1OX3A

Crystal structure of mini-fibritin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
DIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQEAGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Fibritin
publication title Design and Crystal Structure of Bacteriophage T4 Mini-Fibritin NCCF.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 27
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1ox3A00
2ZYGA 1PGOA 2IYOA 2W90A 2IZ1A 2W8ZA 3FWNA 2ZYAA 1NAYA 1PGPA 1AA0A 2JKVA 1PGQA 1OX3A 2PGDA 1AVYA 2IYPA 2IZ0A 1PGJA 2ZYDA
chains in the Genus database with same CATH superfamily
2KZIA 2YXRB 2D2CC 3L71D 4QMAA 3GF3A 2FXPA 1P84H 4AUWA 4W80A 1NTMK 3KYQA 2RKLA 5KAFH 1FC2C 5CCGC 1YITP 1DX7A 1L4AD 3A0HE 5KKZB 2W6AA 1BCCE 2IBZE 4NPFX 1H88A 3L73G 4A7PA 2P1JA 2YIUB 1FDIA 5CJ0A 3H1HE 4UB8E 1URQA 3L71J 2WSFH 3AE2C 3H6PA 2YO3A 4BXLA 4H13B 1MKMA 2IX7C 1BSNA 3SFEC 2YNYA 1N7LA 3CWBG 1Q82Q 2R3SA 1QGKB 4M3LA 2M5AA 4JF7A 1NTZG 5AVWB 1ZN5A 1SQVK 3H1ID 3L74D 1UIXA 2Z5HA 4WVZA 1LTIC 1J1EC 4WBAA 1OVUA 4EOTA 2FYZA 1KILA 1NTKD 1RE4A 4OGQB 1VQ7P 2GUSA 3WU2E 5APXA 2YXQB 1JY2N 1IFDA 1EQ7A 5AW5B 1JUNA 3P7KA 3M06A 2CK3H 2P10A 4RESB 1HJBA 3M9HA 3LIDA 3B5NA 2PAJA 3H1IJ 3L74J 2FXOA 3I5CA 4TT3H 1DEBA 1WMKA 2M3BA 1PPJG 1NTKJ 2KS1A 3MGNA 3V4WA 4AYCA 2ZJSE 3AEDC 2IBZD 3CL3D 1MUUA 4GT1A 1LTJA 2O1JA 1YIJP 3VMYA 3TYYA 3W68A 5GTIE 1HH0A 3IFMA 3L72G 4IFFA 4MN4C 1JCDA 1SQPE 2K88A 2LKMA 2FYNC 1MV8A 1KQSO 4H44B 2I1JA 1KYOH 4GKGA 4JYCA 1NGMB 1N7SA 2O01H 2ZYAA 2M8RA 1NJIQ 2OYHA 1ZMEC 3L75E 4HJGH 4WB4A 4IL6E 3E1IA 1RF1B 3V6IA 2D2CD 3OAKA 3VOPA 3FX0A 1FZBA 1OWAA 1OIPA 5CCGD 1PP9E 3CCRP 1SVFA 1M1KQ 2ZXEB 4C7RA 1FDOA 2E74C 1KQLA 1P84D 3VMXA 5CMZA 2I1KA 2J58A 4IOIH 1JO5A 1VL2A 1GTWA 1TU3F 4O9BA 5KJ7A 3CCEP 1GU4A 1EXJA 1LWUC 4W7ZA 3TGUE 2A06E 2ZT9C 1HJ0A 3PTZA 2V7QH 1FS0E 4LC1A 1GL2C 2E76D 3KDPB 5AW1B 2RMZA 3H1LE 3U1AA 2L91A 1J1DB 1CZQA 3K5BA 3GF7A 1HF9A 1M1JB 1T2KC 1JNMA 2KUBA 2R44A 2FYUK 3LW5H 2IBZI 3MZWB 1FZCC 2GM4A 2ZFCA 1M57D 3RK2D 4DJGA 2AXCA 1AJYA 1GW4A 1ZLLA 1ZRTD 2KZJA 2P58A 2QIWA 4U3FD 2WSFJ 2BASA 1U7MA 3L75D 3AE3C 2O01N 5KAIE 1BGYD 1LTGC 4L74A 2YMKA 1S4XA 5CBOA 1OZHA 1H89A 3H1JG 5L8RJ 2W6JH 2OARA 1URQC 3VTPC 4XA4A 1MFTA 2P2UA 5BU5A 2W27A 4U3FJ 1CI6A 1W2BO 2WQYC 4D6TE 1VQ4P 1P84I 1LT9A 5TISE 3H1KD 1YJWP 5AVUB 1NTMG 1PZQA 1BGYJ 1HVVA 1S5LE 3A5TA 4WY4B 3H1LD 1PFIA 5KLVG 1X8YA 3FXEA 1SQQD 3HE4B 3IF4A 1VQMP 3L70D 2O3JA 3CMAP 1FOSF 4LGDE 3HD7A 3T97A 4AQRD 1BDCA 2ZYGA 2D2CB 1ZW0A 1IFIA 2XNDH 3FWLA 2K9JB 3B71A 3H1KJ 2W90A 2E75D 5CHXA 2H8PD 4C7NB 3JC22 1KN7A 1SQVE 3ZDMA 3II6A 2OYIC 1LT1A 3B5NC 3H1LJ 2KNCA 1SQQJ 2QM8A 1A02J 3L70J 2W83C 3OJAB 1U57A 4IL6X 3VP8A 4H0LC 1KFMA 3ABVC 3G9RA 2QJYC 2R32A 4JYBA 2JWDA 1A02F 2O01J 1JTHA 