1SQPG

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqpG00
1KYOH 1BCCG 1BE3G 1PPJG 3H1IG 2A06G 1EZVG 3L70G 1SQQG 2BCCG 5KLVG 3H1KG 1SQPG 1NU1G 3L72G 1P84H 4PD4H 1SQXG 1PP9G 3H1HG 3H1JG 3TGUG 1L0NG 1L0LG 4U3FG 1NTZG 3BCCG 3L75G 2IBZG 3CXHH 1KB9H 3CX5H 1BGYG 3L74G 1NTMG 3L71G 2FYUG 4D6TG 1SQBG 3L73G 3CWBG 1SQVG 3H1LG 1NTKG
chains in the Genus database with same CATH superfamily
3A0HH 3I5CA 2Q1KA 4TLFA 5KAFH 1KB9E 1PP9D 5AW6B 4OGQB 1TU3F 2W8ZA 1HWTC 1LNQA 4LLHA 2E74D 3L74E 4HB1A 4I7ZC 4W80A 5BVZA 2FXPA 1LGHB 1SQVE 1GD2E 2A06G 1PPJE 1NU1G 5M1BA 3K5BA 2OYHA 1OVRA 1URQC 2KSEA 4TT3H 2HR3A 1H0TB 1BGYD 1FOSF 1GTWA 1M1JC 4L74A 2Z5IA 3PHLA 3GG2A 1RH5B 5CBOA 1EDIA 1IC2A 3ITKA 3BASA 2KZJA 4RESB 2OTKE 3BCCG 1SQBG 2E75B 1LTTC 5B66H 2XDJA 2OYHB 3GW6A 1KN7A 3UIAA 1VDFA 2QA4P 1EDJA 1VF5B 1G1IA 2JWDA 1RF0C 4R4MA 1P84E 4PD4E 2GM4A 2FXMA 1EDLA 1PP9G 3CXHH 4U3FE 1N86A 5CBNA 1ZMEC 1JCDA 1RQUA 1IK7A 3PRJA 4ZKUA 1J1DC 3CCMP 3CD6P 1BGYG 4H44C 2I8DA 3VTPC 2NPSA 2H43A 1KQSO 3L71E 1FJPA 2Z4EA 3H1LD 2P7JA 4RKUJ 3H25A 3H1ID 2C0XA 2RKLA 1OVVA 1FZBA 2KIKA 3V4QA 3AECC 1EZVI 1QL1A 3L75D 2ZXXA 3MIWA 1FZCC 3MZWB 3MP7B 1LWUA 3D71A 2A45I 4KJMA 1H89A 1H88A 1T2KC 1RE4A 1KFMA 3CCJP 3E7KA 3CCVP 1GW4A 3OAKA 2KI7B 5APVA 4RJTA 1VQ5P 1YBKA 2HLOA 3RBXA 4QMAA 2WTYA 1RF1C 5CMZA 1R5SA 2OARA 3WUUA 2QRXA 2WWWA 3H1KD 2G3AA 2O01H 2M8RA 5AVXB 4GIFA 3TGUJ 3H1JD 3V2PA 3CX5H 1NTMG 1PFIA 1SFCD 3CWBE 2B89A 1JY2N 4UB6E 2G8YA 4WY4B 4EI2A 1X22A 1SQQE 1JO5A 1S3JA 5H2FE 3USSA 4IFDK 5AW4B 1OW6A 4H0LB 2BEQD 2O1JA 3V2QA 1PGOA 2RH0A 1AQTA 3L73G 1KYOI 3E1IA 1EZVG 4ZKPA 1SQQJ 3TDKA 1ZN5A 2D2CB 2ZT9D 2IZ0A 1G2CB 3VOPA 2FYNB 1KQGB 2E76B 2IDBA 1ZP0C 1CI6A 2GA1A 1SQQK 2N9YB 3AEAC 4H13B 1T2KD 3H1LJ 3L70G 4AUWA 3HE4A 2KUBA 2WPRA 5DJUB 1FZEA 5E79H 3A0BE 3C1LA 3SWKA 3V5BA 2WITA 3M06A 3L75J 3M0DA 3EFGA 2C0WA 2B87A 3HTKA 2YKOA 5GTHH 1BE3G 2JDIH 4GODA 4DZOA 3H1KG 2PRRA 2QM8A 1FZAA 1M1JA 3C9IA 3H1JG 1YI2P 4UB8H 1NJIQ 5AVSB 2HPCA 1J1EC 2I1KA 2OYIC 1S2EA 4YXDC 3JC22 3H32A 3WU2H 3NMDA 3S9OA 2QVAA 2B88A 3QWOC 4I7ZB 2AXCA 1LTIC 3L72E 3H1HD 4OGQD 1SQXE 2R3SA 2POHA 5CCHD 3HTKB 2Q3EA 5APYA 1URQB 1S9KE 1PGPA 5AVWB 4D6TG 3CC7P 2B9BA 3A0HE 1ZV8A 5KAFE 1M1JB 3L37A 2IZ1A 1M90Q 4PJ0H 1RF0A 1IFJA 3I56P 1LTJC 4ZMDA 5AVVB 2Y0CA 2FYUE 3VYIA 3HE5A 2E5YA 1LP1A 3LW5H 1JMBA 1NTZG 1SFCA 2W83C 3NTNA 1JM0A 1L0LJ 2ITAA 1DEEG 1N7SB 1Q81Q 1K05A 3A2AA 2FYUJ 2HG5D 2E75D 1M7LA 3VMXA 2OTLP 2KNCA 1BCCD 2KLVA 2V7QH 3T97B 1L0LK 1JY3O 2FYZA 1VF5D 1E79H 1KILC 3B5NC 3RK3E 5AW5B 4C7NB 3W67A 2KK7A 1S4XA 1IJDB 5AW9B 3VP8A 4PV1C 1FC2C 5CJ0A 1NTKE 1JTHA 2KLUA 1FZCA 1KB9D 1LT1A 1SQPE 1L0NG 1KB9I 4BWNA 2E5TA 2WSEJ 3L74D 1CW5A 1J1DB 1FDOA 3A7OA 3RK2C 1OW7A 4H44B 4OVNF 2WZ7A 4DOJA 1PPJD 1X0TA 2QEXP 3GHGC 1U7JA 3CXHE 1SQPJ 5KLVE 4OH8B 4H0LC 3H1HJ 