA 1GL2D 1SQQD 4KHXA 2IZ0A 3PH0A 1HGVA 1AFOA 5EFWB 3R2PA 3RK2C 3L70D 2Q3IA 5B5EH 2H89C 2XDJA 3IFMA 3NFQA 4U3FE 2XNDH 3A0BE 5APVA 1JM0A 2WSEJ 4M3LA 1JNMA 3AEFC 2OTKE 1QEXA 3RL0B 4NPFX 2ZXEB 1MUUA 1DD3A 2FY8A 1QL2A 1PIXA 1J1DB 3MP7B 3H1JE 2W6AA 1J1EB 3L75D 3BATA 2QSIA 3PRJA 2QA4P 3CCQP 3CPWO 3VMXA 3VMYA 4EDFA 2ZT9C 5AW9B 2ZXXA 3HD7C 2KI7B 2PP6A 2NPSA 4LLHA 1FZEA 1RE3C 1SQVE 1VQ5P 1L4AB 1G1JA 3C8VA 1FOSE 1LWUC 4OGQD 3TSIA 1H0TB 1OZHA 1PGOA 1W2BO 2WT7B 2IFNA 1URQB 3JCUE 1GK4A 3OAKA 1NTKG 2KXPB 2HPCA 1JO5A 4L75A 3TNUB 5BU8B 2Q5UA 3HD7A 4WY4B 3HE4A 2B87A 1KZUB 4KT0J 5AW8B 1PPJE 1RE3A 4BWNA 5GTHH 2KLVA 1LWUA 2UWJE 5CCHD 5BVZA 1LP1A 1NU1D 3RK3E 1K8AQ 3M06A 5AVQB 1LTGC 4W7YA 2K3RA 2OQQA 2O01N 3ZDMA 2C9NY 5BU5A 3CCVP 3KYQA 3H1LG 1GK6A 1UIIA 3RBXA 1N8RQ 1HUCA 3H6PA 2W90A 3H1KE 4DOJA 2IBZE 2QJPB 2XNXA 2KK7A 4H0LD 3L74E 2B89A 2OYHB 3HTKB 3M9QA 1NTMJ 2M5AA 2NPSD 5AW0B 1EDIA 1SQBD 3GHGC 2P58A 3KZIH 3B4SA 1VF5D 2KS1B 1MFTA 3GLMA 3R4YA 1MFZA 1JY2O 3CCLP 4EOTA 2SPZA 1L0LE 1E5WA 3MGNA 5TJHA 5CBOA 3TYYA 1ZV8A 2C0WA 4HB1A 1Y47A 3KDPB 2Q9IA 2WWWA 1N7SC 1KORA 3TGUJ 1MZ9A 4AYCA 3M9HA 2Q3EA 1L2PA 1AVYA 2FYUD 1MV8A 1QX8A 3GHGA 1FOSF 1NTMK 1BGYJ 1BE3J 1EZVI 1PV3A 1JB0J 5L8RJ 3CWBE 1L4AC 1S4XA 2OYIB 1S2EA 1NTZJ 4WBAA 5KLVJ 4UB6E 2ZYDA 3M9BA 4YXWH 3B5NC 1PFIA 1RF1B 2FFDC 1YYCA 3TGUE 1LJ2A 2ZYGA 2A06E 4R4MA 1RY3A 1AV1A 1VQ6P 1KILD 3RGUA 3V4WA 3L71D 1SQXG 1R5LA 1RF0C 4C7NB 1SFCD 2M3EA 1NH4A 4YPCA 1PP9D 4AUWA 1P84D 3II6A 4XFJA 1NTZE 1T2KC 1KN7A 3VP9A 2FFDA 3B71A 3FX0A 3CC7P 1SQPD 1NO4A 1NTZK 5KLVK 3MUDC 1KB9D 1S5LE 2N9YB 5AVYB 3JC22 2WPSA 2JO1A 3Q3DA 3L73D 2MKVA 3S4RA 1SVFA 5CHXA 5H2FH 3CX5D 3PP5A 5KJ7A 5CCGC 5DJUB 4HJGH 2C9LY 1JOCA 3MUDA 4H44D 2O1KA 5KAIE 2KSJA 1HJBA 4H13B 3G9RA 5CMZA 2QEXP 2FYZA 1LTJC 3NMDA 1BSNA 2FYNB 2WZ7A 5CCGA 4EI2A 3M0AA 2K9JB 3Q5SA 1HWTC 1IZNB 3TDKA 2KUBA 1PL5A 3LW5J 1GD2E 1NTMG 2WPQA 1VQ8P 2N1TB 4DZOA 4I7ZB 1IFMA 3G71P 3U1AA 2W6BA 3AE7C 1DEEG 1OVUA 