4ASVA 3RGUA 1VQ6P 1FJPA 2ZYDA 1L0LD 1Y8AA 1QX8A 1IZNB 1IO4A 1L4AC 3TNUB 3A0BE 3IR9A 1KILE 2Q7CA 3TF5A 1T2KD 2FBWC 1KZUB 1L2PA 1SQBE 2XZRA 2QG4A 1NU1G 1N7SC 5GTHH 4I6MC 1VQKP 1LTBC 2QE7H 3HUSA 3RL0D 3R2PA 1NYHA 1L0LJ 2Q3IA 3EQ2A 1BE3E 1FZEA 3RK3B 1AVOA 4PJ0H 2NPSB 3P8CD 1IFPA 4EI2A 2K1AA 1G1JA 3CX5E 2XNXA 3BCCE 2YKPA 1IK9A 1URQD 1KORA 4N6JA 3LW5J 2C9LY 2B9BA 2JP3A 1YJNP 2H89C 2JEEA 2YO2A 3CXHE 2ITAA 2Q9IA 1JOCA 3A0HH 4GOEA 4OH8B 2HG5D 1USDA 2A45H 3L71G 3S1KA 3M9BA 1FJKA 5AVRB 1JY2O 2AEJA 3CC2P 1KILD 4UB8H 3GHGB 4ZKPA 1S2EA 2H43A 1L0NE 4Y99B 2OYOA 2FXMA 1RY3A 2QJPC 4UB6E 3G6EP 2FYUE 2E43A 1WT6A 3B5ND 2E74B 1OW7A 1ZXGA 5APUA 3C8VA 3U59A 2Q3EA 1YBKA 3MP7B 3NTNA 3CCSP 3V5BA 4DT0A 1DIPA 2ZT9B 2YKQA 2BCCD 2GA1A 4YPCA 3CX5D 3F5HA 2HR3A 1GL2B 3BCCD 3L73E 3V2QA 3H1IG 3WU2H 3UIAA 1QL1A 3L74G 2OQQA 4GODA 1KMIZ 5KLVK 3EFGA 3VN0A 3CLQA 3G3ZA 1NTKG 3TK1A 1SLQA 2MKVA 3HE5B 2KB7P 1N7SD 5CCHA 3AECC 3CWBE 1FZCB 2KYVA 1RF0C 1GZLA 2BCCJ 2FFDB 1BSHA 2PGDA 3BCCJ 2QSIA 1NTZE 1JMBA 1EXIA 2E76C 1SQXK 1G1IA 5GTIH 1ZR4A 5B66E 1L0ND 1K8AQ 2WSSH 3CCUP 1HBWA 5KJ7D 1VF5D 1VQ5P 2XU6A 2B88A 2BEZF 4I2LC 1R8EA 2HFED 1NH4A 1NO4A 4PV1C 3RK2C 4IL6H 3Q5PA 5CBNA 1EZVD 1Y47A 3RL0g 2H88C 4R4MA 1QVFO 1FU1A 3R4YA 5APSA 1KQGB 1PPJE 3WUUA 3FXDA 1NHLA 2W8ZA 1VQ8P 5EFWB 1NU1K 1YJ9P 3CX5I 2KK7A 5TJHA 2LXCB 1QLED 3HUSC 3L72E 4K3AA 2QJKC 5E79E 1N73C 1BCCD 3S4RA 1R5SA 3GLMA 1T6AA 1KB9E 2LXBA 3H1HD 2OYIB 2M0BA 1NTZD 3M0DA 4XFJA 4YXWH 2UWJE 4C46A 1PGJA 1RF1A 1YTZT 3TDKA 3G71P 2CPSA 1ZP0C 2YMYA 2O1KA 4L76A 1WRGA 4H0LB 3V2NA 2N1TB 3MUDA 3L4FA 1BCCJ 2SPZA 2N9YB 3O8ZA 5BVZA 2QJYB 4KT0J 1SFCC 2RN0A 1AVYA 2E75C 2C0WA 3H1HJ 1FZFA 5B5EE 2MJZA 1NTZJ 3RK3E 4EYYQ 1L4AB 3PJSK 5KAIH 4RO0A 2QEXP 1EZVI 4U3FG 5M1BA 4PD4E 4I7ZC 2E5TA 3HD7D 1KQFB 1Q7YQ 5APWA 1BGYG 1AV1A 1M1JA 3TSIA 3L36A 5TISH 2B87B 1OVVA 1X79B 1IJDB 5AVSB 4JPZB 2Q1KA 1R5LA 2LR2A 1D7MA 5AW0B 1S3JA 1S5LH 3CC4P 2IFNA 3AE1C 2A45I 2KOGA 3E1RA 1AQ5A 1Y9BA 3D6ZA 4L75A 1OXZA 1YYCA 1SQPD 3H1KG 4PV1D 2Y0DA 2AXTE 2FKWB 5DJUB 4Y28J 5AW2B 1KFNA 2QRXA 3RL0C 5KKZC 3H1JE 3Q3DA 1SQQG 2YIUC 2WT7B 2KLVA 3L70G 3VMZA 1NTKK 4H13C 1PP9D 1SQPJ 4N78E 1YQ3C 2KSJA 1NTME 3PRJA 3MIWA 2PP6A 2KSEA 1IFJA 2WTYA 4WY4A 3L75J 5KLVE 2WSCH 1H0TB 1VPCA 3USSA 3TGUD 2A06D 1JCCA 3HE4A 1SS1A 3AE7C 3AEGC 1GU5A 4DCKA 3A0BH 1PP9J 2B89A 3PH0A 3O6QB 1AA0A 4OGQC 2K9JA 5KTBA 2HODB 4C7NA 1L0LG 2KP8A 4HH2A 1KILC 1OFCX 1RE4C 1EDLA 1SFCD 5APYA 3TGUJ 2CPBA 2WSEH 2Q6QA 4GIFA 3KQGA 2ZXXA 1SQXG 1N8RQ 2OTLP 1HUCA 3CX5H 5AW7B 3FWNA 2R5DA 2AEMA 3E7KA 2K37A 1FZGA 1LTJC 3TNUA 3CMEP 1KV4A 2E76B 1FZAA 4NPEA 2WPSA 1NU1E 1YI2P 3CXHH 4U7JA 2QA4P 5CJ4A 1GD2E 3V2RA 4D6TD 2G8YA 4ZKUA 3M0AA 4R4LA 2OYHC 3KXDA 2JWAA 1LJ2A 5AVQB 2WPRA 3RK2B 1K73Q 1J1EB 2NPSA 