1SQPG

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqpG00
3BCCG 1BGYG 1KB9H 3L71G 1NTKG 1PPJG 3H1KG 4D6TG 3H1HG 3TGUG 1EZVG 1NTMG 1SQPG 3CXHH 1KYOH 3L75G 4PD4H 1PP9G 1BCCG 2FYUG 3CWBG 3H1IG 1SQBG 2A06G 3L72G 5KLVG 1SQVG 3L74G 4U3FG 1P84H 1NU1G 2IBZG 3CX5H 1L0LG 3L70G 1NTZG 2BCCG 3L73G 3H1JG 1L0NG 1BE3G 3H1LG 1SQXG 1SQQG
chains in the Genus database with same CATH superfamily
3S4RA 2QVAA 2CPSA 2IZ0A 1NAYA 2NPSB 3CX5D 3CCLP 1U57A 1RF1C 2IDBA 3M9QA 3AE4C 3E1RA 4I6MC 3ZDMA 1SQXK 4JPZB 4LC1A 5BU5A 2D2CD 2CK3H 1SVFA 2O3JA 3L73E 4RESB 4AYCA 3CCEP 3Q2YA 1LWUA 2GA1A 3H1LE 4GDOA 4U3FD 1HF9A 3E1IA 4JQ0D 1AQTA 2M5AA 1X79B 2OYHC 3HD7A 1SQVJ 5CCHC 1LTTC 3H1IE 2N1TA 2LKMA 3M9HA 1AVYA 2OARA 4DJGA 2R5DA 2W90A 1JY3O 2KZIA 3WU2E 1L0LD 2HLOA 1L0LG 4H0LB 2BCCE 1L4AA 1PGPA 3AECC 3LIEA 5CCHD 3A0BE 3P7KA 1BE3G 3MHVA 1ZN5A 2A45H 2AXTH 3H1HE 4XFJA 2W27A 3CL3D 1RE4A 3Q5PA 3VP8A 1Q81Q 5AVQB 2ZFCA 4IOIH 1NOHA 1FBMA 1NTMD 3S1KA 3CC2P 3L73D 4ZKUA 1SQQD 2ZT9B 2IX7C 2OGUA 2M0BA 2WSFJ 1FAVA 1QX8A 3P8CE 2C0XA 2V7QH 3V5BA 3QH9A 1KTMA 1SQBJ 1RE3A 1H0TB 1KILA 2IFMA 1RF0C 2YO3A 3H1HJ 3GHGC 2R44A 3AE9C 3H1JJ 2OYIA 1M1JB 3CWBD 4H0LD 3V4WA 3B5ND 1PP9E 2V4HA 1LT9A 1LWUB 2RKLA 2Q6QA 1URQD 1Q2NA 4U3FG 1FC2C 3W67A 2V7QJ 1SQQK 1FZCA 1BE3J 2WTYA 1WT6A 1VQ6P 4NPFX 4UB6H 1T2KD 2AXTE 1Y47A 1L0NG 2R32A 1P84D 2ZXXA 1R8EA 3A0BH 3MTUE 1EXJA 1SQXG 2E5TA 2RMZA 5GTHH 3SFDC 4QMAA 3L71G 1S4XA 4DOJA 1L0NK 2KS1A 3MP7B 2QEXP 2XNXA 2OQQA 2Y0DA 2POHA 1T2KC 1S72P 1NWQA 1RF1B 2Z5IA 3LW5J 5KLVD 3CCVP 3HE4B 1NTMG 3PRJA 4UB8H 2J5UA 1JUNA 1YQ3C 3L70J 1DEEG 3IF4A 2FKWB 1N7SC 3Q3DA 4TLFA 1GK4A 1LTJB 2A06D 3NFQA 2Z4EA 3KZIH 1SQPE 1VQ9P 1CZQA 1SFCB 2FYUE 4I2LC 3M91A 2ZVOB 2I1JA 3T97A 1Y9BA 3SWKA 1BDCA 3FWLA 5APYA 1JY3P 1OVRA 2JWDA 3N4XA 4OH8B 2KP8A 5AVWB 2JKVA 1HGZA 2KIKA 1N7SD 3CX5H 4H44C 3CWBJ 4XE5B 3LW5H 1SQXJ 5H2FH 3HUSC 1HVVA 1DIPA 1HJ0A 1YJNP 3HE5A 5KAIE 1PPJE 3MUDA 2W83C 1G2CB 4PJ0H 3CLQA 5B66E 1MV8A 4U3FJ 3L4FA 1FDMA 1YTZI 5AVUB 1NHLA 4DZOA 1FDOA 1VF5C 3RL0B 1K8AQ 2BCCD 3RBXA 3LIDA 1NTZJ 3IR9A 5TISH 1QVFO 5AW9B 3VMYA 2LXCB 3B5NC 1IO4A 2E42A 1UIXA 3L74J 2B87A 2QG4A 3I55P 3Q1MA 3RBZA 3GHGB 1GL2D 2PP6A 3BRTB 4AUWA 1NTKJ 2BEQD 4U3FE 3A2AA 1P84H 5KLIC 1G1JA 3M06A 1OXZA 2ZYGA 4BRYB 3V2PA 1MZ9A 1FZEA 1NU1D 1S1CX 1KC8Q 4Y99B 1MFZA 1YJWP 2YO2A 2D2CB 3RL0D 3MIWA 1ZR4A 1JO5A 1LT9C 1ZP0C 4M3LA 5AVVB 2J58A 2XZRA 2PRRA 2XKMA 2VRSA 3TYYA 5GTIE 4ASVA 1SFCA 2DW3A 2MKVA 4PD4D 5CCGA 5C39A 1N86A 3L71J 1KORA 3AEGC 4EOTA 1H88A 2C9LY 5KAFH 1Y8AA 3L70E 2K9YA 2NZ2A 1R5LA 2ZYDA 1DD4A 2KZJA 1QLED 1R5SA 1KZUB 3C1LA 3FX0A 1NU1K 4L73A 4PV1D 2HPCB 1M56D 4WY4D 5AVTB 3A3YB 1E5WA 2IBZD 2A06G 3JSVC 1NU1E 1LNQA 4K35A 1IZNB 3P8MC 1KYOD 3AEFC 3N7NA 2GM4A 1KILE 2KB7P 1VQ8P 3L72D 1W2EA 1KB9D 2JO1A 3H1IJ 1LGHB 2W6BA 3AEDC 