1OX3A

Crystal structure of mini-fibritin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
b'DIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQEAGYIPEAPRDGQAYVRKDGEWVLLSTFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibritin
publication title Design and Crystal Structure of Bacteriophage T4 Mini-Fibritin NCCF.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Chaperone
total genus 27
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1ox3A00
1PGJA 2JKVA 2IZ0A 2IYPA 2IZ1A 2IYOA 2ZYDA 1PGQA 2W8ZA 1NAYA 1PGPA 1OX3A 1AA0A 1PGOA 2PGDA 3FWNA 2ZYGA 1AVYA 2W90A 2ZYAA
chains in the Genus database with same CATH superfamily
1EQ7A 1HH0A 3MUDA 2LXCB 3MIWA 1P84E 2KNCA 1N2DC 5AW8B 3P8MC 1ZLLA 1Q90D 3RK3C 1N73B 2M5AA 5E79H 1FZCA 3AE2C 1PGPA 1VQ8P 3Q5RA 1URQA 2IFMA 1S72P 3A7OA 3H25A 4NPFX 2C9LY 4QMAA 4JQ0D 4GODA 2FKWB 1YJ9P 3H1JJ 3CCMP 4H44C 3N4XA 5KLVE 5H2FH 1OW6A 3H1KJ 1PGJA 2Y0CA 3AEEC 2L5GB 4W7ZA 2E74B 2XKMA 5GTIH 2E5TA 1LTAC 1DEEG 3H32B 2ZT9B 2XNDH 1Q81Q 4H0LC 1GMJA 3E7KA 4WWIA 2WZ7A 3D70A 1L0ND 3CX5E 3L73D 3A3YB 3LIEA 5AW5B 1KMIZ 1E5WA 2I1KA 1VQ6P 1NJIQ 1FZFA 3BATA 2OYIA 1KTMA 2KNCB 2Q9IA 1OW7A 2B87A 1KYOD 2M5AB 4Y99B 3O8ZA 3TF5A 1PP9E 1FZCB 2YKOA 3VP8A 4DJGA 2N1TD 3RBZA 3VP9A 1URQB 2YIUC 3V4WA 3G6EP 3IF4A 1PGQA 2E76C 1R5SA 1LP1A 1GK4A 3B5ND 2O3JA 3F5HA 1VQ9P 1GL2D 2XV5A 3T97A 2IX7C 3KZIH 3GG2A 4LLHA 5CCHD 1YQ3C 5DJTB 2IDBA 2B88A 1VQNP 1MKMA 5AW9B 2H89C 2QVAA 5AVYB 3FXEA 3IAOA 3M9QA 2FBWC 5KJ7D 1VL2A 4D6TJ 3ZDMA 4C46A 3HUSC 1OWAA 2N1TA 1KQGB 3L70J 3BASA 1RQUA 2OYIB 3G9RA 2WT7A 1G2CA 2I8DA 1AVYA 5B66E 3TGUJ 2JO1A 4H44B 2C9NY 2KK7A 3CMEP 3GW6A 2B87B 1NKNA 1GDTA 2PFXA 3B5NA 3EFGA 3E1IA 2O01J 3H6PA 1GL2A 1NTZD 3CCRP 2BCCD 3H1IJ 3RBXA 5AW6B 3Q5PA 1SS1A 1GW4A 2WSEH 2QJYB 4H0LB 1P84D 1DEBA 1LP1B 1GU5A 1XTGB 1E79H 5AVXB 1M56D 3U59A 4AQRD 3KHUA 2IBZG 1IK9A 2JWAA 1CZQA 3T97B 1FOSE 4EDFA 5GTHH 2ZVOB 1RF1C 5KJ7A 3KYQA 1FJKA 1JY3P 3M06A 3VTPC 3CCQP 1QVFO 4LGDE 3L72E 3CC2P 5KLVD 1SQBE 2YIUB 3P8CE 1AQTA 3RK2C 2E76B 4PV1C 1Q82Q 4C7NA 2N1TB 1N7SC 1JUNA 2JKVA 2WQYC 2P10A 1JM0A 2WT7B 1G2CB 3CCLP 2AXCA 2BASA 3A5TA 2R5DA 3BVHA 3B5NB 1Q86Q 1RF1A 3CX5D 1GL2B 2WSSH 1G1IA 1NU1E 3SWKA 1NTZJ 1RH5B 4WVZA 2IYPA 3H1JE 2NPSC 1M90Q 3BRVB 1HUCA 2G8YA 2YO2A 3H1KE 1PP9D 1HTLC 4L76A 2KLUA 3W68A 5AVQB 1EDIA 2YMYA 4XE5B 2GUSA 2K37A 2FXMA 1K9MQ 3I5CA 3L74E 1VQOP 2QJKC 1FC2C 3H1JG 2J59M 3LW5H 4WY4D 2RKLA 3H1KG 4PD4I 3F89A 4O9BA 5KLVJ 3RK3E 4C7NB 1S5LE 2JJLA 3FXDA 1KB9I 3V2RA 1H8AA 1BGYE 3LIDA 1OW8A 5APXA 4IL6E 1Y9BA 1OXZA 1L2PA 1RF1B 2H43A 5AVTB 3GMAA 5BU8B 3CXHE 4RKUJ 5EFWB 1JY2P 2Y9ZA 3CPWO 4H13C 1PL5A 4KT0J 2GM4A 1VDFA 4PV1B 3IN6A 1KILC 4HKZH 3NFQA 1NWQA 5TISE 3SWFA 3VYIA 1GU4A 4RO0A 3L75D 3PLNA 3L35A 4D6TE 1SQQJ 