2HODA 3PTZA 3ABVC 1NAYA 2RKLA 3RK2B 1FJKA 2P2UA 3NTNA 2BCCJ 3H1HD 2FXOA 1QGKB 1Z56A 2Y9ZA 2WSCJ 5AW2B 4AQRD 1X8YA 3E1RA 1KYOE 1BE3G 4U3FD 2Z5HA 1RF1C 1LGHB 1GL2A 1RE4C 2MJZA 1NAFA 3IF4A 2YNYA 2YMKA 2HYNA 5KLVG 1FZCC 1P84H 1T8ZA 3SWFA 4PJ0E 3L73J 1SLQA 5KJ7D 3LIDA 1J2JB 2O01H 4IOIH 2Q7CA 1KB9H 3U59A 4YXDC 2WTYA 1XTGB 2AEFA 4RJTA 1N7LA 3H1JD 2ZT9B 1RE4A 3HD7B 2B88A 4IL6H 3HE4B 1AQTA 2YIUC 2P1JA 2WSSH 1K73Q 3CX5H 1FZCA 3H1ID 1LWUB 5AW3B 3BASA 3S9OA 3GF7A 1E79H 1SQVD 2E42A 3BVHA 2IZ1A 1OVRA 1LP1B 4OGQC 1ZXGA 5GTIE 2YKOA 1JEKA 3KXDA 2E76D 1KQFB 1OVVA 1USEA 3WU2H 2LXBA 1L0NJ 1DX7A 3BCCD 3PHLA 4TLFA 5KAFH 1NTKE 3CMAP 1FDMA 2GUSA 2R44A 2ZVOB 2KB7P 2FYNC 5CCHC 1PGQA 1YITP 1QLED 4GIFA 2R32A 4I1LA 3N7NA 3H1LJ 3I56P 3RK3D 3AE3C 1M57D 4K3AA 1L0NK 2OYOA 1EZVD 2BEZF 1ZN5A 1KB9I 2KOGA 4IL6X 1K9MQ 4ASVA 2M8RA 3FWLA 3OA7A 2H7HA 5CCHA 1EDJA 1VQ7P 2AEMA 4BRYA 3L37A 3FGAD 1YJWP 1VQ4P 2BEQD 3CX5I 2LR2A 3A0HE 1YI2P 1YQ4C 1M90Q 2YKPA 3H1LE 3A0BH 2A45H 3H1KD 4H0LC 1BCCE 1QL1A 1LT9C 1YJ9P 1IFPA 1NWQA
chains in the Genus database with same CATH topology
1S4XA 1M8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4X A;  1M8O B; 
#chains in the Genus database with same CATH topology
 2BCC G;  3GHG B;  2Z5I A;  3L74 D;  2NPS C;  1Q2N A;  3L4F A;  3KQG A;  1VF5 C;  4ZNC A;  5AVV B;  1N7S B;  1L0L D;  2CPS A;  1ZRT E;  1DD4 A;  3G3Z A;  1LT9 A;  2WSE H;  2WIT A;  2R5B A;  3P32 A;  1S9K E;  3CC4 P;  2M0B A;  3L73 G;  3IR9 A;  3CI9 A;  1OFC X;  4ASW A;  1FZF A;  2AXT E;  5APT A;  3L72 J;  1WT6 A;  4RKU J;  1H89 A;  1SQX J;  2E74 D;  2WQY C;  1N86 A;  3B5N B;  3H32 A;  3SWK A;  1IFD A;  2KLU A;  3CWB D;  3JCU H;  2FFD B;  2IFM A;  3Q5R A;  2D2C D;  1OX3 A;  3O6Q A;  1GW4 A;  1FC2 C;  1KIL C;  3GW6 A;  2LKM A;  4LGD E;  2A06 D;  1PGJ A;  2V7Q H;  1SFC C;  2A45 I;  1L0N G;  1SQQ J;  2L91 A;  1SQX E;  3CCR P;  1A02 J;  1IO4 A;  1SQX K;  3L70 J;  1OMI A;  1VQ9 P;  3USS A;  2QVA