2ZVNB

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
85
structure length
85
Chain Sequence
SLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords UBC protein
total genus 38
structure length 85
sequence length 85
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2zvnB00
2V4HA 2ZVNB 3FX0A 3F89A 4BWNA 4OWFA 3JSVC 2ZVOB
chains in the Genus database with same CATH superfamily
2WVRA 3RGUA 2FKWB 3R2PA 4LC1A 2Z5HA 5KKZC 1NWQA 2OTKE 3FXDA 3H1JG 3CD6P 1NU1G 2N1TA 1RY3A 2IPPA 3A3YB 4PD4D 1BCCJ 2ZFCA 1KTMA 1VL2A 1Y9BA 1E5WA 2RH0A 1HH0A 1EDJA 4ZNCA 3Q3DA 4D6TE 2R5DA 1OVRA 1NGMB 3G71P 1IK9A 2BEQD 4HYTB 4GT1A 4JF7A 2WSCJ 5AW1B 5CCGC 3RL0B 2HLOA 3RL0C 2WT7B 1HBWA 1JMMA 3A7OA 5H2FE 3MUDA 4TLFA 2P58A 4OGQB 5CMZA 4AUWA 2IBZI 2KS1A 1UIIA 1HGVA 2CPSA 2OYHC 4GOFA 1FC2C 1K9MQ 1OXZA 3G6EP 1ZN5A 1OW6A 4XE5B 2Q6QA 1GU4A 1MV8A 1Q81Q 1FZCA 1W2BO 4OVNF 1N7SA 1P84H 2K9JA 3W68A 5KKZB 3W67A 3N7NA 5M1BA 3FX0A 3A0BE 1SFCB 2AXCA 2OYOA 1WT6A 2K9YA 1IFNA 5AVQB 1LT9C 2HODB 2P2UA 1FZCB 3KQGA 1NTKJ 4H44B 2NRGA 3L70G 4HB1A 1GTWA 3CXHI 1SQVD 5KLVD 1NTKG 4I6MC 1FZBA 1KB9E 2V7QJ 3VP9A 1J1DC 4D6TG 1S5LH 1FZGA 1DEBA 3CC4P 3F5HA 4GIFA 5H2FH 2C9NY 1MUUA 1XTCC 3MIWA 3M06A 4UB6H 2W6AA 3VP8A 3BVHA 1SQBE 2WQYC 2KZJA 2JWAA 1NAYA 1HJ0A 1G2CA 2POHA 3GHGA 5APXA 4ZMDA 1GZLA 1HGZA 1D7MA 1AA0A 3KZIH 3A5TA 1NJIQ 1M57D 4GOEA 4ZKUA 1IFDA 3JC22 2YKPA 1G2CB 1OW7A 1YBKA 4OWFA 1NTMK 1YJ9P 1R8EA 1VQLP 3H32A 1GW4A 5AW3B 2YKQA 5BU5A 1K8AQ 1PGQA 1SQBD 3HD7D 3RK3B 3MD0A 2IBZE 2R3SA 4Y99B 1VF5D 1DIPA 1Q82Q 1LP1A 4YTPC 3JCUE 1VPCA 3H1KD 3BRVB 2FY8A 3C8VA 3Q2YA 1YI2P 3KDPB 1AVOA 4PJ0E 2B89A 2Y0DA 1EDIA 1ZR4A 2Y0EA 3USSA 2PGDA 2Q9IA 1SP4A 1URQC 2ZXEB 1JEKA 2YO2A 2P7JA 2VRSA 5GTHH 5TISE 4IFFA 1SQPJ 2Q7CA 2J58A 2WSEJ 1JCDA 3EFGA 1LWUA 2KUBA 1VQ5P 4I7ZC 1NTZG 2AXTH 1KN7A 2O01N 1CI6B 3CCMP 2QJPC 4JYBA 1KB9I 1ZLLA 1P84D 3MHVA 3U1CA 2QVAA 3A0HH 1VF5B 1U57A 2JO1A 4Z1MH 3CCSP 1YIJP 2E5YA 1KFMA 1K73Q 2FFDA 3D6YA 2IX7C 2E74B 5KAFE 1SQBJ 2M5AA 1K05A 1P84E 1X8YA 3LIDA 2HPCB 3IN6A 5CCGD 3RL0D 1MKMA 5AW7B 1RH5B 1QEXA 5CJ0A 3P7KA 4U3FJ 5CCHD 1KB9H 3SWYA 1HVVA 1FZCC 2GM4A 1JY2N 2XZRA 1N86A 1SQQE 1X79B 4L76A 3IFMA 3H1HJ 4EYYQ 4RO0A 1VQ6P 2R44A 4IL6X 4BRYB 5CJ4A 1VQNP 1QVGO 2M3EA 3MUDC 3D6ZA 3CLQA 4EOTA 4L75A 1RF1C 3CC2P 5AW9B 1N7LA 2OQQA 4YXDC 2ZT9D 1VQ7P 1AJYA 2HYNA 4JQ0D 3M0AA 1JY3N 2E5TA 3OA7A 3VMYA 2NPSA 2HG5D 1RE3C 2LXCB 3EWKA 4OGQC 3CCRP 1GU5A 2V4HA 2N9YB 1KMIZ 1IK7A 2I1KA 2M3BA 1S9KE 1KILC 1GD2E 1HUCA 1LTAC 3V2PA 1GK4A 2E76C 3CCQP 2E74D 1NTKD 2YNYA 3PJSK 2O01H 3G3ZA 1KYOI 1M1JA 1SQVJ 3H1JD 2K1AA 1OVVA 2KIKA 3PRJA 1RQVA 3H1KG 5TJHA 4EI2A 1KYOE 1S72P 3ITKA 4EDFA 1M90Q 1FBMA 1SVFA 2BCCG 2A06G 