3L70E 2OTLP 1S2EA 2QM7A 3EQ2A 3TGUE 3VN0A 3OW2O 5BU5A 1LNQA 2WTYA 3G71P 1FDMA 3CCVP 3L72D 3D6ZA 2XDJA 1KILA 2A06E 3H1IE 4L75A 1ZN5A 2NRGA 1SQBD 1YIJP 3P8CD 3Q5SA 1T8ZA 3B8EB 1X22A 4D6TG 4UB8E 2UWJE 3GHGC 4PD4E 1JB0J 1QVGO 2J5UA 3L73G 3S1KA 1KC8Q 1J1DB 2V4HA 3L71J 3WUUA 2A06G 1NU1D 4DOJA 4WY4B 2O1JA 3WMM0 1J1EB 1FZEA 3H1JD 2SPZA 4JPZB 3PP5A 2HG5D 3H1KD 1URQD 2ZXEB 3L75J 1KQLA 1Q2NA 4B86A 3GHGA 2N9YB 3N7NA 2IPPA 4PJ0E 1YYCA 4N78E 1HBWA 1FE6A 4H13B 1RF0C 2AEFA 3I55P 2ZVNB 1EZVI 2AXTH 1AFOA 3H1HE 1R8EA 3L74D 1OVVA 5CHXA 4YXDC 2KS1A 2O1KA 1LT9A 3WUVA 1JY3N 1KILB 1RE3A 1OVRA 1U7JA 1BCCE 4AYCA 3L72J 1LGHB 2K88A 3RK3D 1SQBJ 4ZKUA 1NTZK 1QLED 5KAIE 3HE5A 2WSCJ 1K8AQ 5KTBA 5CBNA 3Q3DA 1BGYD 1K73Q 3CWBJ 1AQ5A 5APUA 4CPGA 4OGQC 1NO4A 1SVFA 3UIAA 1ZR2A 2D2CC 1X79B 3V2QA 1QX8A 3CXHD 2OYOA 1DIPA 5AW1B 2YKPA 5DJUB 3D71A 4H44D 1S9KE 1NTZG 2BCCG 2KXPB 1NU1J 1Q7YQ 3AE8C 4HYTB 3H1LE 2V7QJ 3MTUE 1FU1A 3WU2H 4L74A 2FYNC 1AV1A 1LTGC 5KLVK 4H0LD 1IFJA 4BRYA 1ZMEC 3G3ZA 4N6JA 1PFIA 2H8PD 2B89A 3MD0A 3TYYA 3V2NA 5APSA 4D6TD 1NH4A 2KS1B 1LT9B 4I1LA 3L74J 3L70D 1MV8A 1N8RQ 1Z56A 4A7PA 4EYYQ 1M57D 2WSFH 3TGUD 5KLVG 3HE5B 5TJHA 1YTZI 1IFDA 2E5YA 5KLIC 1EZVE 1AVOA 2A06D 3H1ID 4IL6H 2PRRA 1BGYJ 2E76D 5APWA 2JDIH 3CMAP 2P58A 1WT6A 1KD1Q 3QWOC 4PD4D 3V4QA 5AVZB 1NTKJ 3TNUA 3MGNA 2JEEA 5CJ4A 1JY2N 2Y0EA 3G4SP 1SQQE 2CPBA 3OA7A 2KUBA 1LTTC 1T2KC 1PP9G 1SFCC 1CSBA 2R3CA 1X0TA 4BRYB 2WITA 3HTKA 5KAFH 3RK3B 2CK3H 1U57A 2PP6A 1VQKP 4OGQB 1L4AC 1WRGA 2R32A 2D2CB 2HPCA 4ZMDA 2G3AA 4N78D 3HD7C 1GW3A 1JY3O 3VMAA 3AEBC 1NOHA 1NTME 3H1HD 1CI6A 2O01H 1KILE 5AVUB 1PPJE 1KYOH 3L71E 2ZXXA 2FYUE 1BCCD 4K3AA 5B5EH 3JC22 2KYVA 3U1AA 3VMYA 1IFPA 1FS0E 3SFEC 1U7MA 2QSIA 3MZWB 3L75E 3TNUB 3JCUE 5AVVB 1M7LA 3HD7A 3HUSA 5AVWB 2R44A 5APTA 4TT3H 1VPCA 2QRXA 1S9KD 3HTKB 4W80A 3VOPA 2WSEJ 3RK2D 2VRSA 4PV1D 3H1LD 1N7SD 2HPCB 1OVUA 3L75G 4PJ0H 1SQBK 1VQ7P 1ZW0A 1BSHA 1JOCA 3CWBE 4C7RA 2BEQD 1LJ2A 3AE1C 2CPSA 5CJ0A 3I56P 3M9BA 1CI6B 3E1RA 2Q5UA 3H1HJ 3A0BE 1VF5C 2NPSD 1LTJC 1MFTA 3L72G 1SQBG 1BCCJ 4JBZA 2HYNA 3OAKA 4GIFA 1NU1K 1P84H 2K9YA 1EZVD 3CCUP 1SQXJ 2JP3A 3CWBG 1M8OB 5AW4B 1A02F 1NGMB 3HD7B 3HUSB 1N86A 1M1JC 5AVSB 1N7SA 2ZJSE 4DCKA 4IFMA 1JY2O 1KV4A 1IFNA 2A45G 2ZFCA 1X8YA 3AECC 1RE4C 2HR3A 1DX7A 2KB7P 4DT0A 1NU1G 5K5GB 1SQQD 2GA1A 1LTJA 2IFNA 2O01N 5H2FE 1JMMA 4U3FE 2C0XA 3H1LJ 1YHQP 2KP8A 2KIKA 2NPSA 1T3JA 3AE5C 5GTIE 4R4MA 2WPSA 2XU6A 1USDA 4YTPC 3PJSK 1NVOA 1M1JA 1UIIA 1JTHA 4H13D 3L74G 3CX5H 2LR2A 2LXBA 1NTKE 1NTMD 1KILD 4GKGA 4JYBA 1AA0A 1PPJD 2YMKA 1LWUC 3L71D 2YNYA 1SQPE 2FYUD 3RK2B 1BGYG 2K3RA 3O6QA 1N7SB 1T3UA 5CCGC 2RH0A 1KQFB 1QGKB 2YXRB 5AW0B 2Q7CA 2JWDA 2KI7B 3KQGA 3MP7B 1OX3A 2OYHC 2OTJP 2YO3A 2PGDA 4BWNA 1USEA 3Q2YA 2HLOA 1LTJB 