1WMKA 1RF1A 3M9QA 4EDFA 2Q3IA 1JTHB 1SQPK 2BCCG 4JPZB 1SS1A 5KTBA 2KS1A 3MTUE 1RE3A 1AQ5A 3LIEA 3GF7A 2QJYC 2WSFJ 1KMIZ 2HFED 3JCUH 3AE7C 2KXPB 5CCHA 4L75A 3FWNA 5B5EH 2BCCE 1RF1B 3PTZA 3RL0C 3CCEP 1YHQP 1AVYA 1ZXGA 3TNUA 1VQ6P 2PGDA 1KQLA 4JBZA 1X8YA 3AE6C 1P84D 4PD4D 1H0TA 1IFDA 3RBZA 2KS1B 1P84I 4PD4I 1BCCJ 1Y47A 1Q7YQ 4IOIH 1FOSE 1AFOA 3CC4P 1G1JA 4U3FD 4HH2A 4HKZH 4N3YB 2L5GB 2XU6A 3GLMA 3BRVB 4NPDA 4ASVA 1PZQA 3AEFC 1KYOH 1BDCA 1QL2A 1WT6A 4WY4D 1T8ZA 2WSCJ 4W7ZA 1FE6A 1FDIA 3TNUB 3CX5E 2JWAA 3MUDC 1VQOP 4H0LD 1PV3A 3L71D 3L74J 4JQ0D 2ZJSE 4WVZA 1SQVJ 1GZLA 4WB4A 1ZOYC 3KDPB 3HD7B 2D2CD 2A06E 2IFMA 2OYIA 2P58A 1YJWP 1NU1E 1GDTA 2UWJE 2N1TC 2E76D 3V4WA 1AJYA 1SQVK 4H13D 1L4AC 4N78D 3E1RA 1AV1A 3TGUD 5CJ4A 1N7SC 2P10A 3BCCE 2YO2A 4B86A 1U7MA 4IL6H 1FS0E 1VQ9P 3M91A 1KFNA 1JOCA 1KILE 2QIWA 2FY8A 3OA7A 3CCQP 1SQBE 1J1EB 2ZYDA 2OYIB 3PP5A 1M57D 5E79E 3F5HA 1NO4A 4YXWH 3CCLP 1HBWA 3NFQA 2QJKB 2PAJA 3N7NA 1USDA 5AW3B 3U1CA 1N73C 1U57A 5GTHE 3AEDC 1BSNA 3CWBD 3TSIA 1Y9BA 1SQQD 4O9BA 4UB8E 3AE4C 5AW2B 1PP9E 2CK3H 4U3FJ 1URQD 4LC1A 5EFWB 4Y99B 3G4SP 3WU2E 1LTJB 3Q5SA 2Y0EA 2N9BA 3V2NA 1YYCA 1J2JB 3R4YA 1W2EA 4BRYB 3Q3DA 1IFPA 1BGYE 2OTJP 3L71J 5APTA 5L8RJ 3CCUP 4PJ0E 2AEMA 1HH0A 1NAFA 2C9LY 3CCRP 4WY4A 1VQ8P 1N7SD 3WUVA 1S5LH 3VP9A 3RGUA 1JY2O 3A3YB 3A5TA 1KILB 3B5NB 4EOTA 1HF9A 4PV1B 1VQKP 1OZHA 5KJ7C 1NGMB 4GKGA 3RK3C 3D6ZA 1HGVA 1KB9H 1OXZA 2KOGA 2ZXEB 5BU8B 1G2CA 3LW5J 1YTZI 1FJKA 2QM7A 3RK2B 1E5WA 3KPEA 3L4FA 3VMZA 3L72D 1Q2NA 1SQXD 1A02F 2K9YA 3GHGB 4NPEA 3Q2YA 2J5UA 2ZYGA 5KAIH 1EXJA 1S9KD 2YNYA 3HUSC 2H8PD 1NTME 4H44D 3PJSK 1X79B 2WT7B 3H1LG 3CWBJ 3H1IG 4XE5B 4JF7A 3NXSA 3L75G 1WRGA 5CCGC 1L0LD 1CZQA 2A45G 5BU5A 1XTGB 1M1KQ 1GL2C 1NTMJ 2FYUD 3CI9A 5APQA 2C9NY 2XZRA 3HD7C 2QJYB 3B8EB 2MJZA 3L73E 4GOEA 2K9JA 3M9HA 1EZVE 2Y9ZA 3M9BA 2FXOA 2YXRB 1NTMK 3U59A 2IBZD 1NKZB 1NHLA 3IR9A 3RL0B 1Q82Q 5CHXA 1LJ2A 1KC8Q 2IBZI 3WMM0 2R44A 1IO4A 4IL6X 2IPPA 3L73J 3MUDA 3FGAD 1URQA 1FZGA 2K1AA 3L70E 3II6A 3JCUE 2Q5UA 2V4HA 3AEEC 1ZRTD 2R5DA 1HTLC 1H8AA 2K9JB 5B5EE 1JY3P 4WBAA 1MFTA 1NTKD 3N4XA 1BE3E 4ZNCA 3L70J 2QJKC 1SQPD 2JJLA 1YJNP 4GT1A 3H1KE 1DD3A 4CPGA 4JYCA 3H1JE 2W6AA 4Z1MH 1EQ7A 4N6JA 1LTSC 3Q5PA 1N7SA 3C8VA 3FXDA 5KLVD 3L72J 1L0LG 2O1KA 4Y99C 1SQXJ 3OW2O 3T97A 2WPQA 2N1TB 2IFNA 1KYOE 4ASWA 5AVZB 4D6TE 2O3JA 4C7NA 5AW7B 3HD7D 1SQXK 2K3RA 1L4AB 2FBWC 2J59M 4WWIA 4D6TJ 1S5LX 3HRNA 1R5LA 3CMAP 1W2BO 1Y8AA 4KHXA 5GTIH 1KZUB 1VL2A 4XFJA 2LXCB 5APXA 3AEGC 1OMIA 1NTZE 2FYUK 1RQVA 3KQGA 5B66E 3LIDA 1N73B 5AVRB 3GMAA 2FKWB 2W6BA 3IAOA 1T3UA 4I1LA 3BVHA 1BDDA 1FBMA 3U1AA 3H1HG 1KD1Q 4IL6E 1Q90D 2QG4A 2YO3A 3B4SA 1SQVD 1FAVA 1MV8A 1NTKJ 1LWUC 3H6PA 3AEBC 3CX5D 4OWFA 2H89C 1RE4C 3CX5I 1LTBC 1L0NE 4M3LA 2HODA 3AE5C 1KORA 1NTKK 1W5CE 2M3EA 2A45H 