1SQPG

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqpG00
1SQPG 2BCCG 1NTMG 4PD4H 3L70G 3H1HG 3TGUG 5KLVG 2FYUG 3H1LG 1SQBG 1BGYG 3L72G 3CXHH 2A06G 4D6TG 1BCCG 1NTZG 3CWBG 3L73G 1PPJG 1SQVG 2IBZG 3L74G 3CX5H 1SQQG 1KYOH 1P84H 1KB9H 1NU1G 1L0NG 3H1KG 1BE3G 3H1JG 3H1IG 3BCCG 4U3FG 3L71G 1EZVG 1NTKG 1PP9G 1SQXG 3L75G 1L0LG
chains in the Genus database with same CATH superfamily
2QJPC 5TISH 2A45G 3EFGA 2L5GB 3L70G 4H0LB 1VDFA 2GUSA 2Z4EA 3H1HE 3IAOA 4H0LC 1GU5A 1VQNP 1HH0A 3WU2E 2I1KA 5APSA 1LJ2A 3BCCG 3L71G 2B87B 4PD4D 1S9KE 2ZAEB 1L4AB 3BASA 1GDTA 5B66E 1RY3A 2E74B 1EZVD 2QM8A 1A02J 2W83C 1VQLP 3TNUA 1L4AC 3CCSP 3SWFA 3A3YB 1Q82Q 3OW2O 2WSEH 2WWWA 1SS1A 2E74C 1M57D 2FYNB 2IBZE 2LXCB 1U7MA 1AVOA 2FXMA 2AEJA 2N9BA 3OAKA 2QE7H 3G6EP 2BASA 2FYNC 2V4HA 2FKWB 4H0LD 4H44B 3EWKA 4UB6E 5APVA 3SSUA 2A06D 2E75B 3HE5A 2XDJA 4WBAA 1JMBA 4H44C 2ZYDA 3TNUB 1SQPG 1KQSO 1FZEA 3AE8C 2E75C 4HJGH 2HFED 5CHXA 1XTCC 2E74D 5APXA 3O8ZA 3B8EB 3RK2B 3P8CE 1FDMA 1IZNB 2I8DA 4WWIA 1JCCA 2KNCB 1KYOI 3CPWO 3AE5C 3Q5PA 1Q86Q 1RQUA 5AVXB 3RK2C 2AXCA 1SP4A 4C7NB 4L74A 4QMAA 3GHGA 1OW8A 4H44D 2Q1KA 1IFMA 3WU2H 2R5BA 5APYA 1T8ZA 3L72J 2RN0A 2WPVB 3CWBJ 3H1LG 5B66H 2QA4P 4IFDK 3KXDA 4PD4I 2M0BA 1NTKE 2Z5IA 3SWYA 1EQ7A 1EZVI 1K04A 3N7NA 2IZ0A 3GHGB 1GD2E 3LIEA 2NZ2A 1MUUA 2KLVA 4WB4A 2KYVA 5AW1B 3GHGC 1S3JA 1W2EA 4UB6H 2WSCH 5KJ7C 5AVVB 5KLVJ 2WSEJ 1BGYJ 1JO5A 3FX0A 1L0NE 1YJ9P 4N6JA 1IFNA 3EFFK 2KLUA 2KZJA 2ZYAA 2YKOA 1NTMK 1NHLA 3F5HA 2ZXXA 3L72D 2Y9YA 3GW6A 3CWBD 1YTZI 1LTIC 3IR9A 1FOSE 2PFXA 1NTKK 5CJ4A 1KYOE 2C9NY 1L0LD 4R4LA 1BSNA 3QH9A 5KJ7D 1FZGA 3CCJP 2RKLA 1MV8A 1N7SD 2YMKA 3V6IA 2N9YB 1KN7A 1KZUB 1NTMG 5AVQB 4ASVA 1E79H 1QVGO 4H13D 3KDPB 3BATA 2Y0DA 3L73G 1HBWA 2K9JB 2WT7A 2QRXA 1R5LA 1VQ5P 5KLVD 3KPEA 3HD7A 5C39A 3VP9A 4KJMA 3H1HJ 1NTKG 4IFMA 1G1JA 1BCCG 4MN4C 5AW2B 3B5NA 2AXTE 1EZVE 4GT1A 4EI2A 1N8RQ 1PZQA 3L75J 4EDFA 2WT7B 5CBOA 1VQ8P 5DJUB 1SLQA 3A5TA 4HB1A 3HD7C 3B5NB 2A06E 2BEQD 2HYNA 1URQA 4CPGA 3M9HA 2WSCJ 1IC2A 1NTZJ 1UIXA 1M1JB 1QL2A 2M3EA 3B5NC 5AVRB 2FY8A 3V4QA 3II6A 1M1JC 3H1HD 2YKQA 3B71A 1SVFA 2MJZA 4C46A 3W67A 2P7JA 5GTIE 1NU1K 2QSIA 3VN0A 1URQB 1W5CE 3L75D 1NWQA 4UB8E 3VMZA 2R5DA 3H32A 1URQC 2KI7B 1RE4C 2IBZD 3V2NA 3B5ND 3RBXA 2M5AA 1JY3N 2UWJE 5AW6B 3MIWA 1JMMA 1FZBA 2WTYA 2AXTH 3CXHI 3HE4A 3VYIA 1JM0A 5KTBA 2YMYA 1PP9J 4I6MC 1N2DC 1NTZD 2YNYA 1EZVG 5AW3B 2O01N 3H32B 2IPPA 2V7QH 2IDBA 3CCVP 3S4RA 2QM7A 1URQD 2M5AB 1K9MQ 2IYOA 3TSIA 1GU4A 3P8CD 4YXWH 3R2PA 1SQVK 3HE4B 2Y9ZA 4GOEA 3CX5D 1QX8A 1IFJA 1L0NJ 1KILA 2C0WA 2QJYB 3RL0g 4JYCA 2K3RA 1SQBE 2W6BA 3L72E 1OXZA 3GLMA 3L74E 2QJYC 1OX3A 5GTIH 3H1KE 3M06A 1DIPA 1SQVG 3NXSA 1PP9D 3H1JJ 1L0LE 4UB8H 1Z56A 1OW6A 3HUSA 1AQTA 1FZCA 3M0AA 1PGQA 4N3YB 1KILB 1ZMEC 3WMM0 2GA1A 3C1LA 3WUUA 