2E75C 5KKZC 2POHA 1RY3A 3KZIE 3PTZA 3CL3D 4I2LC 1ZV8A 2NPSB 2ITAA 3B4SA 3HRNA 3TK1A 4NPDA 1N73C 1M1JB 1HGZA 2Q3IA 3RGUA 1LTBC 1JTHB 3FWLA 4GDOA 2N9BA 4RESB 1RHZB 3CWBD 2OYHA 2W8ZA 4MN4C 1LT1A 2H88C 3L70G 2Y0DA 5B66H 2QJKB 3RL0C 2AEJA 1KB9E 2RN0A 3AE4C 3VMXA 1CW5A 1KORA 3TGUG 1NTMJ 3GLMA 2R5BA 1FZGA 1IZNB 4YXWH 3O6QB 3H1IG 2FYUJ 4HB1A 1JMBA 2LKMA 2E74C 3V2PA 4KHXA 2Z5IA 2ZT9C 2Z5HA 2B9BA 1YQ4C 4UB6E 1L0LJ 1VQLP 3AEGC 3Q1MA 4YPCA 1JNMA 4XA4A 1KFNA 2MJZA 2HFED 1AJYA 1BE3J 3MUDC 2WWWA 3CCEP 4Y99C 2WSCH 4U3FD 1FZCC 2FXPA 2OYHB 1SQXE 2OTKE 4OGQD 2K9JA 1SQXK 1IFMA 2KZIA 1FOSF 2D2CD 3M9HA 2E75B 2QE7H 4TLFA 1EXIA 2A45H 3H1HG 1RF0A 2OARA 1NTKD 2ZYAA 3M0DC 4OH8B 1MUUA 1T6AA 4R4LA 1BCCG 2V7QH 3QH9A 3EFFK 1HJ0A 1YBKA 3MHVA 1S4XA 4LC1A 1SQXG 3BCCJ 2MKVA 1NYHA 3AE3C 3CC4P 1SQPD 2QJPC 3CD6P 1IC2A 1EDKA 3M91A 3GHGB 4RJTA 3RL0B 1EXJA 2OYIC 3ABVC 3A2AA 3C9IA 1NAFA 1ZRTE 3M0DA 1DD4A 3H1LG 1S5LH 2IBZI 4U3FJ 3KXDA 4IOIH 2BEZF 2K9JB 1SQVJ 2QJYC 4GOFA 4L73A 1PZQA 1HJBA 5AVRB 2KSEA 2DW3A 3CXHH 3D6YA 3NMDA 3PH0A 4HJGH 3S9OA 4HH2A 2WSFJ 1XTCC 2M3BA 3P7KA 1KB9D 3V6IA 2K1AA 1GK6A 1SFCD 1T2KD 4M3LA 1SQQK 1EZVG 1EC5A 4NPEA 1VQMP 2ZAEB 2PAJA 3AEDC 5TISH 1SQPJ 4AUWA 1L4AD 4IFDK 1QL1A 2J58A 2W6AA 4ASWA 2N1TC 1RQVA 3W67A 3L36A 3HD7D 1LTSC 1SLQA 5AW3B 1ZXGA 3L37A 3B5NC 4EOTA 4EIJA 3IR9A 1SQQG 1GL2C 3A0HE 1K04A 1WMKA 2Q6QA 1YI2P 3CC7P 1YJNP 2YKQA 2ZYGA 2QJPB 2AEMA 5CCHC 2W90A 3CLQA 1NTMK 2A45I 1EDJA 2FYNB 2E42A 1SFCA 4Z1MH 2FYUK 4UB8H 2WMMA 1QEXA 1JCCA 3WUTA 1KZUB 4PD4H 2KOGA 3R4YA 1L0NJ 1SQXD 5L8RJ 1BSNA 2FFDC 3L73J 1L4AA 2IBZE 1ZR4A 5KJ7C 1KB9H 1L0LE 2FYZA 2P67A 2Q1KA 1YITP 5AW2B 1L0LK 2QG4A 1YJWP 1D7MA 3GF7A 1M1KQ 4U7JA 4DZOA 5CMZA 1NTMG 3SSUA 1S3JA 1DH3A 3PHLA 1PPJG 2KSJA 1HF9A 1BE3E 3L71G 2FY8A 5CCHA 1NKZB 2FYUG 5KLIB 1DD3A 3BRTB 2NZ2A 2QEXP 1W2EA 4UB6H 3ITKA 2P1JA 1L0LG 1IFIA 2W6BA 2FFDA 3C8VA 3SFDC 1H0TA 3USSA 1IO4A 3NTNA 2HODA 2I1JA 5APVA 2AXTE 1BE3G 1VF5D 4I7ZC 4I6MC 2QIWA 1OMIA 1Y8AA 1ZOYC 1ZRTD 2KZJA 3CXHI 3SWYA 1FDOA 1SFCB 4JYCA 3V5BA 5KAIH 2WVRA 3OJAB 1BDCA 3BCCE 1L4AB 1A02J 1EDLA 1GZLA 3II6A 3TSIA 5E79E 4OVNF 1FJPA 2M8RA 1NHLA 2QA4P 3AE6C 1GD2E 1W2BO 1YTZT 2BCCJ 4W7YA 1FDIA 2RMZA 3AEAC 3BCCG 1TU3F 3WU2E 4WB4A 1JCDA 2FFDB 3TDKA 2M0BA 1SQVE 1H0TB 3B71A 1ZP0C 3AEFC 2JR8A 1HWTC 3K5BA 1SQVK 2HODB 2P7JA 1VQ5P 1KYOI 1VQPP 3S4RA 2Y9YA 3FWNA 3HE4A 2XNXA 1J1DC 1IK7A 2C0WA 3AE9C 2H7HA 1HVVA 3LW5J 1RE4A 3AE7C 4GOEA 4WY4C 1NTKK 3GF3A 4U3FG 1J1EC 2WPQA 1SQVG 1IJDB 1NAYA 1SP4A 5CBOA 2FXOA 5CCGD 2M3EA 1K05A 3C1LA 1N7LA 1SQPK 1JO5A 4XFJA 1X9VA 1MZ9A 4EI2A 3PRJA 2W83C 1H88A 3FGAD 2IYOA 4I7ZB 2IBZD 1R5LA 2E75D 1L0LD 2R3SA 1S1CX 1NTKG 1FZBA 5APYA 5AW7B 1VF5B 4Y28J 4GT1A 2W6JH 1H89A 1PP9J 4WY4A 1BE3D 3NXSA 1SQPG 1W5CE 1QL2A 3KPEA 