3CC4P 1SQXE 1FZGA 1VQ4P 2FBWC 2M3BA 1IK9A 1IK7A 1Z56A 1KYOI 2AEMA 3H1LG 4N78D 4RO0A 2KSJA 1A02F 1L0LK 5AVXB 2FFDC 1GU5A 1KB9H 1CSBA 2N1TC 3RK2C 1JCCA 1UIIA 1LTBC 2O1JA 1NTKG 2P10A 2ZAEB 1GU4A 1L4AB 3AE1C 3NTNA 4PD4E 3U59A 2Q1KA 1FZBA 2Q5UA 3M9BA 4YPCA 1IFDA 2UWJE 3GW6A 3L75J 3I56P 1BGYJ 2Y0CA 1LP1B 1T3JA 1X9VA 3TGUD 4ASWA 1ZOYC 2WPQA 3CI9A 1HUCA 1IFMA 1JTHA 2R5BA 5CCGC 2H88C 4I7ZC 1FE6A 5AVZB 4D6TE 3H25A 1LT1A 1RF1A 3AE7C 3WU2H 5APTA 3CWBG 2H43A 1OVUA 3VOPA 3TGUJ 1FZFA 1FS0E 3V6IA 2QJPC 2Y9YA 3VP9A 2HG5D 3VTPC 1M7LA 1OFCX 5E79H 1LTJA 1BCCJ 2IYPA 1KFMA 1JTHB 1FJKA 1KQLA 3EFGA 5EFWB 1GDTA 1RE3C 4H0LC 3EQ2A 2XNDH 2W6JH 1NKNA 3EWKA 1MUUA 1SQQG 1AJYA 3AEEC 1M8OB 4Y99C 2JJLA 4C46A 1HH0A 2B89A 2P1JA 2D2CC 1PP9J 4TT3H 1OX3A 2FXMA 2QA4P 1RY3A 1K04A 4GOFA 1N7LA 4L74A 1QL1A 1N73A 1JCDA 1OIPA 2HFED 1BSHA 1SQPG 3CXHH 2KXPB 3WUVA 2Q7CA 3RK3E 2KLVA 3HTKA 1PPJD 5CJ4A 1K9MQ 4JYBA 1JB0J 4RKUJ 2WPRA 2KSEA 4BWNA 1PZQA 4GOEA 3CCJP 1N73C 1FZCB 3OW2O 3MZWB 4HYTB 1AA0A 1AVOA 1NTZD 1NU1J 2WSEJ 1PGOA 1IFIA 1VL2A 4DT0A 1M1JC 3VN0A 5CCHA 5GTIH 1N8RQ 3CD6P 2OYHA 2J59M 3HUSA 2B87B 2IBZG 2IYOA 1LWUC 3L35A 4IL6E 1NTMJ 1RF0A 1KILC 2WPVB 1SQQJ 2C0WA 2WWWA 3KYQA 1NYHA 1RQVA 4O9BA 2GUSA 2H89C 1RQUA 2N1TD 1JY2P 1JOCA 3AE5C 1JM0A 4OGQB 4WY4A 3RK2D 1W5CE 2QJYC 2I1KA 3KQGA 3GG2A 1SLQA 1BGYD 2YIUC 3BCCG 1ZLLA 5AW1B 1MKMA 1P84E 1IFPA 1WRGA 4N78E 1HWTC 3BASA 3H1HD 1N7SA 1NAFA 1SQVE 2QJKB 3H1HG 3H1JD 3G6EP 2Q3IA 3GMAA 3A7OA 1L4AC 3HE5B 5AVSB 1L0LE 1SFCD 2A45I 2XV5A 3V2NA 1SQQE 1SQBK 3Q5SA 2H8PD 1USEA 3FXEA 3H1KD 1KYOE 3L75G 1KMIZ 4EI2A 3USSA 3L72J 3H6PA 1EZVI 1N7SB 2KNCA 3H1IG 3H1ID 4I7ZB 4GODA 1LTJC 4BXLA 1SQBG 1CW5A 4HB1A 3TGUE 3RGUA 1OWAA 1SFCC 3L74E 3E7KA 3SWFA 1YJ9P 1DEBA 2NPSA 2YKOA 1XTCC 2P7JA 2YMKA 3C8VA 3WUUA 5KAIH 5KJ7A 1YITP 1NTZG 5H2FE 1Q82Q 1SQPJ 1U7MA 2AEFA 3P32A 4EDFA 2OTLP 4H44B 5DJUB 2FYNB 1S5LX 4D6TD 2WQYC 1VQPP 4L75A 3HUSB 1H0TA 1EQ7A 1X0TA 3CX5E 5KLVJ 2K9JB 3AEBC 1S5LE 2BASA 1X22A 3JCUE 3O8ZA 1IFNA 2WMMA 3C9IA 3L70D 3RK3B 4IFMA 3TSIA 4L76A 4IL6X 4YXWH 2QSIA 1FJPA 1JY2N 1L0NJ 2JEEA 4R4LA 2FFDA 1EC5A 3H32B 2FYZA 1J1EB 3D6ZA 4UB8E 2WZ7A 1KB9I 3GF7A 2JR8A 4Y28J 2YXRB 2RH0A 2O1KA 3FXDA 1N73B 5DJTB 1KB9E 2W6AA 2NRGA 3H1KJ 3MGNA 4KJMA 3TF5A 1NU1G 4W7ZA 4PV1C 1T3UA 1LTGC 4OWFA 5APXA 4Z1MH 1FOSF 4GT1A 4N3YB 2LXBA 1KILB 1NTKE 3TNUB 2N9YB 3V2RA 1BCCD 1Q86Q 2PGDA 2BCCJ 2QRXA 2KK7A 3CXHD 4OGQC 1VF5D 4C7RA 3HD7C 4H13C 1M1JA 2YIUB 3JC22 4PJ0E 1DH3A 3CCUP 1KFNA 2YMYA 1SQVD 1VQLP 4IFDK 1FOSE 3M0DA 1RHZB 3AE3C 2K1AA 3SFEC 4BRYA 4C7NA 1OVVA 2OTKE 4WVZA 5B5EE 2FYUD 1NTZK 5APWA 3L72G 1IC2A 3AE2C 3PHLA 4JYCA 5K5GB 1J1DC 2L5GB 5KKZB 5CCGD 1VPCA 3I5CA 3BCCJ 1GD2E 1URQA 1DX7A 3A5TA 1SQVK 2HR3A 3O6QB 3B5NA 3AE6C 2Q3EA 1OMIA 1YYCA 2A06E 2KI7B 1VQ5P 1L0ND 3HTKB 1W2BO 3L37A 3MD0A 