2IBZI 4DCKA 3P8MC 1KILC 1GL2D 4JBZA 5KLVE 3H1IG 1USDA 2W27A 3CXHE 4IL6H 1FZCB 1L0ND 2ITAA 3VOPA 2KK7A 3BVHA 1NOHA 3FXDA 3PH0A 1FZCC 1KQFB 1YTZT 1Y8AA 2JO1A 2XKMA 3AEGC 3CLQA 3H1JD 4N78E 2IFNA 4JF7A 3L36A 1G2CA 2POHA 2H89C 3CX5I 3JCUE 2R32A 1RF0C 1RF1A 2OYHA 1FZAA 2Q3EA 1NKNA 1OVVA 1R8EA 3L72G 4XFJA 3CWBG 4OGQB 5AW9B 3AEFC 2ZXEB 2JKVA 5EFWB 2M8RA 1H8AA 1BE3G 4OGQC 3ABVC 2QEXP 2N1TD 1G2CB 1SQQK 1KQLA 3V2PA 3H6PA 3JSVC 3SFDC 1RF1B 2WMMA 2OYHB 3A7OA 5KAIE 3SWKA 1K73Q 3WUVA 4HYTB 1KB9H 3L75E 1FAVA 1SQPK 4U7JA 3TGUE 2FYUK 1RF1C 2OYHC 1AFOA 3PHLA 2RH0A 1GMJA 1TU3F 4GOFA 1JB0J 1BGYG 3CXHH 2OYOA 1IFPA 1SQQG 2B88A 2K37A 2QIWA 2P2UA 3HRNA 3E7KA 4D6TE 3PTZA 1NTZE 4EIJA 2HG5D 2JWAA 1BSHA 1PGPA 3W68A 2FYUG 3AE1C 3IF4A 1PGJA 1GW4A 3D70A 3TDKA 1L4AD 1RE3A 4XA4A 3CCEP 2CPBA 3JCUH 1DH3A 2QVAA 1LNQA 3VTPC 1ZP0C 3K5BA 3HE5B 1X79B 3CX5E 3NMDA 1T3JA 2QG4A 3MHVA 1R5SA 1EC5A 4W80A 1YYCA 2OARA 5K5GB 1KC8Q 5BU5A 3RBZA 2AEMA 1SQBJ 2XV5A 2E75D 1NO4A 3H1HG 3L74J 1RE3C 5KAIH 4YPCA 1PP9E 3BRVB 3H1KJ 1QVFO 1NGMB 4GIFA 2WVRA 1J1EB 1L0LJ 2WITA 3L70J 1LTGC 3L75G 1HGZA 3RK2D 1GK6A 2ZT9C 1AVYA 1J1EC 4U3FE 2IZ1A 2IBZG 1HJ0A 3L4FA 2ZJSE 4IL6X 2FXPA 3CMAP 2Q9IA 1PFIA 1HVVA 3UIAA 1RQVA 3D6ZA 3I5CA 2DW3A 1ZV8A 1NTZG 4GDOA 3CCQP 5E79H 3IN6A 2OGUA 1SQBD 3CCRP 2HPCA 3KQGA 1N86A 3L74D 5CCGA 4W7ZA 3E1RA 1KQGB 2OYIA 5AW0B 1FE6A 1KILE 3H1KD 3H1JE 5AVTB 3OJAB 3CX5H 4M3LA 1SFCA 3VP8A 3L70D 2ZFCA 3EQ2A 1FZFA 3MUDA 2J58A 5APQA 3M9BA 1KTMA 1LTSC 1BDDA 1QEXA 1H0TA 3CMEP 1N73A 1KB9D 5APUA 1W2BO 1PL5A 5BU8B 5CCGC 1JEKA 1SFCB 2R3SA 1PP9G 2OYIC 1HJBA 1USEA 1FS0E 3CXHD 1L0NK 4WY4A 1OW7A 4YTPC 2YXRB 1SFCC 3V2RA 3I55P 1SQXE 2O1JA 1DD4A 2AEFA 1H0TB 1FU1A 2M3BA 1VPCA 3MUDC 1N73B 3A0BE 2MKVA 5H2FH 3SFEC 2NPSA 3TGUJ 3CCMP 3TK1A 3M91A 1JY2N 3HD7B 1JCDA 4KHXA 4N78D 1N73C 1KD1Q 2HLOA 4PV1B 3KHUA 1U57A 3CCLP 3GF3A 4WY4B 3MTUE 4OWFA 1L0NG 3PLNA 2IFMA 3S9OA 4KT0J 4PV1C 4LC1A 4D6TJ 4WY4C 5L8RJ 4NPFX 1CSBA 2NPSB 3PRJA 1NAYA 1VF5B 4NPDA 1NYHA 2NPSC 2YKPA 3AECC 3CC4P 1VF5C 2C0XA 1VQPP 4DJGA 2JWDA 1JOCA 4I2LC 1KMIZ 1NAFA 3GF7A 2KS1A 3QWOC 3A2AA 3HD7D 3Q2YA 5KKZB 4PV1D 3TGUD 3LIDA 5CCHA 2IYPA 4W7YA 1KB9I 1X8YA 2PGDA 1IO4A 5KKZC 2WSSH 1KFMA 1VL2A 4ZMDA 2W90A 2P10A 2NPSD 1LP1A 1VF5D 4D6TD 2CPSA 1NTMJ 5AVYB 3A0BH 1LTAC 1EDLA 5CMZA 5AVUB 3L73J 4IL6E 3CCUP 3VMYA 3AE2C 3C8VA 1Q7YQ 1HGVA 2XZRA 4U3FJ 1ZN5A 1X22A 3KYQA 3AE3C 5APWA 4DZOA 4C7RA 3G71P 1NVOA 4LGDE 1BCCJ 4OH8B 1KORA 1Y47A 1X0TA 1VQOP 1M90Q 2A06G 2RMZA 2Y0CA 3USSA 3AEAC 2JP3A 5AW8B 1LTTC 2FFDA 1PPJE 1X9VA 1LT9A 2KSJA 2P1JA 1S5LE 1YJWP 2O01H 1Q81Q 1YQ4C 3L37A 1PGOA 2YO3A 1AJYA 1N7LA 1NTMD 3L70E 2R3CA 5AVSB 1BDCA 3L73D 1ZW0A 1JY2O 1PV3A 2YIUB 1MFTA 1S72P 4OVNF 3P32A 4U3FD 1P84D 3L71E 1KB9E 2KSEA 1GK4A 2YIUC 2FFDC 1OZHA 1BCCD 3CD6P 2CK3H 1UIIA 5GTHH 1MKMA 