1L0NG 3JCUH 3L74D 5AVRB 5K5GB 3QH9A 1M1JB 3H1IJ 1Q7YQ 1JUNA 2ZJSE 3HD7A 4LLHA 1PL5A 1LTBC 3PH0A 4HH2A 3GHGB 3AEEC 4C7RA 3PTZA 2N9BA 1FJPA 2NPSC 4IOIH 3BATA 1J1EB 3GG2A 1EZVI 4W7YA 3TF5A 1OMIA 2M8RA 1BGYD 2OTJP 1LWUC 3RK2B 1ZRTD 3GMAA 1NTZE 2QJKB 4IL6E 1S2EA 3CX5I 1NKNA 1N7SB 2YXRB 3L75E 3QWOC 1ZR2A 1N73B 5CCHA 3MP7B 1PFIA 2D2CB 1M7LA 2MKVA 3H1JJ 2C0WA 2JDIH 1S1CX 3O6QA 3H6PA 3L72G 1ZP0C 2FYUJ 2RKLA 3H1KE 3T97A 3U59A 3HUSA 4IFDK 1BSHA 2Z5IA 3HE4A 2IYPA 1RQUA 1ZV8A 2NPSD 4KHXA 5AW5B 2OYIC 1E79H 1FZAA 3BCCJ 2WSCH 1JTHA 3Q1MA 1KILB 1PPJE 1LTSC 1RF0C 1USDA 3Q5RA 1Y47A 2OYIA 4DJGA 3NTNA 2P67A 2KYVA 1OIPA 2QE7H 3BCCE 4RKUJ 1FDMA 2JP3A 2Q3IA 3AE4C 2E75C 2O01J 1JM0A 2QIWA 4NPEA 1LTJC 1KQGB 5B5EE 2OYIB 1PGPA 1EDLA 1USEA 1NVOA 3L74E 3OW2O 1EDKA 1L0LG 2LXBA 3B5NC 2BCCE 3H1IG 1SQQJ 1A02J 3KXDA 3ABVC 3LW5H 1SQBK 3MZWB 1SFCD 1S9KD 1SQQG 1SQXK 4I1LA 5KTBA 4U3FE 1YITP 4U3FG 4L73A 3RBZA 5B5EH 1EXJA 1VQ8P 1RF0A 5KLVG 1XTGB 2ITAA 5APQA 3PP5A 2G3AA 2FYUE 3RK2C 5KAFH 5AW8B 1NAFA 3L74G 2G8YA 1BDCA 2FYNC 1Q90D 1N7SC 4DCKA 2QJKC 2XNXA 2CPBA 3B5ND 3BCCG 3M9HA 1M1JC 2AEJA 4DZOA 5CCHC 1IFIA 2HR3A 1GL2A 3TNUB 3TGUE 4C7NB 2GA1A 3L35A 2WITA 3GHGC 3P8CD 2P10A 2IZ1A 3FWLA 2DW3A 4PV1C 2W8ZA 1N8RQ 2GUSA 3P8MC 1AV1A 3AECC 3H1LJ 1W2EA 3JSVC 2W6JH 1SS1A 1NTMJ 4IL6H 1VQOP 2HPCA 3A0HE 2OARA 5E79H 1FS0E 3AE8C 1L4AD 4DT0A 3L72D 2H43A 1JY2O 1YTZT 4NPDA 1IFPA 2QJYC 3CXHD 3CMEP 1JY3P 1ZMEC 4H13D 4Y99C 4JBZA 3TGUD 2N1TC 3AEBC 3RBXA 3RK3C 3CCVP 1CSBA 2A45G 3HTKB 4ASWA 1DD4A 1NU1E 1RF1B 2JWDA 3EFFK 3H1HE 1PPJG 3C9IA 3LW5J 5AVTB 1T2KD 1M8OB 2H7HA 1ZRTE 4NPFX 5B66E 1FDIA 1JY2P 1SQPK 3HTKA 5GTIE 3CXHE 1Q86Q 3D71A 3CC7P 3SWKA 3FGAD 3L72E 3OAKA 1LP1B 1NH4A 2QG4A 3N4XA 1YJNP 1LNQA 2D2CD 2FYUG 2IBZD 2M0BA 1KILE 2V7QH 2WSSH 5CBNA 1HJBA 1IO4A 2BCCD 4JYCA 5E79E 5BU8B 2E43A 1JOCA 5TISH 3V6IA 1H0TA 1KD1Q 2ZVOB 3CWBG 4H0LC 1NTKE 1S3JA 5B66H 3CWBJ 3L70E 3CL3D 4N78E 3WU2E 1LT9B 3IF4A 2E74C 2LKMA 2YO3A 1IC2A 2H8PD 1FZEA 4UB6E 2ZYGA 2A45I 2L91A 3H1HG 2KNCA 4YXWH 2QEXP 1PP9J 1IFMA 1S5LE 2IDBA 3VYIA 2XDJA 4ZKPA 3NXSA 1QGKB 1KC8Q 1FOSF 4LGDE 1L4AA 2PFXA 1JMBA 1L0LJ 2FXPA 3FWNA 4I7ZB 3V4QA 5AVYB 2ZT9C 4O9BA 3AE2C 5C39A 1JB0J 1SQQD 2Q5UA 2W83C 4KT0J 1KYOH 4U3FD 1N73A 4GDOA 3CCUP 2O1KA 4WY4D 4D6TJ 2JR8A 2FYUK 3KPEA 2O1JA 3GF3A 1RE4A 3WUVA 1Q2NA 1GL2D 4HKZH 2I1JA 2WPQA 3CCEP 2KXPB 1RE4C 2K9JB 2Y0CA 2ZYDA 1DD3A 1EZVD 1SQXE 3I55P 2LR2A 1SQVK 2A06D 2YMYA 4PD4H 3TGUG 2IFNA 1JO5A 2W6BA 1NKZB 5AW6B 5GTHE 2KS1B 1BE3D 4GODA 3TYYA 1J2JB 1PPJD 3R4YA 3CCLP 1AVYA 1L4AC 1BCCD 1MFZA 1OVUA 1CZQA 1SLQA 1U7MA 2PRRA 2QJYB 1LT9A 2R32A 2KP8A 1BGYG 1LT1A 5AVUB 3P8CE 2KOGA 4C7NA 1H8AA 1HF9A 2WSFH 2A06E 4WBAA 2WPSA 