3TGUJ

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3tguJ00
3BCCJ 4D6TJ 1P84I 1BCCJ 3L72J 2FYUJ 3H1HJ 1SQVJ 1SQQJ 1BE3J 3CWBJ 3H1IJ 2BCCJ 1L0LJ 1EZVI 1KB9I 1PP9J 1SQBJ 1NTKJ 3H1LJ 5KLVJ 3CX5I 3L71J 3TGUJ 4PD4I 1NTMJ 3L74J 1NU1J 1SQPJ 1L0NJ 3CXHI 3H1KJ 1KYOI 3L70J 1SQXJ 3L73J 2IBZI 1BGYJ 3L75J 4U3FJ 3H1JJ 1NTZJ
chains in the Genus database with same CATH superfamily
2WSFH 1RF1B 1JCCA 3MD0A 1LTAC 1S2EA 1HUCA 5AW4B 5AW8B 1AVOA 3CX5D 2GUSA 4UB8H 1USEA 2RMZA 2V7QJ 4ZKUA 3CCLP 2YIUC 1FU1A 1L0NE 1UIXA 2WSCH 1OMIA 3M9BA 3OW2O 1GDTA 1AQTA 1OFCX 2BCCG 3H25A 1HJBA 1EZVD 2KI7B 3AEBC 1AA0A 4GDOA 2QA4P 2C9NY 1K05A 3L71D 5E79E 1WT6A 3WUTA 2QJPB 1KB9H 2K88A 2KZJA 1PPJD 5B66E 4PJ0E 3S4RA 3IN6A 1NTZE 1JY3O 4H44B 5KAFH 2IYPA 3GHGC 3CL3D 1HVVA 2PGDA 1KMIZ 1KD1Q 3CCUP 1T2KC 3PLNA 3L75E 4DJGA 1BCCG 3BCCD 2IZ1A 1VQ5P 2IX7C 3TYYA 3A7OA 3CPWO 2ZYGA 1M7LA 1M90Q 5KAIH 1NYHA 3C8VA 3AEGC 3C9IA 3CLQA 1M56D 3RGUA 3G6EP 3V2PA 2WITA 1OVUA 1LT1A 1NWQA 3HD7C 1G2CA 1Z56A 3H1IE 1Q90D 2WSEH 1YQ4C 1NGMB 2GM4A 1R5SA 3I55P 5APVA 5EFWB 1Q2NA 3TK1A 1G2CB 3PTZA 2AEMA 2QSIA 3H1KJ 5M1BA 1URQA 5CHXA 2A06G 3GHGA 2O1JA 3RL0g 2FXPA 2ZJSE 1S3JA 2W8ZA 4GOFA 1SQQJ 2Q9IA 4N3YB 3H1KG 4RKUJ 1JOCA 1URQB 5CCHC 1MFZA 2E5YA 3KHUA 3E1RA 2NPSA 2CK3H 1VQ4P 1AVYA 2E74B 2JWAA 1L2PA 1SQQG 3H1HG 4IL6X 2E75B 2DW3A 2QG4A 1L0LJ 3R2PA 1IO4A 3HD7A 4WY4C 4L73A 1OW8A 3S1KA 1FZFA 1OZHA 2Q5UA 2WSSH 2HR3A 3WMM0 3B5ND 1FOSF 2NPSB 2FFDC 1ZR4A 1NO4A 4D6TJ 2WTYA 2FYUG 2N1TC 1SS1A 1JY2N 4BWNA 1OVVA 1E5WA 2HG5D 3P8MC 1JMMA 3H1LE 1QGKB 1PGOA 2IBZG 1VQOP 2IBZI 2PRRA 3CCRP 4D6TG 3RK3D 4W7YA 5APWA 3AEEC 2YO3A 2PFXA 5KLVG 3FXDA 4W80A 2N9YB 3CC2P 2YKOA 1PIXA 1K9MQ 1PL5A 1GW3A 1BGYJ 1X22A 2A06D 1CSBA 4H0LD 2Q3IA 5CJ0A 3L72J 1VQNP 5C39A 2O01N 3AEFC 3AE8C 1RE3C 1GTWA 4PD4E 4KT0J 2WT7A 4OGQD 3H1KD 1ZRTE 2QJYC 1SQQK 3SWKA 3L37A 3PJSK 3EFGA 4KJMA 2P2UA 3R4YA 5AVXB 4L76A 3USSA 3P32A 1SQQD 1OW6A 1FDIA 1LTGC 1SQBG 5KKZC 2WSFJ 4N78D 5APUA 5AVYB 1OXZA 2WT7B 1USDA 4LC1A 2FYUK 3A3YB 2J5UA 2M5AA 2HPCA 4WB4A 1HTLC 1XTGB 1JMBA 1PP9J 2WSCJ 1JY2O 1L0LD 3CCVP 3V2QA 2JKVA 1EC5A 2CPSA 1YTZT 2K37A 2M5AB 2IBZD 4IFDK 2HPCB 5E79H 3VOPA 1GU4A 5KLVK 4D6TD 5CJ4A 2UWJE 1QL2A 4PJ0H 2OGUA 3WUUA 2RKLA 3O8ZA 1VF5C 3L73J 2YO2A 4IL6H 1EDKA 1N7SC 3T97A 3GLMA 4U3FE 2OYIC 3CWBJ 4H13C 2WWWA 1KB9I 2JP3A 2IZ0A 1Q81Q 3VMAA 4EDFA 1X0TA 1KYOI 4OWFA 2POHA 1RQVA 2M8RA 3T97B 1BGYD 1L4AC 1LTJC 5APXA 3AE2C 1SQBK 3M9QA 3SFEC 3L72D 3S9OA 2XZRA 3CX5E 3D70A 3RBXA 1DD4A 2D2CD 5CCGD 1KV4A 1KQLA 2M3EA 5B5EE 2OYHA 3UIAA 1J1DB 1QL1A 2WSEJ 1KILA 3JCUE 1KQSO 1W5CE 1FS0E 4DT0A 1EZVE 3MHVA 3V6IA 2KNCA 3HTKA 1SQPJ 3L71E 1U7MA 3RL0C 1PGQA 1PPJE 5AVTB 3Q1MA 2OYHB 1CZQA 2FYNC 1KILB 1G1JA 2KP8A 2LXCB 3ZDMA 2KNCB 3HTKB 4NPEA 1SQPG 1M1JA 1YQ3C 3CCQP 1S9KE 3L4FA 1SFCA 