A;  3VMA A;  4JBZ A;  5AVT B;  2RMZ A;  1KIL A;  1OW6 A;  3U1C A;  2ZJS E;  2QJY C;  1NKN A;  3OW2 O;  1SFC A;  3G4S P;  3V2P A;  1AA0 A;  2RN0 A;  1BDD A;  3MIW A;  1VL2 A;  3H1H G;  1YTZ I;  4N78 E;  1SQQ K;  4GDO A;  4LC1 A;  4KJM A;  2H43 A;  4H44 C;  4D6T D;  3V4Q A;  3ITK A;  1RH5 B;  2OAR A;  1K05 A;  3W67 A;  1LTJ B;  3L75 J;  3AEC C;  2E43 A;  2HOD B;  3IAO A;  2Z4E A;  3AE2 C;  2R3C A;  2JWA A;  2KIK A;  3D70 A;  5APW A;  2E75 D;  3CCU P;  3V2Q A;  4Y99 C;  3A2A A;  2PAJ A;  4O9B A;  2E5Y A;  1AVO A;  1AJY A;  3UIA A;  3V5B A;  3AEE C;  3H1J G;  1LTI C;  5AW4 B;  2Q6Q A;  3VYI A;  3EQ2 A;  5C39 A;  3L36 A;  1GL2 B;  2OGU A;  1NTM E;  2OTL P;  1QVG O;  4ZKP A;  4NPD A;  3H1I G;  4OH8 B;  1IC2 A;  1SQV G;  4YTP C;  3SFD C;  1T3J A;  1IFJ A;  2P7J A;  1KTM A;  4NPE A;  4UB6 H;  2N9B A;  3BCC G;  1M8O B;  1CI6 B;  1NU1 J;  3L72 G;  1Q86 Q;  3MHV A;  4I2L C;  3CD6 P;  1G1I A;  4A7P A;  3AE4 C;  2IBZ I;  1FZC B;  5AVS B;  1FE6 A;  1LT1 A;  2IX7 C;  1BGY E;  1BE3 E;  4PV1 D;  2WSF H;  5AW1 B;  2KYV A;  1U7M A;  1CZQ A;  5KJ7 C;  3SWY A;  1VQK P;  5KLV E;  3IN6 A;  2VRS A;  1OIP A;  1VDF A;  1USD A;  5KTB A;  1QVF O;  3I55 P;  5AVR B;  1JMM A;  2YIU B;  1S5L H;  3O8Z A;  1EZV G;  1CW5 A;  1SQQ G;  2WPV B;  2YO3 A;  1NU1 K;  3FXD A;  1FS0 E;  3AE8 C;  3TK1 A;  5CJ0 A;  3EWK A;  1A02 F;  3GG2 A;  3L70 G;  4OGQ B;  1VQL P;  3LIE A;  3RL0 g;  2W27 A;  2CPB A;  4WY4 A;  1SQB J;  2Y0C A;  3A3Y B;  2AXC A;  5KLI C;  2E76 C;  5KKZ B;  1NGM B;  1JTH A;  3H1K G;  5KAI H;  4L73 A;  1KD1 Q;  3CL3 D;  1FU1 A;  4Y28 J;  1NOH A;  1JMB A;  1NTK D;  4BRY B;  2J59 M;  1AQ5 A;  2FYU J;  4C46 A;  1X0T A;  1EC5 A;  3CCJ P;  3S1K A;  2O3J A;  2XZR A;  3L75 G;  1EXJ A;  3RL0 D;  1GU5 A;  5TIS E;  1SQB K;  4ZKU A;  1BDC A;  2HLO A;  1HTL C;  2YO2 A;  3CC2 P;  3RK3 C;  3SFE C;  1JUN A;  1GL2 C;  3WUU A;  1JCC A;  1S5L X;  5AVZ B;  3V2R A;  2YMY A;  2Y0E A;  1IFN