1KYOD 2WMMA 1AQTA 1EZVE 1SQXD 1YQ4C 3HE4B 3HUSB 3HUSC 4H0LB 1N7SD 2I8DA 3GW6A 1N2DC 1ZW0A 4WY4C 3SSUA 4B86A 3OJAB 1NTMD 2W90A 1YHQP 3H1ID 3WMM0 2OYHA 3F89A 3L72J 1DEEG 5AVSB 1MZ9A 2QJPB 3AEDC 3IAOA 1PV3A 5DJUB 1ZXGA 1FAVA 2ZAEB 3WUUA 1VQPP 3AEAC 1SFCC 2OYHB 1U7JA 1DX7A 1RF1A 1NU1J 1HTLC 2C0XA 2WPRA 1BE3J 1FU1A 3GLMA 2K3RA 4WB4A 1OWAA 2W27A 4HJGH 3E1RA 2KLVA 3V2QA 2JEEA 3AE5C 3BASA 3KZIE 1KFNA 1IZNB 1X0TA 5AW0B 4H0LD 4ASVA 3H32B 1SQXJ 2QRXA 5AVZB 3PHLA 1BCCE 3L73D 3L71D 3Q5PA 5AVVB 2K37A 4H44D 1NTKK 3CX5H 3BCCD 2IFMA 1JTHB 2AEMA 1KILA 4PV1B 3I5CA 2ZT9B 4IFMA 1KB9D 3KHUA 5CCGA 5APSA 2Y9ZA 1RE3A 3RK3E 3V2RA 3I56P 3G9RA 4CPGA 1L0LK 3M91A 3VMXA 1T2KC 4WY4A 3TDKA 1NU1D 1UIXA 1SQQK 1GL2C 3Q5SA 2KSEA 2K88A 3B8EB 2N1TD 1RHZB 3HE5A 2FYNB 1VQ9P 1S5LX 1L0LD 1J1DB 2SPZA 3A2AA 1EQ7A 3FXEA 1NU1K 4WY4B 3TK1A 1AFOA 1HWTC 1T8ZA 4W7ZA 4BRYA 1PIXA 4H44C 2O3JA 1KORA 2XNDH 3AE7C 1OFCX 1BGYE 3H25A 1OZHA 1X9VA 3B71A 4D6TD 2OTLP 3L75G 2ZVNB 3AE9C 3CMAP 1L0NJ 1OX3A 2WT7A 2J59M 1LTGC 3L73E 1AQ5A 1OW8A 2JKVA 3A0BH 2FFDC 1KQFB 2AEFA 2QM7A 2C9LY 2ZXXA 3PLNA 1M1KQ 2KLUA 1GDTA 1FZFA 4RJTA 2PAJA 4N78D 4UB8E 3TNUA 5CBOA 3E7KA 4PD4E 5DJTB 4U7JA 4GKGA 5APYA 4TT3H 2YMKA 3M0DC 4QMAA 4JPZB 1PGJA 2N1TB 2QA4P 1URQA 2MJZA 2XU6A 2IYOA 3B4SA 3H1LD 3RK2D 5KJ7C 1K04A 5KLVE 1FDOA 2E76D 4WWIA 4XFJA 1VQKP 2UWJE 2B87A 3L4FA 3SFEC 2FYUD 2IBZG 3SWFA 2PP6A 3AEGC 3IR9A 1R5LA 2KZIA 1BSNA 3LIEA 1L0LE 2P1JA 1JCCA 2XV5A 3AE1C 1NTME 3H1HD 3L75J 2FBWC 4I2LC 3D70A 3H1LE 1NTZJ 1PP9E 2NZ2A 2RMZA 2A45H 2KNCB 5KLIB 1SQPG 3V4WA 2KSJA 1EXIA 1IFJA 1WRGA 5KAIE 2YIUB 2YIUC 3HD7B 3RK3D 2Z4EA 5GTIH 1M56D 2H88C 5BVZA 1QVFO 1SQBG 3CWBE 3L70J 3WU2H 1SQXG 2R3CA 2ZYAA 3AE6C 4C46A 4KJMA 2CK3H 4PJ0H 1NTMG 2BCCJ 3M9BA 5APVA 3CPWO 1JNMA 1EZVG 4PV1D 1T6AA 3UIAA 3L71G 1QX8A 2BASA 2HFED 5KAIH 3L71J 2R5BA 3CWBD 3AE3C 4PD4I 1VQ4P 2OGUA 1PGOA 2E76B 3HRNA 1QL2A 3L75D 3NFQA 3VTPC 2GUVA 1NTZD 3T97B 1BDDA 3B5NB 4RESB 2WZ7A 1L0NK 2YKOA 1GK6A 2KK7A 4K3AA 5CHXA 1SFCA 3NMDA 4BWNA 1LTJB 4DOJA 4H13B 1NHLA 1PP9D 2Q1KA 1ZOYC 3MTUE 5AVWB 5AW4B 2E75B 3K5BA 1NTZK 1URQD 1H88A 4R4LA 3ZDMA 1GW3A 2QSIA 2IZ0A 5KJ7D 1L0NE 4EIJA 1G1IA 3MGNA 4W80A 1WMKA 1BCCG 3RL0g 2WTYA 1LGHB 2YXQB 2KI7B 1R5SA 1L2PA 3P32A 3VN0A 2BEZF 2WPVB 1SQVG 3C1LA 2WSEH 3S9OA 1LTTC 2FXOA 1YJWP 1T3JA 2JJLA 1L0ND 2D2CC 1FE6A 3H1JE 3S1KA 3TGUJ 1QL1A 2E75D 5APTA 1MFTA 4AQRD 1GL2B 1GMJA 1QLED 1W5CE 1X22A 1LWUB 2QM8A 2RN0A 3BRTB 2B88A 4OH8B 3SFDC 1T3UA 1CI6A 2HODA 1S4XA 2NPSB 3L73G 2H89C 4R4MA 1SQVE 5KLIC 4AYCA 3B5NA 3V5BA 2FXMA 1H89A 3L37A 5KLVJ 4WVZA 1LTIC 3CX5D 2KB7P 3TSIA 1Y8AA 1KQSO 1PZQA 5AW2B 1TU3F 2XKMA 1LTJA 4MN4C 1URQB 3HE5B 4XA4A 1VQMP 5L8RJ 3H1IE 4K35A 