1IFDA 3AE6C 2OTKE 1FJKA 1AFOA 3G9RA 1EZVG 1Y9BA 2A45I 4GT1A 1A02J 5H2FE 1KB9D 2VRSA 1FZEA 4IFMA 3Q5SA 1YHQP 1M1JB 1SFCB 4EYYQ 2G8YA 1KYOD 1PPJG 5APQA 3L73D 3TNUA 1OIPA 2XU6A 1LWUC 1SQVJ 3CCEP 1AJYA 4PV1B 1YJ9P 4JBZA 1GL2C 2ZAEB 4EI2A 3VYIA 2ZYDA 2XDJA 3M0DC 3CMEP 2JR8A 3TNUB 5AW0B 2OTLP 1Q82Q 2Y0EA 4Y99B 3U1CA 3BCCG 1VQKP 1IK9A 1SQVG 1GW4A 3E7KA 3P8CD 2ZXXA 1H88A 2QM8A 1URQD 3WU2H 4TT3H 2E76B 1NTMJ 2E74D 2QRXA 4YXDC 5APSA 4DOJA 2JDIH 1BDDA 2E75D 2O01H 5AVRB 1KFMA 5KJ7C 3D6YA 1ZV8A 1J2JB 2RN0A 2BASA 1RF0A 1EDIA 1NTMG 2NPSD 1EQ7A 1SQPD 2R3SA 2YMKA 3RK2B 4I7ZC 2J58A 3CMAP 1VL2A 5AVVB 5AW5B 1RH5B 3B8EB 3HD7D 2W90A 1ZW0A 3PHLA 3KZIE 5CCGA 3L36A 1BCCE 3CCJP 3Q3DA 2XNDH 3TGUJ 3Q5RA 4EOTA 3H32A 1S5LX 3L70J 1FOSE 4K3AA 3V2RA 5AVQB 1MZ9A 3A0HE 2LR2A 2D2CB 2B89A 1KYOH 1IFJA 4Z1MH 1N73A 2SPZA 5CBOA 1L0NJ 3H32B 2AXCA 1A02F 1IK7A 1SQVK 1JO5A 1BDCA 4RJTA 1IZNB 3CD6P 3RK3E 2KIKA 2L91A 4IFFA 1AV1A 2JWDA 1SQVD 1N73B 4OH8B 3WUVA 5BU5A 2C0WA 3SWYA 5CCHD 3QWOC 2AEFA 5KLIB 1GU5A 3G71P 4JYBA 1Y8AA 2HYNA 3NMDA 2AEJA 2A06E 1NTZJ 2WMMA 4YTPC 4RO0A 1HWTC 1GMJA 2FXOA 4AUWA 4Y28J 2KYVA 4WY4D 1S72P 1NTMD 3H1KE 3G3ZA 3L75J 2IYOA 2YIUB 2P1JA 2HODA 3W67A 2N1TD 3V2NA 5APYA 1SQQE 3H1HE 2YKQA 2YXQB 3TDKA 3D6ZA 3FWLA 2LXBA 1KFNA 1FZBA 3SSUA 2A45H 1HJ0A 2NRGA 3KXDA 2ZT9C 3W68A 2HODB 2IFMA 1FZAA 3H1IJ 2Q6QA 1T3JA 2FYUE 1VQ7P 5B5EH 2AXTE 3TGUD 1RQUA 2K9JA 2JJLA 1YTZI 3CXHE 3GHGB 3L70D 2IBZE 4ZKPA 3KPEA 1J1EC 3PRJA 4D6TE 1KQGB 1OWAA 1FDOA 1Y47A 2H43A 5KLVE 3VTPC 2K9JB 5GTIE 1L0ND 3K5BA 3M9HA 1R8EA 5AVZB 1DIPA 2C0XA 1S5LH 1L0LG 3HD7B 1W2BO 3AECC 1P84H 5TISE 4C7RA 5H2FH 1YJWP 2Z4EA 2KB7P 3BRTB 2Y0DA 1BGYE 1NOHA 1NTZD 2FY8A 3L72E 4A7PA 3AE3C 2B9BA 1JB0J 3L74J 1SQBE 1XTCC 4NPFX 2GUVA 1FAVA 1KILD 5CCHA 3L75D 3GW6A 4ASWA 4NPDA 1JEKA 3GMAA 3H1LJ 1HH0A 3AEAC 3L74G 1N2DC 1SP4A 4WY4A 2I8DA 1KC8Q 1BGYG 2KLUA 3N4XA 5CMZA 1YBKA 5APTA 3EQ2A 1JTHA 3L72G 2FFDA 3CCMP 3A0BH 3EFFK 1PGPA 1LTBC 3MIWA 1LP1A 3H1ID 1SFCD 5AW9B 2K1AA 1X9VA 2L5GB 2N1TA 1FC2C 2O01J 3II6A 3BASA 4WY4B 3B5NC 1L4AD 4PV1D 1L0LK 1LT9C 2FFDB 2WVRA 1YJNP 4I6MC 3Q2YA 1X79B 2WPQA 1LP1B 3TF5A 1NTKJ 2NZ2A 2N1TB 1KB9E 3MGNA 1QEXA 3LIEA 1K8AQ 3IR9A 5BU8B 4W7ZA 2E76D 3HUSC 1RE4C 4K35A 2KZIA 1U7JA 5B66H 1PP9G 1U57A 4JPZB 4OVNF 4TLFA 3C1LA 5CBNA 3M06A 4JYCA 1RE3A 3H1JJ 1LTTC 4H0LC 2KUBA 1BSHA 1QX8A 2Q7CA 1IFMA 3P8CE 3P7KA 1QVGO 2I1KA 2W83C 3A5TA 1EDLA 4GODA 1KZUB 5TJHA 3RK2D 3L74D 3L73G 4OGQC 1RY3A 1VQLP 2QM7A 3H1JG 2GA1A 2QEXP 2QJYB 1OW7A 4L75A 2QJKC 3CWBG 2O3JA 2PP6A 3H1LD 3GG2A 5KKZB 1SQXJ 1VDFA 1SQPE 2M0BA 2R5BA 2R32A 4GOEA 1K04A 1FZCC 1GL2D 4JF7A 4AQRD 2ZXEB 3HUSA 1WMKA 5AW3B 3GF3A 5AW7B 4GIFA 4WVZA 1LTIC 1ZOYC 1N7SA 4UB6E 2OYIA 1VQ8P 2R44A 3HUSB 1NTKD 1PP9D 1HBWA 2C9LY 2R5DA 1RF1C 3EWKA 5L8RJ 2Y9ZA 1VF5B 4I1LA 3CXHH 