3TGUJ

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3tguJ00
3L73J 2FYUJ 1NTMJ 1SQQJ 1KB9I 3L71J 3TGUJ 1KYOI 1PP9J 3H1KJ 3L75J 1BCCJ 1BE3J 1NTKJ 1SQPJ 1L0LJ 3L72J 3CX5I 1SQVJ 1NTZJ 3CXHI 1EZVI 3CWBJ 3L70J 3H1JJ 1P84I 1SQXJ 4U3FJ 3L74J 3BCCJ 5KLVJ 1L0NJ 1SQBJ 4D6TJ 2IBZI 3H1IJ 3H1LJ 1BGYJ 2BCCJ 3H1HJ 1NU1J 4PD4I
chains in the Genus database with same CATH superfamily
3FXDA 1KYOE 3CI9A 1OVVA 1DEEG 3L73G 1CSBA 2R3CA 3VN0A 1M1KQ 3H1HD 2WPQA 3F89A 1JY3O 3P8CD 3AE3C 2K9YA 2KNCA 2ZAEB 1FZCC 4GODA 1GK6A 1OVRA 3P32A 1H0TB 1LT9B 1ZP0C 2C9LY 2YXQB 1ZLLA 4WY4B 2WSEJ 2BEQD 1W2EA 4UB6E 2JP3A 1QVGO 1NTMK 1RF0A 1N7SA 1L0NG 2Q6QA 2BCCE 1SFCB 1BE3J 3H1KE 5AVVB 3B5NB 2B88A 2KUBA 3L74J 1Q2NA 1RF1C 5CBNA 2NPSC 1JB0J 4HYTB 1KILB 5BVZA 4OGQC 3SFDC 4WY4C 5CCHA 3Q5RA 2ZJSE 1X79B 1DIPA 1CW5A 3K5BA 2FYUG 3AEDC 1BSNA 2WSSH 2V7QH 3WU2E 2Y9YA 3II6A 2Y0CA 4DT0A 1Y47A 1FZBA 1KYOH 1OMIA 5CCGA 2KXPB 1MFZA 5EFWB 3PTZA 3ABVC 4OH8B 4PD4I 1L4AA 1OVUA 4NPEA 2AEJA 3B5NC 1P84H 2Y0EA 3AEAC 1K04A 1M1JA 1KC8Q 2V7QJ 2E43A 1VQ9P 3N7NA 2Q9IA 3V4WA 1GL2D 4UB6H 3Q3DA 4I1LA 1WRGA 1J1DC 2G3AA 4EDFA 1FOSF 2FY8A 3T97A 3H1IJ 3M0DA 3H1JE 3AE5C 3MTUE 2H8PD 1AV1A 3AE2C 2M3EA 5AW4B 2D2CD 3L71G 4PV1D 2P10A 3O8ZA 3KYQA 3RGUA 3TSIA 2OYIA 1JY3P 4Y99B 1SVFA 2P7JA 1YJWP 4GOEA 3RK3E 4Y28J 3WU2H 4KHXA 3H1KJ 3D70A 1E79H 1NU1E 2RH0A 1LTGC 1VQMP 4IFFA 1LTBC 3L75E 2M5AB 3S1KA 3L72E 1FDIA 4KJMA 3AE7C 1GL2B 2AXTE 1Q81Q 1J2JB 1BE3D 1VQ6P 1MFTA 2QJKB 3I56P 4H13D 3VP8A 1KYOI 3L74D 1NAYA 4ASVA 2NZ2A 2J59M 1G2CB 1QX8A 3AE8C 5M1BA 1P84I 4LC1A 5AVYB 3Q2YA 3HD7D 1YBKA 1URQD 2RMZA 1KB9E 2D2CB 1M8OB 2JEEA 3H1IG 4PV1B 1S9KE 1VF5C 1GL2C 2GUSA 1ZXGA 1L2PA 1ZR4A 1M7LA 2QJKC 2YIUC 2OGUA 4OVNF 4GT1A 5KLVG 5AVUB 1BGYE 3RBXA 1IFPA 4U7JA 1KYOD 3RL0g 4WB4A 5CJ4A 1N86A 3H1JJ 2JWAA 1FU1A 2D2CC 2B87A 3CD6P 4C7RA 3CWBE 3H25A 2FBWC 1BDDA 1P84D 1YIJP 3V4QA 4HH2A 3CCLP 1OW6A 4WVZA 1FJPA 3H1HE 3P8CE 2AXTH 1CI6A 3H1ID 4L73A 1JY2O 1SQPE 3HD7B 1URQB 5KLIC 4RJTA 1DEBA 3AEEC 4LLHA 1GW4A 2JKVA 1NU1J 4I2LC 2IYPA 3L72J 4H13C 2B9BA 3HUSC 3L36A 2E75D 1KB9H 1SQVG 3H1KD 1LTTC 1XTGB 1GTWA 2N1TC 3U1CA 1HUCA 1FBMA 3G6EP 3FWNA 3JCUH 1LWUC 3HD7C 1RH5B 1IFDA 1K73Q 3B4SA 1N73B 1R8EA 2FXMA 3EFFK 4MN4C 1HH0A 1AQTA 3PLNA 3CCJP 5AVQB 4AQRD 2QJYB 2KS1B 1S5LX 2KB7P 4JYCA 1PGQA 2K37A 2KLUA 4C7NB 5B66E 1ZRTD 3H1LJ 1W2BO 1L0NE 2JJLA 2WPSA 2Q1KA 2E75B 1KN7A 4N6JA 3HTKB 1N73C 4DCKA 5KJ7D 3CWBJ 2Q3EA 4U3FJ 3EWKA 3H32A 3SWKA 1FZGA 2W6BA 1PIXA 3TF5A 2KSJA 5KAIE 4D6TG 1H8AA 3H1JD 1SQPJ 2Y0DA 5B5EE 1VQPP 3NTNA 2ZYGA 1OX3A 3GF7A 1N7SD 1EXJA 3AEBC 1IFJA 1FOSE 4BXLA 5APUA 2ZT9D 4BRYA 1RQUA 3WUUA 3WMM0 2FFDB 1KB9I 2YKPA 3RK3D 3A0HE 1Q7YQ 3FGAD 1NU1D 3IAOA 2BEZF 1OIPA 3L72D 3A3YB 3E1IA 3USSA 3L73J 1OWAA 4K3AA 3BRTB 3H1LG 5CCGD 1IFNA 1QGKB 2UWJE 5B66H 