A;  3L71 J;  2QM7 A;  1NKZ B;  3P7K A;  2W83 C;  1WRG A;  4XE5 B;  3CWB G;  2FYU K;  2HG5 D;  1PP9 J;  3W68 A;  4MN4 C;  4H0L B;  1KYO H;  1LT9 B;  1T6A A;  4IFF A;  1FAV A;  1L4A D;  1S1C X;  2KS1 A;  2O1J A;  4PD4 E;  2E5T A;  3H25 A;  2NPS B;  1SQP J;  2O01 J;  3G6E P;  1BCC D;  1VF5 B;  2GA1 A;  1LTT C;  1URQ D;  1N73 A;  2ZAE B;  2QJK C;  4W80 A;  4PJ0 H;  2G8Y A;  3HE5 A;  2BCC E;  1NU1 G;  1YHQ P;  2NRG A;  3H32 B;  4N6J A;  4WY4 D;  1N2D C;  2HPC B;  3O6Q B;  1HF9 A;  3HUS C;  3M0D A;  4JQ0 D;  5B66 E;  2IYO A;  2K9Y A;  2B87 B;  4I6M C;  1ZRT D;  2J58 A;  1FDI A;  3A7O A;  2OYI A;  1S9K D;  3QWO C;  1U57 A;  1EDL A;  1SQP K;  1HVV A;  5AW5 B;  5CJ4 A;  3L73 E;  4WB4 A;  3A5T A;  1YQ3 C;  5GTI H;  4DT0 A;  2E74 C;  2H88 C;  4L74 A;  3RBZ A;  3HUS A;  4C7N A;  4D6T G;  2D2C C;  5KKZ C;  3CME P;  1KIL B;  3CXH E;  1CSB A;  3AED C;  2H8P D;  1JCD A;  3D6Z A;  1TU3 F;  1SFC B;  1JY2 N;  1SQB G;  1S3J A;  5E79 E;  2L5G B;  2RH0 A;  1KYO I;  4DJG A;  1PPJ D;  4GOE A;  2PFX A;  1Q7Y Q;  3E1I A;  4UB8 E;  3F89 A;  1RQU A;  1ZOY C;  1HGZ A;  3MZW B;  1VQP P;  1IJD B;  1NYH A;  1L0N E;  1XTC C;  3H1H J;  2QJY B;  2IDB A;  4GOD A;  2FYU G;  1G2C A;  2KSE A;  2M5A B;  1RQV A;  4U3F J;  1YJN P;  1GDT A;  1H88 A;  3A0H H;  4H44 B;  4B86 A;  2JR8 A;  3MTU E;  1M7L A;  4N78 D;  3H1H E;  3CCS P;  3P8C E;  2BAS A;  2IBZ D;  1Q82 Q;  2KNC A;  2K9J A;  3L71 G;  5B5E E;  3H1J J;  4Y99 B;  2ITA A;  2KZJ A;  5AVU B;  2Y0D A;  2E75 C;  3CXH I;  1PP9 G;  1GZL A;  2N1T A;  2FXM A;  5APU A;  3H1I J;  1OWA A;  3AEB C;  1PZQ A;  1LTA C;  1WMK A;  1SQP G;  1SQV J;  3V6I A;  3VOP A;  3AE1 C;  1GW3 A;  2FBW C;  1OW7 A;  1NTM D;  3AE6 C;  3BCC J;  1FBM A;  3GMA A;  2AXT H;  4GOF A;  1GMJ A;  1YIJ P;  1HH0 A;  1IFI A;  3H1I E;  1YTZ T;  2IYP A;  2CK3 H;  2V7Q J;  2YXQ B;  4C7R A;  4GT1 A;  3AE5 C;  4BXL A;  2QM8 A;  1SQV K;  3CCM P;  3Q5P A;  2PGD A;  3TGU D;  1KV4 A;  