1GW3A 1JY3N 2K37A 2WSCH 2YKQA 1E79H 3IFMA 4PD4I 3H1KG 2E74B 5APUA 2HODB 1FDIA 3R2PA 2N1TB 3PP5A 3RK2B 3CMEP 3UIAA 1N2DC 1ZRTE 2QE7H 3K5BA 3RK3C 2WT7B 1GZLA 2C9NY 1GL2A 1S3JA 3MUDC 3QWOC 5KLVK 2K9JA 3G4SP 1U7JA 2O01J 3EFFK 2JP3A 1EDJA 3PLNA 1GTWA 2ZJSE 3CWBE 3IN6A 1Q7YQ 4RJTA 1SQPK 2M8RA 1QEXA 1VDFA 2QM8A 1G2CA 1K05A 2WSCJ 3H32A 3JCUH 2AXCA 2E76B 1GMJA 3CMAP 5BVZA 3B4SA 1T8ZA 1XTGB 2QJPB 4LGDE 2FYUJ 3SWYA 1TU3F 4HJGH 4ZNCA 2XDJA 1J2JB 1H8AA 1RE4C 3H1JG 2SPZA 2WPSA 4OGQD 3WUTA 3A0HE 4H13D 1FU1A 1K73Q 1L2PA 2O01H 2B88A 1NTME 1BGYG 1JMMA 1BCCE 1X8YA 1ZRTD 2XU6A 3BCCD 2E75B 3PH0A 5CMZA 3VMAA 1PPJG 1JY2O 4DCKA 5L8RJ 3G9RA 4HKZH 1CI6A 2JWAA 4IFFA 3HD7B 3TK1A 1EZVG 1SS1A 4WBAA 1NO4A 1EZVE 2FXPA 1KYOH 1NGMB 3F89A 2P67A 2R3CA 1EDLA 1PL5A 2G8YA 5CBNA 1BCCG 4AQRD 3OJAB 1JMBA 1M1KQ 1HJBA 1FZCC 1GL2B 2CPBA 2ZT9D 1EDKA 1FZAA 1LP1A 1PGJA 2KOGA 2WSFH 3D6YA 1OZHA 3L72E 4K3AA 3L70G 2LR2A 1H89A 2BCCG 1EXIA 3P8CD 4UB6E 1ZR2A 2WSSH 1OW8A 5AW2B 1D7MA 2P58A 3FGAD 2ZYAA 2ZT9C 3L71E 3BVHA 1PGQA 5TJHA 1OW6A 3AE8C 2O01N 2WSEH 3AEAC 3CCMP 2QJYB 4ZKPA 1PIXA 5B5EH 1GK6A 2OYIB 1BSNA 3SSUA 2R3SA 5AW5B 2E74C 1EDIA 1LTIC 1QGKB 2QJKC 3CXHE 5AW0B 2IPPA 3CX5I 4GIFA 2IZ1A 1NTKD 3KHUA 1BE3E 2KYVA 2H7HA 2P2UA 1PP9G 3L75D 3PJSK 1VQ7P 2HODA 5AVYB 3VYIA 4WY4B 3H1LD 2K3RA 2E74D 2QM7A 1KILD 3KZIE 3G3ZA 5BU8B 3L36A 5M1BA 3CXHI 4ZMDA 1VQMP 1JEKA 1YBKA 3TDKA 4N6JA 2HYNA 3FWNA 3GHGA 1PV3A 4H44D 3ITKA 1KN7A 1GW4A 1HGVA 4W80A 1SP4A 1SQBE 3L71D 1JNMA 1AQ5A 1S9KE 1BGYE 2FYNC 2AEJA 1NJIQ 2WITA 2WVRA 1IJDB 1L4AD 1ZW0A 2G3AA 5B66H 4CPGA 4U7JA 2M5AB 2N9BA 5CBOA 2E75C 3H1JE 5AW6B 1P84I 4W7YA 3GLMA 3KXDA 1LTSC 1URQC 4GKGA 2L91A 4JBZA 4KT0J 4OVNF 3U1AA 3CC7P 1Q90D 3HD7D 4PD4H 1J1EC 2FYUG 3B8EB 1SQPD 1ZV8A 2E75D 3B71A 3O6QA 1NVOA 1EZVD 2M3EA 5AVRB 3II6A 3L74G 3L74D 3S9OA 4D6TJ 3TNUA 1GL2C 2RN0A 4WB4A 3M0DC 1A02J 3V2QA 2FYUK 1OW7A 1MFTA 5APSA 1QVGO 4PV1B 3WMM0 5APVA 2NPSC 5KJ7C 3ABVC 3H1KE 1BE3D 2E76D 3OAKA 3KDPB 1L0LJ 1USDA 2Y0EA 3BRVB 2ZXEB 3OA7A 1NTMK 3D70A 1VQNP 1M90Q 4R4MA 1VF5B 3RL0C 2OTJP 2Y9ZA 3Q5RA 1KQGB 1YQ4C 2FXOA 2I8DA 1S5LH 2MJZA 4H13B 3V4QA 3B5NB 3CCSP 3BCCE 4A7PA 2JDIH 3L73J 3H1LJ 5KAFE 1NH4A 1WMKA 3PTZA 2OYIC 2OYHB 2BEZF 2Z5HA 5KTBA 1KD1Q 1YHQP 5E79E 1YTZT 4HH2A 2YXQB 2ZVNB 4NPDA 4XA4A 4LLHA 1G1IA 3RL0g 1KQSO 5KLIB 3RK3D 5KLVG 3NMDA 4MN4C 4KHXA 3HE4A 2QIWA 3CCRP 3GF3A 2E43A 4WY4C 5KLVE 3BATA 5CJ0A 4B86A 2KLUA 2PAJA 5AW7B 1LJ2A 1NTZE 4NPEA 1AV1A 1PP9D 1J1DB 5KKZC 3W68A 1LT9B 2E5YA 3M0AA 1L0NE 1VQOP 1PFIA 2WT7A 1S9KD 5APQA 2OYOA 4YXDC 3CCQP 1KQFB 2FY8A 4D6TG 2KNCB 1LTAC 1S2EA 3TGUG 3U1CA 4EIJA 2IFNA 5GTHE 1RH5B 2GUVA 2B9BA 2YKPA 1QL2A 5CHXA 3CPWO 5TISE 1VQKP 4JF7A 1NTKK 2KUBA 2IBZI 1AFOA 1KV4A 1NKZB 1YIJP 1URQB 1HTLC 1SQBD 2W8ZA 4WWIA 3VMZA 3HRNA 4IL6H 3KPEA 3G71P 1HBWA 3F5HA 1CI6B 1SQXD 4EYYQ 1DD3A 1ZXGA 1SQVG 5AW3B 1YI2P 5AW8B 2PFXA 3A0HH 2HPCA 4C7NB 3D71A 2KS1B 2NPSD 5KJ7D 2ITAA 3L73G 2E76C 3NXSA 2Q9IA 1IFJA 2IBZE 3T97B 1ZMEC 2YNYA 2K88A 3VMXA 3IAOA 3R4YA 5AW4B 1M57D 4YTPC 2FFDB 3L75E 2A45G 4I1LA 1BDDA 1T6AA