5APVA 1L4AD 1PP9G 1T8ZA 1HGZA 2YO2A 4JPZB 2FYNC 3AE9C 2QE7H 1MZ9A 2IPPA 2QJPB 1NTKJ 2NRGA 1KB9D 3L71E 2W6JH 2H7HA 5KAIH 1S9KD 1PZQA 3TK1A 1DD3A 4OGQD 2WPVB 1L0NJ 2WITA 5AW7B 3RK3B 1JCCA 4QMAA 1E5WA 2OYHA 1FZCB 2FXPA 3H1LD 1FDMA 2N9YB 2YMKA 2O01N 1L0LG 2KK7A 3TYYA 2P67A 5CBOA 1N7SC 1Z56A 1SQXG 2K9JB 4N78D 3E7KA 3RBZA 2FYUJ 1EQ7A 3CWBD 2ZT9C 1WT6A 1YTZI 3R4YA 4U3FD 2WSEH 2K88A 2N9BA 1S2EA 4O9BA 4YXWH 4XE5B 1FS0E 1P84E 3RK3C 1LTJA 4NPFX 1LTIC 1HF9A 1KORA 1SQPD 3B8EB 1Q82Q 1VL2A 1NU1K 1OW7A 2R32A 4EOTA 1VQOP 2E76D 3AE4C 1SQBG 3H1IE 1RF1B 1PPJG 2NPSB 1T3JA 1PGOA 2YKOA 4DZOA 1NTZJ 2WPRA 4OGQB 3KDPB 4PJ0E 5CCGC 3L70J 1NTKG 3CMAP 3GW6A 1KD1Q 3NXSA 1TU3F 1L4AC 2LR2A 4W7YA 5KKZB 2DW3A 3GMAA 5KLVE 1M1JC 3CX5E 4GIFA 2MKVA 1VQ8P 2ZYDA 3UIAA 2O01J 3L73D 1GK4A 2BASA 2OYIB 1G1IA 4OWFA 3SWFA 3L71J 2FXOA 3S9OA 2WVRA 1MUUA 2PFXA 3P8MC 1GMJA 5BU5A 3FX0A 5AW5B 2E42A 3AEGC 5KKZC 1S5LE 5GTIE 3M0DC 1FZAA 4ZNCA 2E76B 2M0BA 1NTKD 3KHUA 3VP9A 1J1DB 4H0LC 2YO3A 4R4LA 1U7MA 4ZKUA 4WBAA 3N4XA 1HJBA 3CPWO 1L0ND 1J1EB 2OYIC 1BCCG 1ZRTE 1SQVE 5CJ0A 1NTZG 4JBZA 1VDFA 3O6QB 1EDKA 2XU6A 1LGHB 3L70G 3RL0D 1LNQA 1VF5D 4PJ0H 4IL6E 1SQPK 1JNMA 2QRXA 2I1JA 2HPCB 2XZRA 1SQQG 1KMIZ 2E76C 3I5CA 4GOFA 5AW2B 5TJHA 2FYUD 1BDCA 3FWLA 1OZHA 5DJUB 3CX5H 1H0TA 4HB1A 1LT9A 1J1EC 2KZIA 1JMMA 3HE5B 2J58A 3WUVA 5APSA 2AXCA 2OARA 5AVTB 3Q1MA 5KLVJ 2B87B 2OQQA 3JC22 4H44C 1ZOYC 3IFMA 1Y9BA 3L37A 4KT0J 1SFCA 1S5LH 5GTIH 3VTPC 4ASWA 5AVXB 2ZXEB 3F5HA 1HTLC 3NFQA 2IX7C 3EQ2A 1IFMA 1VF5B 3CMEP 1KILA 1AFOA 2O3JA 3A7OA 3G71P 2IDBA 2YIUB 4D6TE 3LIEA 1NTKK 1M90Q 1GD2E 2VRSA 2Z5IA 1RHZB 1EZVG 3L71D 2N1TD 1L0NK 2XV5A 4IL6H 1GW3A 3MUDA 3V2RA 5GTHE 3RL0C 1HWTC 1SQVJ 2QVAA 5E79E 3BATA 3JCUE 1SS1A 1M57D 2XDJA 1DX7A 5DJTB 1T3UA 2C0XA 3FXEA 3QWOC 2FYUK 5KLIB 1GDTA 1AA0A 3H1LE 5H2FE 3CX5I 1KZUB 1PP9E 2KI7B 3GF3A 1U7JA 4N78E 4H13B 5AVSB 3HUSB 3VMAA 1SLQA 1EXIA 2AEFA 4U3FE 2BCCG 3L35A 5KAFE 1NWQA 1NTZK 3M0AA 2QA4P 2N1TB 5C39A 1PFIA 1KQLA 1LWUB 2HLOA 2JDIH 2YXRB 1JO5A 1JMBA 4BWNA 5KLVD 2M5AA 2J5UA 2QEXP 3VMXA 1NGMB 3CX5D 1GL2A 3G3ZA 1RE3A 5GTHH 2E5TA 4D6TJ 3VMYA 1SQXE 2GA1A 5E79H 3M9QA 2HYNA 2KOGA 2XNDH 1FJKA 1LJ2A 3GHGA 1LP1B 3L73E 5CMZA 1YITP 1G2CA 2W6AA 1S1CX 3HE4B 1JTHB 3D71A 4HJGH 5H2FH 1AJYA 2QM8A 1NAFA 1JUNA 2G8YA 5APTA 1SQBE 3A0BE 2HR3A 2A06G 1PGPA 3G4SP 2GM4A 1NTKE 5KAFH 1KQFB 1SQVD 1S72P 3E1RA 1PP9J 3AECC 2C9NY 3KZIE 4Z1MH 3VMZA 1JM0A 4I7ZC 3PJSK 1IZNB 2IFMA 4IL6X 2WWWA 3TNUB 2HG5D 2Z4EA 2HODB 2H43A 4JF7A 1VQ5P 4WWIA 3LW5H 1IK7A 2FYUE 4YTPC 3TGUG 1EC5A 1ZN5A 1URQA 3L75G 3V6IA 1NKNA 1QL1A 1XTCC 5KLVK 1A02F 2IBZI 1ZMEC 2IBZG 2LXCB 3CC7P 1L0LJ 2FYNB 1NH4A 1NTMG 2CK3H 3LW5J 2HFED 1YYCA 2POHA 1BCCE 4AYCA 5CCHD 1SQXJ 1NTZE 3D6YA 3A0BH 3CCRP 2KNCB 2R3SA 3L70E 3PH0A 1Q86Q 2OYHC 4TT3H 3QH9A 3CLQA 