2QRX A;  5CBN A;  1KQS O;  3AEG C;  1M1J C;  3BCC E;  3L72 E;  4PV1 C;  1IK9 A;  3Q2Y A;  1FZB A;  1BGY D;  1BE3 D;  4H13 D;  1Q81 Q;  1HJ0 A;  3T97 A;  3BRV B;  1JTH B;  4RES B;  1OW8 A;  5GTH E;  4EIJ A;  1NTZ D;  5KLV D;  2QIW A;  2LXC B;  2P67 A;  1W5C E;  1GU4 A;  1ZW0 A;  2WMM A;  4N3Y B;  2YKQ A;  1K04 A;  1M1J A;  4R4L A;  3V2N A;  3EFG A;  3H1K J;  1ZR4 A;  4HYT B;  2WPR A;  1EZV E;  1SQQ E;  2N1T D;  1KC8 Q;  3L74 J;  4HH2 A;  5KLI B;  2E76 B;  3SSU A;  3WUT A;  3D71 A;  3CCE P;  3TF5 A;  3L70 E;  4U3F G;  2XU6 A;  1T3U A;  3KHU A;  5AW7 B;  3RK2 D;  2A45 G;  1L0L J;  1BCC G;  2QG4 A;  1LTS C;  1EDK A;  3I5C A;  2WVR A;  1DEB A;  4DCK A;  1JY3 N;  1X79 B;  1Q90 D;  3RL0 C;  1OXZ A;  3PLN A;  2J5U A;  4CPG A;  3RK3 B;  2P10 A;  3KZI E;  2AEJ A;  2V4H A;  3VP8 A;  3CWB J;  3L75 E;  1KMI Z;  1JY3 P;  2I8D A;  1J1D C;  4U7J A;  1U7J A;  1RHZ B;  3KPE A;  2Y9Y A;  2HFE D;  1L0L K;  1N73 B;  1J1E C;  2K88 A;  1FJP A;  3HE5 B;  2ZT9 D;  3HD7 D;  3D6Y A;  2WSF J;  2W6J H;  1LNQ A;  1R8E A;  3WUV A;  1KYO D;  2JDI H;  2JJL A;  1N7S A;  1PPJ G;  4PD4 D;  4Z1M H;  2QJK B;  4ZMD A;  3PJS K;  1KQL A;  5DJT B;  1URQ C;  2ZFC A;  3C1L A;  4WVZ A;  4HKZ H;  1PGP A;  1EXI A;  1SP4 A;  4WY4 C;  3HUS B;  2BCC D;  3AEA C;  5AW6 B;  1X9V A;  1H8A A;  5APY A;  1L4A A;  4XA4 A;  3HRN A;  1NU1 E;  1Y8A A;  1H0T A;  2IPP A;  1Y9B A;  4D6T J;  2WT7 A;  3B5N A;  1URQ A;  1VPC A;  2NZ2 A;  2I1J A;  1NHL A;  3CLQ A;  3TNU A;  2E74 B;  1RF0 A;  2W8Z A;  1SS1 A;  4TT3 H;  3MD0 A;  2D2C B;  1DH3 A;  3F5H A;  5H2F E;  3NXS A;  2IBZ G;  1G2C B;  3L74 G;  2JKV A;  3CXH D;  4D6T E;  2DW3 A;  2GUV A;  4K35 A;  5AVW B;  2B9B A;  2QJP C;  3M91 A;  1SQB E;  4GKG A;  1X22 A;  1L0L G;  2OYH C;  4WWI A;  5TIS H;  2ZYA A;  1LTB C;  2PRR A;  2KNC B;  5K5G B;  1HBW A;  1L0N D;  2FKW B;  4RO0 A;  1R5S A;  4OVN F;  1DIP A;  2Q1K A;  2R5D A;  1N7S D;  5APQ A;  3B8E B;  2FYU E;  