chains in the Genus database with same CATH topology
3BCCG 1BGYG 1KB9H 3L71G 1NTKG 1PPJG 3H1KG 4D6TG 3H1HG 3TGUG 1EZVG 1NTMG 1SQPG 3CXHH 1KYOH 3L75G 4PD4H 1PP9G 1BCCG 2FYUG 3CWBG 3H1IG 1SQBG 2A06G 3L72G 5KLVG 1SQVG 3L74G 4U3FG 1P84H 1NU1G 2IBZG 3CX5H 1L0LG 3L70G 1NTZG 2BCCG 3L73G 3H1JG 1L0NG 1BE3G 3H1LG 1SQXG 1SQQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC G;  1BGY G;  1KB9 H;  3L71 G;  1NTK G;  1PPJ G;  3H1K G;  4D6T G;  3H1H G;  3TGU G;  1EZV G;  1NTM G;  1SQP G;  3CXH H;  1KYO H;  3L75 G;  4PD4 H;  1PP9 G;  1BCC G;  2FYU G;  3CWB G;  3H1I G;  1SQB G;  2A06 G;  3L72 G;  5KLV G;  1SQV G;  3L74 G;  4U3F G;  1P84 H;  1NU1 G;  2IBZ G;  3CX5 H;  1L0L G;  3L70 G;  1NTZ G;  2BCC G;  3L73 G;  3H1J G;  1L0N G;  1BE3 G;  3H1L G;  1SQX G;  1SQQ G; 
#chains in the Genus database with same CATH topology
 3S4R A;  2QVA A;  2CPS A;  2IZ0 A;  1NAY A;  2NPS B;  3CX5 D;  3CCL P;  1U57 A;  1RF1 C;  2IDB A;  3M9Q A;  3AE4 C;  3E1R A;  4I6M C;  3ZDM A;  1SQX K;  4JPZ B;  4LC1 A;  5BU5 A;  2D2C D;  2CK3 H;  1SVF A;  2O3J A;  3L73 E;  4RES B;  4AYC A;  3CCE P;  3Q2Y A;  1LWU A;  2GA1 A;  3H1L E;  4GDO A;  4U3F D;  1HF9 A;  3E1I A;  4JQ0 D;  1AQT A;  2M5A A;  1X79 B;  2OYH C;  3HD7 A;  1SQV J;  5CCH C;  1LTT C;  3H1I E;  2N1T A;  2LKM A;  3M9H A;  1AVY A;  2OAR A;  4DJG A;  2R5D A;  2W90 A;  1JY3 O;  2KZI A;  3WU2 E;  1L0L D;  2HLO A;  1L0L G;  4H0L B;  2BCC E;  1L4A A;  1PGP A;  3AEC C;  3LIE A;  5CCH D;  3A0B E;  3P7K A;  1BE3 G;  3MHV A;  1ZN5 A;  2A45 H;  2AXT H;  3H1H E;  4XFJ A;  2W27 A;  3CL3 D;  1RE4 A;  3Q5P A;  3VP8 A;  1Q81 Q;  5AVQ B;  2ZFC A;  4IOI H;  1NOH A;  1FBM A;  1NTM D;  3S1K A;  3CC2 P;  3L73 D;  4ZKU A;  1SQQ D;  2ZT9 B;  2IX7 C;  2OGU A;  2M0B A;  2WSF J;  1FAV A;  1QX8 A;  3P8C E;  2C0X A;  2V7Q H;  3V5B A;  3QH9 A;  1KTM A;  1SQB J;  1RE3 A;  1H0T B;  1KIL A;  2IFM A;  1RF0 C;  2YO3 A;  3H1H J;  3GHG C;  2R44 A;  3AE9 C;  3H1J J;  2OYI A;  1M1J B;  3CWB D;  4H0L D;  3V4W A;  3B5N D;  1PP9 E;  2V4H A;  1LT9 A;  1LWU B;  2RKL A;  2Q6Q A;  1URQ D;  1Q2N A;  4U3F G;  1FC2 C;  3W67 A;  2V7Q J;  1SQQ K;  1FZC A;  1BE3 J;  2WTY A;  1WT6 A;  1VQ6 P;  4NPF X;  4UB6 H;  1T2K D;  2AXT E;  1Y47 A;  1L0N G;  2R32 A;  1P84 D;  2ZXX A;  1R8E A;  3A0B H;  3MTU E;  1EXJ A;  1SQX G;  2E5T A;  2RMZ A;  5GTH H;  3SFD C;  4QMA A;  3L71 G;  1S4X A;  4DOJ A;  1L0N K;  2KS1 A;  3MP7 B;  2QEX P;  2XNX A;  2OQQ A;  2Y0D A;  2POH A;  1T2K C;  1S72 P;  1NWQ A;  1RF1 B;  2Z5I A;  3LW5 J;  5KLV D;  3CCV P;  