3M9QA 3VMZA 2Q3EA 1FOSE 1KV4A 1Z56A 4M3LA 3S4RA 2Y9YA 2J5UA 1NYHA 3E1IA 1KZUB 3AEFC 3L74J 3V2NA 3EQ2A 4H13C 3CI9A 5KLVK 1FJKA 3VMAA 3GF7A 4BXLA 5EFWB 1A02F 3U1AA 1DH3A 1BE3E 4Y28J 2FFDB 1BE3G 1EC5A 5APWA 2M5AB 1CW5A 5KJ7A 1JY3O 3KYQA 2WWWA 1BGYJ 3CCJP 3L36A 1PP9G 3M0DA 3H1LG 3VOPA 2WSFJ 1LJ2A 3L70D 4YPCA 1P84I 3L71E 4N6JA 1H0TB 1YYCA 3H1KJ 2AXTE 3WUTA 3II6A 4N3YB 1VDFA 3L73J 2FYZA 2E42A 1NOHA 1YQ3C 2L5GB 1IJDB 3CX5E 1KILD 3O6QB 4UB8H 5APUA 1N73C 3CXHH 2B9BA 4L74A 4A7PA 1NO4A 1SQPD 1VF5C 1KQLA 2B87B 3O8ZA 3G4SP 3HD7C 4OGQD 1G1JA 1J1EC 1YTZI 5AVXB 1SQPE 1L4AB
chains in the Genus database with same CATH topology
2V4HA 2ZVNB 3FX0A 3F89A 4BWNA 4OWFA 3JSVC 2ZVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H A;  2ZVN B;  3FX0 A;  3F89 A;  4BWN A;  4OWF A;  3JSV C;  2ZVO B; 
#chains in the Genus database with same CATH topology
 2WVR A;  3RGU A;  2FKW B;  3R2P A;  4LC1 A;  2Z5H A;  5KKZ C;  1NWQ A;  2OTK E;  3FXD A;  3H1J G;  3CD6 P;  1NU1 G;  2N1T A;  1RY3 A;  2IPP A;  3A3Y B;  4PD4 D;  1BCC J;  2ZFC A;  1KTM A;  1VL2 A;  1Y9B A;  1E5W A;  2RH0 A;  1HH0 A;  1EDJ A;  4ZNC A;  3Q3D A;  4D6T E;  2R5D A;  1OVR A;  1NGM B;  3G71 P;  1IK9 A;  2BEQ D;  4HYT B;  4GT1 A;  4JF7 A;  2WSC J;  5AW1 B;  5CCG C;  3RL0 B;  2HLO A;  3RL0 C;  2WT7 B;  1HBW A;  1JMM A;  3A7O A;  5H2F E;  3MUD A;  4TLF A;  2P58 A;  4OGQ B;  5CMZ A;  4AUW A;  2IBZ I;  2KS1 A;  1UII A;  1HGV A;  2CPS A;  2OYH C;  4GOF A;  1FC2 C;  1K9M Q;  1OXZ A;  3G6E P;  1ZN5 A;  1OW6 A;  4XE5 B;  2Q6Q A;  1GU4 A;  1MV8 A;  1Q81 Q;  1FZC A;  1W2B O;  4OVN F;  1N7S A;  1P84 H;  2K9J A;  3W68 A;  5KKZ B;  3W67 A;  3N7N A;  5M1B A;  3FX0 A;  3A0B E;  1SFC B;  2AXC A;  2OYO A;  1WT6 A;  2K9Y A;  1IFN A;  5AVQ B;  1LT9 C;  2HOD B;  2P2U A;  1FZC B;  3KQG A;  1NTK J;  4H44 B;  2NRG A;  3L70 G;  4HB1 A;  1GTW A;  3CXH I;  1SQV D;  5KLV D;  1NTK G;  4I6M C;  1FZB A;  1KB9 E;  2V7Q J;  3VP9 A;  1J1D C;  4D6T G;  1S5L H;  1FZG A;  1DEB A;  3CC4 P;  3F5H A;  4GIF A;  5H2F H;  2C9N Y;  1MUU A;  1XTC C;  3MIW A;  3M06 A;  4UB6 H;  2W6A A;  3VP8 A;  3BVH A;  1SQB E;  2WQY C;  2KZJ A;  2JWA A;  1NAY A;  1HJ0 A;  1G2C A;  2POH A;  3GHG A;  5APX A;  4ZMD A;  1GZL A;  1HGZ A;  1D7M A;  1AA0 A;  3KZI H;  3A5T A;  1NJI Q;  1M57 D;  4GOE A;  4ZKU A;  1IFD A;  3JC2 2;  2YKP A;  1G2C B;  1OW7 A;  1YBK A;  4OWF A;  1NTM K;  1YJ9 P;  1R8E A;  1VQL P;  3H32 A;  1GW4 A;  5AW3 B;  2YKQ A;  5BU5 A;  1K8A Q;  1PGQ A;  1SQB D;  3HD7 D;  3RK3 B;  3MD0 A;  2IBZ E;  2R3S A;  4Y99 B;  1VF5 D;  1DIP A;  1Q82 Q;  1LP1 A;  4YTP C;  3JCU E;  1VPC A;  3H1K D;  3BRV B;  2FY8 A;  3C8V A;  3Q2Y A;  1YI2 P;  3KDP