3VN0 A;  2G3A A;  1FDO A;  4QMA A;  1N73 C;  3LW5 H;  1LTJ A;  2OYH A;  3HTK A;  4JYC A;  1VQO P;  3K5B A;  1BSH A;  4EYY Q;  2M3B A;  3M0D C;  3FXE A;  4PD4 H;  3H1L D;  3TGU G;  3EFF K;  2ZVN B;  1NVO A;  2A06 G;  2XKM A;  3P8C D;  1FZA A;  2E75 B;  3P8M C;  4JPZ B;  3B5N D;  1KIL E;  2OYI C;  3E7K A;  2JWD A;  3L71 E;  2GM4 A;  1BGY G;  2JP3 A;  4JYB A;  2K37 A;  4OWF A;  2WSC H;  3VTP C;  2YXR B;  1PP9 E;  3VMZ A;  1NTZ G;  2HR3 A;  1P84 E;  1UIX A;  2KZI A;  5M1B A;  5B66 H;  1ZME C;  1KQG B;  2FXP A;  1GTW A;  3JSV C;  1SQP E;  4L76 A;  1T2K D;  1KB9 E;  1ZR2 A;  1ZLL A;  4IFM A;  2JEE A;  1YBK A;  1RF1 A;  1JY3 O;  1CI6 A;  1VQM P;  4IL6 E;  3WMM 0;  4JF7 A;  1ZP0 C;  3CX5 E;  1NTK J;  1D7M A;  3T97 B;  2OTJ P;  1FZG A;  1S72 P;  1KFN A;  3CXH H;  1W2E A;  2K1A A;  5CCG D;  1NJI Q;  3BRT B;  1M1J B;  4PV1 B;  5E79 H;  5AVX B;  2C0X A;  4IFD K;  3OJA B;  3WU2 E;  2QE7 H;  3QH9 A;  4PD4 I;  4UB8 H;  1EQ7 A;  3L72 D;  4H13 C;  3L35 A;  4W7Z A;  5KAF E;  1JY2 P;  3GF3 A;  1SQX D;  1KFM A;  1NTK K;  3C9I A;  2I1K A;  1M1K Q;  1M56 D;  2R3S A;  3FWN A;  1P84 I;  3AE9 C;  2KP8 A;  2POH A;  1IK7 A;  2N1T C;  1MKM A;  2XV5 A;  1BCC J;  4I7Z C;  3N4X A;  5APX A;  1VQN P;  3Q1M A;  5APS A;  1GL2 D;  1SQQ D;  4KHX A;  2IZ0 A;  3PH0 A;  1HGV A;  1AFO A;  5EFW B;  3R2P A;  3RK2 C;  3L70 D;  2Q3I A;  5B5E H;  2H89 C;  2XDJ A;  3IFM A;  3NFQ A;  4U3F E;  2XND H;  3A0B E;  5APV A;  1JM0 A;  2WSE J;  4M3L A;  1JNM A;  3AEF C;  2OTK E;  1QEX A;  3RL0 B;  4NPF X;  2ZXE B;  1MUU A;  1DD3 A;  2FY8 A;  1QL2 A;  1PIX A;  1J1D B;  3MP7 B;  3H1J E;  2W6A A;  1J1E B;  3L75 D;  3BAT A;  2QSI A;  3PRJ A;  2QA4 P;  3CCQ P;  3CPW O;  3VMX A;  3VMY A;  4EDF A;  2ZT9 C;  5AW9 B;  2ZXX A;  3HD7 C;  2KI7 B;  2PP6 A;  2NPS A;  4LLH A;  1FZE A;  1RE3 C;  1SQV E;  1VQ5 P;  1L4A B;  1G1J A;  3C8V A;  1FOS E;  1LWU C;  4OGQ D;  3TSI A;  1H0T B;  1OZH A;  1PGO A;  1W2B O;  