1QLED 4BXLA 1OW8A 1VQLP 1OX3A 2A06D 1BSHA 5KLVJ 2Q6QA 2WMMA 2K37A 1LT9B 1DX7A 1ZR2A 2W90A 1DEBA 2Y0DA 2M5AA 1YQ4C 1BCCG 5KLVK 2PFXA 3D70A 3G71P 4GOFA 3ZDMA 2AEFA 4EYYQ 1SVFA 1IFNA 3Q1MA 1CSBA 5TJHA 2HODB 3HUSA 1LTGC 3BCCD 1GU5A 3RK3B 3AE8C 1FZFA 1KILD 3B5ND 1NYHA 2FFDB 1SQBD 1ZR4A 1VQ4P 3O6QB 2P1JA 5APUA 1HVVA 4PV1D 1PGJA 2JP3A 3IN6A 5C39A 2BCCJ 1S5LE 1EC5A 3HD7A 1QEXA 1VPCA 3L74G 2M5AB 1YIJP 2WSSH 3CMEP 5APWA 2R3CA 4Y28J 1SQVG 2GUVA 2ZVOB 2O01N 3RK2D 3HUSB 1PPJG 1N8RQ 3JSVC 1VQMP 1KQFB 2VRSA 4YPCA 3P8CE 1QGKB 2YMYA 1EDKA 2NRGA 2ZAEB 4JYBA 1FDMA 3MD0A 1GL2B 3M0DC 2O01J 1ZLLA 2H7HA 3P7KA 5KAIE 3SWYA 3KYQA 3CLQA 2YKPA 2CPBA 3OJAB 2I1JA 3EWKA 4IFFA 1DD4A 1GK6A 2KB7P 3D6YA 1YJ9P 2YXQB 1K9MQ 5KKZC 1MFZA 1NU1J 3L36A 1AVOA 3ABVC 3RL0D 1DH3A 2P67A 3KHUA 3S1KA 2WPVB 4AYCA 2WSEH 1K04A 3KZIH 1IZNB 2R32A 2LKMA 1HUCA 3TYYA 1LTJA 1NU1K 1JY2P 2AEJA 2RN0A 4U3FG 2XKMA 2W27A 2QJPC 3BCCJ 4U7JA 2KZIA 4BRYA 1LTAC 2AXTH 3SWFA 1SQBJ 4YTPC 4K35A 1IFIA 1SLQA 4MN4C 1UIXA 4I6MC 5KLIC 2K88A 1SQBK 3L71G 1NTMD 1SFCC 2YKQA 2WSFH 3Q5RA 4DCKA 1KILA 3B5NA 1RY3A 1X9VA 2JKVA 4DJGA 1PP9J 2N1TD 1NH4A 2JEEA 3CL3D 5AW8B 2WQYC 1L2PA 3TF5A 3L73D 2OQQA 1HJBA 5TISH 1EZVD 1L4AD 2ZT9C 1LT9C 4W7YA 1MZ9A 3AE2C 3TGUG 2E43A 1N2DC 2MKVA 1KTMA 2KSJA 1BGYJ 3GHGA 3VMYA 3GF3A 1FU1A 1VQPP 1QX8A 4N78E 3L70D 3CC2P 2ZFCA 4HYTB 2WT7A 2NPSB 2WSCH 3RL0g 3TGUE 3F89A 2FFDC 3FXEA 2P2UA 2M0BA 5GTIE 4NPFX 3CWBG 1A02J 1HGZA 2L91A 1BE3D 1SQQG 2DW3A 1PIXA 1LWUB 4R4LA 3V2RA 2QSIA 2E74B 2H88C 1RE3C 2V7QJ 4KT0J 3W68A 2ZVNB 4OGQC 5CCHC 5AVQB 1YITP 3R2PA 2NZ2A 1OIPA 2QE7H 2W6JH 1YTZT 1KYOD 4GDOA 5DJTB 1S1CX 4D6TD 2J58A 2OGUA 1OVUA 3MGNA 3H1LE 3IFMA 3P32A 3H1IE 1T6AA 1QVGO 1JCCA 1K8AQ 1MUUA 3FX0A 3SSUA 3L75E 4RO0A 5AVUB 2LR2A 4XA4A 1ZW0A 3H1IJ 1NKNA 4L76A 1P84H 4PD4H 1IK9A 1OFCX 2KP8A 5KJ7D 3G6EP 1NTZD 3I55P 3S4RA 1M56D 2WVRA 3RK3D 3TK1A 1PGQA 2E75C 4HJGH 2OYHC 5K5GB 3G3ZA 1JUNA 2YIUB 2IYOA 2N1TA 1M8OB 1OWAA 3L72G 1VF5C 1T3JA 1SQXG 2XV5A 3SFEC 1CI6B 1L4AA 2XNDH 3O8ZA 2SPZA 2WPSA 3HE4B 4DT0A 1VQNP 3FWLA 3SFDC 2E42A 1BE3J 3CXHD 3CPWO 3H1KJ 2M3BA 3MHVA 3PH0A 1NVOA 3CXHI 1L0ND 2B87B 3H1JJ 1S72P 5CCGD 2FYUG 3IF4A 1GL2D 3WUTA 2HYNA 1NAYA 5AVTB 1USEA 2KYVA 1N73A 2HPCB 1SP4A 1KV4A 2CPSA 2GUSA 3VMAA 3BATA 2IBZG 1L0LE 5KKZB 3AE9C 3H32B 5AVYB 3EFFK 3KXDA 1GMJA 2BCCD 2Q7CA 2YMKA 1AA0A 2BASA 3L35A 2IBZE 4I2LC 3G9RA 2QJPB 4L73A 1PL5A 3V6IA 1NTKG 4C46A 1K73Q 3B71A 2XNXA 2BEZF 2NPSC 1N7LA 1SQPG 2Z5HA 1RHZB 1D7MA 2IX7C 1MKMA 4UB6H 1GW3A 2IYPA 1HJ0A 1IFMA 2LXBA 3HE5B 1UIIA 1NTZJ 2RMZA 3EQ2A 1LP1B 1ZRTE 3KZIE 5H2FH 1JMMA 1LT9A 4A7PA 5KLIB 1R8EA 4AQRD 4LGDE 1SFCB 2R5BA 5KLVG 1NTZK 3P8CD 3PLNA 1YQ3C 3H1HE 5APSA 2AXTE 2E74C 1JY3N 2KNCB 1NWQA 1GU4A 1EXIA 5KJ7A 4WY4C 1Q86Q 1GK4A 2FFDA 1NU1D 3O6QA 2ZT9B 1L0NJ 1JB0J 5AW0B 1JNMA 3A0BH 3AE3C 3QH9A 3P8MC 2PP6A 4K3AA 2ZYAA 1XTCC 1FZCB 3AE1C 2D2CC 1VQ7P 2JO1A 1QVFO 1L0NK 2FYNC 2E76C 2JR8A 3BRTB 2Y9YA 4H13C 3VN0A 5TISE 4C7RA 4IFMA 1Z56A 5CCGA 3M0AA 1BCCE 2OYOA 2NPSD 1GL2A 1NOHA 3CCSP 2YIUC 1DIPA 4EIJA 5AW1B 2Q9IA 1JEKA