5KJ7D 3BCCE 1N7SB 1L4AA 1LTJA 3OA7A 1SQVE 2A45G 2W6BA 2OYIB 3L71J 4KHXA 4H13B 3BATA 3MUDC 4XE5B 3KDPB 5DJTB 1IFNA 3B71A 3U1AA 3H1JD 1BE3J 2QVAA 1L4AB 1LTJB 1HGVA 3CWBD 3HRNA 2I1JA 1HF9A 3HE4A 2QJPC 3CC4P 4N6JA 1NTME 5TISH 1H89A 1GD2E 1ZXGA 4H44C 3KQGA 4ZNCA 1VQMP 1H0TA 2YKPA 3KYQA 2P10A 2B87A 1GK4A 3LW5H 3HE4B 3CCSP 1NKZB 1NU1J 2HLOA 1H8AA 2H89C 3O6QA 5DJUB 2FBWC 1T2KD 1SQXD 1PGJA 2H8PD 1P84I 2Q1KA 1EDJA 1ZN5A 4HH2A 3SFDC 3RL0B 1H0TB 5AW1B 2XNXA 1SQPK 1Q86Q 2B87B 2JEEA 2FYNB 1NU1G 3F5HA 2FKWB 3O6QB 4M3LA 3IF4A 3V4QA 4MN4C 1YIJP 4B86A 2CPBA 4PD4H 1MKMA 2RH0A 3VMZA 2BCCJ 2N9BA 2HFED 1LWUA 4HJGH 1JM0A 1GL2A 2FYZA 2OYOA 5GTHE 2B88A 3M0DA 1E79H 1LWUB 3MZWB 3TGUG 1ZLLA 1GL2B 2P58A 3L70G 2YXRB 3N7NA 1IFIA 2ZT9D 4L74A 1BCCJ 3H6PA 1VQPP 4I2LC 4BXLA 1BE3D 2J59M 4IL6E 1URQC 1M1KQ 2XV5A 5KJ7A 1M57D 1S9KD 1L0NG 1G1IA 2E74C 3NTNA 1LGHB 1ZMEC 2E75C 1KILE 4HB1A 3V4WA 1EXJA 1GK6A 1P84D 1NU1K 1NTMK 2K3RA 2KS1A 1D7MA 2NPSC 2QIWA 3A2AA 1NU1D 2OARA 1DX7A 3M0AA 1NTZG 1HGZA 3GF7A 4I7ZB 2WPVB 1TU3F 2KS1B 3Q5PA 1YI2P 1FJPA 2R3CA 5BVZA 4N78E 3L75G 3CX5H 5AVSB 1N7LA 1GZLA 2BCCD 1S1CX 3NXSA 1L0LE 1ZP0C 2KLVA 3JCUH 3F89A 1N8RQ 4BRYA 1ZR2A 1NAFA 3H1HJ 1WRGA 3I56P 1KORA 3G4SP 1QLED 4QMAA 3H1IG 4IOIH 1SVFA 2G3AA 1K73Q 1L0NK 4YPCA 2BEQD 2KOGA 4XA4A 4UB6H 1Q7YQ 3QH9A 4BRYB 2FXMA 2FYUJ 3OAKA 1OVRA 1BCCD 1KN7A 3MTUE 2E5TA 2WZ7A 1NTZK 2KK7A 3L74E 3HE5A 2W6JH 2WPRA 3VP8A 2E43A 1X8YA 1YITP 1IFPA 2M3BA 2WQYC 3VN0A 5KLVJ 1NVOA 4WBAA 1JY2P 3D71A 3CXHI 2ZYAA 2E42A 4HKZH 2KSJA 3FGAD 3HE5B 3FX0A 3WU2E 4EIJA 2PAJA 2ZT9B 2MKVA 1JUNA 3AE7C 1FBMA 1T6AA 1VF5D 1DH3A 2KXPB 3LW5J 1N7SD 5AW2B 5AW6B 5KTBA 3AEDC 4H13D 2V7QH 3CI9A 4R4LA 4UB8E 1S4XA 1J1EB 2XKMA 4R4MA 2P67A 1SQBJ 3OJAB 3H1LG 2Z5IA 1NTKE 1PP9E 3IAOA 3M91A 2ZFCA 1NHLA 4U7JA 1JTHB 4JQ0D 3H1HD 3JSVC 4AYCA 3KZIH 2JO1A 2ZVOB 3JC22 1KYOE 1J1DC 4YXWH 3L73E 3ITKA 1M8OB 2WPSA 5GTHH 3H1JE 5KAFE 3RK3C 2FYUD 3ABVC 2IDBA 3AE1C 3CWBE 1NTKG 3A0HH 4PD4I 2IFNA 3BRVB 3CXHD 3RBZA 3E1IA 2OYHC 1T8ZA 1JCDA 4ASVA 3RL0D 2W6AA 1KILC 1MUUA 3U59A 1T3UA 5KAIE 1IJDB 2OQQA 2QE7H 4DZOA 4LLHA 2MJZA 4CPGA 3LIDA 5KLVD 1FE6A 1R5LA 2OTJP 3TSIA 1MFTA 1CW5A 1SQXE 2KSEA 1CI6A 1DD3A 3CC7P 3VMYA 3B5NA 1LTSC 2YNYA 1M1JC 1SFCC 3NFQA 1LT9A 3FWNA 1VQ6P 3I5CA 1OX3A 1UIIA 4U3FJ 4WWIA 1CI6B 4PV1C 2LKMA 3B5NB 3VP9A 4ZMDA 1RHZB 1LT9B 1SQBD 3B4SA 1N86A 1RE4A 4Y99C 1LNQA 1SQXG 3SWFA 1FDMA 4U3FG 1LJ2A 4DCKA 4H44D 1DEBA 1NTKK 1KQFB 2E76C 2IPPA 1EXIA 3RK3B 5AVWB 1PZQA 2K9YA 4PD4D 2O1KA 1W2EA 5K5GB 1ZRTD 3IFMA 3AE9C 2AXTH 1NKNA 2P7JA 4H0LB 1BE3E 4C7NA 3CX5I 4XFJA 3PP5A 1VQ9P 3RK2C 2H88C 1MV8A 1AQ5A 2ZVNB 1S5LE 2Y0CA 3AE4C 4OGQB 1PFIA 5GTIH 1P84E 4HYTB 1RF0C 2Q3EA 1EZVI 3BVHA 4C7NB 3L71G 2QJKB 4O9BA 1DEEG 1FZCA 4RESB 2Y9YA 1SLQA 2V4HA 1NU1E 2W27A 1NJIQ 2D2CC 5CCGC 3BCCJ 3V5BA 1NAYA 1JY3N 1BE3G 2BEZF 1NH4A 3FXEA 1JY3P 1SQXK 1FZCB 5AVUB 1KTMA 3MP7B 1QVFO 4U3FD 1N73C 1RF1A 1VPCA 3PH0A 1BSNA 4C46A 4LGDE 2YMYA 1PV3A 2BCCE 5KLIC 3AE5C 2ITAA 2H7HA 4GKGA 3VMXA 3TGUE 2Z5HA 1FZGA 1IC2A 3A0BE 3L35A 3MUDA 1YYCA 1JNMA 3L70E