B;  1AVO A;  4PJ0 E;  2B89 A;  2Y0D A;  1EDI A;  1ZR4 A;  2Y0E A;  3USS A;  2PGD A;  2Q9I A;  1SP4 A;  1URQ C;  2ZXE B;  1JEK A;  2YO2 A;  2P7J A;  2VRS A;  5GTH H;  5TIS E;  4IFF A;  1SQP J;  2Q7C A;  2J58 A;  2WSE J;  1JCD A;  3EFG A;  1LWU A;  2KUB A;  1VQ5 P;  4I7Z C;  1NTZ G;  2AXT H;  1KN7 A;  2O01 N;  1CI6 B;  3CCM P;  2QJP C;  4JYB A;  1KB9 I;  1ZLL A;  1P84 D;  3MHV A;  3U1C A;  2QVA A;  3A0H H;  1VF5 B;  1U57 A;  2JO1 A;  4Z1M H;  3CCS P;  1YIJ P;  2E5Y A;  1KFM A;  1K73 Q;  2FFD A;  3D6Y A;  2IX7 C;  2E74 B;  5KAF E;  1SQB J;  2M5A A;  1K05 A;  1P84 E;  1X8Y A;  3LID A;  2HPC B;  3IN6 A;  5CCG D;  3RL0 D;  1MKM A;  5AW7 B;  1RH5 B;  1QEX A;  5CJ0 A;  3P7K A;  4U3F J;  5CCH D;  1KB9 H;  3SWY A;  1HVV A;  1FZC C;  2GM4 A;  1JY2 N;  2XZR A;  1N86 A;  1SQQ E;  1X79 B;  4L76 A;  3IFM A;  3H1H J;  4EYY Q;  4RO0 A;  1VQ6 P;  2R44 A;  4IL6 X;  4BRY B;  5CJ4 A;  1VQN P;  1QVG O;  2M3E A;  3MUD C;  3D6Z A;  3CLQ A;  4EOT A;  4L75 A;  1RF1 C;  3CC2 P;  5AW9 B;  1N7L A;  2OQQ A;  4YXD C;  2ZT9 D;  1VQ7 P;  1AJY A;  2HYN A;  4JQ0 D;  3M0A A;  1JY3 N;  2E5T A;  3OA7 A;  3VMY A;  2NPS A;  2HG5 D;  1RE3 C;  2LXC B;  3EWK A;  4OGQ C;  3CCR P;  1GU5 A;  2V4H A;  2N9Y B;  1KMI Z;  1IK7 A;  2I1K A;  2M3B A;  1S9K E;  1KIL C;  1GD2 E;  1HUC A;  1LTA C;  3V2P A;  1GK4 A;  2E76 C;  3CCQ P;  2E74 D;  1NTK D;  2YNY A;  3PJS K;  2O01 H;  3G3Z A;  1KYO I;  1M1J A;  1SQV J;  3H1J D;  2K1A A;  1OVV A;  2KIK A;  3PRJ A;  1RQV A;  3H1K G;  5TJH A;  4EI2 A;  1KYO E;  1S72 P;  3ITK A;  4EDF A;  1M90 Q;  1FBM A;  1SVF A;  2BCC G;  2A06 G;  1L0N G;  3JCU H;  3L74 D;  5AVR B;  5K5G B;  3QH9 A;  1M1J B;  3H1I J;  1Q7Y Q;  1JUN A;  2ZJS E;  3HD7 A;  4LLH A;  1PL5 A;  1LTB C;  3PH0 A;  4HH2 A;  3GHG B;  3AEE C;  4C7R A;  3PTZ A;  2N9B A;  1FJP A;  2NPS C;  4IOI H;  3BAT A;  1J1E B;  3GG2 A;  1EZV I;  4W7Y A;  3TF5 A;  1OMI A;  2M8R A;  1BGY D;  2OTJ P;  1LWU C;  3RK2 B;  1ZRT D;  3GMA A;  1NTZ E;  2QJK B;  4IL6 E;  1S2E A;  3CX5 I;  1NKN A;  1N7S B;  2YXR B;  3L75 E;  3QWO C;  1ZR2 A;  1N73 B;  5CCH A;  3MP7 B;  1PFI A;  2D2C B;  1M7L A;  2MKV A;  3H1J J;  2C0W A;  2JDI H;  1S1C X;  3O6Q A;  3H6P A;  3L72 G;  1ZP0 C;  2FYU J;  2RKL A;  3H1K E;  3T97 A;  3U59 A;  3HUS A;  4IFD K;  1BSH A;  2Z5I A;  3HE4 A;  2IYP A;  1RQU A;  1ZV8 A;  2NPS D;  4KHX A;  5AW5 B;  2OYI C;  1E79 H;  1FZA A;  3BCC J;  2WSC H;  1JTH A;  3Q1M A;  1KIL B;  1PPJ E;  1LTS C;  1RF0 C;  1USD A;  3Q5R A;  1Y47 A;  2OYI A;  4DJG A;  3NTN A;  2P67 A;  2KYV A;  1OIP A;  2QE7 H;  3BCC E;  4RKU J;  1FDM A;  2JP3 A;  2Q3I A;  3AE4 C;  2E75 C;  2O01 J;  1JM0 A;  2QIW A;  4NPE A;  1LTJ C;  