3HE4 B;  1NTM G;  3PRJ A;  4UB8 H;  2J5U A;  1JUN A;  1YQ3 C;  3L70 J;  1DEE G;  3IF4 A;  2FKW B;  1N7S C;  3Q3D A;  4TLF A;  1GK4 A;  1LTJ B;  2A06 D;  3NFQ A;  2Z4E A;  3KZI H;  1SQP E;  1VQ9 P;  1CZQ A;  1SFC B;  2FYU E;  4I2L C;  3M91 A;  2ZVO B;  2I1J A;  3T97 A;  1Y9B A;  3SWK A;  1BDC A;  3FWL A;  5APY A;  1JY3 P;  1OVR A;  2JWD A;  3N4X A;  4OH8 B;  2KP8 A;  5AVW B;  2JKV A;  1HGZ A;  2KIK A;  1N7S D;  3CX5 H;  4H44 C;  3CWB J;  4XE5 B;  3LW5 H;  1SQX J;  5H2F H;  3HUS C;  1HVV A;  1DIP A;  1HJ0 A;  1YJN P;  3HE5 A;  5KAI E;  1PPJ E;  3MUD A;  2W83 C;  1G2C B;  4PJ0 H;  3CLQ A;  5B66 E;  1MV8 A;  4U3F J;  3L4F A;  1FDM A;  1YTZ I;  5AVU B;  1NHL A;  4DZO A;  1FDO A;  1VF5 C;  3RL0 B;  1K8A Q;  2BCC D;  3RBX A;  3LID A;  1NTZ J;  3IR9 A;  5TIS H;  1QVF O;  5AW9 B;  3VMY A;  2LXC B;  3B5N C;  1IO4 A;  2E42 A;  1UIX A;  3L74 J;  2B87 A;  2QG4 A;  3I55 P;  3Q1M A;  3RBZ A;  3GHG B;  1GL2 D;  2PP6 A;  3BRT B;  4AUW A;  1NTK J;  2BEQ D;  4U3F E;  3A2A A;  1P84 H;  5KLI C;  1G1J A;  3M06 A;  1OXZ A;  2ZYG A;  4BRY B;  3V2P A;  1MZ9 A;  1FZE A;  1NU1 D;  1S1C X;  1KC8 Q;  4Y99 B;  1MFZ A;  1YJW P;  2YO2 A;  2D2C B;  3RL0 D;  3MIW A;  1ZR4 A;  1JO5 A;  1LT9 C;  1ZP0 C;  4M3L A;  5AVV B;  2J58 A;  2XZR A;  2PRR A;  2XKM A;  2VRS A;  3TYY A;  5GTI E;  4ASV A;  1SFC A;  2DW3 A;  2MKV A;  4PD4 D;  5CCG A;  5C39 A;  1N86 A;  3L71 J;  1KOR A;  3AEG C;  4EOT A;  1H88 A;  2C9L Y;  5KAF H;  1Y8A A;  3L70 E;  2K9Y A;  2NZ2 A;  1R5L A;  2ZYD A;  1DD4 A;  2KZJ A;  1QLE D;  1R5S A;  1KZU B;  3C1L A;  3FX0 A;  1NU1 K;  4L73 A;  4PV1 D;  2HPC B;  1M56 D;  4WY4 D;  5AVT B;  3A3Y B;  1E5W A;  2IBZ D;  2A06 G;  3JSV C;  1NU1 E;  1LNQ A;  4K35 A;  1IZN B;  3P8M C;  1KYO D;  3AEF C;  3N7N A;  2GM4 A;  1KIL E;  2KB7 P;  1VQ8 P;  3L72 D;  1W2E A;  1KB9 D;  2JO1 A;  3H1I J;  1LGH B;  2W6B A;  3AED C;  3CC4 P;  1SQX E;  1FZG A;  1VQ4 P;  2FBW C;  2M3B A;  1IK9 A;  1IK7 A;  1Z56 A;  1KYO I;  2AEM A;  3H1L G;  4N78 D;  4RO0 A;  2KSJ A;  1A02 F;  1L0L K;  5AVX B;  2FFD C;  1GU5 A;  1KB9 H;  1CSB A;  2N1T C;  3RK2 C;  1JCC A;  1UII A;  1LTB C;  2O1J A;  1NTK G;  2P10 A;  2ZAE B;  1GU4 A;  1L4A B;  3AE1 C;  3NTN A;  4PD4 E;  3U59 A;  2Q1K A;  1FZB A;  2Q5U A;  3M9B A;  4YPC A;  1IFD A;  2UWJ E;  3GW6 A;  3L75 J;  3I56 P;  1BGY J;  2Y0C A;  1LP1 B;  1T3J A;  1X9V A;  3TGU D;  4ASW A;  1ZOY C;  2WPQ A;  3CI9 A;  1HUC A;  1IFM A;  1JTH A;  2R5B A;  5CCG C;  2H88 C;  4I7Z C;  1FE6 A;  5AVZ B;  4D6T E;  3H25 A;  1LT1 A;  1RF1 A;  3AE7 C;  3WU2 H;  5APT A;  3CWB G;  2H43 A;  1OVU A;  3VOP A;  3TGU J;  1FZF A;  1FS0 E;  3V6I A;  2QJP C;  2Y9Y A;  3VP9 A;  2HG5 D;  3VTP C;  1M7L A;  1OFC X;  5E79 H;  1LTJ A;  1BCC J;  2IYP A;  1KFM A;  1JTH B;  1FJK A;  1KQL A;  