chains in the Genus database with same CATH topology
3BCCJ 4D6TJ 1P84I 1BCCJ 3L72J 2FYUJ 3H1HJ 1SQVJ 1SQQJ 1BE3J 3CWBJ 3H1IJ 2BCCJ 1L0LJ 1EZVI 1KB9I 1PP9J 1SQBJ 1NTKJ 3H1LJ 5KLVJ 3CX5I 3L71J 3TGUJ 4PD4I 1NTMJ 3L74J 1NU1J 1SQPJ 1L0NJ 3CXHI 3H1KJ 1KYOI 3L70J 1SQXJ 3L73J 2IBZI 1BGYJ 3L75J 4U3FJ 3H1JJ 1NTZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC J;  4D6T J;  1P84 I;  1BCC J;  3L72 J;  2FYU J;  3H1H J;  1SQV J;  1SQQ J;  1BE3 J;  3CWB J;  3H1I J;  2BCC J;  1L0L J;  1EZV I;  1KB9 I;  1PP9 J;  1SQB J;  1NTK J;  3H1L J;  5KLV J;  3CX5 I;  3L71 J;  3TGU J;  4PD4 I;  1NTM J;  3L74 J;  1NU1 J;  1SQP J;  1L0N J;  3CXH I;  3H1K J;  1KYO I;  3L70 J;  1SQX J;  3L73 J;  2IBZ I;  1BGY J;  3L75 J;  4U3F J;  3H1J J;  1NTZ J; 
#chains in the Genus database with same CATH topology
 2WSF H;  1RF1 B;  1JCC A;  3MD0 A;  1LTA C;  1S2E A;  1HUC A;  5AW4 B;  5AW8 B;  1AVO A;  3CX5 D;  2GUS A;  4UB8 H;  1USE A;  2RMZ A;  2V7Q J;  4ZKU A;  3CCL P;  2YIU C;  1FU1 A;  1L0N E;  1UIX A;  2WSC H;  1OMI A;  3M9B A;  3OW2 O;  1GDT A;  1AQT A;  1OFC X;  2BCC G;  3H25 A;  1HJB A;  1EZV D;  2KI7 B;  3AEB C;  1AA0 A;  4GDO A;  2QA4 P;  2C9N Y;  1K05 A;  3L71 D;  5E79 E;  1WT6 A;  3WUT A;  2QJP B;  1KB9 H;  2K88 A;  2KZJ A;  1PPJ D;  5B66 E;  4PJ0 E;  3S4R A;  3IN6 A;  1NTZ E;  1JY3 O;  4H44 B;  5KAF H;  2IYP A;  3GHG C;  3CL3 D;  1HVV A;  2PGD A;  1KMI Z;  1KD1 Q;  3CCU P;  1T2K C;  3PLN A;  3L75 E;  4DJG A;  1BCC G;  3BCC D;  2IZ1 A;  1VQ5 P;  2IX7 C;  3TYY A;  3A7O A;  3CPW O;  2ZYG A;  1M7L A;  1M90 Q;  5KAI H;  1NYH A;  3C8V A;  3AEG C;  3C9I A;  3CLQ A;  1M56 D;  3RGU A;  3G6E P;  3V2P A;  2WIT A;  1OVU A;  1LT1 A;  1NWQ A;  3HD7 C;  1G2C A;  1Z56 A;  3H1I E;  1Q90 D;  2WSE H;  1YQ4 C;  1NGM B;  2GM4 A;  1R5S A;  3I55 P;  5APV A;  5EFW B;  1Q2N A;  3TK1 A;  1G2C B;  3PTZ A;  2AEM A;  2QSI A;  3H1K J;  5M1B A;  1URQ A;  5CHX A;  2A06 G;  3GHG A;  2O1J A;  3RL0 g;  2FXP A;  2ZJS E;  1S3J A;  2W8Z A;  4GOF A;  1SQQ J;  2Q9I A;  4N3Y B;  3H1K G;  4RKU J;  1JOC A;  1URQ B;  5CCH C;  1MFZ A;  2E5Y A;  3KHU A;  3E1R A;  2NPS A;  2CK3 H;  1VQ4 P;  1AVY A;  2E74 B;  2JWA A;  1L2P A;  1SQQ G;  3H1H G;  4IL6 X;  2E75 B;  2DW3 A;  2QG4 A;  1L0L J;  3R2P A;  1IO4 A;  3HD7 A;  4WY4 C;  4L73 A;  1OW8 A;  3S1K A;  1FZF A;  1OZH A;  2Q5U A;  2WSS H;  2HR3 A;  3WMM 0;  3B5N D;  1FOS F;  2NPS B;  2FFD C;  1ZR4 A;  1NO4 A;  4D6T J;  2WTY A;  2FYU G;  2N1T C;  1SS1 A;  1JY2 N;  4BWN A;  1OVV A;  1E5W A;  2HG5 D;  