1KQG B;  5B5E E;  2OYI B;  1PGP A;  1EDL A;  1USE A;  1NVO A;  3L74 E;  3OW2 O;  1EDK A;  1L0L G;  2LXB A;  3B5N C;  2BCC E;  3H1I G;  1SQQ J;  1A02 J;  3KXD A;  3ABV C;  3LW5 H;  1SQB K;  3MZW B;  1SFC D;  1S9K D;  1SQQ G;  1SQX K;  4I1L A;  5KTB A;  4U3F E;  1YIT P;  4U3F G;  4L73 A;  3RBZ A;  5B5E H;  1EXJ A;  1VQ8 P;  1RF0 A;  5KLV G;  1XTG B;  2ITA A;  5APQ A;  3PP5 A;  2G3A A;  2FYU E;  3RK2 C;  5KAF H;  5AW8 B;  1NAF A;  3L74 G;  2G8Y A;  1BDC A;  2FYN C;  1Q90 D;  1N7S C;  4DCK A;  2QJK C;  2XNX A;  2CPB A;  3B5N D;  3BCC G;  3M9H A;  1M1J C;  2AEJ A;  4DZO A;  5CCH C;  1IFI A;  2HR3 A;  1GL2 A;  3TNU B;  3TGU E;  4C7N B;  2GA1 A;  3L35 A;  2WIT A;  3GHG C;  3P8C D;  2P10 A;  2IZ1 A;  3FWL A;  2DW3 A;  4PV1 C;  2W8Z A;  1N8R Q;  2GUS A;  3P8M C;  1AV1 A;  3AEC C;  3H1L J;  1W2E A;  3JSV C;  2W6J H;  1SS1 A;  1NTM J;  4IL6 H;  1VQO P;  2HPC A;  3A0H E;  2OAR A;  5E79 H;  1FS0 E;  3AE8 C;  1L4A D;  4DT0 A;  3L72 D;  2H43 A;  1JY2 O;  1YTZ T;  4NPD A;  1IFP A;  2QJY C;  3CXH D;  3CME P;  1JY3 P;  1ZME C;  4H13 D;  4Y99 C;  4JBZ A;  3TGU D;  2N1T C;  3AEB C;  3RBX A;  3RK3 C;  3CCV P;  1CSB A;  2A45 G;  3HTK B;  4ASW A;  1DD4 A;  1NU1 E;  1RF1 B;  2JWD A;  3EFF K;  3H1H E;  1PPJ G;  3C9I A;  3LW5 J;  5AVT B;  1T2K D;  1M8O B;  2H7H A;  1ZRT E;  4NPF X;  5B66 E;  1FDI A;  1JY2 P;  1SQP K;  3HTK A;  5GTI E;  3CXH E;  1Q86 Q;  3D71 A;  3CC7 P;  3SWK A;  3FGA D;  3L72 E;  3OAK A;  1LP1 B;  1NH4 A;  2QG4 A;  3N4X A;  1YJN P;  1LNQ A;  2D2C D;  2FYU G;  2IBZ D;  2M0B A;  1KIL E;  2V7Q H;  2WSS H;  5CBN A;  1HJB A;  1IO4 A;  2BCC D;  4JYC A;  5E79 E;  5BU8 B;  2E43 A;  1JOC A;  5TIS H;  3V6I A;  1H0T A;  1KD1 Q;  2ZVO B;  3CWB G;  4H0L C;  1NTK E;  1S3J A;  5B66 H;  3CWB J;  3L70 E;  3CL3 D;  4N78 E;  3WU2 E;  1LT9 B;  3IF4 A;  2E74 C;  2LKM A;  2YO3 A;  1IC2 A;  2H8P D;  1FZE A;  4UB6 E;  2ZYG A;  2A45 I;  2L91 A;  3H1H G;  2KNC A;  4YXW H;  2QEX P;  1PP9 J;  1IFM A;  1S5L E;  2IDB A;  3VYI A;  2XDJ A;  4ZKP A;  3NXS A;  1QGK B;  1KC8 Q;  1FOS F;  4LGD E;  1L4A A;  2PFX A;  1JMB A;  1L0L J;  2FXP A;  3FWN A;  4I7Z B;  3V4Q A;  5AVY B;  2ZT9 C;  4O9B A;  3AE2 C;  5C39 A;  1JB0 J;  1SQQ D;  2Q5U A;  2W83 C;  4KT0 J;  1KYO H;  4U3F D;  1N73 A;  4GDO A;  3CCU P;  2O1K A;  4WY4 D;  4D6T J;  2JR8 A;  2FYU K;  3KPE A;  2O1J A;  3GF3 A;  1RE4 A;  3WUV A;  1Q2N A;  1GL2 D;  4HKZ H;  2I1J A;  2WPQ A;  3CCE P;  2KXP B;  1RE4 C;  2K9J B;  2Y0C A;  2ZYD A;  1DD3 A;  1EZV D;  1SQX E;  3I55 P;  2LR2 A;  1SQV K;  2A06 D;  2YMY A;  4PD4 H;  3TGU G;  2IFN A;  1JO5 A;  2W6B A;  1NKZ B;  5AW6 B;  5GTH E;  2KS1 B;  1BE3 D;  4GOD A;  3TYY A;  