2JO1A 3Q5RA 3B4SA 1PGPA 4ASWA 4GOFA 1K05A 1XTGB 1PL5A 2WITA 1SQPK 1GMJA 4UB6H 3VYIA 4D6TJ 4BRYB 4DZOA 4XE5B 1MFZA 4RJTA 4KHXA 3RBZA 4H13D 3N4XA 5CCHD 3Q5SA 3H32B 1QEXA 1VF5C 5KJ7C 2OTKE 2PRRA 1J1DC 1SQVD 2WMMA 3HTKB 1SP4A 1DD4A 3JSVC 1N73B 1M7LA 1PGOA 2NZ2A 1K04A 3L71E 1NOHA 1Q86Q 3D70A 1JB0J 2JKVA 4OVNF 4KJMA 4IFMA 5AW3B 2WPQA 2JDIH 2FYNB 1M90Q 3A7OA 2IYPA 3GHGA 2BCCG 4OWFA 1SQVJ 4OGQD 3WUVA 2K3RA 3GW6A 3BCCG 3Q1MA 1IFNA 1T3JA 2IDBA 2E42A 1VQOP 3CCJP 1S1CX 3PHLA 3V2PA 1SQBD 1SFCB 1SQQK 2E75B 3MD0A 2WVRA 3AE6C 1NKZB 3WUTA 2WSCJ 5B66H 3M9QA 2E5YA 3CCMP 1G2CB 5DJTB 2ZVNB 1Q2NA 1FBMA 1BE3D 1GL2A 1HGVA 2JJLA 4I7ZB 3H1IE 1LNQA 1LWUB 4WWIA 3L74E 1X22A 2KIKA 5AW4B 5BU8B 1SQBJ 3M91A 3C1LA 4H44D 1JY2P 1EDJA 4WY4C 2HPCB 1LT9C 1OW8A 1NAYA 1PGQA 3HE5A 3F89A 1FZCA 2WSEJ 1Q81Q 3CI9A 2FFDA 4YXDC 1BE3J 3KZIE 1HGZA 3BATA 1IFMA 1EZVG 1LP1B 2IZ1A 3CXHD 1L0LK 1EDIA 3ITKA 2Z5IA 1M56D 2XDJA 3HD7C 2L5GB 1KC8Q 2NRGA 5E79H 3RL0B 1DH3A 4RKUJ 3CCQP 2ZAEB 5AVYB 3BRTB 1CSBA 1KB9H 1GDTA 2G3AA 2H7HA 2A45G 1BCCG 2IBZG 5APQA 3KPEA 2FYUD 2K9YA 1OVRA 1E5WA 1RQUA 1URQB 3A3YB 3H1HG 2BEQD 4B86A 1E79H 1ZOYC 2KXPB 5KLIC 5H2FE 5AW8B 5B5EH 1L0NJ 1ZV8A 1LGHB 3JCUE 2M5AB 2IPPA 3P32A 1JY3N 1Z56A 3BRVB 1HWTC 2FYUJ 1S72P 1P84E 3L73D 2J59M 4HYTB 5KAFE 3RK3C 1QVGO 4PD4H 3I56P 4L73A 2NPSC 3EWKA 3KHUA 1KILB 2OYIA 2W6BA 1QL2A 2WPVB 1JEKA 3L37A 3CWBD 1LTSC 4NPDA 1VDFA 2JR8A 3H25A 3CXHI 5AVVB 1RE3A 2N1TA 3B5NB 2C0XA 3L73J 3GMAA 1SQBK 3NXSA 4K35A 3QH9A 1RHZB 2WZ7A 2KS1B 2AXTH 2OGUA 3SSUA 2YKOA 5C39A 1LTJB 1L4AA 2HYNA 3CWBJ 1EC5A 4WY4D 1M8OB 1ZRTE 3LIEA 1AQTA 2Q5UA 4U3FE 3B8EB 3AE4C 1SQPG 1N2DC 3GHGC 2QVAA 3MHVA 4Y99C 1BGYE 3NFQA 1GK4A 1FOSE 1NAFA 1OW6A 1N7SB 1PPJD 2OYHB 2VRSA 1N86A 2B87A 3L75G 3GG2A 3VP9A 3OA7A 4JQ0D 1PP9G 1VQLP 3L72D 3H1KE 5APTA 1PV3A 1FAVA 3AEEC 4GDOA 3C9IA 2N9BA 1EDKA 2Y9ZA 1KB9D 1YHQP 2KI7B 1VF5B 3SWYA 1SQQE 2V4HA 3TGUG 2WWWA 5K5GB 2A06G 2Y9YA 3A2AA 2WT7A 3L70E 1L0NK 2XV5A 5AVZB 1KYOE 1VQ9P 2IFMA 1K9MQ 1FDMA 3L72J 3H1LG 3SWFA 4N3YB 3VMAA 2FFDC 3CC7P 1VQNP 1XTCC 5CCHC 1LTAC 3RK3D 3SWKA 3D71A 1H0TA 2NPSD 3QWOC 3IAOA 1IK7A 3BASA 1OMIA 5AW9B 4PD4D 2IZ0A 3O6QA 3CD6P 2QJPB 1OX3A 2HODA 1L0LE 1DD3A 3D6YA 1JM0A 1PIXA 3WMM0 4CPGA 1NVOA 1SQXE 3AEBC 1UIIA 5CCGA 2KLUA 1NTZK 4DOJA 1CI6B 3NMDA 2RH0A 4D6TG 3OW2O 1LT9B 3AE8C 2Z4EA 1X9VA 1KB9I 3MTUE 5AVTB 2C9NY 1USEA 1RF0A 2P7JA 2Y0EA 1S9KE 3P8CE 1KYOD 1YQ4C 2AEFA 3H1JD 1AFOA 2P67A 4HB1A 4I1LA 4Z1MH 2J5UA 3IN6A 1T8ZA 4ZNCA 3SFDC 3HD7B 2POHA 1YTZI 3T97B 4IFDK 4ZMDA 3BVHA 2R3CA 2E74D 4H44C 3PLNA 3CCLP 4N78D 3AE9C 1NTMD 1SQVG 2ZT9D 3M0DC 1RE3C 2N1TC 3P8MC 3H1JJ 3Q2YA 2KNCB 2PFXA 3S9OA 1RF1C 1HTLC 1GL2D 2ZVOB 5KLVD 3I55P 2I8DA 2Y0CA 1GW3A 1LTTC 4TLFA 3G4SP 1ZR2A 2R5BA 3MUDC 1RH5B 4PD4I 