2L91A 2WPVB 2XZRA 5KAFE 1PGOA 1LWUA 4BXLA 1VQ4P 1PIXA 3P32A 2WPRA 3HE4B 5CCGA 1PV3A 1L0NE 5BVZA 5APQA 3A0HH 3L73E 3RL0D 1L0NK 4N3YB 1Y47A 1P84I 2QM8A 2YXQB 3KDPB 1UIXA 3R2PA 1KYOE 4ASVA 2OQQA 4JF7A 3FX0A 2E74D 5B5EE 2E43A 1OFCX 2ZT9D 1L0NG 2Z4EA 3BCCD 4OWFA 2Q3EA 2KLVA 1MFZA 1N73A 3JCUH 1S5LX 2IZ0A 3CCJP 1BDDA 1GTWA 3L4FA 3CI9A 2IZ1A 3EWKA 3CCSP 1LT9C 1RE3C 1FBMA 3VMZA 1KFMA 4IFFA 4IL6X 5GTHE 5C39A 5M1BA 3U1CA 3JSVC 1OIPA 2P2UA 3RL0g 1G1JA 4K35A 1LWUB 3IFMA 1JEKA 4WBAA 3CX5I 1FZAA 1HGVA 2W27A 1LTIC 1SQVD 1URQC 3M0AA 4KJMA 3H32A 2GUVA 1J2JB 1KQSO 2OGUA 1OZHA 5KKZB 2ZYDA 3A0BH 4ZNCA 4ZKPA 1KN7A 1NTZE 2BCCE 1FAVA
chains in the Genus database with same CATH topology
1PGJA 2JKVA 2IZ0A 2IYPA 2IZ1A 2IYOA 2ZYDA 1PGQA 2W8ZA 1NAYA 1PGPA 1OX3A 1AA0A 1PGOA 2PGDA 3FWNA 2ZYGA 1AVYA 2W90A 2ZYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGJ A;  2JKV A;  2IZ0 A;  2IYP A;  2IZ1 A;  2IYO A;  2ZYD A;  1PGQ A;  2W8Z A;  1NAY A;  1PGP A;  1OX3 A;  1AA0 A;  1PGO A;  2PGD A;  3FWN A;  2ZYG A;  1AVY A;  2W90 A;  2ZYA A; 
#chains in the Genus database with same CATH topology
 1EQ7 A;  1HH0 A;  3MUD A;  2LXC B;  3MIW A;  1P84 E;  2KNC A;  1N2D C;  5AW8 B;  3P8M C;  1ZLL A;  1Q90 D;  3RK3 C;  1N73 B;  2M5A A;  5E79 H;  1FZC A;  3AE2 C;  1PGP A;  1VQ8 P;  3Q5R A;  1URQ A;  2IFM A;  1S72 P;  3A7O A;  3H25 A;  4NPF X;  2C9L Y;  4QMA A;  4JQ0 D;  4GOD A;  2FKW B;  1YJ9 P;  3H1J J;  3CCM P;  4H44 C;  3N4X A;  5KLV E;  5H2F H;  1OW6 A;  3H1K J;  1PGJ A;  2Y0C A;  3AEE C;  2L5G B;  4W7Z A;  2E74 B;  2XKM A;  5GTI H;  2E5T A;  1LTA C;  1DEE G;  3H32 B;  2ZT9 B;  2XND H;  1Q81 Q;  4H0L C;  1GMJ A;  3E7K A;  4WWI A;  2WZ7 A;  3D70 A;  1L0N D;  3CX5 E;  3L73 D;  3A3Y B;  3LIE A;  5AW5 B;  1KMI Z;  1E5W A;  2I1K A;  1VQ6 P;  1NJI Q;  1FZF A;  3BAT A;  2OYI A;  1KTM A;  2KNC B;  2Q9I A;  1OW7 A;  2B87 A;  1KYO D;  2M5A B;  4Y99 B;  3O8Z A;  3TF5 A;  1PP9 E;  1FZC B;  2YKO A;  3VP8 A;  4DJG A;  2N1T D;  3RBZ A;  3VP9 A;  1URQ B;  2YIU C;  3V4W A;  3G6E P;  3IF4 A;  1PGQ A;  2E76 C;  1R5S A;  1LP1 A;  1GK4 A;  3B5N D;  2O3J A;  3F5H A;  1VQ9 P;  1GL2 D;  2XV5 A;  3T97 A;  2IX7 C;  3KZI H;  3GG2 A;  4LLH A;  5CCH D;  1YQ3 C;  5DJT B;  2IDB A;  2B88 A;  1VQN P;  1MKM A;  5AW9 B;  2H89 C;  2QVA A;  5AVY B;  3FXE A;  3IAO A;  3M9Q A;  2FBW C;  5KJ7 D;  1VL2 A;  4D6T J;  3ZDM A;  4C46 A;  3HUS C;  1OWA A;  2N1T A;  1KQG B;  3L70 J;  3BAS A;  1RQU A;  2OYI B;  3G9R A;  2WT7 A;  1G2C A;  2I8D A;  1AVY A;  5B66 E;  3TGU J;  2JO1 A;  4H44 B;  2C9N Y;  2KK7 A;  3CME P;  3GW6 A;  2B87 B;  1NKN A;  1GDT A;  2PFX A;  3B5N A;  3EFG A;  3E1I A;  2O01 J;  3H6P A;  1GL2 A;  1NTZ D;  3CCR P;  2BCC D;  3H1I J;  3RBX A;  5AW6 B;  3Q5P A;  1SS1 A;  1GW4 A;  2WSE H;  2QJY B;  4H0L B;  1P84 D;  1DEB A;  1LP1 B;  1GU5 A;  1XTG B;  1E79 H;  5AVX B;  1M56 D;  3U59 A;  4AQR D;  3KHU A;  2IBZ G;  1IK9 A;  2JWA A;  1CZQ A;  3T97 B;  1FOS E;  4EDF A;  5GTH H;  2ZVO B;  1RF1 C;  5KJ7 A;  3KYQ A;  1FJK A;  1JY3 P;  3M06 A;  3VTP C;  3CCQ P;  1QVF O;  4LGD E;  3L72 E;  3CC2 P;  5KLV D;  1SQB E;  2YIU B;  3P8C E;  1AQT A;  3RK2 C;  2E76 B;  4PV1 C;  1Q82 Q;  4C7N A;  2N1T B;  1N7S C;  1JUN A;  2JKV A;  2WQY C;  2P10 A;  1JM0 A;  2WT7 B;  1G2C B;  3CCL P;  2AXC A;  2BAS A;  3A5T A;  2R5D A;  3BVH A;  3B5N B;  1Q86 Q;  1RF1 A;  3CX5 D;  1GL2 B;  2WSS H;  1G1I A;  1NU1 E;  3SWK A;  1NTZ J;  1RH5 B;  4WVZ A;  2IYP A;  3H1J E;  2NPS C;  1M90 Q;  3BRV B;  1HUC A;  2G8Y A;  2YO2 A;  3H1K E;  1PP9 D;  1HTL C;  4L76 A;  2KLU A;  3W68 A;  5AVQ B;  1EDI A;  2YMY A;  4XE5 B;  2GUS A;  2K37 A;  2FXM A;  1K9M Q;  3I5C A;  3L74 E;  1VQO P;  2QJK C;  1FC2 C;  3H1J G;  2J59 M;  3LW5 H;  4WY4 D;  2RKL A;  3H1K G;  4PD4 I;  3F89 A;  4O9B A;  5KLV J;  3RK3 E;  4C7N B;  1S5L E;  2JJL A;  3FXD A;  1KB9 I;  3V2R A;  1H8A A;  1BGY E;  3LID A;  1OW8 A;  5APX A;  4IL6 E;  1Y9B A;  1OXZ A;  1L2P A;  1RF1 B;  2H43 A;  5AVT B;  3GMA A;  5BU8 B;  3CXH E;  4RKU J;  5EFW B;  1JY2 P;  2Y9Z A;  3CPW O;  4H13 C;  1PL5 A;  4KT0 J;  2GM4 A;  1VDF A;  4PV1 B;  3IN6 A;  1KIL C;  4HKZ H;  3NFQ A;  1NWQ A;  5TIS E;  3SWF A;  3VYI A;  1GU4 A;  4RO0 A;  3L75 D;  3PLN A;  3L35 A;  4D6T E;  1SQQ J;  3L70 E;  2OTL P;  1S2E A;  2QM7 A;  3EQ2 A;  3TGU E;  3VN0 A;  3OW2 O;  5BU5 A;  1LNQ A;  2WTY A;  3G71 P;  1FDM A;  3CCV P;  3L72 D;  3D6Z A;  2XDJ A;  1KIL A;  2A06 E;  3H1I E;  4L75 A;  1ZN5 A;  2NRG A;  1SQB D;  1YIJ P;  3P8C D;  3Q5S A;  1T8Z A;  3B8E B;  1X22 A;  4D6T G;  4UB8 E;  2UWJ E;  3GHG C;  4PD4 E;  1JB0 J;  1QVG O;  2J5U A;  3L73 G;  3S1K A;  1KC8 Q;  1J1D B;  2V4H A;  3L71 J;  3WUU A;  2A06 G;  1NU1 D;  4DOJ A;  4WY4 B;  2O1J A;  3WMM 0;  1J1E B;  1FZE A;  3H1J D;  2SPZ A;  4JPZ B;  3PP5 A;  2HG5 D;  3H1K D;  1URQ D;  2ZXE B;  3L75 J;  1KQL A;  1Q2N A;  4B86 A;  3GHG A;  2N9Y B;  3N7N A;  2IPP A;  4PJ0 E;  1YYC A;  4N78 E;  1HBW A;  1FE6 A;  4H13 B;  1RF0 C;  2AEF A;  3I55 P;  2ZVN B;  1EZV I;  2AXT H;  1AFO A;  3H1H E;  1R8E A;  3L74 D;  1OVV A;  5CHX A;  4YXD C;  2KS1 A;  2O1K A;  1LT9 A;  3WUV A;  1JY3 N;  1KIL B;  1RE3 A;  1OVR A;  1U7J A;  1BCC E;  4AYC A;  3L72 J;  1LGH B;  2K88 A;  3RK3 D;  1SQB J;  4ZKU A;  1NTZ K;  1QLE D;  5KAI E;  3HE5 A;  2WSC J;  1K8A Q;  5KTB A;  5CBN A;  3Q3D A;  1BGY D;  1K73 Q;  3CWB J;  1AQ5 A;  5APU A;  4CPG A;  4OGQ C;  1NO4 A;  1SVF A;  3UIA A;  1ZR2 A;  2D2C C;  1X79 B;  3V2Q A;  1QX8 A;  3CXH D;  2OYO A;  1DIP A;  5AW1 B;  2YKP A;  5DJU