3HUSB 1M8OB 2B89A 3G4SP 2G8YA 4EOTA 1FOSF 2J59M 3AE6C 1JUNA 1SQBK 3HUSC 1SQXJ 2PP6A 2BCCJ 1K8AQ 2D2CB 4BRYA 2HODA 1KILD 1WRGA 1NU1J 1U7JA 2D2CC 1L0LK 1ZOYC 2FBWC 1J2JB 2ZVNB 1QL1A 3VMAA 1IK7A 1JY3O 2LR2A 1S5LH 2WPQA 1SQBG 3RGUA 3L74G 3MGNA 4BRYB 1ZLLA 5CBNA 2B87A 2HODB 5KLVK 2A45H 1QGKB 3A0HE 3H1KG 5AW5B 5APTA 1RHZB 1LGHB 2E43A 1L0LG 4R4MA 4GKGA 1EDIA 1Q2NA 2D2CD 2O01J 1SQXD 2BCCD 2K88A 1H89A 3H1LE 1P84I 4RO0A 1JNMA 1NU1D 2P58A 1SQVJ 5KLVG 2H7HA 1FDOA 1T3UA 1E5WA 2K1AA 2E5YA 2KZIA 4ASWA 4OGQD 2W8ZA 3M0DA 1OWAA 4JYBA 4RESB 4PJ0E 4AYCA 3PJSK 1AA0A 2KNCA 4Z1MH 4ZKUA 5E79E 3H1IJ 2J5UA 1A02F 3Q3DA 2K9YA 3AEDC 1FBMA 1VQ7P 1H88A 1WMKA 2WSFH 5AW4B 4C7NA 1YIJP 1FJKA 3VMXA 2PRRA 3U59A 3V2QA 2HR3A 3U1CA 1DEEG 2LKMA 1RH5B 5KAFE 1IK9A 3M0DC 1EXIA 3A0HH 2KXPB 1SQVD 1LTJA 1LWUA 3E1IA 3TYYA 3TF5A 2XU6A 1ZRTD 5DJTB 5AW7B 2G3AA 4WVZA 1AQ5A 1NTME 3GG2A 2ZT9B 3OA7A 3L73E 1NTZK 4I7ZB 5KJ7A 3FGAD 2KP8A 1N7SA 1D7MA 3Q5RA 3D6YA 3TGUG 2WPSA 1CI6A 1OVRA 1LTJB 3AEBC 3H1ID 4NPEA 1LWUB 1M7LA 4I7ZC 1P84E 1BE3J 3BCCJ 1GTWA 3C9IA 3L71J 4ZKPA 1BCCE 1LTJC 3KZIE 3M9QA 1LWUC 5H2FE 3LW5H 1EXJA 2E76B 4DT0A 2Z5HA 2JJLA 4PJ0H 4D6TG 4RKUJ 3HTKA 1N7SB 2E76C 1HF9A 1CI6B 3IFMA 1PIXA 1NKZB 4H13B 1N7SC 2OTLP 1CW5A 1PPJD 2JR8A 2ZYGA 3Q5SA 1J1DB 2ZT9D 2C9LY 3FWNA 1Q90D 1YBKA 4EYYQ 2LXBA 1SQQJ 4H13C 4GODA 1S5LX 1J1DC 1S2EA 4HH2A 4Y28J 1ZR4A 1IFIA 3HTKB 3WUTA 5KAFH 1SQPJ 2FYUJ 1L2PA 2K9JA 3RK3B 4YXDC 3FXEA 1K05A 2OQQA 1BE3D 2E76D 2WSFJ 1ZXGA 2HPCB 5CJ0A 3AE9C 3BCCD 2QJKB 3L71D 3RK3C 1YHQP 2OYIB 3GMAA 3CC2P 2OTJP 1FDIA 2WZ7A 2QJKC 2GM4A 1HWTC 2NRGA 2B9BA 1JTHA 2SPZA 5AVWB 1KFNA 4BWNA 5TJHA 2KB7P 1P84H 3AE4C 2BCCE 1VQ9P 1BGYD 4U3FG 3KZIH 2Y0EA 1SQQD 3H1LJ 4ZNCA 4PD4E 1NU1E 1LTBC 4L73A 4TLFA 4TT3H 3R4YA 3RK3D 4JPZB 2YO2A 1JTHB 2FYZA 1SQPD 4K3AA 3V4WA 2OTKE 2FYUD 5CCGD 2P67A 1M1JA 1OVUA 5B5EE 3LW5J 2BEZF 1AV1A 3RL0B 1SFCD 2Q7CA 1HTLC 1LT1A 1S4XA 3RL0C 3B4SA 3S1KA 3H1JG 4XE5B 1RE4A 2A45I 3MD0A 4L76A 2WPRA 1XTGB 3D71A 1CZQA 2W6JH 2Q5UA 1SQXK 4O9BA 1KYOH 3JC22 3CI9A 3CL3D 3H1LD 1VQMP 2JDIH 1SQVE 2H43A 4WY4D 1S9KD 5AVZB 1GZLA 2W6AA 3H25A 1NJIQ 1ZRTE 1OFCX 3N4XA 1M1KQ 3RL0D 1FJPA 2ZVOB 2L91A 2KS1B 1MFZA 1EDJA 2VRSA 2XNDH 1SQXG 1YQ3C 2BCCG 3P7KA 4PD4H 5GTHE 1VQKP 3ITKA 2O1KA 2PAJA 3BRTB 2XNXA 3H1IE 3F89A 3NTNA 1VQ4P 3I56P 1NU1G 5CCHC 4B86A 4HKZH 1NTKJ 1GL2A 3MZWB 2FXOA 5B5EH 2I1JA 2R44A 1LP1B 3AE7C 2E5TA 2YXQB 3T97A 5M1BA 4DOJA 4A7PA 1GW3A 1T6AA 1GL2B 3U1AA 3G3ZA 1JY2P 2KOGA 1DEBA 5CCHD 1IJDB 3G9RA 1GL2C 1OMIA 3O6QA 2WQYC 1EDKA 4IOIH 3CWBE 4K35A 5KLIB 5TISE 2KUBA 3T97B 1NH4A 4I1LA 1BE3E 2FFDB 1VQ6P 5KLIC 3BCCE 1LT9B 1Y9BA 1NTKD 1WT6A 1HUCA 2KIKA 2GUVA 3L35A 3Q1MA 4JQ0D 4AQRD 1LT9C 1YJNP 2O3JA 2Q6QA 3O6QB 2N1TA 4RJTA 3MP7B 4L75A 1YI2P 2IX7C 4LLHA 3CC7P 4Y99B 2Q3IA 1BGYE 1G1IA 2JEEA 1T2KC 1RF0A 1SQQE 4Y99C 3RK3E 3PP5A 1JY3P 1KV4A 4BXLA 3FWLA 1DX7A 1M56D 2N1TB 1SQPE 3V5BA 2FYUE 3ZDMA 1MZ9A 1FC2C 1S1CX 2H8PD 2N1TC 4IFFA 1YITP 3NFQA 5BVZA 1QLED 2V7QJ 1PPJG 1KYOD 1IFDA 2E42A 2QJPB 1T2KD 4AUWA 1L4AA 2H88C 1DD3A 1ZR2A 1OIPA 3AEEC