3Q5SA 2RKLA 4D6TD 1OW8A 4IFMA 3VOPA 3AE6C 2CPBA 1G1JA 2RN0A 4GKGA 1SQBJ 3EFGA 3KXDA 3OW2O 4YXDC 2KS1A 2IBZD 1AVOA 3KZIH 3CCSP 2R5BA 2E74C 1BGYG 1YI2P 1N7SB 1NOHA 4K35A 1SQVK 2L5GB 1RE4A 3RK2C 1LTJC 3CCMP 3M91A 2ZT9B 1BSHA 2JWDA 2QSIA 4C7NA 3BCCJ 1VQLP 4IOIH 2Q7CA 2IFNA 4RKUJ 2A45G 3BVHA 3AEFC 4DOJA 1DH3A 1X9VA 1N8RQ 2QG4A 3H1HG 3HTKA 2OTKE 1QL2A 1UIXA 1FAVA 3CL3D 1USEA 1PP9D 2H89C 4H0LD 1RF0C 2MJZA 1YHQP 1VQ7P 2P1JA 1JCDA 1L4AB 4EI2A 2Q5UA 1EZVE 1T2KD 1M1JB 4YPCA 2XKMA 2I1KA 5AVZB 2WZ7A 2FFDA 5CCHC 5K5GB 3PP5A 3PRJA 1KILD 4RO0A 1BCCJ 4CPGA 2ITAA 3A2AA 4L75A 2O01H 2OTLP 3M06A 4I6MC 3LIDA 2K1AA 1LTAC 3C8VA 5BU8B 1KQGB 1L0LD 1WMKA 2WSFJ 3T97B 3KQGA 3S4RA 3CXHH 3I55P 2WMMA 2M3BA 1SQQJ 5AVWB 5AW6B 5KJ7A 3BCCG 1LTSC 1SQXD 3SFEC 1GZLA 4H0LB 4H44D 2W83C 2ZYAA 2Y9ZA 3SWYA 2QM7A 3GLMA 2WT7A 5AW8B 5AW0B 3NMDA 1M56D 2WQYC 1FC2C 1SQBD 1PPJD 3WUTA 1YQ3C 3IR9A 4RESB 1MV8A 3R2PA 1LT9C 3M9HA 1T6AA 1DD4A 1NHLA 4L74A 1X8YA 3M9BA 1FZCA 1VPCA 2YMYA 3BCCD 2W27A 3VYIA 5APYA 5APXA 1USDA 1YQ4C 3CC2P 1R5LA 1T2KC 1SFCC 3KPEA 2K9JA 1OFCX 2C0WA 4IFDK 4UB8E 2W8ZA 3MGNA 3Q5PA 4H44B 3MHVA 1AQ5A 1KILC 3P7KA 2IZ1A 5AVRB 1K05A 1K8AQ 3CCUP 1RF1A 2NPSA 1OXZA 3PHLA 1UIIA 1L0LK 2A06E 1IFIA 2YKQA 4WY4A 1KV4A 3CXHI 3V2PA 1BE3G 1SQXK 2KLVA 3MUDC 1BCCD 1RQVA 3L74G 1NTZD 1YTZT 1QEXA 1N7LA 4EYYQ 4PD4D 3L70D 2JR8A 5APWA 1QVFO 2QIWA 3A5TA 3B5NA 5APQA 1CI6B 2ZFCA 1SQQD 1IO4A 1SQBK 3RL0B 2W90A 2KYVA 2BCCJ 1PGJA 4JYBA 1RY3A 2PAJA 3TGUE 1EDJA 1EZVI 2Z5HA 2GUVA 2IYOA 4UB8H 2K3RA 3CXHD 1FZFA 5KTBA 1NJIQ 2IBZE 5AW1B 1JY3N 1NTME 2Q3IA 3GHGB 4Y99C 3V2QA 1KQSO 1VQKP 2YNYA 1HJ0A 3O6QA 1KTMA 2PGDA 3IF4A 2KSEA 3V5BA 1FDOA 2O1KA 2IZ0A 3OJAB 2HPCA 2ZVNB 1RE3C 4TLFA 2OYOA 1EZVD 1KFNA 2P58A 2PRRA 3GHGC 3HE5A 1JEKA 1H88A 1X22A 4ZKPA 4NPDA 1A02J 2V4HA 3H1KG 1YJ9P 2ZXXA 1IK9A 4PV1C 3H32B 1CZQA 4L76A 1KILE 1SQQK 3OAKA 1EDLA 2ZVOB 4M3LA 3CCEP 4HKZH 1NKZB 1ZR2A 3TDKA 4R4MA 1L0LE 2CPSA 1FE6A 4BRYB 1D7MA 4JQ0D 2XNXA 1AVYA 3TGUJ 2R5DA 3L75J 3JSVC 2LKMA 3CCQP 2BCCD 1GU4A 1R5SA 4A7PA 4XA4A 5L8RJ 1H89A 4I7ZB 1NTMJ 3MP7B 4W80A 5AW3B 3AE1C 3HRNA 1PPJE 1URQC 2JO1A 1S4XA 4C46A 1PL5A 1HVVA 2E74D 3GG2A 3H1JG 3BCCE 3RK2D 2H88C 2KP8A 3C1LA 5AW9B 2WSCH 2A45H 4AUWA 3L4FA 3HUSA 1BGYJ 4ZMDA 3G9RA 1PV3A 3U59A 2N1TA 1IC2A 1NU1G 1NVOA 2L91A 2SPZA 2OYHB 3W67A 1LWUA 2A06D 3HD7A 3IN6A 3L72G 1W5CE 1ZW0A 3D6ZA 2WSCJ 2QJYC 1S3JA 2OTJP 1NO4A 1IJDB 3H1HJ 1KFMA 3BASA 4GDOA 1JOCA 1RE4C 5CHXA 3MD0A 1K9MQ 4B86A 3ZDMA 1FZEA 2KZJA 1ZV8A 2E74B 2FKWB 3ITKA 1LT1A 5TISE 1LTJB 3RK2B 4DJGA 2E75C 3CC4P 3OA7A 1NYHA 4PD4E 3SSUA 1U57A 2M8RA 1QLED 1LP1A 2PP6A 3H6PA 1SQQE 3W68A 3HE4A 2AEMA 1JY2P 1JTHA 3TGUD 1N73A 3L75D 2LXBA 1HBWA 3B71A 3BRVB 2I8DA 1VQNP 2WTYA 2O1JA 1EDIA 3CXHE 1GU5A 1BE3E 2FYZA 2FFDC 1NTMD 4N3YB 2E5YA 4W7ZA 3CWBG 3L74E 4U3FG 1SP4A 2A45I 1MKMA 2WT7B 3V2NA 1X0TA 1JY2N 1YJNP 2NPSD 1HGVA 3U1AA 1SQPG 3MIWA 3MZWB 1VQ4P 3TNUA 4WY4D 5B5EH 5KJ7C 4LGDE 2HODA 3CCVP 2P2UA 4EIJA 3C9IA 1Y8AA 1N2DC 5TISH 1BGYD 2B89A 2R44A 4PD4H 1SFCD 2KIKA 1Q90D 4XFJA 2QJPC 2WSFH 3B5ND 3A0HH