1J2J B;  1PPJ D;  3R4Y A;  3CCL P;  1AVY A;  1L4A C;  1BCC D;  1MFZ A;  1OVU A;  1CZQ A;  1SLQ A;  1U7M A;  2PRR A;  2QJY B;  1LT9 A;  2R32 A;  2KP8 A;  1BGY G;  1LT1 A;  5AVU B;  3P8C E;  2KOG A;  4C7N A;  1H8A A;  1HF9 A;  2WSF H;  2A06 E;  4WBA A;  2WPS A;  1KYO D;  2WMM A;  1AQT A;  1EZV E;  1SQX D;  1YQ4 C;  3HE4 B;  3HUS B;  3HUS C;  4H0L B;  1N7S D;  2I8D A;  3GW6 A;  1N2D C;  1ZW0 A;  4WY4 C;  3SSU A;  4B86 A;  3OJA B;  1NTM D;  2W90 A;  1YHQ P;  3H1I D;  3WMM 0;  2OYH A;  3F89 A;  3L72 J;  1DEE G;  5AVS B;  1MZ9 A;  2QJP B;  3AED C;  3IAO A;  1PV3 A;  5DJU B;  1ZXG A;  1FAV A;  2ZAE B;  3WUU A;  1VQP P;  3AEA C;  1SFC C;  2OYH B;  1U7J A;  1DX7 A;  1RF1 A;  1NU1 J;  1HTL C;  2C0X A;  2WPR A;  1BE3 J;  1FU1 A;  3GLM A;  2K3R A;  4WB4 A;  1OWA A;  2W27 A;  4HJG H;  3E1R A;  2KLV A;  3V2Q A;  2JEE A;  3AE5 C;  3BAS A;  3KZI E;  1KFN A;  1IZN B;  1X0T A;  5AW0 B;  4H0L D;  4ASV A;  3H32 B;  1SQX J;  2QRX A;  5AVZ B;  3PHL A;  1BCC E;  3L73 D;  3L71 D;  3Q5P A;  5AVV B;  2K37 A;  4H44 D;  1NTK K;  3CX5 H;  3BCC D;  2IFM A;  1JTH B;  2AEM A;  1KIL A;  4PV1 B;  3I5C A;  2ZT9 B;  4IFM A;  1KB9 D;  3KHU A;  5CCG A;  5APS A;  2Y9Z A;  1RE3 A;  3RK3 E;  3V2R A;  3I56 P;  3G9R A;  4CPG A;  1L0L K;  3M91 A;  3VMX A;  1T2K C;  4WY4 A;  3TDK A;  1NU1 D;  1UIX A;  1SQQ K;  1GL2 C;  3Q5S A;  2KSE A;  2K88 A;  3B8E B;  2N1T D;  1RHZ B;  3HE5 A;  2FYN B;  1VQ9 P;  1S5L X;  1L0L D;  1J1D B;  2SPZ A;  3A2A A;  1EQ7 A;  3FXE A;  1NU1 K;  4WY4 B;  3TK1 A;  1AFO A;  1HWT C;  1T8Z A;  4W7Z A;  4BRY A;  1PIX A;  4H44 C;  2O3J A;  1KOR A;  2XND H;  3AE7 C;  1OFC X;  1BGY E;  3H25 A;  1OZH A;  1X9V A;  3B71 A;  4D6T D;  2OTL P;  3L75 G;  2ZVN B;  3AE9 C;  3CMA P;  1L0N J;  1OX3 A;  2WT7 A;  2J59 M;  1LTG C;  3L73 E;  1AQ5 A;  1OW8 A;  2JKV A;  3A0B H;  2FFD C;  1KQF B;  2AEF A;  2QM7 A;  2C9L Y;  2ZXX A;  3PLN A;  1M1K Q;  2KLU A;  1GDT A;  1FZF A;  4RJT A;  2PAJ A;  4N78 D;  4UB8 E;  3TNU A;  5CBO A;  3E7K A;  4PD4 E;  5DJT B;  4U7J A;  4GKG A;  5APY A;  4TT3 H;  2YMK A;  3M0D C;  4QMA A;  4JPZ B;  1PGJ A;  2N1T B;  2QA4 P;  1URQ A;  2MJZ A;  2XU6 A;  2IYO A;  3B4S A;  3H1L D;  3RK2 D;  5KJ7 C;  1K04 A;  5KLV E;  1FDO A;  2E76 D;  4WWI A;  4XFJ A;  1VQK P;  2UWJ E;  2B87 A;  3L4F A;  3SFE C;  2FYU D;  2IBZ G;  3SWF A;  2PP6 A;  3AEG C;  3IR9 A;  1R5L A;  2KZI A;  1BSN A;  3LIE A;  1L0L E;  2P1J A;  1JCC A;  2XV5 A;  3AE1 C;  1NTM E;  3H1H D;  3L75 J;  2FBW C;  4I2L C;  3D70 A;  3H1L E;  1NTZ J;  1PP9 E;  2NZ2 A;  2RMZ A;  2A45 H;  2KNC B;  5KLI B;  1SQP G;  3V4W A;  2KSJ A;  1EXI A;  1IFJ A;  1WRG A;  5KAI E;  2YIU B;  2YIU C;  3HD7 B;  3RK3 