4PV1B 4BRYA 3PP5A 1JTHB 1NTMJ 3FGAD 2GUVA 1X0TA 5KLIB 1SQXD 3L35A 3H32A 4HKZH 3AE5C 3AEFC 3HTKA 5KLVJ 2QM7A 1N73A 1SQBG 2V7QJ 3U1CA 4JBZA 3HUSB 1S9KD 2QJKB 3HRNA 1JMMA 1M1JC 4YTPC 1SQXJ 2BCCE 1RQVA 1KYOI 1W2EA 1IC2A 1BE3G 3AEAC 2FY8A 1CW5A 3KZIH 2HLOA 4EIJA 1NU1D 1SFCA 2DW3A 3RBXA 1Q90D 4BWNA 4EDFA 2OTJP 1JY3O 1G2CA 1U7JA 5AW6B 5GTHE 1DEEG 2IYOA 1VQPP 1LWUA 5APVA 1J2JB 4LLHA 1NU1J 3CCVP 5AVXB 3N7NA 2HPCA 3CPWO 2M3EA 1BDDA 4W7YA 1H8AA 1S5LX 4PJ0E 1NWQA 1MZ9A 1FE6A 1L0NG 3EFFK 1NTKE 1EZVE 1JY3P 1NKNA 1LP1A 1KTMA 1W5CE 2FYUG 5H2FH 2XKMA 4H0LD 3V4QA 3W67A 2N1TD 1T3UA 3JCUH 1GK6A 1KD1Q
chains in the Genus database with same CATH topology
2ZYGA 1PGOA 2IYOA 2W90A 2IZ1A 2W8ZA 3FWNA 2ZYAA 1NAYA 1PGPA 1AA0A 2JKVA 1PGQA 1OX3A 2PGDA 1AVYA 2IYPA 2IZ0A 1PGJA 2ZYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZYG A;  1PGO A;  2IYO A;  2W90 A;  2IZ1 A;  2W8Z A;  3FWN A;  2ZYA A;  1NAY A;  1PGP A;  1AA0 A;  2JKV A;  1PGQ A;  1OX3 A;  2PGD A;  1AVY A;  2IYP A;  2IZ0 A;  1PGJ A;  2ZYD A; 
#chains in the Genus database with same CATH topology
 2KZI A;  2YXR B;  2D2C C;  3L71 D;  4QMA A;  3GF3 A;  2FXP A;  1P84 H;  4AUW A;  4W80 A;  1NTM K;  3KYQ A;  2RKL A;  5KAF H;  1FC2 C;  5CCG C;  1YIT P;  1DX7 A;  1L4A D;  3A0H E;  5KKZ B;  2W6A A;  1BCC E;  2IBZ E;  4NPF X;  1H88 A;  3L73 G;  4A7P A;  2P1J A;  2YIU B;  1FDI A;  5CJ0 A;  3H1H E;  4UB8 E;  1URQ A;  3L71 J;  2WSF H;  3AE2 C;  3H6P A;  2YO3 A;  4BXL A;  4H13 B;  1MKM A;  2IX7 C;  1BSN A;  3SFE C;  2YNY A;  1N7L A;  3CWB G;  1Q82 Q;  2R3S A;  1QGK B;  4M3L A;  2M5A A;  4JF7 A;  1NTZ G;  5AVW B;  1ZN5 A;  1SQV K;  3H1I D;  3L74 D;  1UIX A;  2Z5H A;  4WVZ A;  1LTI C;  1J1E C;  4WBA A;  1OVU A;  4EOT A;  2FYZ A;  1KIL A;  1NTK D;  1RE4 A;  4OGQ B;  1VQ7 P;  2GUS A;  3WU2 E;  5APX A;  2YXQ B;  1JY2 N;  1IFD A;  1EQ7 A;  5AW5 B;  1JUN A;  3P7K A;  3M06 A;  2CK3 H;  2P10 A;  4RES B;  1HJB A;  3M9H A;  3LID A;  3B5N A;  2PAJ A;  3H1I J;  3L74 J;  2FXO A;  3I5C A;  4TT3 H;  1DEB A;  1WMK A;  2M3B A;  1PPJ G;  1NTK J;  2KS1 A;  3MGN A;  3V4W A;  4AYC A;  2ZJS E;  3AED C;  2IBZ D;  3CL3 D;  1MUU A;  4GT1 A;  1LTJ A;  2O1J A;  1YIJ P;  3VMY A;  3TYY A;  3W68 A;  5GTI E;  1HH0 A;  3IFM A;  3L72 G;  4IFF A;  4MN4 C;  1JCD A;  1SQP E;  2K88 A;  2LKM A;  2FYN C;  1MV8 A;  1KQS O;  4H44 B;  2I1J A;  1KYO H;  4GKG A;  4JYC A;  1NGM B;  1N7S A;  2O01 H;  2ZYA A;  2M8R A;  1NJI Q;  2OYH A;  1ZME C;  3L75 E;  4HJG H;  4WB4 A;  4IL6 E;  3E1I A;  1RF1 B;  3V6I A;  2D2C D;  3OAK A;  3VOP A;  3FX0 A;  1FZB A;  1OWA A;  1OIP A;  5CCG D;  1PP9 E;  3CCR P;  1SVF A;  1M1K Q;  2ZXE B;  4C7R A;  1FDO A;  2E74 C;  1KQL A;  1P84 D;  3VMX A;  5CMZ A;  2I1K A;  2J58 A;  4IOI H;  