chains in the Genus database with same CATH topology
3L73J 2FYUJ 1NTMJ 1SQQJ 1KB9I 3L71J 3TGUJ 1KYOI 1PP9J 3H1KJ 3L75J 1BCCJ 1BE3J 1NTKJ 1SQPJ 1L0LJ 3L72J 3CX5I 1SQVJ 1NTZJ 3CXHI 1EZVI 3CWBJ 3L70J 3H1JJ 1P84I 1SQXJ 4U3FJ 3L74J 3BCCJ 5KLVJ 1L0NJ 1SQBJ 4D6TJ 2IBZI 3H1IJ 3H1LJ 1BGYJ 2BCCJ 3H1HJ 1NU1J 4PD4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L73 J;  2FYU J;  1NTM J;  1SQQ J;  1KB9 I;  3L71 J;  3TGU J;  1KYO I;  1PP9 J;  3H1K J;  3L75 J;  1BCC J;  1BE3 J;  1NTK J;  1SQP J;  1L0L J;  3L72 J;  3CX5 I;  1SQV J;  1NTZ J;  3CXH I;  1EZV I;  3CWB J;  3L70 J;  3H1J J;  1P84 I;  1SQX J;  4U3F J;  3L74 J;  3BCC J;  5KLV J;  1L0N J;  1SQB J;  4D6T J;  2IBZ I;  3H1I J;  3H1L J;  1BGY J;  2BCC J;  3H1H J;  1NU1 J;  4PD4 I; 
#chains in the Genus database with same CATH topology
 3FXD A;  1KYO E;  3CI9 A;  1OVV A;  1DEE G;  3L73 G;  1CSB A;  2R3C A;  3VN0 A;  1M1K Q;  3H1H D;  2WPQ A;  3F89 A;  1JY3 O;  3P8C D;  3AE3 C;  2K9Y A;  2KNC A;  2ZAE B;  1FZC C;  4GOD A;  1GK6 A;  1OVR A;  3P32 A;  1H0T B;  1LT9 B;  1ZP0 C;  2C9L Y;  2YXQ B;  1ZLL A;  4WY4 B;  2WSE J;  2BEQ D;  1W2E A;  4UB6 E;  2JP3 A;  1QVG O;  1NTM K;  1RF0 A;  1N7S A;  1L0N G;  2Q6Q A;  2BCC E;  1SFC B;  1BE3 J;  3H1K E;  5AVV B;  3B5N B;  2B88 A;  2KUB A;  3L74 J;  1Q2N A;  1RF1 C;  5CBN A;  2NPS C;  1JB0 J;  4HYT B;  1KIL B;  5BVZ A;  4OGQ C;  3SFD C;  4WY4 C;  5CCH A;  3Q5R A;  2ZJS E;  1X79 B;  1DIP A;  1CW5 A;  3K5B A;  2FYU G;  3AED C;  1BSN A;  2WSS H;  2V7Q H;  3WU2 E;  2Y9Y A;  3II6 A;  2Y0C A;  4DT0 A;  1Y47 A;  1FZB A;  1KYO H;  1OMI A;  5CCG A;  2KXP B;  1MFZ A;  5EFW B;  3PTZ A;  3ABV C;  4OH8 B;  4PD4 I;  1L4A A;  1OVU A;  4NPE A;  2AEJ A;  3B5N C;  1P84 H;  2Y0E A;  3AEA C;  1K04 A;  1M1J A;  1KC8 Q;  2V7Q J;  2E43 A;  1VQ9 P;  3N7N A;  2Q9I A;  3V4W A;  1GL2 D;  4UB6 H;  3Q3D A;  4I1L A;  1WRG A;  1J1D C;  2G3A A;  4EDF A;  1FOS F;  2FY8 A;  3T97 A;  3H1I J;  3M0D A;  3H1J E;  3AE5 C;  3MTU E;  2H8P D;  1AV1 A;  3AE2 C;  2M3E A;  5AW4 B;  2D2C D;  3L71 G;  4PV1 D;  2P10 A;  3O8Z A;  3KYQ A;  3RGU A;  3TSI A;  2OYI A;  1JY3 P;  4Y99 B;  1SVF A;  2P7J A;  1YJW P;  4GOE A;  3RK3 E;  4Y28 J;  3WU2 H;  4KHX A;  3H1K J;  3D70 A;  1E79 H;  1NU1 E;  2RH0 A;  1LTG C;  1VQM P;  4IFF A;  1LTB C;  3L75 E;  2M5A B;  3S1K A;  3L72 E;  1FDI A;  4KJM A;  3AE7 C;  1GL2 B;  2AXT E;  1Q81 Q;  1J2J B;  1BE3 D;  1VQ6 P;  1MFT A;  2QJK B;  3I56 P;  4H13 D;  3VP8 A;  1KYO I;  3L74 D;  1NAY A;  4ASV A;  2NZ2 A;  2J59 M;  