chains in the Genus database with same CATH topology
1KYOH 1BCCG 1BE3G 1PPJG 3H1IG 2A06G 1EZVG 3L70G 1SQQG 2BCCG 5KLVG 3H1KG 1SQPG 1NU1G 3L72G 1P84H 4PD4H 1SQXG 1PP9G 3H1HG 3H1JG 3TGUG 1L0NG 1L0LG 4U3FG 1NTZG 3BCCG 3L75G 2IBZG 3CXHH 1KB9H 3CX5H 1BGYG 3L74G 1NTMG 3L71G 2FYUG 4D6TG 1SQBG 3L73G 3CWBG 1SQVG 3H1LG 1NTKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO H;  1BCC G;  1BE3 G;  1PPJ G;  3H1I G;  2A06 G;  1EZV G;  3L70 G;  1SQQ G;  2BCC G;  5KLV G;  3H1K G;  1SQP G;  1NU1 G;  3L72 G;  1P84 H;  4PD4 H;  1SQX G;  1PP9 G;  3H1H G;  3H1J G;  3TGU G;  1L0N G;  1L0L G;  4U3F G;  1NTZ G;  3BCC G;  3L75 G;  2IBZ G;  3CXH H;  1KB9 H;  3CX5 H;  1BGY G;  3L74 G;  1NTM G;  3L71 G;  2FYU G;  4D6T G;  1SQB G;  3L73 G;  3CWB G;  1SQV G;  3H1L G;  1NTK G; 
#chains in the Genus database with same CATH topology
 3A0H H;  3I5C A;  2Q1K A;  4TLF A;  5KAF H;  1KB9 E;  1PP9 D;  5AW6 B;  4OGQ B;  1TU3 F;  2W8Z A;  1HWT C;  1LNQ A;  4LLH A;  2E74 D;  3L74 E;  4HB1 A;  4I7Z C;  4W80 A;  5BVZ A;  2FXP A;  1LGH B;  1SQV E;  1GD2 E;  2A06 G;  1PPJ E;  1NU1 G;  5M1B A;  3K5B A;  2OYH A;  1OVR A;  1URQ C;  2KSE A;  4TT3 H;  2HR3 A;  1H0T B;  1BGY D;  1FOS F;  1GTW A;  1M1J C;  4L74 A;  2Z5I A;  3PHL A;  3GG2 A;  1RH5 B;  5CBO A;  1EDI A;  1IC2 A;  3ITK A;  3BAS A;  2KZJ A;  4RES B;  2OTK E;  3BCC G;  1SQB G;  2E75 B;  1LTT C;  5B66 H;  2XDJ A;  2OYH B;  3GW6 A;  1KN7 A;  3UIA A;  1VDF A;  2QA4 P;  1EDJ A;  1VF5 B;  1G1I A;  2JWD A;  1RF0 C;  4R4M A;  1P84 E;  4PD4 E;  2GM4 A;  2FXM A;  1EDL A;  1PP9 G;  3CXH H;  4U3F E;  1N86 A;  5CBN A;  1ZME C;  1JCD A;  1RQU A;  1IK7 A;  3PRJ A;  4ZKU A;  1J1D C;  3CCM P;  3CD6 P;  1BGY G;  4H44 C;  2I8D A;  3VTP C;  2NPS A;  2H43 A;  1KQS O;  3L71 E;  1FJP A;  2Z4E A;  3H1L D;  2P7J A;  4RKU J;  3H25 A;  3H1I D;  2C0X A;  2RKL A;  1OVV A;  1FZB A;  2KIK A;  3V4Q A;  3AEC C;  1EZV I;  1QL1 A;  3L75 D;  2ZXX A;  3MIW A;  1FZC C;  3MZW B;  3MP7 B;  1LWU A;  3D71 A;  2A45 I;  4KJM A;  1H89 A;  1H88 A;  1T2K C;  1RE4 A;  1KFM A;  3CCJ P;  3E7K A;  3CCV P;  1GW4 A;  3OAK A;  2KI7 B;  5APV A;  4RJT A;  1VQ5 P;  1YBK A;  2HLO A;  3RBX A;  4QMA A;  2WTY A;  1RF1 C;  5CMZ A;  1R5S A;  2OAR A;  3WUU A;  2QRX A;  2WWW A;  3H1K D;  2G3A A;  2O01 H;  2M8R A;  5AVX B;  4GIF A;  3TGU J;  3H1J D;  3V2P A;  3CX5 H;  1NTM G;  1PFI A;  1SFC D;  3CWB E;  2B89 A;  1JY2 N;  4UB6 E;  2G8Y A;  4WY4 B;  4EI2 A;  1X22 A;  1SQQ E;  1JO5 A;  1S3J A;  5H2F E;  3USS A;  4IFD K;  5AW4 B;  1OW6 A;  4H0L B;  