3EFG A;  5EFW B;  1GDT A;  1RE3 C;  4H0L C;  3EQ2 A;  2XND H;  2W6J H;  1NKN A;  3EWK A;  1MUU A;  1SQQ G;  1AJY A;  3AEE C;  1M8O B;  4Y99 C;  2JJL A;  4C46 A;  1HH0 A;  2B89 A;  2P1J A;  2D2C C;  1PP9 J;  4TT3 H;  1OX3 A;  2FXM A;  2QA4 P;  1RY3 A;  1K04 A;  4GOF A;  1N7L A;  4L74 A;  1QL1 A;  1N73 A;  1JCD A;  1OIP A;  2HFE D;  1BSH A;  1SQP G;  3CXH H;  2KXP B;  3WUV A;  2Q7C A;  3RK3 E;  2KLV A;  3HTK A;  1PPJ D;  5CJ4 A;  1K9M Q;  4JYB A;  1JB0 J;  4RKU J;  2WPR A;  2KSE A;  4BWN A;  1PZQ A;  4GOE A;  3CCJ P;  1N73 C;  1FZC B;  3OW2 O;  3MZW B;  4HYT B;  1AA0 A;  1AVO A;  1NTZ D;  1NU1 J;  2WSE J;  1PGO A;  1IFI A;  1VL2 A;  4DT0 A;  1M1J C;  3VN0 A;  5CCH A;  5GTI H;  1N8R Q;  3CD6 P;  2OYH A;  2J59 M;  3HUS A;  2B87 B;  2IBZ G;  2IYO A;  1LWU C;  3L35 A;  4IL6 E;  1NTM J;  1RF0 A;  1KIL C;  2WPV B;  1SQQ J;  2C0W A;  2WWW A;  3KYQ A;  1NYH A;  1RQV A;  4O9B A;  2GUS A;  2H89 C;  1RQU A;  2N1T D;  1JY2 P;  1JOC A;  3AE5 C;  1JM0 A;  4OGQ B;  4WY4 A;  3RK2 D;  1W5C E;  2QJY C;  2I1K A;  3KQG A;  3GG2 A;  1SLQ A;  1BGY D;  2YIU C;  3BCC G;  1ZLL A;  5AW1 B;  1MKM A;  1P84 E;  1IFP A;  1WRG A;  4N78 E;  1HWT C;  3BAS A;  3H1H D;  1N7S A;  1NAF A;  1SQV E;  2QJK B;  3H1H G;  3H1J D;  3G6E P;  2Q3I A;  3GMA A;  3A7O A;  1L4A C;  3HE5 B;  5AVS B;  1L0L E;  1SFC D;  2A45 I;  2XV5 A;  3V2N A;  1SQQ E;  1SQB K;  3Q5S A;  2H8P D;  1USE A;  3FXE A;  3H1K D;  1KYO E;  3L75 G;  1KMI Z;  4EI2 A;  3USS A;  3L72 J;  3H6P A;  1EZV I;  1N7S B;  2KNC A;  3H1I G;  3H1I D;  4I7Z B;  4GOD A;  1LTJ C;  4BXL A;  1SQB G;  1CW5 A;  4HB1 A;  3TGU E;  3RGU A;  1OWA A;  1SFC C;  3L74 E;  3E7K A;  3SWF A;  1YJ9 P;  1DEB A;  2NPS A;  2YKO A;  1XTC C;  2P7J A;  2YMK A;  3C8V A;  3WUU A;  5KAI H;  5KJ7 A;  1YIT P;  1NTZ G;  5H2F E;  1Q82 Q;  1SQP J;  1U7M A;  2AEF A;  3P32 A;  4EDF A;  2OTL P;  4H44 B;  5DJU B;  2FYN B;  1S5L X;  4D6T D;  2WQY C;  1VQP P;  4L75 A;  3HUS B;  1H0T A;  1EQ7 A;  1X0T A;  3CX5 E;  5KLV J;  2K9J B;  3AEB C;  1S5L E;  2BAS A;  1X22 A;  3JCU E;  3O8Z A;  1IFN A;  2WMM A;  3C9I A;  3L70 D;  3RK3 B;  4IFM A;  3TSI A;  4L76 A;  4IL6 X;  4YXW H;  2QSI A;  1FJP A;  1JY2 N;  1L0N J;  2JEE A;  4R4L A;  2FFD A;  1EC5 A;  3H32 B;  2FYZ A;  1J1E B;  3D6Z A;  4UB8 E;  2WZ7 A;  1KB9 I;  3GF7 A;  2JR8 A;  4Y28 J;  2YXR B;  2RH0 A;  2O1K A;  3FXD A;  1N73 B;  5DJT B;  1KB9 E;  2W6A A;  2NRG A;  3H1K J;  3MGN A;  4KJM A;  3TF5 A;  1NU1 G;  4W7Z A;  4PV1 C;  1T3U A;  1LTG C;  4OWF A;  5APX A;  4Z1M H;  1FOS F;  4GT1 A;  4N3Y B;  2LXB A;  1KIL B;  1NTK E;  3TNU B;  2N9Y B;  3V2R A;  1BCC D;  1Q86 Q;  2PGD A;  2BCC J;  2QRX A;  2KK7 A;  3CXH D;  4OGQ C;  1VF5 D;  4C7R A;  3HD7 C;  4H13 C;  1M1J A;  2YIU B;  3JC2 2;  4PJ0 E;  1DH3 A;  3CCU P;  1KFN