D;  2Z4E A;  5GTI H;  1M56 D;  2H88 C;  5BVZ A;  1QVF O;  1SQB G;  3CWB E;  3L70 J;  3WU2 H;  1SQX G;  2R3C A;  2ZYA A;  3AE6 C;  4C46 A;  4KJM A;  2CK3 H;  4PJ0 H;  1NTM G;  2BCC J;  3M9B A;  5APV A;  3CPW O;  1JNM A;  1EZV G;  4PV1 D;  1T6A A;  3UIA A;  3L71 G;  1QX8 A;  2BAS A;  2HFE D;  5KAI H;  3L71 J;  2R5B A;  3CWB D;  3AE3 C;  4PD4 I;  1VQ4 P;  2OGU A;  1PGO A;  2E76 B;  3HRN A;  1QL2 A;  3L75 D;  3NFQ A;  3VTP C;  2GUV A;  1NTZ D;  3T97 B;  1BDD A;  3B5N B;  4RES B;  2WZ7 A;  1L0N K;  2YKO A;  1GK6 A;  2KK7 A;  4K3A A;  5CHX A;  1SFC A;  3NMD A;  4BWN A;  1LTJ B;  4DOJ A;  4H13 B;  1NHL A;  1PP9 D;  2Q1K A;  1ZOY C;  3MTU E;  5AVW B;  5AW4 B;  2E75 B;  3K5B A;  1NTZ K;  1URQ D;  1H88 A;  4R4L A;  3ZDM A;  1GW3 A;  2QSI A;  2IZ0 A;  5KJ7 D;  1L0N E;  4EIJ A;  1G1I A;  3MGN A;  4W80 A;  1WMK A;  1BCC G;  3RL0 g;  2WTY A;  1LGH B;  2YXQ B;  2KI7 B;  1R5S A;  1L2P A;  3P32 A;  3VN0 A;  2BEZ F;  2WPV B;  1SQV G;  3C1L A;  2WSE H;  3S9O A;  1LTT C;  2FXO A;  1YJW P;  1T3J A;  2JJL A;  1L0N D;  2D2C C;  1FE6 A;  3H1J E;  3S1K A;  3TGU J;  1QL1 A;  2E75 D;  5APT A;  1MFT A;  4AQR D;  1GL2 B;  1GMJ A;  1QLE D;  1W5C E;  1X22 A;  1LWU B;  2QM8 A;  2RN0 A;  3BRT B;  2B88 A;  4OH8 B;  3SFD C;  1T3U A;  1CI6 A;  2HOD A;  1S4X A;  2NPS B;  3L73 G;  2H89 C;  4R4M A;  1SQV E;  5KLI C;  4AYC A;  3B5N A;  3V5B A;  2FXM A;  1H89 A;  3L37 A;  5KLV J;  4WVZ A;  1LTI C;  3CX5 D;  2KB7 P;  3TSI A;  1Y8A A;  1KQS O;  1PZQ A;  5AW2 B;  1TU3 F;  2XKM A;  1LTJ A;  4MN4 C;  1URQ B;  3HE5 B;  4XA4 A;  1VQM P;  5L8R J;  3H1I E;  4K35 A;  3M9Q A;  3VMZ A;  2Q3E A;  1FOS E;  1KV4 A;  1Z56 A;  4M3L A;  3S4R A;  2Y9Y A;  2J5U A;  1NYH A;  3E1I A;  1KZU B;  3AEF C;  3L74 J;  3V2N A;  3EQ2 A;  4H13 C;  3CI9 A;  5KLV K;  1FJK A;  3VMA A;  3GF7 A;  4BXL A;  5EFW B;  1A02 F;  3U1A A;  1DH3 A;  1BE3 E;  4Y28 J;  2FFD B;  1BE3 G;  1EC5 A;  5APW A;  2M5A B;  1CW5 A;  5KJ7 A;  1JY3 O;  3KYQ A;  2WWW A;  1BGY J;  3CCJ P;  3L36 A;  1PP9 G;  3M0D A;  3H1L G;  3VOP A;  2WSF J;  1LJ2 A;  3L70 D;  4YPC A;  1P84 I;  3L71 E;  4N6J A;  1H0T B;  1YYC A;  3H1K J;  2AXT E;  3WUT A;  3II6 A;  4N3Y B;  1VDF A;  3L73 J;  2FYZ A;  2E42 A;  1NOH A;  1YQ3 C;  2L5G B;  1IJD B;  3CX5 E;  1KIL D;  3O6Q B;  4UB8 H;  5APU A;  1N73 C;  3CXH H;  2B9B A;  4L74 A;  4A7P A;  1NO4 A;  1SQP D;  1VF5 C;  1KQL A;  2B87 B;  3O8Z A;  3G4S P;  3HD7 C;  4OGQ D;  1G1J A;  1J1E C;  1YTZ I;  5AVX B;  1SQP E;  1L4A B; 
#chains in the Genus database with same CATH homology
 2V4H A;  2ZVN B;  3FX0 A;  3F89 A;  4BWN A;  4OWF A;  3JSV C;  2ZVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...