B;  3D71 A;  4H44 D;  1S9K E;  1NTZ G;  2BCC G;  2KXP B;  1NU1 J;  1Q7Y Q;  3AE8 C;  4HYT B;  3H1L E;  2V7Q J;  3MTU E;  1FU1 A;  3WU2 H;  4L74 A;  2FYN C;  1AV1 A;  1LTG C;  5KLV K;  4H0L D;  1IFJ A;  4BRY A;  1ZME C;  3G3Z A;  4N6J A;  1PFI A;  2H8P D;  2B89 A;  3MD0 A;  3TYY A;  3V2N A;  5APS A;  4D6T D;  1NH4 A;  2KS1 B;  1LT9 B;  4I1L A;  3L74 J;  3L70 D;  1MV8 A;  1N8R Q;  1Z56 A;  4A7P A;  4EYY Q;  1M57 D;  2WSF H;  3TGU D;  5KLV G;  3HE5 B;  5TJH A;  1YTZ I;  1IFD A;  2E5Y A;  5KLI C;  1EZV E;  1AVO A;  2A06 D;  3H1I D;  4IL6 H;  2PRR A;  1BGY J;  2E76 D;  5APW A;  2JDI H;  3CMA P;  2P58 A;  1WT6 A;  1KD1 Q;  3QWO C;  4PD4 D;  3V4Q A;  5AVZ B;  1NTK J;  3TNU A;  3MGN A;  2JEE A;  5CJ4 A;  1JY2 N;  2Y0E A;  3G4S P;  1SQQ E;  2CPB A;  3OA7 A;  2KUB A;  1LTT C;  1T2K C;  1PP9 G;  1SFC C;  1CSB A;  2R3C A;  1X0T A;  4BRY B;  2WIT A;  3HTK A;  5KAF H;  3RK3 B;  2CK3 H;  1U57 A;  2PP6 A;  1VQK P;  4OGQ B;  1L4A C;  1WRG A;  2R32 A;  2D2C B;  2HPC A;  4ZMD A;  2G3A A;  4N78 D;  3HD7 C;  1GW3 A;  1JY3 O;  3VMA A;  3AEB C;  1NOH A;  1NTM E;  3H1H D;  1CI6 A;  2O01 H;  1KIL E;  5AVU B;  1PPJ E;  1KYO H;  3L71 E;  2ZXX A;  2FYU E;  1BCC D;  4K3A A;  5B5E H;  3JC2 2;  2KYV A;  3U1A A;  3VMY A;  1IFP A;  1FS0 E;  3SFE C;  1U7M A;  2QSI A;  3MZW B;  3L75 E;  3TNU B;  3JCU E;  5AVV B;  1M7L A;  3HD7 A;  3HUS A;  5AVW B;  2R44 A;  5APT A;  4TT3 H;  1VPC A;  2QRX A;  1S9K D;  3HTK B;  4W80 A;  3VOP A;  2WSE J;  3RK2 D;  2VRS A;  4PV1 D;  3H1L D;  1N7S D;  2HPC B;  1OVU A;  3L75 G;  4PJ0 H;  1SQB K;  1VQ7 P;  1ZW0 A;  1BSH A;  1JOC A;  3CWB E;  4C7R A;  2BEQ D;  1LJ2 A;  3AE1 C;  2CPS A;  5CJ0 A;  3I56 P;  3M9B A;  1CI6 B;  3E1R A;  2Q5U A;  3H1H J;  3A0B E;  1VF5 C;  2NPS D;  1LTJ C;  1MFT A;  3L72 G;  1SQB G;  1BCC J;  4JBZ A;  2HYN A;  3OAK A;  4GIF A;  1NU1 K;  1P84 H;  2K9Y A;  1EZV D;  3CCU P;  1SQX J;  2JP3 A;  3CWB G;  1M8O B;  5AW4 B;  1A02 F;  1NGM B;  3HD7 B;  3HUS B;  1N86 A;  1M1J C;  5AVS B;  1N7S A;  2ZJS E;  4DCK A;  4IFM A;  1JY2 O;  1KV4 A;  1IFN A;  2A45 G;  2ZFC A;  1X8Y A;  3AEC C;  1RE4 C;  2HR3 A;  1DX7 A;  2KB7 P;  4DT0 A;  1NU1 G;  5K5G B;  1SQQ D;  2GA1 A;  1LTJ A;  2IFN A;  2O01 N;  5H2F E;  1JMM A;  4U3F E;  2C0X A;  3H1L J;  1YHQ P;  2KP8 A;  2KIK A;  2NPS A;  1T3J A;  3AE5 C;  5GTI E;  4R4M A;  2WPS A;  2XU6 A;  1USD A;  4YTP C;  3PJS K;  1NVO A;  1M1J A;  1UII A;  1JTH A;  4H13 D;  3L74 G;  3CX5 H;  2LR2 A;  2LXB A;  1NTK E;  1NTM D;  1KIL D;  4GKG A;  4JYB A;  1AA0 A;  1PPJ D;  2YMK A;  1LWU C;  3L71 D;  2YNY A;  1SQP E;  2FYU D;  3RK2 B;  1BGY G;  2K3R A;  3O6Q A;  1N7S B;  1T3U A;  5CCG C;  2RH0 A;  1KQF B;  1QGK B;  2YXR B;  5AW0 B;  2Q7C A;  2JWD A;  2KI7 B;  