2BEQ D;  2O1J A;  3V2Q A;  1PGO A;  2RH0 A;  1AQT A;  3L73 G;  1KYO I;  3E1I A;  1EZV G;  4ZKP A;  1SQQ J;  3TDK A;  1ZN5 A;  2D2C B;  2ZT9 D;  2IZ0 A;  1G2C B;  3VOP A;  2FYN B;  1KQG B;  2E76 B;  2IDB A;  1ZP0 C;  1CI6 A;  2GA1 A;  1SQQ K;  2N9Y B;  3AEA C;  4H13 B;  1T2K D;  3H1L J;  3L70 G;  4AUW A;  3HE4 A;  2KUB A;  2WPR A;  5DJU B;  1FZE A;  5E79 H;  3A0B E;  3C1L A;  3SWK A;  3V5B A;  2WIT A;  3M06 A;  3L75 J;  3M0D A;  3EFG A;  2C0W A;  2B87 A;  3HTK A;  2YKO A;  5GTH H;  1BE3 G;  2JDI H;  4GOD A;  4DZO A;  3H1K G;  2PRR A;  2QM8 A;  1FZA A;  1M1J A;  3C9I A;  3H1J G;  1YI2 P;  4UB8 H;  1NJI Q;  5AVS B;  2HPC A;  1J1E C;  2I1K A;  2OYI C;  1S2E A;  4YXD C;  3JC2 2;  3H32 A;  3WU2 H;  3NMD A;  3S9O A;  2QVA A;  2B88 A;  3QWO C;  4I7Z B;  2AXC A;  1LTI C;  3L72 E;  3H1H D;  4OGQ D;  1SQX E;  2R3S A;  2POH A;  5CCH D;  3HTK B;  2Q3E A;  5APY A;  1URQ B;  1S9K E;  1PGP A;  5AVW B;  4D6T G;  3CC7 P;  2B9B A;  3A0H E;  1ZV8 A;  5KAF E;  1M1J B;  3L37 A;  2IZ1 A;  1M90 Q;  4PJ0 H;  1RF0 A;  1IFJ A;  3I56 P;  1LTJ C;  4ZMD A;  5AVV B;  2Y0C A;  2FYU E;  3VYI A;  3HE5 A;  2E5Y A;  1LP1 A;  3LW5 H;  1JMB A;  1NTZ G;  1SFC A;  2W83 C;  3NTN A;  1JM0 A;  1L0L J;  2ITA A;  1DEE G;  1N7S B;  1Q81 Q;  1K05 A;  3A2A A;  2FYU J;  2HG5 D;  2E75 D;  1M7L A;  3VMX A;  2OTL P;  2KNC A;  1BCC D;  2KLV A;  2V7Q H;  3T97 B;  1L0L K;  1JY3 O;  2FYZ A;  1VF5 D;  1E79 H;  1KIL C;  3B5N C;  3RK3 E;  5AW5 B;  4C7N B;  3W67 A;  2KK7 A;  1S4X A;  1IJD B;  5AW9 B;  3VP8 A;  4PV1 C;  1FC2 C;  5CJ0 A;  1NTK E;  1JTH A;  2KLU A;  1FZC A;  1KB9 D;  1LT1 A;  1SQP E;  1L0N G;  1KB9 I;  4BWN A;  2E5T A;  2WSE J;  3L74 D;  1CW5 A;  1J1D B;  1FDO A;  3A7O A;  3RK2 C;  1OW7 A;  4H44 B;  4OVN F;  2WZ7 A;  4DOJ A;  1PPJ D;  1X0T A;  2QEX P;  3GHG C;  1U7J A;  3CXH E;  1SQP J;  5KLV E;  4OH8 B;  4H0L C;  3H1H J;  1WMK A;  1RF1 A;  3M9Q A;  4EDF A;  2Q3I A;  1JTH B;  1SQP K;  2BCC G;  4JPZ B;  1SS1 A;  5KTB A;  2KS1 A;  3MTU E;  1RE3 A;  1AQ5 A;  3LIE A;  3GF7 A;  2QJY C;  2WSF J;  1KMI Z;  2HFE D;  3JCU H;  3AE7 C;  2KXP B;  5CCH A;  4L75 A;  3FWN A;  5B5E H;  2BCC E;  1RF1 B;  3PTZ A;  3RL0 C;  3CCE P;  1YHQ P;  1AVY A;  1ZXG A;  3TNU A;  1VQ6 P;  2PGD A;  1KQL A;  4JBZ A;  1X8Y A;  3AE6 C;  1P84 D;  4PD4 D;  1H0T A;  1IFD A;  3RBZ A;  2KS1 B;  1P84 I;  4PD4 I;  1BCC J;  1Y47 A;  1Q7Y Q;  4IOI H;  1FOS E;  1AFO A;  3CC4 P;  1G1J A;  4U3F D;  4HH2 A;  4HKZ H;  4N3Y B;  2L5G B;  2XU6 A;  3GLM A;  3BRV B;  4NPD A;  4ASV A;  1PZQ A;  3AEF C;  1KYO H;  1BDC A;  1QL2 A;  1WT6 A;  4WY4 D;  1T8Z A;  2WSC J;  4W7Z A;  1FE6 A;  1FDI A;  3TNU B;  3CX5 E;  2JWA A;  3MUD C;  1VQO P;  4H0L D;  1PV3 A;  3L71 D;  3L74 J;  4JQ0 D;  2ZJS E;  4WVZ A;  1SQV J;  1GZL A;  4WB4 A;  