1G2C B;  1QX8 A;  3AE8 C;  5M1B A;  1P84 I;  4LC1 A;  5AVY B;  3Q2Y A;  3HD7 D;  1YBK A;  1URQ D;  2RMZ A;  1KB9 E;  2D2C B;  1M8O B;  2JEE A;  3H1I G;  4PV1 B;  1S9K E;  1VF5 C;  1GL2 C;  2GUS A;  1ZXG A;  1L2P A;  1ZR4 A;  1M7L A;  2QJK C;  2YIU C;  2OGU A;  4OVN F;  4GT1 A;  5KLV G;  5AVU B;  1BGY E;  3RBX A;  1IFP A;  4U7J A;  1KYO D;  3RL0 g;  4WB4 A;  5CJ4 A;  1N86 A;  3H1J J;  2JWA A;  1FU1 A;  2D2C C;  2B87 A;  3CD6 P;  4C7R A;  3CWB E;  3H25 A;  2FBW C;  1BDD A;  1P84 D;  1YIJ P;  3V4Q A;  4HH2 A;  3CCL P;  1OW6 A;  4WVZ A;  1FJP A;  3H1H E;  3P8C E;  2AXT H;  1CI6 A;  3H1I D;  4L73 A;  1JY2 O;  1SQP E;  3HD7 B;  1URQ B;  5KLI C;  4RJT A;  1DEB A;  3AEE C;  4LLH A;  1GW4 A;  2JKV A;  1NU1 J;  4I2L C;  2IYP A;  3L72 J;  4H13 C;  2B9B A;  3HUS C;  3L36 A;  2E75 D;  1KB9 H;  1SQV G;  3H1K D;  1LTT C;  1XTG B;  1GTW A;  2N1T C;  3U1C A;  1HUC A;  1FBM A;  3G6E P;  3FWN A;  3JCU H;  1LWU C;  3HD7 C;  1RH5 B;  1IFD A;  1K73 Q;  3B4S A;  1N73 B;  1R8E A;  2FXM A;  3EFF K;  4MN4 C;  1HH0 A;  1AQT A;  3PLN A;  3CCJ P;  5AVQ B;  4AQR D;  2QJY B;  2KS1 B;  1S5L X;  2KB7 P;  4JYC A;  1PGQ A;  2K37 A;  2KLU A;  4C7N B;  5B66 E;  1ZRT D;  3H1L J;  1W2B O;  1L0N E;  2JJL A;  2WPS A;  2Q1K A;  2E75 B;  1KN7 A;  4N6J A;  3HTK B;  1N73 C;  4DCK A;  5KJ7 D;  3CWB J;  2Q3E A;  4U3F J;  3EWK A;  3H32 A;  3SWK A;  1FZG A;  2W6B A;  1PIX A;  3TF5 A;  2KSJ A;  5KAI E;  4D6T G;  1H8A A;  3H1J D;  1SQP J;  2Y0D A;  5B5E E;  1VQP P;  3NTN A;  2ZYG A;  1OX3 A;  3GF7 A;  1N7S D;  1EXJ A;  3AEB C;  1IFJ A;  1FOS E;  4BXL A;  5APU A;  2ZT9 D;  4BRY A;  1RQU A;  3WUU A;  3WMM 0;  2FFD B;  1KB9 I;  2YKP A;  3RK3 D;  3A0H E;  1Q7Y Q;  3FGA D;  1NU1 D;  3IAO A;  2BEZ F;  1OIP A;  3L72 D;  3A3Y B;  3E1I A;  3USS A;  3L73 J;  1OWA A;  4K3A A;  3BRT B;  3H1L G;  5CCG D;  1IFN A;  1QGK B;  2UWJ E;  5B66 H;  5APV A;  1L4A D;  1PP9 G;  1T8Z A;  1HGZ A;  2YO2 A;  4JPZ B;  2FYN C;  3AE9 C;  2QE7 H;  1MZ9 A;  2IPP A;  2QJP B;  1NTK J;  2NRG A;  1KB9 D;  3L71 E;  2W6J H;  2H7H A;  5KAI H;  1S9K D;  1PZQ A;  3TK1 A;  1DD3 A;  4OGQ D;  2WPV B;  1L0N J;  2WIT A;  5AW7 B;  3RK3 B;  1JCC A;  4QMA A;  1E5W A;  2OYH A;  1FZC B;  2FXP A;  3H1L D;  1FDM A;  2N9Y B;  2YMK A;  2O01 N;  1L0L G;  2KK7 A;  3TYY A;  2P67 A;  5CBO A;  1N7S C;  1Z56 A;  1SQX G;  2K9J B;  4N78 D;  3E7K A;  3RBZ A;  2FYU J;  1EQ7 A;  3CWB D;  2ZT9 C;  1WT6 A;  1YTZ I;  3R4Y A;  4U3F D;  2WSE H;  2K88 A;  2N9B A;  1S2E A;  4O9B A;  4YXW H;  4XE5 B;  1FS0 E;  1P84 E;  3RK3 C;  1LTJ A;  4NPF X;  1LTI C;  1HF9 A;  1KOR A;  1SQP D;  3B8E B;  1Q82 Q;  1VL2 A;  1NU1 K;  1OW7 A;  2R32 A;  4EOT A;  1VQO P;  2E76 D;  3AE4 C;  1SQB G;  3H1I E;  1RF1 B;  1PPJ G;  2NPS B;  1T3J A;  1PGO A;  2YKO A;  4DZO