3KQG A;  3MP7 B;  1OX3 A;  2OYH C;  2OTJ P;  2YO3 A;  2PGD A;  4BWN A;  1USE A;  3Q2Y A;  2HLO A;  1LTJ B;  2E75 C;  5KKZ C;  2POH A;  1RY3 A;  3KZI E;  3PTZ A;  3CL3 D;  4I2L C;  1ZV8 A;  2NPS B;  2ITA A;  3B4S A;  3HRN A;  3TK1 A;  4NPD A;  1N73 C;  1M1J B;  1HGZ A;  2Q3I A;  3RGU A;  1LTB C;  1JTH B;  3FWL A;  4GDO A;  2N9B A;  4RES B;  1RHZ B;  3CWB D;  2OYH A;  2W8Z A;  4MN4 C;  1LT1 A;  2H88 C;  3L70 G;  2Y0D A;  5B66 H;  2QJK B;  3RL0 C;  2AEJ A;  1KB9 E;  2RN0 A;  3AE4 C;  3VMX A;  1CW5 A;  1KOR A;  3TGU G;  1NTM J;  3GLM A;  2R5B A;  1FZG A;  1IZN B;  4YXW H;  3O6Q B;  3H1I G;  2FYU J;  4HB1 A;  1JMB A;  2LKM A;  2E74 C;  3V2P A;  4KHX A;  2Z5I A;  2ZT9 C;  2Z5H A;  2B9B A;  1YQ4 C;  4UB6 E;  1L0L J;  1VQL P;  3AEG C;  3Q1M A;  4YPC A;  1JNM A;  4XA4 A;  1KFN A;  2MJZ A;  2HFE D;  1AJY A;  1BE3 J;  3MUD C;  2WWW A;  3CCE P;  4Y99 C;  2WSC H;  4U3F D;  1FZC C;  2FXP A;  2OYH B;  1SQX E;  2OTK E;  4OGQ D;  2K9J A;  1SQX K;  1IFM A;  2KZI A;  1FOS F;  2D2C D;  3M9H A;  2E75 B;  2QE7 H;  4TLF A;  1EXI A;  2A45 H;  3H1H G;  1RF0 A;  2OAR A;  1NTK D;  2ZYA A;  3M0D C;  4OH8 B;  1MUU A;  1T6A A;  4R4L A;  1BCC G;  2V7Q H;  3QH9 A;  3EFF K;  1HJ0 A;  1YBK A;  3MHV A;  1S4X A;  4LC1 A;  1SQX G;  3BCC J;  2MKV A;  1NYH A;  3AE3 C;  3CC4 P;  1SQP D;  2QJP C;  3CD6 P;  1IC2 A;  1EDK A;  3M91 A;  3GHG B;  4RJT A;  3RL0 B;  1EXJ A;  2OYI C;  3ABV C;  3A2A A;  3C9I A;  1NAF A;  1ZRT E;  3M0D A;  1DD4 A;  3H1L G;  1S5L H;  2IBZ I;  4U3F J;  3KXD A;  4IOI H;  2BEZ F;  2K9J B;  1SQV J;  2QJY C;  4GOF A;  4L73 A;  1PZQ A;  1HJB A;  5AVR B;  2KSE A;  2DW3 A;  3CXH H;  3D6Y A;  3NMD A;  3PH0 A;  4HJG H;  3S9O A;  4HH2 A;  2WSF J;  1XTC C;  2M3B A;  3P7K A;  1KB9 D;  3V6I A;  2K1A A;  1GK6 A;  1SFC D;  1T2K D;  4M3L A;  1SQQ K;  1EZV G;  1EC5 A;  4NPE A;  1VQM P;  2ZAE B;  2PAJ A;  3AED C;  5TIS H;  1SQP J;  4AUW A;  1L4A D;  4IFD K;  1QL1 A;  2J58 A;  2W6A A;  4ASW A;  2N1T C;  1RQV A;  3W67 A;  3L36 A;  3HD7 D;  1LTS C;  1SLQ A;  5AW3 B;  1ZXG A;  3L37 A;  3B5N C;  4EOT A;  4EIJ A;  3IR9 A;  1SQQ G;  1GL2 C;  3A0H E;  1K04 A;  1WMK A;  2Q6Q A;  1YI2 P;  3CC7 P;  1YJN P;  2YKQ A;  2ZYG A;  2QJP B;  2AEM A;  5CCH C;  2W90 A;  3CLQ A;  1NTM K;  2A45 I;  1EDJ A;  2FYN B;  2E42 A;  1SFC A;  4Z1M H;  2FYU K;  4UB8 H;  2WMM A;  1QEX A;  1JCC A;  3WUT A;  1KZU B;  4PD4 H;  2KOG A;  3R4Y A;  1L0N J;  1SQX D;  5L8R J;  1BSN A;  2FFD C;  3L73 J;  1L4A A;  2IBZ E;  1ZR4 A;  5KJ7 C;  1KB9 H;  1L0L E;  2FYZ A;  2P67 A;  2Q1K A;  1YIT P;  5AW2 B;  1L0L K;  2QG4 A;  1YJW P;  1D7M A;  3GF7 A;  1M1K Q;  4U7J A;  4DZO A;  5CMZ A;  1NTM G;  3SSU A;  1S3J A;  1DH3 A;  3PHL A;  1PPJ G;  2KSJ A;  1HF9 A;  1BE3 E;  3L71 G;  