1JO5 A;  1VL2 A;  1GTW A;  1TU3 F;  4O9B A;  5KJ7 A;  3CCE P;  1GU4 A;  1EXJ A;  1LWU C;  4W7Z A;  3TGU E;  2A06 E;  2ZT9 C;  1HJ0 A;  3PTZ A;  2V7Q H;  1FS0 E;  4LC1 A;  1GL2 C;  2E76 D;  3KDP B;  5AW1 B;  2RMZ A;  3H1L E;  3U1A A;  2L91 A;  1J1D B;  1CZQ A;  3K5B A;  3GF7 A;  1HF9 A;  1M1J B;  1T2K C;  1JNM A;  2KUB A;  2R44 A;  2FYU K;  3LW5 H;  2IBZ I;  3MZW B;  1FZC C;  2GM4 A;  2ZFC A;  1M57 D;  3RK2 D;  4DJG A;  2AXC A;  1AJY A;  1GW4 A;  1ZLL A;  1ZRT D;  2KZJ A;  2P58 A;  2QIW A;  4U3F D;  2WSF J;  2BAS A;  1U7M A;  3L75 D;  3AE3 C;  2O01 N;  5KAI E;  1BGY D;  1LTG C;  4L74 A;  2YMK A;  1S4X A;  5CBO A;  1OZH A;  1H89 A;  3H1J G;  5L8R J;  2W6J H;  2OAR A;  1URQ C;  3VTP C;  4XA4 A;  1MFT A;  2P2U A;  5BU5 A;  2W27 A;  4U3F J;  1CI6 A;  1W2B O;  2WQY C;  4D6T E;  1VQ4 P;  1P84 I;  1LT9 A;  5TIS E;  3H1K D;  1YJW P;  5AVU B;  1NTM G;  1PZQ A;  1BGY J;  1HVV A;  1S5L E;  3A5T A;  4WY4 B;  3H1L D;  1PFI A;  5KLV G;  1X8Y A;  3FXE A;  1SQQ D;  3HE4 B;  3IF4 A;  1VQM P;  3L70 D;  2O3J A;  3CMA P;  1FOS F;  4LGD E;  3HD7 A;  3T97 A;  4AQR D;  1BDC A;  2ZYG A;  2D2C B;  1ZW0 A;  1IFI A;  2XND H;  3FWL A;  2K9J B;  3B71 A;  3H1K J;  2W90 A;  2E75 D;  5CHX A;  2H8P D;  4C7N B;  3JC2 2;  1KN7 A;  1SQV E;  3ZDM A;  3II6 A;  2OYI C;  1LT1 A;  3B5N C;  3H1L J;  2KNC A;  1SQQ J;  2QM8 A;  1A02 J;  3L70 J;  2W83 C;  3OJA B;  1U57 A;  4IL6 X;  3VP8 A;  4H0L C;  1KFM A;  3ABV C;  3G9R A;  2QJY C;  2R32 A;  4JYB A;  2JWD A;  1A02 F;  2O01 J;  1JTH A;  4ASV A;  3RGU A;  1VQ6 P;  1FJP A;  2ZYD A;  1L0L D;  1Y8A A;  1QX8 A;  1IZN B;  1IO4 A;  1L4A C;  3TNU B;  3A0B E;  3IR9 A;  1KIL E;  2Q7C A;  3TF5 A;  1T2K D;  2FBW C;  1KZU B;  1L2P A;  1SQB E;  2XZR A;  2QG4 A;  1NU1 G;  1N7S C;  5GTH H;  4I6M C;  1VQK P;  1LTB C;  2QE7 H;  3HUS A;  3RL0 D;  3R2P A;  1NYH A;  1L0L J;  2Q3I A;  3EQ2 A;  1BE3 E;  1FZE A;  3RK3 B;  1AVO A;  4PJ0 H;  2NPS B;  3P8C D;  1IFP A;  4EI2 A;  2K1A A;  1G1J A;  3CX5 E;  2XNX A;  3BCC E;  2YKP A;  1IK9 A;  1URQ D;  1KOR A;  4N6J A;  3LW5 J;  2C9L Y;  2B9B A;  2JP3 A;  1YJN P;  2H89 C;  2JEE A;  2YO2 A;  3CXH E;  2ITA A;  2Q9I A;  1JOC A;  3A0H H;  4GOE A;  4OH8 B;  2HG5 D;  1USD A;  2A45 H;  3L71 G;  3S1K A;  3M9B A;  1FJK A;  5AVR B;  1JY2 O;  2AEJ A;  3CC2 P;  1KIL D;  4UB8 H;  3GHG B;  4ZKP A;  1S2E A;  2H43 A;  1L0N E;  4Y99 B;  2OYO A;  2FXM A;  1RY3 A;  2QJP C;  4UB6 E;  3G6E P;  2FYU E;  2E43 A;  1WT6 A;  3B5N D;  2E74 B;  1OW7 A;  1ZXG A;  5APU A;  3C8V A;  3U59 A;  2Q3E A;  1YBK A;  3MP7 B;  3NTN A;  3CCS P;  3V5B A;  4DT0 A;  1DIP A;  2ZT9 B;  2YKQ A;  2BCC D;  2GA1 A;  4YPC A;  3CX5 D;  3F5H A;  2HR3 A;  1GL2 B;  3BCC D;  3L73 E;  3V2Q A;  3H1I G;  3WU2 H;  3UIA