A;  2YMY A;  1SQV D;  1VQL P;  4IFD K;  1FOS E;  3M0D A;  1RHZ B;  3AE3 C;  2K1A A;  3SFE C;  4BRY A;  4C7N A;  1OVV A;  2OTK E;  4WVZ A;  5B5E E;  2FYU D;  1NTZ K;  5APW A;  3L72 G;  1IC2 A;  3AE2 C;  3PHL A;  4JYC A;  5K5G B;  1J1D C;  2L5G B;  5KKZ B;  5CCG D;  1VPC A;  3I5C A;  3BCC J;  1GD2 E;  1URQ A;  1DX7 A;  3A5T A;  1SQV K;  2HR3 A;  3O6Q B;  3B5N A;  3AE6 C;  2Q3E A;  1OMI A;  1YYC A;  2A06 E;  2KI7 B;  1VQ5 P;  1L0N D;  3HTK B;  1W2B O;  3L37 A;  3MD0 A;  1GW3 A;  1JY3 N;  2K37 A;  2WSC H;  2YKQ A;  1E79 H;  3IFM A;  4PD4 I;  3H1K G;  2E74 B;  5APU A;  2HOD B;  1FDI A;  3R2P A;  2N1T B;  3PP5 A;  3RK2 B;  3CME P;  3UIA A;  1N2D C;  1ZRT E;  2QE7 H;  3K5B A;  3RK3 C;  2WT7 B;  1GZL A;  2C9N Y;  1GL2 A;  1S3J A;  3MUD C;  3QWO C;  5KLV K;  2K9J A;  3G4S P;  1U7J A;  2O01 J;  3EFF K;  2JP3 A;  1EDJ A;  3PLN A;  1GTW A;  2ZJS E;  3CWB E;  3IN6 A;  1Q7Y Q;  4RJT A;  1SQP K;  2M8R A;  1QEX A;  1VDF A;  2QM8 A;  1G2C A;  1K05 A;  2WSC J;  3H32 A;  3JCU H;  2AXC A;  2E76 B;  1GMJ A;  3CMA P;  5BVZ A;  3B4S A;  1T8Z A;  1XTG B;  2QJP B;  4LGD E;  2FYU J;  3SWY A;  1TU3 F;  4HJG H;  4ZNC A;  2XDJ A;  1J2J B;  1H8A A;  1RE4 C;  3H1J G;  2SPZ A;  2WPS A;  4OGQ D;  3WUT A;  3A0H E;  4H13 D;  1FU1 A;  1K73 Q;  1L2P A;  2O01 H;  2B88 A;  1NTM E;  1BGY G;  1JMM A;  1BCC E;  1X8Y A;  1ZRT D;  2XU6 A;  3BCC D;  2E75 B;  3PH0 A;  5CMZ A;  3VMA A;  1PPJ G;  1JY2 O;  4DCK A;  5L8R J;  3G9R A;  4HKZ H;  1CI6 A;  2JWA A;  4IFF A;  3HD7 B;  3TK1 A;  1EZV G;  1SS1 A;  4WBA A;  1NO4 A;  1EZV E;  2FXP A;  1KYO H;  1NGM B;  3F89 A;  2P67 A;  2R3C A;  1EDL A;  1PL5 A;  2G8Y A;  5CBN A;  1BCC G;  4AQR D;  3OJA B;  1JMB A;  1M1K Q;  1HJB A;  1FZC C;  1GL2 B;  2CPB A;  2ZT9 D;  1EDK A;  1FZA A;  1LP1 A;  1PGJ A;  2KOG A;  2WSF H;  3D6Y A;  1OZH A;  3L72 E;  4K3A A;  3L70 G;  2LR2 A;  1H89 A;  2BCC G;  1EXI A;  3P8C D;  4UB6 E;  1ZR2 A;  2WSS H;  1OW8 A;  5AW2 B;  1D7M A;  2P58 A;  3FGA D;  2ZYA A;  2ZT9 C;  3L71 E;  3BVH A;  1PGQ A;  5TJH A;  1OW6 A;  3AE8 C;  2O01 N;  2WSE H;  3AEA C;  3CCM P;  2QJY B;  4ZKP A;  1PIX A;  5B5E H;  1GK6 A;  2OYI B;  1BSN A;  3SSU A;  2R3S A;  5AW5 B;  2E74 C;  1EDI A;  1LTI C;  1QGK B;  2QJK C;  3CXH E;  5AW0 B;  2IPP A;  3CX5 I;  4GIF A;  2IZ1 A;  1NTK D;  3KHU A;  1BE3 E;  2KYV A;  2H7H A;  2P2U A;  1PP9 G;  3L75 D;  3PJS K;  1VQ7 P;  2HOD A;  5AVY B;  3VYI A;  4WY4 B;  3H1L D;  2K3R A;  2E74 D;  2QM7 A;  1KIL D;  3KZI E;  3G3Z A;  5BU8 B;  3L36 A;  5M1B A;  3CXH I;  4ZMD A;  1VQM P;  1JEK A;  1YBK A;  3TDK A;  4N6J A;  2HYN A;  3FWN A;  3GHG A;  1PV3 A;  4H44 D;  3ITK A;  1KN7 A;  1GW4 A;  1HGV A;  4W80 A;  1SP4 A;  1SQB E;  3L71 D;  1JNM A;  1AQ5 A;  1S9K E;  1BGY E;  2FYN C;  2AEJ A;  1NJI Q;  2WIT A;  2WVR