3P8M C;  1JMM A;  3H1L E;  1QGK B;  1PGO A;  2IBZ G;  1VQO P;  2IBZ I;  2PRR A;  3CCR P;  4D6T G;  3RK3 D;  4W7Y A;  5APW A;  3AEE C;  2YO3 A;  2PFX A;  5KLV G;  3FXD A;  4W80 A;  2N9Y B;  3CC2 P;  2YKO A;  1PIX A;  1K9M Q;  1PL5 A;  1GW3 A;  1BGY J;  1X22 A;  2A06 D;  1CSB A;  4H0L D;  2Q3I A;  5CJ0 A;  3L72 J;  1VQN P;  5C39 A;  2O01 N;  3AEF C;  3AE8 C;  1RE3 C;  1GTW A;  4PD4 E;  4KT0 J;  2WT7 A;  4OGQ D;  3H1K D;  1ZRT E;  2QJY C;  1SQQ K;  3SWK A;  3L37 A;  3PJS K;  3EFG A;  4KJM A;  2P2U A;  3R4Y A;  5AVX B;  4L76 A;  3USS A;  3P32 A;  1SQQ D;  1OW6 A;  1FDI A;  1LTG C;  1SQB G;  5KKZ C;  2WSF J;  4N78 D;  5APU A;  5AVY B;  1OXZ A;  2WT7 B;  1USD A;  4LC1 A;  2FYU K;  3A3Y B;  2J5U A;  2M5A A;  2HPC A;  4WB4 A;  1HTL C;  1XTG B;  1JMB A;  1PP9 J;  2WSC J;  1JY2 O;  1L0L D;  3CCV P;  3V2Q A;  2JKV A;  1EC5 A;  2CPS A;  1YTZ T;  2K37 A;  2M5A B;  2IBZ D;  4IFD K;  2HPC B;  5E79 H;  3VOP A;  1GU4 A;  5KLV K;  4D6T D;  5CJ4 A;  2UWJ E;  1QL2 A;  4PJ0 H;  2OGU A;  3WUU A;  2RKL A;  3O8Z A;  1VF5 C;  3L73 J;  2YO2 A;  4IL6 H;  1EDK A;  1N7S C;  3T97 A;  3GLM A;  4U3F E;  2OYI C;  3CWB J;  4H13 C;  2WWW A;  1KB9 I;  2JP3 A;  2IZ0 A;  1Q81 Q;  3VMA A;  4EDF A;  1X0T A;  1KYO I;  4OWF A;  2POH A;  1RQV A;  2M8R A;  3T97 B;  1BGY D;  1L4A C;  1LTJ C;  5APX A;  3AE2 C;  1SQB K;  3M9Q A;  3SFE C;  3L72 D;  3S9O A;  2XZR A;  3CX5 E;  3D70 A;  3RBX A;  1DD4 A;  2D2C D;  5CCG D;  1KV4 A;  1KQL A;  2M3E A;  5B5E E;  2OYH A;  3UIA A;  1J1D B;  1QL1 A;  2WSE J;  1KIL A;  3JCU E;  1KQS O;  1W5C E;  1FS0 E;  4DT0 A;  1EZV E;  3MHV A;  3V6I A;  2KNC A;  3HTK A;  1SQP J;  3L71 E;  1U7M A;  3RL0 C;  1PGQ A;  1PPJ E;  5AVT B;  3Q1M A;  2OYH B;  1CZQ A;  2FYN C;  1KIL B;  1G1J A;  2KP8 A;  2LXC B;  3ZDM A;  2KNC B;  3HTK B;  4NPE A;  1SQP G;  1M1J A;  1YQ3 C;  3CCQ P;  1S9K E;  3L4F A;  1SFC A;  1IFD A;  3AE6 C;  2OTK E;  1FJK A;  1AFO A;  3G9R A;  1EZV G;  1Y9B A;  2A45 I;  4GT1 A;  1A02 J;  5H2F E;  1KB9 D;  2VRS A;  1FZE A;  4IFM A;  3Q5S A;  1YHQ P;  1M1J B;  1SFC B;  4EYY Q;  2G8Y A;  1KYO D;  1PPJ G;  5APQ A;  3L73 D;  3TNU A;  1OIP A;  2XU6 A;  1LWU C;  1SQV J;  3CCE P;  1AJY A;  4PV1 B;  1YJ9 P;  4JBZ A;  1GL2 C;  2ZAE B;  4EI2 A;  3VYI A;  2ZYD A;  2XDJ A;  3M0D C;  3CME P;  2JR8 A;  3TNU B;  5AW0 B;  2OTL P;  1Q82 Q;  2Y0E A;  4Y99 B;  3U1C A;  3BCC G;  1VQK P;  1IK9 A;  1SQV G;  1GW4 A;  3E7K A;  3P8C D;  2ZXX A;  1H88 A;  2QM8 A;  1URQ D;  3WU2 H;  4TT3 H;  2E76 B;  1NTM J;  2E74 D;  2QRX A;  4YXD C;  5APS A;  4DOJ A;  2JDI H;  1BDD A;  2E75 D;  2O01 H;  5AVR B;  1KFM A;  5KJ7 C;  3D6Y A;  1ZV8 A;  1J2J B;  2RN0 A;  2BAS A;  1RF0 A;  1EDI A;  1NTM G;  2NPS D;  1EQ7 A;  1SQP D;  2R3S A;  2YMK A;  3RK2 B;  4I7Z C;  2J58 A;  3CMA