A;  1QL1 A;  3L74 G;  2OQQ A;  4GOD A;  1KMI Z;  5KLV K;  3EFG A;  3VN0 A;  3CLQ A;  3G3Z A;  1NTK G;  3TK1 A;  1SLQ A;  2MKV A;  3HE5 B;  2KB7 P;  1N7S D;  5CCH A;  3AEC C;  3CWB E;  1FZC B;  2KYV A;  1RF0 C;  1GZL A;  2BCC J;  2FFD B;  1BSH A;  2PGD A;  3BCC J;  2QSI A;  1NTZ E;  1JMB A;  1EXI A;  2E76 C;  1SQX K;  1G1I A;  5GTI H;  1ZR4 A;  5B66 E;  1L0N D;  1K8A Q;  2WSS H;  3CCU P;  1HBW A;  5KJ7 D;  1VF5 D;  1VQ5 P;  2XU6 A;  2B88 A;  2BEZ F;  4I2L C;  1R8E A;  2HFE D;  1NH4 A;  1NO4 A;  4PV1 C;  3RK2 C;  4IL6 H;  3Q5P A;  5CBN A;  1EZV D;  1Y47 A;  3RL0 g;  2H88 C;  4R4M A;  1QVF O;  1FU1 A;  3R4Y A;  5APS A;  1KQG B;  1PPJ E;  3WUU A;  3FXD A;  1NHL A;  2W8Z A;  1VQ8 P;  5EFW B;  1NU1 K;  1YJ9 P;  3CX5 I;  2KK7 A;  5TJH A;  2LXC B;  1QLE D;  3HUS C;  3L72 E;  4K3A A;  2QJK C;  5E79 E;  1N73 C;  1BCC D;  3S4R A;  1R5S A;  3GLM A;  1T6A A;  1KB9 E;  2LXB A;  3H1H D;  2OYI B;  2M0B A;  1NTZ D;  3M0D A;  4XFJ A;  4YXW H;  2UWJ E;  4C46 A;  1PGJ A;  1RF1 A;  1YTZ T;  3TDK A;  3G71 P;  2CPS A;  1ZP0 C;  2YMY A;  2O1K A;  4L76 A;  1WRG A;  4H0L B;  3V2N A;  2N1T B;  3MUD A;  3L4F A;  1BCC J;  2SPZ A;  2N9Y B;  3O8Z A;  5BVZ A;  2QJY B;  4KT0 J;  1SFC C;  2RN0 A;  1AVY A;  2E75 C;  2C0W A;  3H1H J;  1FZF A;  5B5E E;  2MJZ A;  1NTZ J;  3RK3 E;  4EYY Q;  1L4A B;  3PJS K;  5KAI H;  4RO0 A;  2QEX P;  1EZV I;  4U3F G;  5M1B A;  4PD4 E;  4I7Z C;  2E5T A;  3HD7 D;  1KQF B;  1Q7Y Q;  5APW A;  1BGY G;  1AV1 A;  1M1J A;  3TSI A;  3L36 A;  5TIS H;  2B87 B;  1OVV A;  1X79 B;  1IJD B;  5AVS B;  4JPZ B;  2Q1K A;  1R5L A;  2LR2 A;  1D7M A;  5AW0 B;  1S3J A;  1S5L H;  3CC4 P;  2IFN A;  3AE1 C;  2A45 I;  2KOG A;  3E1R A;  1AQ5 A;  1Y9B A;  3D6Z A;  4L75 A;  1OXZ A;  1YYC A;  1SQP D;  3H1K G;  4PV1 D;  2Y0D A;  2AXT E;  2FKW B;  5DJU B;  4Y28 J;  5AW2 B;  1KFN A;  2QRX A;  3RL0 C;  5KKZ C;  3H1J E;  3Q3D A;  1SQQ G;  2YIU C;  2WT7 B;  2KLV A;  3L70 G;  3VMZ A;  1NTK K;  4H13 C;  1PP9 D;  1SQP J;  4N78 E;  1YQ3 C;  2KSJ A;  1NTM E;  3PRJ A;  3MIW A;  2PP6 A;  2KSE A;  1IFJ A;  2WTY A;  4WY4 A;  3L75 J;  5KLV E;  2WSC H;  1H0T B;  1VPC A;  3USS A;  3TGU D;  2A06 D;  1JCC A;  3HE4 A;  1SS1 A;  3AE7 C;  3AEG C;  1GU5 A;  4DCK A;  3A0B H;  1PP9 J;  2B89 A;  3PH0 A;  3O6Q B;  1AA0 A;  4OGQ C;  2K9J A;  5KTB A;  2HOD B;  4C7N A;  1L0L G;  2KP8 A;  4HH2 A;  1KIL C;  1OFC X;  1RE4 C;  1EDL A;  1SFC D;  5APY A;  3TGU J;  2CPB A;  2WSE H;  2Q6Q A;  4GIF A;  3KQG A;  2ZXX A;  1SQX G;  1N8R Q;  2OTL P;  1HUC A;  3CX5 H;  5AW7 B;  3FWN A;  2R5D A;  2AEM A;  3E7K A;  2K37 A;  1FZG A;  1LTJ C;  3TNU A;  3CME P;  1KV4 A;  2E76 B;  1FZA A;  4NPE A;  2WPS A;  1NU1 E;  1YI2 P;  3CXH H;  4U7J A;  2QA4 P;  5CJ4 A;  1GD2 