1ZOY C;  3KDP B;  3HD7 B;  2D2C D;  2A06 E;  2IFM A;  2OYI A;  2P58 A;  1YJW P;  1NU1 E;  1GDT A;  2UWJ E;  2N1T C;  2E76 D;  3V4W A;  1AJY A;  1SQV K;  4H13 D;  1L4A C;  4N78 D;  3E1R A;  1AV1 A;  3TGU D;  5CJ4 A;  1N7S C;  2P10 A;  3BCC E;  2YO2 A;  4B86 A;  1U7M A;  4IL6 H;  1FS0 E;  1VQ9 P;  3M91 A;  1KFN A;  1JOC A;  1KIL E;  2QIW A;  2FY8 A;  3OA7 A;  3CCQ P;  1SQB E;  1J1E B;  2ZYD A;  2OYI B;  3PP5 A;  1M57 D;  5E79 E;  3F5H A;  1NO4 A;  4YXW H;  3CCL P;  1HBW A;  3NFQ A;  2QJK B;  2PAJ A;  3N7N A;  1USD A;  5AW3 B;  3U1C A;  1N73 C;  1U57 A;  5GTH E;  3AED C;  1BSN A;  3CWB D;  3TSI A;  1Y9B A;  1SQQ D;  4O9B A;  4UB8 E;  3AE4 C;  5AW2 B;  1PP9 E;  2CK3 H;  4U3F J;  1URQ D;  4LC1 A;  5EFW B;  4Y99 B;  3G4S P;  3WU2 E;  1LTJ B;  3Q5S A;  2Y0E A;  2N9B A;  3V2N A;  1YYC A;  1J2J B;  3R4Y A;  1W2E A;  4BRY B;  3Q3D A;  1IFP A;  1BGY E;  2OTJ P;  3L71 J;  5APT A;  5L8R J;  3CCU P;  4PJ0 E;  2AEM A;  1HH0 A;  1NAF A;  2C9L Y;  3CCR P;  4WY4 A;  1VQ8 P;  1N7S D;  3WUV A;  1S5L H;  3VP9 A;  3RGU A;  1JY2 O;  3A3Y B;  3A5T A;  1KIL B;  3B5N B;  4EOT A;  1HF9 A;  4PV1 B;  1VQK P;  1OZH A;  5KJ7 C;  1NGM B;  4GKG A;  3RK3 C;  3D6Z A;  1HGV A;  1KB9 H;  1OXZ A;  2KOG A;  2ZXE B;  5BU8 B;  1G2C A;  3LW5 J;  1YTZ I;  1FJK A;  2QM7 A;  3RK2 B;  1E5W A;  3KPE A;  3L4F A;  3VMZ A;  3L72 D;  1Q2N A;  1SQX D;  1A02 F;  2K9Y A;  3GHG B;  4NPE A;  3Q2Y A;  2J5U A;  2ZYG A;  5KAI H;  1EXJ A;  1S9K D;  2YNY A;  3HUS C;  2H8P D;  1NTM E;  4H44 D;  3PJS K;  1X79 B;  2WT7 B;  3H1L G;  3CWB J;  3H1I G;  4XE5 B;  4JF7 A;  3NXS A;  3L75 G;  1WRG A;  5CCG C;  1L0L D;  1CZQ A;  2A45 G;  5BU5 A;  1XTG B;  1M1K Q;  1GL2 C;  1NTM J;  2FYU D;  3CI9 A;  5APQ A;  2C9N Y;  2XZR A;  3HD7 C;  2QJY B;  3B8E B;  2MJZ A;  3L73 E;  4GOE A;  2K9J A;  3M9H A;  1EZV E;  2Y9Z A;  3M9B A;  2FXO A;  2YXR B;  1NTM K;  3U59 A;  2IBZ D;  1NKZ B;  1NHL A;  3IR9 A;  3RL0 B;  1Q82 Q;  5CHX A;  1LJ2 A;  1KC8 Q;  2IBZ I;  3WMM 0;  2R44 A;  1IO4 A;  4IL6 X;  2IPP A;  3L73 J;  3MUD A;  3FGA D;  1URQ A;  1FZG A;  2K1A A;  3L70 E;  3II6 A;  3JCU E;  2Q5U A;  2V4H A;  3AEE C;  1ZRT D;  2R5D A;  1HTL C;  1H8A A;  2K9J B;  5B5E E;  1JY3 P;  4WBA A;  1MFT A;  1NTK D;  3N4X A;  1BE3 E;  4ZNC A;  3L70 J;  2QJK C;  1SQP D;  2JJL A;  1YJN P;  4GT1 A;  3H1K E;  1DD3 A;  4CPG A;  4JYC A;  3H1J E;  2W6A A;  4Z1M H;  1EQ7 A;  4N6J A;  1LTS C;  3Q5P A;  1N7S A;  3C8V A;  3FXD A;  5KLV D;  3L72 J;  1L0L G;  2O1K A;  4Y99 C;  1SQX J;  3OW2 O;  3T97 A;  2WPQ A;  2N1T B;  2IFN A;  1KYO E;  4ASW A;  5AVZ B;  4D6T E;  2O3J A;  4C7N A;  5AW7 B;  3HD7 D;  1SQX K;  2K3R A;  1L4A B;  2FBW C;  2J59 M;  4WWI A;  4D6T J;  1S5L X;  3HRN A;  1R5L A;  3CMA P;  1W2B O;  1Y8A A;  4KHX A;  5GTI H;  1KZU B;  1VL2 