A;  1NTZ J;  2WPR A;  4OGQ B;  3KDP B;  4PJ0 E;  5CCG C;  3L70 J;  1NTK G;  3CMA P;  3GW6 A;  1KD1 Q;  3NXS A;  1TU3 F;  1L4A C;  2LR2 A;  4W7Y A;  5KKZ B;  2DW3 A;  3GMA A;  5KLV E;  1M1J C;  3CX5 E;  4GIF A;  2MKV A;  1VQ8 P;  2ZYD A;  3UIA A;  2O01 J;  3L73 D;  1GK4 A;  2BAS A;  2OYI B;  1G1I A;  4OWF A;  3SWF A;  3L71 J;  2FXO A;  3S9O A;  2WVR A;  1MUU A;  2PFX A;  3P8M C;  1GMJ A;  5BU5 A;  3FX0 A;  5AW5 B;  2E42 A;  3AEG C;  5KKZ C;  1S5L E;  5GTI E;  3M0D C;  1FZA A;  4ZNC A;  2E76 B;  2M0B A;  1NTK D;  3KHU A;  3VP9 A;  1J1D B;  4H0L C;  2YO3 A;  4R4L A;  1U7M A;  4ZKU A;  4WBA A;  3N4X A;  1HJB A;  3CPW O;  1L0N D;  1J1E B;  2OYI C;  1BCC G;  1ZRT E;  1SQV E;  5CJ0 A;  1NTZ G;  4JBZ A;  1VDF A;  3O6Q B;  1EDK A;  2XU6 A;  1LGH B;  3L70 G;  3RL0 D;  1LNQ A;  1VF5 D;  4PJ0 H;  4IL6 E;  1SQP K;  1JNM A;  2QRX A;  2I1J A;  2HPC B;  2XZR A;  1SQQ G;  1KMI Z;  2E76 C;  3I5C A;  4GOF A;  5AW2 B;  5TJH A;  2FYU D;  1BDC A;  3FWL A;  1OZH A;  5DJU B;  3CX5 H;  1H0T A;  4HB1 A;  1LT9 A;  1J1E C;  2KZI A;  1JMM A;  3HE5 B;  2J58 A;  3WUV A;  5APS A;  2AXC A;  2OAR A;  5AVT B;  3Q1M A;  5KLV J;  2B87 B;  2OQQ A;  3JC2 2;  4H44 C;  1ZOY C;  3IFM A;  1Y9B A;  3L37 A;  4KT0 J;  1SFC A;  1S5L H;  5GTI H;  3VTP C;  4ASW A;  5AVX B;  2ZXE B;  3F5H A;  1HTL C;  3NFQ A;  2IX7 C;  3EQ2 A;  1IFM A;  1VF5 B;  3CME P;  1KIL A;  1AFO A;  2O3J A;  3A7O A;  3G71 P;  2IDB A;  2YIU B;  4D6T E;  3LIE A;  1NTK K;  1M90 Q;  1GD2 E;  2VRS A;  2Z5I A;  1RHZ B;  1EZV G;  3L71 D;  2N1T D;  1L0N K;  2XV5 A;  4IL6 H;  1GW3 A;  3MUD A;  3V2R A;  5GTH E;  3RL0 C;  1HWT C;  1SQV J;  2QVA A;  5E79 E;  3BAT A;  3JCU E;  1SS1 A;  1M57 D;  2XDJ A;  1DX7 A;  5DJT B;  1T3U A;  2C0X A;  3FXE A;  3QWO C;  2FYU K;  5KLI B;  1GDT A;  1AA0 A;  3H1L E;  5H2F E;  3CX5 I;  1KZU B;  1PP9 E;  2KI7 B;  3GF3 A;  1U7J A;  4N78 E;  4H13 B;  5AVS B;  3HUS B;  3VMA A;  1SLQ A;  1EXI A;  2AEF A;  4U3F E;  2BCC G;  3L35 A;  5KAF E;  1NWQ A;  1NTZ K;  3M0A A;  2QA4 P;  2N1T B;  5C39 A;  1PFI A;  1KQL A;  1LWU B;  2HLO A;  2JDI H;  2YXR B;  1JO5 A;  1JMB A;  4BWN A;  5KLV D;  2M5A A;  2J5U A;  2QEX P;  3VMX A;  1NGM B;  3CX5 D;  1GL2 A;  3G3Z A;  1RE3 A;  5GTH H;  2E5T A;  4D6T J;  3VMY A;  1SQX E;  2GA1 A;  5E79 H;  3M9Q A;  2HYN A;  2KOG A;  2XND H;  1FJK A;  1LJ2 A;  3GHG A;  1LP1 B;  3L73 E;  5CMZ A;  1YIT P;  1G2C A;  2W6A A;  1S1C X;  3HE4 B;  1JTH B;  3D71 A;  4HJG H;  5H2F H;  1AJY A;  2QM8 A;  1NAF A;  1JUN A;  2G8Y A;  5APT A;  1SQB E;  3A0B E;  2HR3 A;  2A06 G;  1PGP A;  3G4S P;  2GM4 A;  1NTK E;  5KAF H;  1KQF B;  1SQV D;  1S72 P;  3E1R A;  1PP9 J;  3AEC C;  2C9N Y;  3KZI E;  4Z1M H;  3VMZ A;  1JM0 A;  4I7Z C;  3PJS K;  1IZN B;  2IFM A;  4IL6 X;  2WWW A;  3TNU B;  