chains in the Genus database with same CATH topology
1SQPG 2BCCG 1NTMG 4PD4H 3L70G 3H1HG 3TGUG 5KLVG 2FYUG 3H1LG 1SQBG 1BGYG 3L72G 3CXHH 2A06G 4D6TG 1BCCG 1NTZG 3CWBG 3L73G 1PPJG 1SQVG 2IBZG 3L74G 3CX5H 1SQQG 1KYOH 1P84H 1KB9H 1NU1G 1L0NG 3H1KG 1BE3G 3H1JG 3H1IG 3BCCG 4U3FG 3L71G 1EZVG 1NTKG 1PP9G 1SQXG 3L75G 1L0LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP G;  2BCC G;  1NTM G;  4PD4 H;  3L70 G;  3H1H G;  3TGU G;  5KLV G;  2FYU G;  3H1L G;  1SQB G;  1BGY G;  3L72 G;  3CXH H;  2A06 G;  4D6T G;  1BCC G;  1NTZ G;  3CWB G;  3L73 G;  1PPJ G;  1SQV G;  2IBZ G;  3L74 G;  3CX5 H;  1SQQ G;  1KYO H;  1P84 H;  1KB9 H;  1NU1 G;  1L0N G;  3H1K G;  1BE3 G;  3H1J G;  3H1I G;  3BCC G;  4U3F G;  3L71 G;  1EZV G;  1NTK G;  1PP9 G;  1SQX G;  3L75 G;  1L0L G; 
#chains in the Genus database with same CATH topology
 2QJP C;  5TIS H;  2A45 G;  3EFG A;  2L5G B;  3L70 G;  4H0L B;  1VDF A;  2GUS A;  2Z4E A;  3H1H E;  3IAO A;  4H0L C;  1GU5 A;  1VQN P;  1HH0 A;  3WU2 E;  2I1K A;  5APS A;  1LJ2 A;  3BCC G;  3L71 G;  2B87 B;  4PD4 D;  1S9K E;  2ZAE B;  1L4A B;  3BAS A;  1GDT A;  5B66 E;  1RY3 A;  2E74 B;  1EZV D;  2QM8 A;  1A02 J;  2W83 C;  1VQL P;  3TNU A;  1L4A C;  3CCS P;  3SWF A;  3A3Y B;  1Q82 Q;  3OW2 O;  2WSE H;  2WWW A;  1SS1 A;  2E74 C;  1M57 D;  2FYN B;  2IBZ E;  2LXC B;  1U7M A;  1AVO A;  2FXM A;  2AEJ A;  2N9B A;  3OAK A;  2QE7 H;  3G6E P;  2BAS A;  2FYN C;  2V4H A;  2FKW B;  4H0L D;  4H44 B;  3EWK A;  4UB6 E;  5APV A;  3SSU A;  2A06 D;  2E75 B;  3HE5 A;  2XDJ A;  4WBA A;  1JMB A;  4H44 C;  2ZYD A;  3TNU B;  1SQP G;  1KQS O;  1FZE A;  3AE8 C;  2E75 C;  4HJG H;  2HFE D;  5CHX A;  1XTC C;  2E74 D;  5APX A;  3O8Z A;  3B8E B;  3RK2 B;  3P8C E;  1FDM A;  1IZN B;  2I8D A;  4WWI A;  1JCC A;  2KNC B;  1KYO I;  3CPW O;  3AE5 C;  3Q5P A;  1Q86 Q;  1RQU A;  5AVX B;  3RK2 C;  2AXC A;  1SP4 A;  4C7N B;  4L74 A;  4QMA A;  3GHG A;  1OW8 A;  4H44 D;  2Q1K A;  1IFM A;  3WU2 H;  2R5B A;  5APY A;  1T8Z A;  3L72 J;  2RN0 A;  2WPV B;  3CWB J;  3H1L G;  5B66 H;  2QA4 P;  4IFD K;  3KXD A;  4PD4 I;  2M0B A;  1NTK E;  2Z5I A;  3SWY A;  1EQ7 A;  1EZV I;  1K04 A;  3N7N A;  2IZ0 A;  3GHG B;  1GD2 E;  3LIE A;  2NZ2 A;  1MUU A;  2KLV A;  4WB4 A;  2KYV A;  5AW1 B;  3GHG C;  1S3J A;  1W2E A;  4UB6 H;  2WSC H;  5KJ7 C;  5AVV B;  5KLV J;  2WSE J;  1BGY J;  1JO5 A;  3FX0 A;  1L0N E;  1YJ9 P;  4N6J A;  1IFN A;  3EFF K;  2KLU A;  2KZJ A;  2ZYA A;  2YKO A;  1NTM K;  1NHL A;  3F5H A;  2ZXX A;  3L72 D;  2Y9Y A;  3GW6 A;  3CWB D;  1YTZ I;  