A;  4XFJ A;  2LXC B;  5APX A;  3AEG C;  1OMI A;  1NTZ E;  2FYU K;  1RQV A;  3KQG A;  5B66 E;  3LID A;  1N73 B;  5AVR B;  3GMA A;  2FKW B;  2W6B A;  3IAO A;  1T3U A;  4I1L A;  3BVH A;  1BDD A;  1FBM A;  3U1A A;  3H1H G;  1KD1 Q;  4IL6 E;  1Q90 D;  2QG4 A;  2YO3 A;  3B4S A;  1SQV D;  1FAV A;  1MV8 A;  1NTK J;  1LWU C;  3H6P A;  3AEB C;  3CX5 D;  4OWF A;  2H89 C;  1RE4 C;  3CX5 I;  1LTB C;  1L0N E;  4M3L A;  2HOD A;  3AE5 C;  1KOR A;  1NTK K;  1W5C E;  2M3E A;  2A45 H;  1QLE D;  4BXL A;  1OW8 A;  1VQL P;  1OX3 A;  2A06 D;  1BSH A;  5KLV J;  2Q6Q A;  2WMM A;  2K37 A;  1LT9 B;  1DX7 A;  1ZR2 A;  2W90 A;  1DEB A;  2Y0D A;  2M5A A;  1YQ4 C;  1BCC G;  5KLV K;  2PFX A;  3D70 A;  3G71 P;  4GOF A;  3ZDM A;  2AEF A;  4EYY Q;  1SVF A;  1IFN A;  3Q1M A;  1CSB A;  5TJH A;  2HOD B;  3HUS A;  1LTG C;  3BCC D;  1GU5 A;  3RK3 B;  3AE8 C;  1FZF A;  1KIL D;  3B5N D;  1NYH A;  2FFD B;  1SQB D;  1ZR4 A;  1VQ4 P;  3O6Q B;  2P1J A;  5APU A;  1HVV A;  4PV1 D;  1PGJ A;  2JP3 A;  3IN6 A;  5C39 A;  2BCC J;  1S5L E;  1EC5 A;  3HD7 A;  1QEX A;  1VPC A;  3L74 G;  2M5A B;  1YIJ P;  2WSS H;  3CME P;  5APW A;  2R3C A;  4Y28 J;  1SQV G;  2GUV A;  2ZVO B;  2O01 N;  3RK2 D;  3HUS B;  1PPJ G;  1N8R Q;  3JSV C;  1VQM P;  1KQF B;  2VRS A;  4YPC A;  3P8C E;  1QGK B;  2YMY A;  1EDK A;  2NRG A;  2ZAE B;  4JYB A;  1FDM A;  3MD0 A;  1GL2 B;  3M0D C;  2O01 J;  1ZLL A;  2H7H A;  3P7K A;  5KAI E;  3SWY A;  3KYQ A;  3CLQ A;  2YKP A;  2CPB A;  3OJA B;  2I1J A;  3EWK A;  4IFF A;  1DD4 A;  1GK6 A;  2KB7 P;  3D6Y A;  1YJ9 P;  2YXQ B;  1K9M Q;  5KKZ C;  1MFZ A;  1NU1 J;  3L36 A;  1AVO A;  3ABV C;  3RL0 D;  1DH3 A;  2P67 A;  3KHU A;  3S1K A;  2WPV B;  4AYC A;  2WSE H;  1K04 A;  3KZI H;  1IZN B;  2R32 A;  2LKM A;  1HUC A;  3TYY A;  1LTJ A;  1NU1 K;  1JY2 P;  2AEJ A;  2RN0 A;  4U3F G;  2XKM A;  2W27 A;  2QJP C;  3BCC J;  4U7J A;  2KZI A;  4BRY A;  1LTA C;  2AXT H;  3SWF A;  1SQB J;  4YTP C;  4K35 A;  1IFI A;  1SLQ A;  4MN4 C;  1UIX A;  4I6M C;  5KLI C;  2K88 A;  1SQB K;  3L71 G;  1NTM D;  1SFC C;  2YKQ A;  2WSF H;  3Q5R A;  4DCK A;  1KIL A;  3B5N A;  1RY3 A;  1X9V A;  2JKV A;  4DJG A;  1PP9 J;  2N1T D;  1NH4 A;  2JEE A;  3CL3 D;  5AW8 B;  2WQY C;  1L2P A;  3TF5 A;  3L73 D;  2OQQ A;  1HJB A;  5TIS H;  1EZV D;  1L4A D;  2ZT9 C;  1LT9 C;  4W7Y A;  1MZ9 A;  3AE2 C;  3TGU G;  2E43 A;  1N2D C;  2MKV A;  1KTM A;  2KSJ A;  1BGY J;  3GHG A;  3VMY A;  3GF3 A;  1FU1 A;  1VQP P;  1QX8 A;  4N78 E;  3L70 D;  3CC2 P;  2ZFC A;  4HYT B;  2WT7 A;  2NPS B;  2WSC H;  3RL0 g;  3TGU E;  3F89 A;  2FFD C;  3FXE A;  2P2U A;  2M0B A;  5GTI E;  4NPF X;  3CWB G;  1A02 J;  1HGZ A;  2L91 A;  1BE3 D;  1SQQ G;  2DW3 A;  1PIX A;  1LWU B;  4R4L A;  3V2R A;  2QSI A;  2E74 B;  2H88 C;  1RE3 C;  2V7Q J;  4KT0 J;  3W68 