P;  1VL2 A;  5AVV B;  5AW5 B;  1RH5 B;  3B8E B;  3HD7 D;  2W90 A;  1ZW0 A;  3PHL A;  3KZI E;  5CCG A;  3L36 A;  1BCC E;  3CCJ P;  3Q3D A;  2XND H;  3TGU J;  3Q5R A;  4EOT A;  3H32 A;  1S5L X;  3L70 J;  1FOS E;  4K3A A;  3V2R A;  5AVQ B;  1MZ9 A;  3A0H E;  2LR2 A;  2D2C B;  2B89 A;  1KYO H;  1IFJ A;  4Z1M H;  1N73 A;  2SPZ A;  5CBO A;  1L0N J;  3H32 B;  2AXC A;  1A02 F;  1IK7 A;  1SQV K;  1JO5 A;  1BDC A;  4RJT A;  1IZN B;  3CD6 P;  3RK3 E;  2KIK A;  2L91 A;  4IFF A;  1AV1 A;  2JWD A;  1SQV D;  1N73 B;  4OH8 B;  3WUV A;  5BU5 A;  2C0W A;  3SWY A;  5CCH D;  3QWO C;  2AEF A;  5KLI B;  1GU5 A;  3G71 P;  4JYB A;  1Y8A A;  2HYN A;  3NMD A;  2AEJ A;  2A06 E;  1NTZ J;  2WMM A;  4YTP C;  4RO0 A;  1HWT C;  1GMJ A;  2FXO A;  4AUW A;  4Y28 J;  2KYV A;  4WY4 D;  1S72 P;  1NTM D;  3H1K E;  3G3Z A;  3L75 J;  2IYO A;  2YIU B;  2P1J A;  2HOD A;  3W67 A;  2N1T D;  3V2N A;  5APY A;  1SQQ E;  3H1H E;  2YKQ A;  2YXQ B;  3TDK A;  3D6Z A;  3FWL A;  2LXB A;  1KFN A;  1FZB A;  3SSU A;  2A45 H;  1HJ0 A;  2NRG A;  3KXD A;  2ZT9 C;  3W68 A;  2HOD B;  2IFM A;  1FZA A;  3H1I J;  2Q6Q A;  1T3J A;  2FYU E;  1VQ7 P;  5B5E H;  2AXT E;  3TGU D;  1RQU A;  2K9J A;  2JJL A;  1YTZ I;  3CXH E;  3GHG B;  3L70 D;  2IBZ E;  4ZKP A;  3KPE A;  1J1E C;  3PRJ A;  4D6T E;  1KQG B;  1OWA A;  1FDO A;  1Y47 A;  2H43 A;  5KLV E;  3VTP C;  2K9J B;  5GTI E;  1L0N D;  3K5B A;  3M9H A;  1R8E A;  5AVZ B;  1DIP A;  2C0X A;  1S5L H;  1L0L G;  3HD7 B;  1W2B O;  3AEC C;  1P84 H;  5TIS E;  4C7R A;  5H2F H;  1YJW P;  2Z4E A;  2KB7 P;  3BRT B;  2Y0D A;  1BGY E;  1NOH A;  1NTZ D;  2FY8 A;  3L72 E;  4A7P A;  3AE3 C;  2B9B A;  1JB0 J;  3L74 J;  1SQB E;  1XTC C;  4NPF X;  2GUV A;  1FAV A;  1KIL D;  5CCH A;  3L75 D;  3GW6 A;  4ASW A;  4NPD A;  1JEK A;  3GMA A;  3H1L J;  1HH0 A;  3AEA C;  3L74 G;  1N2D C;  1SP4 A;  4WY4 A;  2I8D A;  1KC8 Q;  1BGY G;  2KLU A;  3N4X A;  5CMZ A;  1YBK A;  5APT A;  3EQ2 A;  1JTH A;  3L72 G;  2FFD A;  3CCM P;  3A0B H;  3EFF K;  1PGP A;  1LTB C;  3MIW A;  1LP1 A;  3H1I D;  1SFC D;  5AW9 B;  2K1A A;  1X9V A;  2L5G B;  2N1T A;  1FC2 C;  2O01 J;  3II6 A;  3BAS A;  4WY4 B;  3B5N C;  1L4A D;  4PV1 D;  1L0L K;  1LT9 C;  2FFD B;  2WVR A;  1YJN P;  4I6M C;  3Q2Y A;  1X79 B;  2WPQ A;  1LP1 B;  3TF5 A;  1NTK J;  2NZ2 A;  2N1T B;  1KB9 E;  3MGN A;  1QEX A;  3LIE A;  1K8A Q;  3IR9 A;  5BU8 B;  4W7Z A;  2E76 D;  3HUS C;  1RE4 C;  4K35 A;  2KZI A;  1U7J A;  5B66 H;  1PP9 G;  1U57 A;  4JPZ B;  4OVN F;  4TLF A;  3C1L A;  5CBN A;  3M06 A;  4JYC A;  1RE3 A;  3H1J J;  1LTT C;  4H0L C;  2KUB A;  1BSH A;  1QX8 A;  2Q7C A;  1IFM A;  3P8C E;  3P7K A;  1QVG O;  2I1K A;  2W83 C;  3A5T A;  1EDL A;  4GOD A;  1KZU B;  5TJH A;  3RK2 D;  3L74 D;  3L73 G;  4OGQ C;  1RY3 A;  1VQL P;  2QM7 A;  