1LTI C;  3IR9 A;  1FOS E;  2PFX A;  1NTK K;  5CJ4 A;  1KYO E;  2C9N Y;  1L0L D;  4R4L A;  1BSN A;  3QH9 A;  5KJ7 D;  1FZG A;  3CCJ P;  2RKL A;  1MV8 A;  1N7S D;  2YMK A;  3V6I A;  2N9Y B;  1KN7 A;  1KZU B;  1NTM G;  5AVQ B;  4ASV A;  1E79 H;  1QVG O;  4H13 D;  3KDP B;  3BAT A;  2Y0D A;  3L73 G;  1HBW A;  2K9J B;  2WT7 A;  2QRX A;  1R5L A;  1VQ5 P;  5KLV D;  3KPE A;  3HD7 A;  5C39 A;  3VP9 A;  4KJM A;  3H1H J;  1NTK G;  4IFM A;  1G1J A;  1BCC G;  4MN4 C;  5AW2 B;  3B5N A;  2AXT E;  1EZV E;  4GT1 A;  4EI2 A;  1N8R Q;  1PZQ A;  3L75 J;  4EDF A;  2WT7 B;  5CBO A;  1VQ8 P;  5DJU B;  1SLQ A;  3A5T A;  4HB1 A;  3HD7 C;  3B5N B;  2A06 E;  2BEQ D;  2HYN A;  1URQ A;  4CPG A;  3M9H A;  2WSC J;  1IC2 A;  1NTZ J;  1UIX A;  1M1J B;  1QL2 A;  2M3E A;  3B5N C;  5AVR B;  2FY8 A;  3V4Q A;  3II6 A;  1M1J C;  3H1H D;  2YKQ A;  3B71 A;  1SVF A;  2MJZ A;  4C46 A;  3W67 A;  2P7J A;  5GTI E;  1NU1 K;  2QSI A;  3VN0 A;  1URQ B;  1W5C E;  3L75 D;  1NWQ A;  4UB8 E;  3VMZ A;  2R5D A;  3H32 A;  1URQ C;  2KI7 B;  1RE4 C;  2IBZ D;  3V2N A;  3B5N D;  3RBX A;  2M5A A;  1JY3 N;  2UWJ E;  5AW6 B;  3MIW A;  1JMM A;  1FZB A;  2WTY A;  2AXT H;  3CXH I;  3HE4 A;  3VYI A;  1JM0 A;  5KTB A;  2YMY A;  1PP9 J;  4I6M C;  1N2D C;  1NTZ D;  2YNY A;  1EZV G;  5AW3 B;  2O01 N;  3H32 B;  2IPP A;  2V7Q H;  2IDB A;  3CCV P;  3S4R A;  2QM7 A;  1URQ D;  2M5A B;  1K9M Q;  2IYO A;  3TSI A;  1GU4 A;  3P8C D;  4YXW H;  3R2P A;  1SQV K;  3HE4 B;  2Y9Z A;  4GOE A;  3CX5 D;  1QX8 A;  1IFJ A;  1L0N J;  1KIL A;  2C0W A;  2QJY B;  3RL0 g;  4JYC A;  2K3R A;  1SQB E;  2W6B A;  3L72 E;  1OXZ A;  3GLM A;  3L74 E;  2QJY C;  1OX3 A;  5GTI H;  3H1K E;  3M06 A;  1DIP A;  1SQV G;  3NXS A;  1PP9 D;  3H1J J;  1L0L E;  4UB8 H;  1Z56 A;  1OW6 A;  3HUS A;  1AQT A;  1FZC A;  3M0A A;  1PGQ A;  4N3Y B;  1KIL B;  1ZME C;  3WMM 0;  2GA1 A;  3C1L A;  3WUU A;  2IBZ I;  4DCK A;  3P8M C;  1KIL C;  1GL2 D;  4JBZ A;  5KLV E;  3H1I G;  1USD A;  2W27 A;  3CXH E;  4IL6 H;  1FZC B;  1L0N D;  2ITA A;  3VOP A;  2KK7 A;  3BVH A;  1NOH A;  3FXD A;  3PH0 A;  1FZC C;  1KQF B;  1YTZ T;  1Y8A A;  2JO1 A;  2XKM A;  3AEG C;  3CLQ A;  3H1J D;  4N78 E;  2IFN A;  4JF7 A;  3L36 A;  1G2C A;  2POH A;  2H89 C;  3CX5 I;  3JCU E;  2R32 A;  1RF0 C;  1RF1 A;  2OYH A;  1FZA A;  2Q3E A;  1NKN A;  1OVV A;  1R8E A;  3L72 G;  4XFJ A;  3CWB G;  4OGQ B;  5AW9 B;  3AEF C;  2ZXE B;  2JKV A;  5EFW B;  2M8R A;  1H8A A;  1BE3 G;  4OGQ C;  3ABV C;  2QEX P;  2N1T D;  1G2C B;  1SQQ K;  1KQL A;  3V2P A;  3H6P A;  3JSV C;  3SFD C;  1RF1 B;  2WMM A;  2OYH B;  3A7O A;  5KAI E;  3SWK A;  1K73 Q;  3WUV A;  4HYT B;  1KB9 H;  3L75 E;  1FAV A;  1SQP K;  4U7J A;  3TGU E;  2FYU K;  1RF1 C;  2OYH C;  1AFO A;  3PHL A;  2RH0 A;  1GMJ A;  1TU3 F;  4GOF A;  1JB0 J;  