E;  3V2R A;  4D6T D;  2G8Y A;  4ZKU A;  3M0A A;  4R4L A;  2OYH C;  3KXD A;  2JWA A;  1LJ2 A;  5AVQ B;  2WPR A;  3RK2 B;  1K73 Q;  1J1E B;  2NPS A;  2JO1 A;  3Q5R A;  3B4S A;  1PGP A;  4ASW A;  4GOF A;  1K05 A;  1XTG B;  1PL5 A;  2WIT A;  1SQP K;  1GMJ A;  4UB6 H;  3VYI A;  4D6T J;  4BRY B;  4DZO A;  4XE5 B;  1MFZ A;  4RJT A;  4KHX A;  3RBZ A;  4H13 D;  3N4X A;  5CCH D;  3Q5S A;  3H32 B;  1QEX A;  1VF5 C;  5KJ7 C;  2OTK E;  2PRR A;  1J1D C;  1SQV D;  2WMM A;  3HTK B;  1SP4 A;  1DD4 A;  3JSV C;  1N73 B;  1M7L A;  1PGO A;  2NZ2 A;  1K04 A;  3L71 E;  1NOH A;  1Q86 Q;  3D70 A;  1JB0 J;  2JKV A;  4OVN F;  4KJM A;  4IFM A;  5AW3 B;  2WPQ A;  2JDI H;  2FYN B;  1M90 Q;  3A7O A;  2IYP A;  3GHG A;  2BCC G;  4OWF A;  1SQV J;  4OGQ D;  3WUV A;  2K3R A;  3GW6 A;  3BCC G;  3Q1M A;  1IFN A;  1T3J A;  2IDB A;  2E42 A;  1VQO P;  3CCJ P;  1S1C X;  3PHL A;  3V2P A;  1SQB D;  1SFC B;  1SQQ K;  2E75 B;  3MD0 A;  2WVR A;  3AE6 C;  1NKZ B;  3WUT A;  2WSC J;  5B66 H;  3M9Q A;  2E5Y A;  3CCM P;  1G2C B;  5DJT B;  2ZVN B;  1Q2N A;  1FBM A;  1BE3 D;  1GL2 A;  1HGV A;  2JJL A;  4I7Z B;  3H1I E;  1LNQ A;  1LWU B;  4WWI A;  3L74 E;  1X22 A;  2KIK A;  5AW4 B;  5BU8 B;  1SQB J;  3M91 A;  3C1L A;  4H44 D;  1JY2 P;  1EDJ A;  4WY4 C;  2HPC B;  1LT9 C;  1OW8 A;  1NAY A;  1PGQ A;  3HE5 A;  3F89 A;  1FZC A;  2WSE J;  1Q81 Q;  3CI9 A;  2FFD A;  4YXD C;  1BE3 J;  3KZI E;  1HGZ A;  3BAT A;  1IFM A;  1EZV G;  1LP1 B;  2IZ1 A;  3CXH D;  1L0L K;  1EDI A;  3ITK A;  2Z5I A;  1M56 D;  2XDJ A;  3HD7 C;  2L5G B;  1KC8 Q;  2NRG A;  5E79 H;  3RL0 B;  1DH3 A;  4RKU J;  3CCQ P;  2ZAE B;  5AVY B;  3BRT B;  1CSB A;  1KB9 H;  1GDT A;  2G3A A;  2H7H A;  2A45 G;  1BCC G;  2IBZ G;  5APQ A;  3KPE A;  2FYU D;  2K9Y A;  1OVR A;  1E5W A;  1RQU A;  1URQ B;  3A3Y B;  3H1H G;  2BEQ D;  4B86 A;  1E79 H;  1ZOY C;  2KXP B;  5KLI C;  5H2F E;  5AW8 B;  5B5E H;  1L0N J;  1ZV8 A;  1LGH B;  3JCU E;  2M5A B;  2IPP A;  3P32 A;  1JY3 N;  1Z56 A;  3BRV B;  1HWT C;  2FYU J;  1S72 P;  1P84 E;  3L73 D;  2J59 M;  4HYT B;  5KAF E;  3RK3 C;  1QVG O;  4PD4 H;  3I56 P;  4L73 A;  2NPS C;  3EWK A;  3KHU A;  1KIL B;  2OYI A;  2W6B A;  1QL2 A;  2WPV B;  1JEK A;  3L37 A;  3CWB D;  1LTS C;  4NPD A;  1VDF A;  2JR8 A;  3H25 A;  3CXH I;  5AVV B;  1RE3 A;  2N1T A;  3B5N B;  2C0X A;  3L73 J;  3GMA A;  1SQB K;  3NXS A;  4K35 A;  3QH9 A;  1RHZ B;  2WZ7 A;  2KS1 B;  2AXT H;  2OGU A;  3SSU A;  2YKO A;  5C39 A;  1LTJ B;  1L4A A;  2HYN A;  3CWB J;  1EC5 A;  4WY4 D;  1M8O B;  1ZRT E;  3LIE A;  1AQT A;  2Q5U A;  4U3F E;  3B8E B;  3AE4 C;  1SQP G;  1N2D C;  3GHG C;  2QVA A;  3MHV A;  4Y99 C;  1BGY E;  3NFQ A;  1GK4 A;  1FOS E;  1NAF A;  1OW6 A;  1N7S B;  1PPJ D;  2OYH B;  2VRS A;  1N86 