3H1J G;  2GA1 A;  2QEX P;  2QJY B;  1OW7 A;  4L75 A;  2QJK C;  3CWB G;  2O3J A;  2PP6 A;  3H1L D;  3GG2 A;  5KKZ B;  1SQX J;  1VDF A;  1SQP E;  2M0B A;  2R5B A;  2R32 A;  4GOE A;  1K04 A;  1FZC C;  1GL2 D;  4JF7 A;  4AQR D;  2ZXE B;  3HUS A;  1WMK A;  5AW3 B;  3GF3 A;  5AW7 B;  4GIF A;  4WVZ A;  1LTI C;  1ZOY C;  1N7S A;  4UB6 E;  2OYI A;  1VQ8 P;  2R44 A;  3HUS B;  1NTK D;  1PP9 D;  1HBW A;  2C9L Y;  2R5D A;  1RF1 C;  3EWK A;  5L8R J;  2Y9Z A;  1VF5 B;  4I1L A;  3CXH H;  5KJ7 D;  3BCC E;  1N7S B;  1L4A A;  1LTJ A;  3OA7 A;  1SQV E;  2A45 G;  2W6B A;  2OYI B;  3L71 J;  4KHX A;  4H13 B;  3BAT A;  3MUD C;  4XE5 B;  3KDP B;  5DJT B;  1IFN A;  3B71 A;  3U1A A;  3H1J D;  1BE3 J;  2QVA A;  1L4A B;  1LTJ B;  1HGV A;  3CWB D;  3HRN A;  2I1J A;  1HF9 A;  3HE4 A;  2QJP C;  3CC4 P;  4N6J A;  1NTM E;  5TIS H;  1H89 A;  1GD2 E;  1ZXG A;  4H44 C;  3KQG A;  4ZNC A;  1VQM P;  1H0T A;  2YKP A;  3KYQ A;  2P10 A;  2B87 A;  1GK4 A;  3LW5 H;  3HE4 B;  3CCS P;  1NKZ B;  1NU1 J;  2HLO A;  1H8A A;  2H89 C;  3O6Q A;  5DJU B;  2FBW C;  1T2K D;  1SQX D;  1PGJ A;  2H8P D;  1P84 I;  2Q1K A;  1EDJ A;  1ZN5 A;  4HH2 A;  3SFD C;  3RL0 B;  1H0T B;  5AW1 B;  2XNX A;  1SQP K;  1Q86 Q;  2B87 B;  2JEE A;  2FYN B;  1NU1 G;  3F5H A;  2FKW B;  3O6Q B;  4M3L A;  3IF4 A;  3V4Q A;  4MN4 C;  1YIJ P;  4B86 A;  2CPB A;  4PD4 H;  1MKM A;  2RH0 A;  3VMZ A;  2BCC J;  2N9B A;  2HFE D;  1LWU A;  4HJG H;  1JM0 A;  1GL2 A;  2FYZ A;  2OYO A;  5GTH E;  2B88 A;  3M0D A;  1E79 H;  1LWU B;  3MZW B;  3TGU G;  1ZLL A;  1GL2 B;  2P58 A;  3L70 G;  2YXR B;  3N7N A;  1IFI A;  2ZT9 D;  4L74 A;  1BCC J;  3H6P A;  1VQP P;  4I2L C;  4BXL A;  1BE3 D;  2J59 M;  4IL6 E;  1URQ C;  1M1K Q;  2XV5 A;  5KJ7 A;  1M57 D;  1S9K D;  1L0N G;  1G1I A;  2E74 C;  3NTN A;  1LGH B;  1ZME C;  2E75 C;  1KIL E;  4HB1 A;  3V4W A;  1EXJ A;  1GK6 A;  1P84 D;  1NU1 K;  1NTM K;  2K3R A;  2KS1 A;  1D7M A;  2NPS C;  2QIW A;  3A2A A;  1NU1 D;  2OAR A;  1DX7 A;  3M0A A;  1NTZ G;  1HGZ A;  3GF7 A;  4I7Z B;  2WPV B;  1TU3 F;  2KS1 B;  3Q5P A;  1YI2 P;  1FJP A;  2R3C A;  5BVZ A;  4N78 E;  3L75 G;  3CX5 H;  5AVS B;  1N7L A;  1GZL A;  2BCC D;  1S1C X;  3NXS A;  1L0L E;  1ZP0 C;  2KLV A;  3JCU H;  3F89 A;  1N8R Q;  4BRY A;  1ZR2 A;  1NAF A;  3H1H J;  1WRG A;  3I56 P;  1KOR A;  3G4S P;  1QLE D;  4QMA A;  3H1I G;  4IOI H;  1SVF A;  2G3A A;  1K73 Q;  1L0N K;  4YPC A;  2BEQ D;  2KOG A;  4XA4 A;  4UB6 H;  1Q7Y Q;  3QH9 A;  4BRY B;  2FXM A;  2FYU J;  3OAK A;  1OVR A;  1BCC D;  1KN7 A;  3MTU E;  2E5T A;  2WZ7 A;  1NTZ K;  2KK7 A;  3L74 E;  3HE5 A;  2W6J H;  2WPR A;  3VP8 A;  2E43 A;  1X8Y A;  1YIT P;  1IFP A;  2M3B A;  2WQY C;  3VN0 A;  5KLV J;  1NVO A;  4WBA A;  1JY2 P;  3D71 A;  3CXH I;  2ZYA A;  2E42 A;  4HKZ H;  2KSJ A;  3FGA