1BGY G;  3CXH H;  2OYO A;  1IFP A;  1SQQ G;  2B88 A;  2K37 A;  2QIW A;  2P2U A;  3HRN A;  3E7K A;  4D6T E;  3PTZ A;  1NTZ E;  4EIJ A;  2HG5 D;  2JWA A;  1BSH A;  1PGP A;  3W68 A;  2FYU G;  3AE1 C;  3IF4 A;  1PGJ A;  1GW4 A;  3D70 A;  3TDK A;  1L4A D;  1RE3 A;  4XA4 A;  3CCE P;  2CPB A;  3JCU H;  1DH3 A;  2QVA A;  1LNQ A;  3VTP C;  1ZP0 C;  3K5B A;  3HE5 B;  1X79 B;  3CX5 E;  3NMD A;  1T3J A;  2QG4 A;  3MHV A;  1R5S A;  1EC5 A;  4W80 A;  1YYC A;  2OAR A;  5K5G B;  1KC8 Q;  5BU5 A;  3RBZ A;  2AEM A;  1SQB J;  2XV5 A;  2E75 D;  1NO4 A;  3H1H G;  3L74 J;  1RE3 C;  5KAI H;  4YPC A;  1PP9 E;  3BRV B;  3H1K J;  1QVF O;  1NGM B;  4GIF A;  2WVR A;  1J1E B;  1L0L J;  2WIT A;  3L70 J;  1LTG C;  3L75 G;  1HGZ A;  3RK2 D;  1GK6 A;  2ZT9 C;  1AVY A;  1J1E C;  4U3F E;  2IZ1 A;  2IBZ G;  1HJ0 A;  3L4F A;  2ZJS E;  4IL6 X;  2FXP A;  3CMA P;  2Q9I A;  1PFI A;  1HVV A;  3UIA A;  1RQV A;  3D6Z A;  3I5C A;  2DW3 A;  1ZV8 A;  1NTZ G;  4GDO A;  3CCQ P;  5E79 H;  3IN6 A;  2OGU A;  1SQB D;  3CCR P;  2HPC A;  3KQG A;  1N86 A;  3L74 D;  5CCG A;  4W7Z A;  3E1R A;  1KQG B;  2OYI A;  5AW0 B;  1FE6 A;  1KIL E;  3H1K D;  3H1J E;  5AVT B;  3OJA B;  3CX5 H;  4M3L A;  1SFC A;  3VP8 A;  3L70 D;  2ZFC A;  3EQ2 A;  1FZF A;  3MUD A;  2J58 A;  5APQ A;  3M9B A;  1KTM A;  1LTS C;  1BDD A;  1QEX A;  1H0T A;  3CME P;  1N73 A;  1KB9 D;  5APU A;  1W2B O;  1PL5 A;  5BU8 B;  5CCG C;  1JEK A;  1SFC B;  2R3S A;  1PP9 G;  2OYI C;  1HJB A;  1USE A;  1FS0 E;  3CXH D;  1L0N K;  4WY4 A;  1OW7 A;  4YTP C;  2YXR B;  1SFC C;  3V2R A;  3I55 P;  1SQX E;  2O1J A;  1DD4 A;  2AEF A;  1H0T B;  1FU1 A;  2M3B A;  1VPC A;  3MUD C;  1N73 B;  3A0B E;  2MKV A;  5H2F H;  3SFE C;  2NPS A;  3TGU J;  3CCM P;  3TK1 A;  3M91 A;  1JY2 N;  3HD7 B;  1JCD A;  4KHX A;  4N78 D;  1N73 C;  1KD1 Q;  2HLO A;  4PV1 B;  3KHU A;  1U57 A;  3CCL P;  3GF3 A;  4WY4 B;  3MTU E;  4OWF A;  1L0N G;  3PLN A;  2IFM A;  3S9O A;  4KT0 J;  4PV1 C;  4LC1 A;  4D6T J;  4WY4 C;  5L8R J;  4NPF X;  1CSB A;  2NPS B;  3PRJ A;  1NAY A;  1VF5 B;  4NPD A;  1NYH A;  2NPS C;  2YKP A;  3AEC C;  3CC4 P;  1VF5 C;  2C0X A;  1VQP P;  4DJG A;  2JWD A;  1JOC A;  4I2L C;  1KMI Z;  1NAF A;  3GF7 A;  2KS1 A;  3QWO C;  3A2A A;  3HD7 D;  3Q2Y A;  5KKZ B;  4PV1 D;  3TGU D;  3LID A;  5CCH A;  2IYP A;  4W7Y A;  1KB9 I;  1X8Y A;  2PGD A;  1IO4 A;  5KKZ C;  2WSS H;  1KFM A;  1VL2 A;  4ZMD A;  2W90 A;  2P10 A;  2NPS D;  1LP1 A;  1VF5 D;  4D6T D;  2CPS A;  1NTM J;  5AVY B;  3A0B H;  1LTA C;  1EDL A;  5CMZ A;  5AVU B;  3L73 J;  4IL6 E;  3CCU P;  3VMY A;  3AE2 C;  3C8V A;  1Q7Y Q;  1HGV A;  2XZR A;  4U3F J;  1ZN5 A;  1X22 A;  3KYQ A;  3AE3 C;  5APW A;  4DZO A;  4C7R A;  3G71 P;  1NVO A;  4LGD E;  1BCC J;  4OH8 B;  1KOR A;  1Y47 A;  1X0T A;  1VQO P;  1M90 Q;  2A06 