A;  2ZVN B;  4OGQ C;  5CCH C;  5AVQ B;  1YIT P;  3R2P A;  2NZ2 A;  1OIP A;  2QE7 H;  2W6J H;  1YTZ T;  1KYO D;  4GDO A;  5DJT B;  1S1C X;  4D6T D;  2J58 A;  2OGU A;  1OVU A;  3MGN A;  3H1L E;  3IFM A;  3P32 A;  3H1I E;  1T6A A;  1QVG O;  1JCC A;  1K8A Q;  1MUU A;  3FX0 A;  3SSU A;  3L75 E;  4RO0 A;  5AVU B;  2LR2 A;  4XA4 A;  1ZW0 A;  3H1I J;  1NKN A;  4L76 A;  1P84 H;  4PD4 H;  1IK9 A;  1OFC X;  2KP8 A;  5KJ7 D;  3G6E P;  1NTZ D;  3I55 P;  3S4R A;  1M56 D;  2WVR A;  3RK3 D;  3TK1 A;  1PGQ A;  2E75 C;  4HJG H;  2OYH C;  5K5G B;  3G3Z A;  1JUN A;  2YIU B;  2IYO A;  2N1T A;  1M8O B;  1OWA A;  3L72 G;  1VF5 C;  1T3J A;  1SQX G;  2XV5 A;  3SFE C;  1CI6 B;  1L4A A;  2XND H;  3O8Z A;  2SPZ A;  2WPS A;  3HE4 B;  4DT0 A;  1VQN P;  3FWL A;  3SFD C;  2E42 A;  1BE3 J;  3CXH D;  3CPW O;  3H1K J;  2M3B A;  3MHV A;  3PH0 A;  1NVO A;  3CXH I;  1L0N D;  2B87 B;  3H1J J;  1S72 P;  5CCG D;  2FYU G;  3IF4 A;  1GL2 D;  3WUT A;  2HYN A;  1NAY A;  5AVT B;  1USE A;  2KYV A;  1N73 A;  2HPC B;  1SP4 A;  1KV4 A;  2CPS A;  2GUS A;  3VMA A;  3BAT A;  2IBZ G;  1L0L E;  5KKZ B;  3AE9 C;  3H32 B;  5AVY B;  3EFF K;  3KXD A;  1GMJ A;  2BCC D;  2Q7C A;  2YMK A;  1AA0 A;  2BAS A;  3L35 A;  2IBZ E;  4I2L C;  3G9R A;  2QJP B;  4L73 A;  1PL5 A;  3V6I A;  1NTK G;  4C46 A;  1K73 Q;  3B71 A;  2XNX A;  2BEZ F;  2NPS C;  1N7L A;  1SQP G;  2Z5H A;  1RHZ B;  1D7M A;  2IX7 C;  1MKM A;  4UB6 H;  1GW3 A;  2IYP A;  1HJ0 A;  1IFM A;  2LXB A;  3HE5 B;  1UII A;  1NTZ J;  2RMZ A;  3EQ2 A;  1LP1 B;  1ZRT E;  3KZI E;  5H2F H;  1JMM A;  1LT9 A;  4A7P A;  5KLI B;  1R8E A;  4AQR D;  4LGD E;  1SFC B;  2R5B A;  5KLV G;  1NTZ K;  3P8C D;  3PLN A;  1YQ3 C;  3H1H E;  5APS A;  2AXT E;  2E74 C;  1JY3 N;  2KNC B;  1NWQ A;  1GU4 A;  1EXI A;  5KJ7 A;  4WY4 C;  1Q86 Q;  1GK4 A;  2FFD A;  1NU1 D;  3O6Q A;  2ZT9 B;  1L0N J;  1JB0 J;  5AW0 B;  1JNM A;  3A0B H;  3AE3 C;  3QH9 A;  3P8M C;  2PP6 A;  4K3A A;  2ZYA A;  1XTC C;  1FZC B;  3AE1 C;  2D2C C;  1VQ7 P;  2JO1 A;  1QVF O;  1L0N K;  2FYN C;  2E76 C;  2JR8 A;  3BRT B;  2Y9Y A;  4H13 C;  3VN0 A;  5TIS E;  4C7R A;  4IFM A;  1Z56 A;  5CCG A;  3M0A A;  1BCC E;  2OYO A;  2NPS D;  1GL2 A;  1NOH A;  3CCS P;  2YIU C;  1DIP A;  4EIJ A;  5AW1 B;  2Q9I A;  1JEK A; 
#chains in the Genus database with same CATH homology
 1KYO H;  1BCC G;  1BE3 G;  1PPJ G;  3H1I G;  2A06 G;  1EZV G;  3L70 G;  1SQQ G;  2BCC G;  5KLV G;  3H1K G;  1SQP G;  1NU1 G;  3L72 G;  1P84 H;  4PD4 H;  1SQX G;  1PP9 G;  3H1H G;  3H1J G;  3TGU G;  1L0N G;  1L0L G;  4U3F G;  1NTZ G;  3BCC G;  3L75 G;  2IBZ G;  3CXH H;  1KB9 H;  3CX5 H;  1BGY G;  3L74 G;  1NTM G;  3L71 G;  2FYU G;  4D6T G;  1SQB G;  3L73 G;  3CWB G;  1SQV G;  3H1L G;  1NTK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...