2FY8 A;  5CCH A;  1NKZ B;  2FYU G;  5KLI B;  1DD3 A;  3BRT B;  2NZ2 A;  2QEX P;  1W2E A;  4UB6 H;  3ITK A;  2P1J A;  1L0L G;  1IFI A;  2W6B A;  2FFD A;  3C8V A;  3SFD C;  1H0T A;  3USS A;  1IO4 A;  3NTN A;  2HOD A;  2I1J A;  5APV A;  2AXT E;  1BE3 G;  1VF5 D;  4I7Z C;  4I6M C;  2QIW A;  1OMI A;  1Y8A A;  1ZOY C;  1ZRT D;  2KZJ A;  3CXH I;  3SWY A;  1FDO A;  1SFC B;  4JYC A;  3V5B A;  5KAI H;  2WVR A;  3OJA B;  1BDC A;  3BCC E;  1L4A B;  1A02 J;  1EDL A;  1GZL A;  3II6 A;  3TSI A;  5E79 E;  4OVN F;  1FJP A;  2M8R A;  1NHL A;  2QA4 P;  3AE6 C;  1GD2 E;  1W2B O;  1YTZ T;  2BCC J;  4W7Y A;  1FDI A;  2RMZ A;  3AEA C;  3BCC G;  1TU3 F;  3WU2 E;  4WB4 A;  1JCD A;  2FFD B;  3TDK A;  2M0B A;  1SQV E;  1H0T B;  3B71 A;  1ZP0 C;  3AEF C;  2JR8 A;  1HWT C;  3K5B A;  1SQV K;  2HOD B;  2P7J A;  1VQ5 P;  1KYO I;  1VQP P;  3S4R A;  2Y9Y A;  3FWN A;  3HE4 A;  2XNX A;  1J1D C;  1IK7 A;  2C0W A;  3AE9 C;  2H7H A;  1HVV A;  3LW5 J;  1RE4 A;  3AE7 C;  4GOE A;  4WY4 C;  1NTK K;  3GF3 A;  4U3F G;  1J1E C;  2WPQ A;  1SQV G;  1IJD B;  1NAY A;  1SP4 A;  5CBO A;  2FXO A;  5CCG D;  2M3E A;  1K05 A;  3C1L A;  1N7L A;  1SQP K;  1JO5 A;  4XFJ A;  1X9V A;  1MZ9 A;  4EI2 A;  3PRJ A;  2W83 C;  1H88 A;  3FGA D;  2IYO A;  4I7Z B;  2IBZ D;  1R5L A;  2E75 D;  1L0L D;  2R3S A;  1S1C X;  1NTK G;  1FZB A;  5APY A;  5AW7 B;  1VF5 B;  4Y28 J;  4GT1 A;  2W6J H;  1H89 A;  1PP9 J;  4WY4 A;  1BE3 D;  3NXS A;  1SQP G;  1W5C E;  1QL2 A;  3KPE A;  2L91 A;  2WPV B;  2XZR A;  5KAF E;  1PGO A;  1LWU A;  4BXL A;  1VQ4 P;  1PIX A;  3P32 A;  2WPR A;  3HE4 B;  5CCG A;  1PV3 A;  1L0N E;  5BVZ A;  5APQ A;  3A0H H;  3L73 E;  3RL0 D;  1L0N K;  4N3Y B;  1Y47 A;  1P84 I;  2QM8 A;  2YXQ B;  3KDP B;  1UIX A;  3R2P A;  1KYO E;  4ASV A;  2OQQ A;  4JF7 A;  3FX0 A;  2E74 D;  5B5E E;  2E43 A;  1OFC X;  2ZT9 D;  1L0N G;  2Z4E A;  3BCC D;  4OWF A;  2Q3E A;  2KLV A;  1MFZ A;  1N73 A;  3JCU H;  1S5L X;  2IZ0 A;  3CCJ P;  1BDD A;  1GTW A;  3L4F A;  3CI9 A;  2IZ1 A;  3EWK A;  3CCS P;  1LT9 C;  1RE3 C;  1FBM A;  3VMZ A;  1KFM A;  4IFF A;  4IL6 X;  5GTH E;  5C39 A;  5M1B A;  3U1C A;  3JSV C;  1OIP A;  2P2U A;  3RL0 g;  1G1J A;  4K35 A;  1LWU B;  3IFM A;  1JEK A;  4WBA A;  3CX5 I;  1FZA A;  1HGV A;  2W27 A;  1LTI C;  1SQV D;  1URQ C;  3M0A A;  4KJM A;  3H32 A;  2GUV A;  1J2J B;  1KQS O;  2OGU A;  1OZH A;  5KKZ B;  2ZYD A;  3A0B H;  4ZNC A;  4ZKP A;  1KN7 A;  1NTZ E;  2BCC E;  1FAV A; 
#chains in the Genus database with same CATH homology
 1PGJ A;  2JKV A;  2IZ0 A;  2IYP A;  2IZ1 A;  2IYO A;  2ZYD A;  1PGQ A;  2W8Z A;  1NAY A;  1PGP A;  1OX3 A;  1AA0 A;  1PGO A;  2PGD A;  3FWN A;  2ZYG A;  1AVY A;  2W90 A;  2ZYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...