2HG5 D;  2Z4E A;  2HOD B;  2H43 A;  4JF7 A;  1VQ5 P;  4WWI A;  3LW5 H;  1IK7 A;  2FYU E;  4YTP C;  3TGU G;  1EC5 A;  1ZN5 A;  1URQ A;  3L75 G;  3V6I A;  1NKN A;  1QL1 A;  1XTC C;  5KLV K;  1A02 F;  2IBZ I;  1ZME C;  2IBZ G;  2LXC B;  3CC7 P;  1L0L J;  2FYN B;  1NH4 A;  1NTM G;  2CK3 H;  3LW5 J;  2HFE D;  1YYC A;  2POH A;  1BCC E;  4AYC A;  5CCH D;  1SQX J;  1NTZ E;  3D6Y A;  3A0B H;  3CCR P;  2KNC B;  2R3S A;  3L70 E;  3PH0 A;  1Q86 Q;  2OYH C;  4TT3 H;  3QH9 A;  3CLQ A;  3Q5S A;  2RKL A;  4D6T D;  1OW8 A;  4IFM A;  3VOP A;  3AE6 C;  2CPB A;  1G1J A;  2RN0 A;  4GKG A;  1SQB J;  3EFG A;  3KXD A;  3OW2 O;  4YXD C;  2KS1 A;  2IBZ D;  1AVO A;  3KZI H;  3CCS P;  2R5B A;  2E74 C;  1BGY G;  1YI2 P;  1N7S B;  1NOH A;  4K35 A;  1SQV K;  2L5G B;  1RE4 A;  3RK2 C;  1LTJ C;  3CCM P;  3M91 A;  2ZT9 B;  1BSH A;  2JWD A;  2QSI A;  4C7N A;  3BCC J;  1VQL P;  4IOI H;  2Q7C A;  2IFN A;  4RKU J;  2A45 G;  3BVH A;  3AEF C;  4DOJ A;  1DH3 A;  1X9V A;  1N8R Q;  2QG4 A;  3H1H G;  3HTK A;  2OTK E;  1QL2 A;  1UIX A;  1FAV A;  3CL3 D;  1USE A;  1PP9 D;  2H89 C;  4H0L D;  1RF0 C;  2MJZ A;  1YHQ P;  1VQ7 P;  2P1J A;  1JCD A;  1L4A B;  4EI2 A;  2Q5U A;  1EZV E;  1T2K D;  1M1J B;  4YPC A;  2XKM A;  2I1K A;  5AVZ B;  2WZ7 A;  2FFD A;  5CCH C;  5K5G B;  3PP5 A;  3PRJ A;  1KIL D;  4RO0 A;  1BCC J;  4CPG A;  2ITA A;  3A2A A;  4L75 A;  2O01 H;  2OTL P;  3M06 A;  4I6M C;  3LID A;  2K1A A;  1LTA C;  3C8V A;  5BU8 B;  1KQG B;  1L0L D;  1WMK A;  2WSF J;  3T97 B;  3KQG A;  3S4R A;  3CXH H;  3I55 P;  2WMM A;  2M3B A;  1SQQ J;  5AVW B;  5AW6 B;  5KJ7 A;  3BCC G;  1LTS C;  1SQX D;  3SFE C;  1GZL A;  4H0L B;  4H44 D;  2W83 C;  2ZYA A;  2Y9Z A;  3SWY A;  2QM7 A;  3GLM A;  2WT7 A;  5AW8 B;  5AW0 B;  3NMD A;  1M56 D;  2WQY C;  1FC2 C;  1SQB D;  1PPJ D;  3WUT A;  1YQ3 C;  3IR9 A;  4RES B;  1MV8 A;  3R2P A;  1LT9 C;  3M9H A;  1T6A A;  1DD4 A;  1NHL A;  4L74 A;  1X8Y A;  3M9B A;  1FZC A;  1VPC A;  2YMY A;  3BCC D;  2W27 A;  3VYI A;  5APY A;  5APX A;  1USD A;  1YQ4 C;  3CC2 P;  1R5L A;  1T2K C;  1SFC C;  3KPE A;  2K9J A;  1OFC X;  2C0W A;  4IFD K;  4UB8 E;  2W8Z A;  3MGN A;  3Q5P A;  4H44 B;  3MHV A;  1AQ5 A;  1KIL C;  3P7K A;  2IZ1 A;  5AVR B;  1K05 A;  1K8A Q;  3CCU P;  1RF1 A;  2NPS A;  1OXZ A;  3PHL A;  1UII A;  1L0L K;  2A06 E;  1IFI A;  2YKQ A;  4WY4 A;  1KV4 A;  3CXH I;  3V2P A;  1BE3 G;  1SQX K;  2KLV A;  3MUD C;  1BCC D;  1RQV A;  3L74 G;  1NTZ D;  1YTZ T;  1QEX A;  1N7L A;  4EYY Q;  4PD4 D;  3L70 D;  2JR8 A;  5APW A;  1QVF O;  2QIW A;  3A5T A;  3B5N A;  5APQ A;  1CI6 B;  2ZFC A;  1SQQ D;  1IO4 A;  1SQB K;  3RL0 B;  2W90 A;  2KYV A;  2BCC J;  1PGJ A;  4JYB A;  1RY3 A;  2PAJ A;  3TGU E;  1EDJ A;  1EZV I;  2Z5H A;  2GUV A;  2IYO A;  4UB8 H;  2K3R A;  3CXH D;  1FZF