A;  2B87 A;  3L75 G;  3GG2 A;  3VP9 A;  3OA7 A;  4JQ0 D;  1PP9 G;  1VQL P;  3L72 D;  3H1K E;  5APT A;  1PV3 A;  1FAV A;  3AEE C;  4GDO A;  3C9I A;  2N9B A;  1EDK A;  2Y9Z A;  1KB9 D;  1YHQ P;  2KI7 B;  1VF5 B;  3SWY A;  1SQQ E;  2V4H A;  3TGU G;  2WWW A;  5K5G B;  2A06 G;  2Y9Y A;  3A2A A;  2WT7 A;  3L70 E;  1L0N K;  2XV5 A;  5AVZ B;  1KYO E;  1VQ9 P;  2IFM A;  1K9M Q;  1FDM A;  3L72 J;  3H1L G;  3SWF A;  4N3Y B;  3VMA A;  2FFD C;  3CC7 P;  1VQN P;  1XTC C;  5CCH C;  1LTA C;  3RK3 D;  3SWK A;  3D71 A;  1H0T A;  2NPS D;  3QWO C;  3IAO A;  1IK7 A;  3BAS A;  1OMI A;  5AW9 B;  4PD4 D;  2IZ0 A;  3O6Q A;  3CD6 P;  2QJP B;  1OX3 A;  2HOD A;  1L0L E;  1DD3 A;  3D6Y A;  1JM0 A;  1PIX A;  3WMM 0;  4CPG A;  1NVO A;  1SQX E;  3AEB C;  1UII A;  5CCG A;  2KLU A;  1NTZ K;  4DOJ A;  1CI6 B;  3NMD A;  2RH0 A;  4D6T G;  3OW2 O;  1LT9 B;  3AE8 C;  2Z4E A;  1X9V A;  1KB9 I;  3MTU E;  5AVT B;  2C9N Y;  1USE A;  1RF0 A;  2P7J A;  2Y0E A;  1S9K E;  3P8C E;  1KYO D;  1YQ4 C;  2AEF A;  3H1J D;  1AFO A;  2P67 A;  4HB1 A;  4I1L A;  4Z1M H;  2J5U A;  3IN6 A;  1T8Z A;  4ZNC A;  3SFD C;  3HD7 B;  2POH A;  1YTZ I;  3T97 B;  4IFD K;  4ZMD A;  3BVH A;  2R3C A;  2E74 D;  4H44 C;  3PLN A;  3CCL P;  4N78 D;  3AE9 C;  1NTM D;  1SQV G;  2ZT9 D;  3M0D C;  1RE3 C;  2N1T C;  3P8M C;  3H1J J;  3Q2Y A;  2KNC B;  2PFX A;  3S9O A;  1RF1 C;  1HTL C;  1GL2 D;  2ZVO B;  5KLV D;  3I55 P;  2I8D A;  2Y0C A;  1GW3 A;  1LTT C;  4TLF A;  3G4S P;  1ZR2 A;  2R5B A;  3MUD C;  1RH5 B;  4PD4 I;  4PV1 B;  4BRY A;  3PP5 A;  1JTH B;  1NTM J;  3FGA D;  2GUV A;  1X0T A;  5KLI B;  1SQX D;  3L35 A;  3H32 A;  4HKZ H;  3AE5 C;  3AEF C;  3HTK A;  5KLV J;  2QM7 A;  1N73 A;  1SQB G;  2V7Q J;  3U1C A;  4JBZ A;  3HUS B;  1S9K D;  2QJK B;  3HRN A;  1JMM A;  1M1J C;  4YTP C;  1SQX J;  2BCC E;  1RQV A;  1KYO I;  1W2E A;  1IC2 A;  1BE3 G;  3AEA C;  2FY8 A;  1CW5 A;  3KZI H;  2HLO A;  4EIJ A;  1NU1 D;  1SFC A;  2DW3 A;  3RBX A;  1Q90 D;  4BWN A;  4EDF A;  2OTJ P;  1JY3 O;  1G2C A;  1U7J A;  5AW6 B;  5GTH E;  1DEE G;  2IYO A;  1VQP P;  1LWU A;  5APV A;  1J2J B;  4LLH A;  1NU1 J;  3CCV P;  5AVX B;  3N7N A;  2HPC A;  3CPW O;  2M3E A;  1BDD A;  4W7Y A;  1H8A A;  1S5L X;  4PJ0 E;  1NWQ A;  1MZ9 A;  1FE6 A;  1L0N G;  3EFF K;  1NTK E;  1EZV E;  1JY3 P;  1NKN A;  1LP1 A;  1KTM A;  1W5C E;  2FYU G;  5H2F H;  2XKM A;  4H0L D;  3V4Q A;  3W67 A;  2N1T D;  1T3U A;  3JCU H;  1GK6 A;  1KD1 Q; 
#chains in the Genus database with same CATH homology
 2ZYG A;  1PGO A;  2IYO A;  2W90 A;  2IZ1 A;  2W8Z A;  3FWN A;  2ZYA A;  1NAY A;  1PGP A;  1AA0 A;  2JKV A;  1PGQ A;  1OX3 A;  2PGD A;  1AVY A;  2IYP A;  2IZ0 A;  1PGJ A;  2ZYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...