G;  2RMZ A;  2Y0C A;  3USS A;  3AEA C;  2JP3 A;  5AW8 B;  1LTT C;  2FFD A;  1PPJ E;  1X9V A;  1LT9 A;  2KSJ A;  2P1J A;  1S5L E;  1YJW P;  2O01 H;  1Q81 Q;  1YQ4 C;  3L37 A;  1PGO A;  2YO3 A;  1AJY A;  1N7L A;  1NTM D;  3L70 E;  2R3C A;  5AVS B;  1BDC A;  3L73 D;  1ZW0 A;  1JY2 O;  1PV3 A;  2YIU B;  1MFT A;  1S72 P;  4OVN F;  3P32 A;  4U3F D;  1P84 D;  3L71 E;  1KB9 E;  2KSE A;  1GK4 A;  2YIU C;  2FFD C;  1OZH A;  1BCC D;  3CD6 P;  2CK3 H;  1UII A;  5GTH H;  1MKM A;  3HUS B;  1M8O B;  2B89 A;  3G4S P;  2G8Y A;  4EOT A;  1FOS F;  2J59 M;  3AE6 C;  1JUN A;  1SQB K;  3HUS C;  1SQX J;  2PP6 A;  2BCC J;  1K8A Q;  2D2C B;  4BRY A;  2HOD A;  1KIL D;  1WRG A;  1NU1 J;  1U7J A;  2D2C C;  1L0L K;  1ZOY C;  2FBW C;  1J2J B;  2ZVN B;  1QL1 A;  3VMA A;  1IK7 A;  1JY3 O;  2LR2 A;  1S5L H;  2WPQ A;  1SQB G;  3RGU A;  3L74 G;  3MGN A;  4BRY B;  1ZLL A;  5CBN A;  2B87 A;  2HOD B;  5KLV K;  2A45 H;  1QGK B;  3A0H E;  3H1K G;  5AW5 B;  5APT A;  1RHZ B;  1LGH B;  2E43 A;  1L0L G;  4R4M A;  4GKG A;  1EDI A;  1Q2N A;  2D2C D;  2O01 J;  1SQX D;  2BCC D;  2K88 A;  1H89 A;  3H1L E;  1P84 I;  4RO0 A;  1JNM A;  1NU1 D;  2P58 A;  1SQV J;  5KLV G;  2H7H A;  1FDO A;  1T3U A;  1E5W A;  2K1A A;  2E5Y A;  2KZI A;  4ASW A;  4OGQ D;  2W8Z A;  3M0D A;  1OWA A;  4JYB A;  4RES B;  4PJ0 E;  4AYC A;  3PJS K;  1AA0 A;  2KNC A;  4Z1M H;  4ZKU A;  5E79 E;  3H1I J;  2J5U A;  1A02 F;  3Q3D A;  2K9Y A;  3AED C;  1FBM A;  1VQ7 P;  1H88 A;  1WMK A;  2WSF H;  5AW4 B;  4C7N A;  1YIJ P;  1FJK A;  3VMX A;  2PRR A;  3U59 A;  3V2Q A;  2HR3 A;  3U1C A;  1DEE G;  2LKM A;  1RH5 B;  5KAF E;  1IK9 A;  3M0D C;  1EXI A;  3A0H H;  2KXP B;  1SQV D;  1LTJ A;  1LWU A;  3E1I A;  3TYY A;  3TF5 A;  2XU6 A;  1ZRT D;  5DJT B;  5AW7 B;  2G3A A;  4WVZ A;  1AQ5 A;  1NTM E;  3GG2 A;  2ZT9 B;  3OA7 A;  3L73 E;  1NTZ K;  4I7Z B;  5KJ7 A;  3FGA D;  2KP8 A;  1N7S A;  1D7M A;  3Q5R A;  3D6Y A;  3TGU G;  2WPS A;  1CI6 A;  1OVR A;  1LTJ B;  3AEB C;  3H1I D;  4NPE A;  1LWU B;  1M7L A;  4I7Z C;  1P84 E;  1BE3 J;  3BCC J;  1GTW A;  3C9I A;  3L71 J;  4ZKP A;  1BCC E;  1LTJ C;  3KZI E;  3M9Q A;  1LWU C;  5H2F E;  3LW5 H;  1EXJ A;  2E76 B;  4DT0 A;  2Z5H A;  2JJL A;  4PJ0 H;  4D6T G;  4RKU J;  3HTK A;  1N7S B;  2E76 C;  1HF9 A;  1CI6 B;  3IFM A;  1PIX A;  1NKZ B;  4H13 B;  1N7S C;  2OTL P;  1CW5 A;  1PPJ D;  2JR8 A;  2ZYG A;  3Q5S A;  1J1D B;  2ZT9 D;  2C9L Y;  3FWN A;  1Q90 D;  1YBK A;  4EYY Q;  2LXB A;  1SQQ J;  4H13 C;  4GOD A;  1S5L X;  1J1D C;  1S2E A;  4HH2 A;  4Y28 J;  1ZR4 A;  1IFI A;  3HTK B;  3WUT A;  5KAF H;  1SQP J;  2FYU J;  1L2P A;  2K9J A;  3RK3 B;  4YXD C;  3FXE A;  1K05 A;  2OQQ A;  1BE3 D;  2E76 D;  2WSF J;  1ZXG A;  2HPC B;  5CJ0 A;  3AE9 C;  3BCC D;  2QJK B;  3L71 D;  3RK3 C;  1YHQ P;  2OYI