D;  3HE5 B;  3FX0 A;  3WU2 E;  4EIJ A;  2PAJ A;  2ZT9 B;  2MKV A;  1JUN A;  3AE7 C;  1FBM A;  1T6A A;  1VF5 D;  1DH3 A;  2KXP B;  3LW5 J;  1N7S D;  5AW2 B;  5AW6 B;  5KTB A;  3AED C;  4H13 D;  2V7Q H;  3CI9 A;  4R4L A;  4UB8 E;  1S4X A;  1J1E B;  2XKM A;  4R4M A;  2P67 A;  1SQB J;  3OJA B;  3H1L G;  2Z5I A;  1NTK E;  1PP9 E;  3IAO A;  3M91 A;  2ZFC A;  1NHL A;  4U7J A;  1JTH B;  4JQ0 D;  3H1H D;  3JSV C;  4AYC A;  3KZI H;  2JO1 A;  2ZVO B;  3JC2 2;  1KYO E;  1J1D C;  4YXW H;  3L73 E;  3ITK A;  1M8O B;  2WPS A;  5GTH H;  3H1J E;  5KAF E;  3RK3 C;  2FYU D;  3ABV C;  2IDB A;  3AE1 C;  3CWB E;  1NTK G;  3A0H H;  4PD4 I;  2IFN A;  3BRV B;  3CXH D;  3RBZ A;  3E1I A;  2OYH C;  1T8Z A;  1JCD A;  4ASV A;  3RL0 D;  2W6A A;  1KIL C;  1MUU A;  3U59 A;  1T3U A;  5KAI E;  1IJD B;  2OQQ A;  2QE7 H;  4DZO A;  4LLH A;  2MJZ A;  4CPG A;  3LID A;  5KLV D;  1FE6 A;  1R5L A;  2OTJ P;  3TSI A;  1MFT A;  1CW5 A;  1SQX E;  2KSE A;  1CI6 A;  1DD3 A;  3CC7 P;  3VMY A;  3B5N A;  1LTS C;  2YNY A;  1M1J C;  1SFC C;  3NFQ A;  1LT9 A;  3FWN A;  1VQ6 P;  3I5C A;  1OX3 A;  1UII A;  4U3F J;  4WWI A;  1CI6 B;  4PV1 C;  2LKM A;  3B5N B;  3VP9 A;  4ZMD A;  1RHZ B;  1LT9 B;  1SQB D;  3B4S A;  1N86 A;  1RE4 A;  4Y99 C;  1LNQ A;  1SQX G;  3SWF A;  1FDM A;  4U3F G;  1LJ2 A;  4DCK A;  4H44 D;  1DEB A;  1NTK K;  1KQF B;  2E76 C;  2IPP A;  1EXI A;  3RK3 B;  5AVW B;  1PZQ A;  2K9Y A;  4PD4 D;  2O1K A;  1W2E A;  5K5G B;  1ZRT D;  3IFM A;  3AE9 C;  2AXT H;  1NKN A;  2P7J A;  4H0L B;  1BE3 E;  4C7N A;  3CX5 I;  4XFJ A;  3PP5 A;  1VQ9 P;  3RK2 C;  2H88 C;  1MV8 A;  1AQ5 A;  2ZVN B;  1S5L E;  2Y0C A;  3AE4 C;  4OGQ B;  1PFI A;  5GTI H;  1P84 E;  4HYT B;  1RF0 C;  2Q3E A;  1EZV I;  3BVH A;  4C7N B;  3L71 G;  2QJK B;  4O9B A;  1DEE G;  1FZC A;  4RES B;  2Y9Y A;  1SLQ A;  2V4H A;  1NU1 E;  2W27 A;  1NJI Q;  2D2C C;  5CCG C;  3BCC J;  3V5B A;  1NAY A;  1JY3 N;  1BE3 G;  2BEZ F;  1NH4 A;  3FXE A;  1JY3 P;  1SQX K;  1FZC B;  5AVU B;  1KTM A;  3MP7 B;  1QVF O;  4U3F D;  1N73 C;  1RF1 A;  1VPC A;  3PH0 A;  1BSN A;  4C46 A;  4LGD E;  2YMY A;  1PV3 A;  2BCC E;  5KLI C;  3AE5 C;  2ITA A;  2H7H A;  4GKG A;  3VMX A;  3TGU E;  2Z5H A;  1FZG A;  1IC2 A;  3A0B E;  3L35 A;  3MUD A;  1YYC A;  1JNM A;  3L70 E; 
#chains in the Genus database with same CATH homology
 3BCC J;  4D6T J;  1P84 I;  1BCC J;  3L72 J;  2FYU J;  3H1H J;  1SQV J;  1SQQ J;  1BE3 J;  3CWB J;  3H1I J;  2BCC J;  1L0L J;  1EZV I;  1KB9 I;  1PP9 J;  1SQB J;  1NTK J;  3H1L J;  5KLV J;  3CX5 I;  3L71 J;  3TGU J;  4PD4 I;  1NTM J;  3L74 J;  1NU1 J;  1SQP J;  1L0N J;  3CXH I;  3H1K J;  1KYO I;  3L70 J;  1SQX J;  3L73 J;  2IBZ I;  1BGY J;  3L75 J;  4U3F J;  3H1J J;  1NTZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...