2WT7 B;  2IFN A;  1URQ B;  3JCU E;  1GK4 A;  3OAK A;  1NTK G;  2KXP B;  2HPC A;  1JO5 A;  4L75 A;  3TNU B;  5BU8 B;  2Q5U A;  3HD7 A;  4WY4 B;  3HE4 A;  2B87 A;  1KZU B;  4KT0 J;  5AW8 B;  1PPJ E;  1RE3 A;  4BWN A;  5GTH H;  2KLV A;  1LWU A;  2UWJ E;  5CCH D;  5BVZ A;  1LP1 A;  1NU1 D;  3RK3 E;  1K8A Q;  3M06 A;  5AVQ B;  1LTG C;  4W7Y A;  2K3R A;  2OQQ A;  2O01 N;  3ZDM A;  2C9N Y;  5BU5 A;  3CCV P;  3KYQ A;  3H1L G;  1GK6 A;  1UII A;  3RBX A;  1N8R Q;  1HUC A;  3H6P A;  2W90 A;  3H1K E;  4DOJ A;  2IBZ E;  2QJP B;  2XNX A;  2KK7 A;  4H0L D;  3L74 E;  2B89 A;  2OYH B;  3HTK B;  3M9Q A;  1NTM J;  2M5A A;  2NPS D;  5AW0 B;  1EDI A;  1SQB D;  3GHG C;  2P58 A;  3KZI H;  3B4S A;  1VF5 D;  2KS1 B;  1MFT A;  3GLM A;  3R4Y A;  1MFZ A;  1JY2 O;  3CCL P;  4EOT A;  2SPZ A;  1L0L E;  1E5W A;  3MGN A;  5TJH A;  5CBO A;  3TYY A;  1ZV8 A;  2C0W A;  4HB1 A;  1Y47 A;  3KDP B;  2Q9I A;  2WWW A;  1N7S C;  1KOR A;  3TGU J;  1MZ9 A;  4AYC A;  3M9H A;  2Q3E A;  1L2P A;  1AVY A;  2FYU D;  1MV8 A;  1QX8 A;  3GHG A;  1FOS F;  1NTM K;  1BGY J;  1BE3 J;  1EZV I;  1PV3 A;  1JB0 J;  5L8R J;  3CWB E;  1L4A C;  1S4X A;  2OYI B;  1S2E A;  1NTZ J;  4WBA A;  5KLV J;  4UB6 E;  2ZYD A;  3M9B A;  4YXW H;  3B5N C;  1PFI A;  1RF1 B;  2FFD C;  1YYC A;  3TGU E;  1LJ2 A;  2ZYG A;  2A06 E;  4R4M A;  1RY3 A;  1AV1 A;  1VQ6 P;  1KIL D;  3RGU A;  3V4W A;  3L71 D;  1SQX G;  1R5L A;  1RF0 C;  4C7N B;  1SFC D;  2M3E A;  1NH4 A;  4YPC A;  1PP9 D;  4AUW A;  1P84 D;  3II6 A;  4XFJ A;  1NTZ E;  1T2K C;  1KN7 A;  3VP9 A;  2FFD A;  3B71 A;  3FX0 A;  3CC7 P;  1SQP D;  1NO4 A;  1NTZ K;  5KLV K;  3MUD C;  1KB9 D;  1S5L E;  2N9Y B;  5AVY B;  3JC2 2;  2WPS A;  2JO1 A;  3Q3D A;  3L73 D;  2MKV A;  3S4R A;  1SVF A;  5CHX A;  5H2F H;  3CX5 D;  3PP5 A;  5KJ7 A;  5CCG C;  5DJU B;  4HJG H;  2C9L Y;  1JOC A;  3MUD A;  4H44 D;  2O1K A;  5KAI E;  2KSJ A;  1HJB A;  4H13 B;  3G9R A;  5CMZ A;  2QEX P;  2FYZ A;  1LTJ C;  3NMD A;  1BSN A;  2FYN B;  2WZ7 A;  5CCG A;  4EI2 A;  3M0A A;  2K9J B;  3Q5S A;  1HWT C;  1IZN B;  3TDK A;  2KUB A;  1PL5 A;  3LW5 J;  1GD2 E;  1NTM G;  2WPQ A;  1VQ8 P;  2N1T B;  4DZO A;  4I7Z B;  1IFM A;  3G71 P;  3U1A A;  2W6B A;  3AE7 C;  1DEE G;  1OVU A;  2HOD A;  3PTZ A;  3ABV C;  1NAY A;  2RKL A;  3RK2 B;  1FJK A;  2P2U A;  3NTN A;  2BCC J;  3H1H D;  2FXO A;  1QGK B;  1Z56 A;  2Y9Z A;  2WSC J;  5AW2 B;  4AQR D;  1X8Y A;  3E1R A;  1KYO E;  1BE3 G;  4U3F D;  2Z5H A;  1RF1 C;  1LGH B;  1GL2 A;  1RE4 C;  2MJZ A;  1NAF A;  3IF4 A;  2YNY A;  2YMK A;  2HYN A;  5KLV G;  1FZC C;  1P84 H;  1T8Z A;  3SWF A;  4PJ0 E;  3L73 J;  1SLQ A;  5KJ7 D;  3LID A;  1J2J B;  2O01 H;  4IOI H;  2Q7C A;  1KB9 H;  3U59 A;  4YXD C;  2WTY A;  1XTG B;  2AEF A;  4RJT A;  1N7L A;  3H1J D;  2ZT9 B;  1RE4 A;  3HD7 B;  2B88 A;  4IL6 H;  3HE4 B;  1AQT A;  2YIU C;  2P1J A;  2WSS H;  1K73 Q;  3CX5 H;  1FZC A;  3H1I D;  1LWU B;  5AW3 B;  3BAS A;  3S9O A;  3GF7 A;  1E79 H;  1SQV D;  2E42 A;  3BVH A;  2IZ1 A;  1OVR A;  1LP1 B;  4OGQ C;  1ZXG A;  5GTI E;  2YKO A;  1JEK A;  3KXD A;  2E76 D;  1KQF B;  1OVV A;  1USE A;  3WU2 H;  2LXB A;  1L0N J;  1DX7 A;  3BCC D;  3PHL A;  4TLF A;  5KAF H;  1NTK E;  3CMA P;  1FDM A;  2GUS A;  2R44 A;  2ZVO B;  2KB7 P;  2FYN C;  5CCH C;  1PGQ A;  1YIT P;  1QLE D;  4GIF A;  2R32 A;  4I1L A;  3N7N A;  3H1L J;  3I56 P;  3RK3 D;  3AE3 C;  1M57 D;  4K3A A;  1L0N K;  2OYO A;  1EZV D;  2BEZ F;  1ZN5 A;  1KB9 I;  2KOG A;  4IL6 X;  1K9M Q;  4ASV A;  2M8R A;  3FWL A;  3OA7 A;  2H7H A;  5CCH A;  1EDJ A;  1VQ7 P;  2AEM A;  4BRY A;  3L37 A;  3FGA D;  1YJW P;  1VQ4 P;  2BEQ D;  3CX5 I;  2LR2 A;  3A0H E;  1YI2 P;  1YQ4 C;  1M90 Q;  2YKP A;  3H1L E;  3A0B H;  2A45 H;  3H1K D;  4H0L C;  1BCC E;  1QL1 A;  1LT9 C;  1YJ9 P;  1IFP A;  1NWQ A; 
#chains in the Genus database with same CATH homology
 1S4X A;  1M8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...