A;  1IJD B;  1L4A D;  1ZW0 A;  2G3A A;  5B66 H;  4CPG A;  4U7J A;  2M5A B;  2N9B A;  5CBO A;  2E75 C;  3H1J E;  5AW6 B;  1P84 I;  4W7Y A;  3GLM A;  3KXD A;  1LTS C;  1URQ C;  4GKG A;  2L91 A;  4JBZ A;  4KT0 J;  4OVN F;  3U1A A;  3CC7 P;  1Q90 D;  3HD7 D;  4PD4 H;  1J1E C;  2FYU G;  3B8E B;  1SQP D;  1ZV8 A;  2E75 D;  3B71 A;  3O6Q A;  1NVO A;  1EZV D;  2M3E A;  5AVR B;  3II6 A;  3L74 G;  3L74 D;  3S9O A;  4D6T J;  3TNU A;  1GL2 C;  2RN0 A;  4WB4 A;  3M0D C;  1A02 J;  3V2Q A;  2FYU K;  1OW7 A;  1MFT A;  5APS A;  1QVG O;  4PV1 B;  3WMM 0;  5APV A;  2NPS C;  5KJ7 C;  3ABV C;  3H1K E;  1BE3 D;  2E76 D;  3OAK A;  3KDP B;  1L0L J;  1USD A;  2Y0E A;  3BRV B;  2ZXE B;  3OA7 A;  1NTM K;  3D70 A;  1VQN P;  1M90 Q;  4R4M A;  1VF5 B;  3RL0 C;  2OTJ P;  2Y9Z A;  3Q5R A;  1KQG B;  1YQ4 C;  2FXO A;  2I8D A;  1S5L H;  2MJZ A;  4H13 B;  3V4Q A;  3B5N B;  3CCS P;  3BCC E;  4A7P A;  2JDI H;  3L73 J;  3H1L J;  5KAF E;  1NH4 A;  1WMK A;  3PTZ A;  2OYI C;  2OYH B;  2BEZ F;  2Z5H A;  5KTB A;  1KD1 Q;  1YHQ P;  5E79 E;  1YTZ T;  4HH2 A;  2YXQ B;  2ZVN B;  4NPD A;  4XA4 A;  4LLH A;  1G1I A;  3RL0 g;  1KQS O;  5KLI B;  3RK3 D;  5KLV G;  3NMD A;  4MN4 C;  4KHX A;  3HE4 A;  2QIW A;  3CCR P;  3GF3 A;  2E43 A;  4WY4 C;  5KLV E;  3BAT A;  5CJ0 A;  4B86 A;  2KLU A;  2PAJ A;  5AW7 B;  1LJ2 A;  1NTZ E;  4NPE A;  1AV1 A;  1PP9 D;  1J1D B;  5KKZ C;  3W68 A;  1LT9 B;  2E5Y A;  3M0A A;  1L0N E;  1VQO P;  1PFI A;  2WT7 A;  1S9K D;  5APQ A;  2OYO A;  4YXD C;  3CCQ P;  1KQF B;  2FY8 A;  4D6T G;  2KNC B;  1LTA C;  1S2E A;  3TGU G;  3U1C A;  4EIJ A;  2IFN A;  5GTH E;  1RH5 B;  2GUV A;  2B9B A;  2YKP A;  1QL2 A;  5CHX A;  3CPW O;  5TIS E;  1VQK P;  4JF7 A;  1NTK K;  2KUB A;  2IBZ I;  1AFO A;  1KV4 A;  1NKZ B;  1YIJ P;  1URQ B;  1HTL C;  1SQB D;  2W8Z A;  4WWI A;  3VMZ A;  3HRN A;  4IL6 H;  3KPE A;  3G71 P;  1HBW A;  3F5H A;  1CI6 B;  1SQX D;  4EYY Q;  1DD3 A;  1ZXG A;  1SQV G;  5AW3 B;  1YI2 P;  5AW8 B;  2PFX A;  3A0H H;  2HPC A;  4C7N B;  3D71 A;  2KS1 B;  2NPS D;  5KJ7 D;  2ITA A;  3L73 G;  2E76 C;  3NXS A;  2Q9I A;  1IFJ A;  2IBZ E;  3T97 B;  1ZME C;  2YNY A;  2K88 A;  3VMX A;  3IAO A;  3R4Y A;  5AW4 B;  1M57 D;  4YTP C;  2FFD B;  3L75 E;  2A45 G;  4I1L A;  1BDD A;  1T6A A; 
#chains in the Genus database with same CATH homology
 3BCC G;  1BGY G;  1KB9 H;  3L71 G;  1NTK G;  1PPJ G;  3H1K G;  4D6T G;  3H1H G;  3TGU G;  1EZV G;  1NTM G;  1SQP G;  3CXH H;  1KYO H;  3L75 G;  4PD4 H;  1PP9 G;  1BCC G;  2FYU G;  3CWB G;  3H1I G;  1SQB G;  2A06 G;  3L72 G;  5KLV G;  1SQV G;  3L74 G;  4U3F G;  1P84 H;  1NU1 G;  2IBZ G;  3CX5 H;  1L0L G;  3L70 G;  1NTZ G;  2BCC G;  3L73 G;  3H1J G;  1L0N G;  1BE3 G;  3H1L G;  1SQX G;  1SQQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...