B;  3GMA A;  3CC2 P;  2OTJ P;  1FDI A;  2WZ7 A;  2QJK C;  2GM4 A;  1HWT C;  2NRG A;  2B9B A;  1JTH A;  2SPZ A;  5AVW B;  1KFN A;  4BWN A;  5TJH A;  2KB7 P;  1P84 H;  3AE4 C;  2BCC E;  1VQ9 P;  1BGY D;  4U3F G;  3KZI H;  2Y0E A;  1SQQ D;  3H1L J;  4ZNC A;  4PD4 E;  1NU1 E;  1LTB C;  4L73 A;  4TLF A;  4TT3 H;  3R4Y A;  3RK3 D;  4JPZ B;  2YO2 A;  1JTH B;  2FYZ A;  1SQP D;  4K3A A;  3V4W A;  2OTK E;  2FYU D;  5CCG D;  2P67 A;  1M1J A;  1OVU A;  5B5E E;  3LW5 J;  2BEZ F;  1AV1 A;  3RL0 B;  1SFC D;  2Q7C A;  1HTL C;  1LT1 A;  1S4X A;  3RL0 C;  3B4S A;  3S1K A;  3H1J G;  4XE5 B;  1RE4 A;  2A45 I;  3MD0 A;  4L76 A;  2WPR A;  1XTG B;  3D71 A;  1CZQ A;  2W6J H;  2Q5U A;  1SQX K;  4O9B A;  1KYO H;  3JC2 2;  3CI9 A;  3CL3 D;  3H1L D;  1VQM P;  2JDI H;  1SQV E;  2H43 A;  4WY4 D;  1S9K D;  5AVZ B;  1GZL A;  2W6A A;  3H25 A;  1NJI Q;  1ZRT E;  1OFC X;  3N4X A;  1M1K Q;  3RL0 D;  1FJP A;  2ZVO B;  2L91 A;  2KS1 B;  1MFZ A;  1EDJ A;  2VRS A;  2XND H;  1SQX G;  1YQ3 C;  2BCC G;  3P7K A;  4PD4 H;  5GTH E;  1VQK P;  3ITK A;  2O1K A;  2PAJ A;  3BRT B;  2XNX A;  3H1I E;  3F89 A;  3NTN A;  1VQ4 P;  3I56 P;  1NU1 G;  5CCH C;  4B86 A;  4HKZ H;  1NTK J;  1GL2 A;  3MZW B;  2FXO A;  5B5E H;  2I1J A;  2R44 A;  1LP1 B;  3AE7 C;  2E5T A;  2YXQ B;  3T97 A;  5M1B A;  4DOJ A;  4A7P A;  1GW3 A;  1T6A A;  1GL2 B;  3U1A A;  3G3Z A;  1JY2 P;  2KOG A;  1DEB A;  5CCH D;  1IJD B;  3G9R A;  1GL2 C;  1OMI A;  3O6Q A;  2WQY C;  1EDK A;  4IOI H;  3CWB E;  4K35 A;  5KLI B;  5TIS E;  2KUB A;  3T97 B;  1NH4 A;  4I1L A;  1BE3 E;  2FFD B;  1VQ6 P;  5KLI C;  3BCC E;  1LT9 B;  1Y9B A;  1NTK D;  1WT6 A;  1HUC A;  2KIK A;  2GUV A;  3L35 A;  3Q1M A;  4JQ0 D;  4AQR D;  1LT9 C;  1YJN P;  2O3J A;  2Q6Q A;  3O6Q B;  2N1T A;  4RJT A;  3MP7 B;  4L75 A;  1YI2 P;  2IX7 C;  4LLH A;  3CC7 P;  4Y99 B;  2Q3I A;  1BGY E;  1G1I A;  2JEE A;  1T2K C;  1RF0 A;  1SQQ E;  4Y99 C;  3RK3 E;  3PP5 A;  1JY3 P;  1KV4 A;  4BXL A;  3FWL A;  1DX7 A;  1M56 D;  2N1T B;  1SQP E;  3V5B A;  2FYU E;  3ZDM A;  1MZ9 A;  1FC2 C;  1S1C X;  2H8P D;  2N1T C;  4IFF A;  1YIT P;  3NFQ A;  5BVZ A;  1QLE D;  2V7Q J;  1PPJ G;  1KYO D;  1IFD A;  2E42 A;  2QJP B;  1T2K D;  4AUW A;  1L4A A;  2H88 C;  1DD3 A;  1ZR2 A;  1OIP A;  3AEE C; 
#chains in the Genus database with same CATH homology
 1SQP G;  2BCC G;  1NTM G;  4PD4 H;  3L70 G;  3H1H G;  3TGU G;  5KLV G;  2FYU G;  3H1L G;  1SQB G;  1BGY G;  3L72 G;  3CXH H;  2A06 G;  4D6T G;  1BCC G;  1NTZ G;  3CWB G;  3L73 G;  1PPJ G;  1SQV G;  2IBZ G;  3L74 G;  3CX5 H;  1SQQ G;  1KYO H;  1P84 H;  1KB9 H;  1NU1 G;  1L0N G;  3H1K G;  1BE3 G;  3H1J G;  3H1I G;  3BCC G;  4U3F G;  3L71 G;  1EZV G;  1NTK G;  1PP9 G;  1SQX G;  3L75 G;  1L0L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...