A;  5KTB A;  1NJI Q;  2IBZ E;  5AW1 B;  1JY3 N;  1NTM E;  2Q3I A;  3GHG B;  4Y99 C;  3V2Q A;  1KQS O;  1VQK P;  2YNY A;  1HJ0 A;  3O6Q A;  1KTM A;  2PGD A;  3IF4 A;  2KSE A;  3V5B A;  1FDO A;  2O1K A;  2IZ0 A;  3OJA B;  2HPC A;  2ZVN B;  1RE3 C;  4TLF A;  2OYO A;  1EZV D;  1KFN A;  2P58 A;  2PRR A;  3GHG C;  3HE5 A;  1JEK A;  1H88 A;  1X22 A;  4ZKP A;  4NPD A;  1A02 J;  2V4H A;  3H1K G;  1YJ9 P;  2ZXX A;  1IK9 A;  4PV1 C;  3H32 B;  1CZQ A;  4L76 A;  1KIL E;  1SQQ K;  3OAK A;  1EDL A;  2ZVO B;  4M3L A;  3CCE P;  4HKZ H;  1NKZ B;  1ZR2 A;  3TDK A;  4R4M A;  1L0L E;  2CPS A;  1FE6 A;  4BRY B;  1D7M A;  4JQ0 D;  2XNX A;  1AVY A;  3TGU J;  2R5D A;  3L75 J;  3JSV C;  2LKM A;  3CCQ P;  2BCC D;  1GU4 A;  1R5S A;  4A7P A;  4XA4 A;  5L8R J;  1H89 A;  4I7Z B;  1NTM J;  3MP7 B;  4W80 A;  5AW3 B;  3AE1 C;  3HRN A;  1PPJ E;  1URQ C;  2JO1 A;  1S4X A;  4C46 A;  1PL5 A;  1HVV A;  2E74 D;  3GG2 A;  3H1J G;  3BCC E;  3RK2 D;  2H88 C;  2KP8 A;  3C1L A;  5AW9 B;  2WSC H;  2A45 H;  4AUW A;  3L4F A;  3HUS A;  1BGY J;  4ZMD A;  3G9R A;  1PV3 A;  3U59 A;  2N1T A;  1IC2 A;  1NU1 G;  1NVO A;  2L91 A;  2SPZ A;  2OYH B;  3W67 A;  1LWU A;  2A06 D;  3HD7 A;  3IN6 A;  3L72 G;  1W5C E;  1ZW0 A;  3D6Z A;  2WSC J;  2QJY C;  1S3J A;  2OTJ P;  1NO4 A;  1IJD B;  3H1H J;  1KFM A;  3BAS A;  4GDO A;  1JOC A;  1RE4 C;  5CHX A;  3MD0 A;  1K9M Q;  4B86 A;  3ZDM A;  1FZE A;  2KZJ A;  1ZV8 A;  2E74 B;  2FKW B;  3ITK A;  1LT1 A;  5TIS E;  1LTJ B;  3RK2 B;  4DJG A;  2E75 C;  3CC4 P;  3OA7 A;  1NYH A;  4PD4 E;  3SSU A;  1U57 A;  2M8R A;  1QLE D;  1LP1 A;  2PP6 A;  3H6P A;  1SQQ E;  3W68 A;  3HE4 A;  2AEM A;  1JY2 P;  1JTH A;  3TGU D;  1N73 A;  3L75 D;  2LXB A;  1HBW A;  3B71 A;  3BRV B;  2I8D A;  1VQN P;  2WTY A;  2O1J A;  1EDI A;  3CXH E;  1GU5 A;  1BE3 E;  2FYZ A;  2FFD C;  1NTM D;  4N3Y B;  2E5Y A;  4W7Z A;  3CWB G;  3L74 E;  4U3F G;  1SP4 A;  2A45 I;  1MKM A;  2WT7 B;  3V2N A;  1X0T A;  1JY2 N;  1YJN P;  2NPS D;  1HGV A;  3U1A A;  1SQP G;  3MIW A;  3MZW B;  1VQ4 P;  3TNU A;  4WY4 D;  5B5E H;  5KJ7 C;  4LGD E;  2HOD A;  3CCV P;  2P2U A;  4EIJ A;  3C9I A;  1Y8A A;  1N2D C;  5TIS H;  1BGY D;  2B89 A;  2R44 A;  4PD4 H;  1SFC D;  2KIK A;  1Q90 D;  4XFJ A;  2QJP C;  2WSF H;  3B5N D;  3A0H H; 
#chains in the Genus database with same CATH homology
 3L73 J;  2FYU J;  1NTM J;  1SQQ J;  1KB9 I;  3L71 J;  3TGU J;  1KYO I;  1PP9 J;  3H1K J;  3L75 J;  1BCC J;  1BE3 J;  1NTK J;  1SQP J;  1L0L J;  3L72 J;  3CX5 I;  1SQV J;  1NTZ J;  3CXH I;  1EZV I;  3CWB J;  3L70 J;  3H1J J;  1P84 I;  1SQX J;  4U3F J;  3L74 J;  3BCC J;  5KLV J;  1L0N J;  1SQB J;  4D6T J;  2IBZ I;  3H1I J;  3H1L J;  1BGY J;  2BCC J;  3H1H J;  1NU1 J;  4PD4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...