2ZVNB

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
85
structure length
85
Chain Sequence
SLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBC protein
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 38
structure length 85
sequence length 85
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2zvnB00
3JSVC 2ZVNB 2ZVOB 3FX0A 4OWFA 4BWNA 3F89A 2V4HA
chains in the Genus database with same CATH superfamily
5KAIE 1KB9E 3VP8A 3H1HD 1HTLC 3AECC 1QVGO 1SQQE 1LWUB 2E76D 5KTBA 1MUUA 2WSFJ 3M0DA 2D2CC 1WRGA 2IPPA 4WY4B 1L0NJ 2XV5A 4R4LA 2HYNA 1SFCA 2HG5D 1KTMA 3V5BA 1FOSF 3D6ZA 4H0LD 1BDDA 3CWBD 3V2PA 1R5SA 2FKWB 1GU5A 1RE3A 1ZMEC 1NVOA 2QJPB 1VF5C 1NTMG 3Q1MA 1X9VA 2QJKC 3VMZA 2Y9ZA 4GOFA 1GMJA 2QM7A 4C7NA 1L0NG 4L73A 1AQTA 1NAFA 1PP9J 1Q90D 2YO3A 5KKZC 1UIIA 3U1AA 5AW1B 3KHUA 4ZMDA 2ZVNB 1RY3A 1EZVE 1M90Q 1KILD 1L4AC 1VF5D 3S9OA 3CXHD 3CXHI 2IZ0A 2WPVB 1JO5A 1NOHA 2FXPA 4PD4H 4N78E 1UIXA 2C9NY 3RK2C 1TU3F 3KDPB 1VL2A 4HH2A 1NTZE 5TISE 2IDBA 5TJHA 2NPSB 1AFOA 2KSJA 3O6QA 3KQGA 3NMDA 3H1HE 1S72P 1L4AD 5B5EH 2FYZA 4PJ0E 2KS1A 2J5UA 2BEZF 3CCVP 3RBZA 2O3JA 3D71A 3SFDC 5DJUB 3O8ZA 1LWUA 3RK2D 1YJNP 1BCCD 5C39A 3CWBE 4C7RA 1Z56A 1SQQJ 3FXDA 1LTGC 2ZXXA 4N3YB 1PPJD 1N73C 1KV4A 1FZEA 3HD7B 4U7JA 2Q7CA 4WVZA 5AVZB 1J2JB 1YJWP 2IFNA 2H88C 3JCUE 1SQPD 3RK3E 4EOTA 4DCKA 2E74C 3CD6P 2M0BA 3H1ID 5GTIE 1FZAA 1K05A 2R5DA 3UIAA 1K04A 1IK7A 3MIWA 1IFDA 2GUVA 4JYBA 1FZCB 3CXHE 3H6PA 3KZIE 3II6A 4HKZH 1MZ9A 1NTKG 1AV1A 2JWAA 1EC5A 2Y0DA 1H88A 3I56P 3L75D 1LTBC 2E74D 3OW2O 1PGQA 1QX8A 2YKPA 2K37A 4JBZA 3SWYA 2OYHB 1N7SD 4D6TE 4Y99B 1Y47A 2YKQA 1Q7YQ 1SQXD 4OGQB 2M5AB 1Q82Q 2MJZA 2NPSA 4IL6H 1KQGB 4I7ZC 3SWKA 3C8VA 3CX5I 3PRJA 2OTJP 2Y9YA 3M9QA 4H13B 3CCQP 1H0TA 1BCCE 3H1HJ 3P8CD 1AQ5A 4H44B 1FZGA 1Q2NA 3H1JD 1EZVG 3A0BE 1SQPK 3TK1A 1U7JA 2FFDC 5B66H 1NH4A 1A02J 4GODA 3LW5H 2Z4EA 3CWBJ 1VQ4P 3OA7A 5E79H 1M57D 1OW6A 3MUDA 2C0XA 2A06E 3GF3A 1RF0A 1QL1A 3A7OA 1NTZG 3HD7A 4N6JA 1JOCA 4PV1B 3H1HG 2B9BA 2KK7A 1URQA 1RE4C 1DX7A 3H1LD 4XFJA 3MZWB 2K1AA 5AVYB 2FYUD 1X0TA 2CPSA 1NU1K 2XKMA 2LKMA 2N9YB 1FZCA 2ITAA 5APXA 1BDCA 1SP4A 3BRVB 2QVAA 1SQXK 4BXLA 1AVOA 1NU1E 2ZJSE 1VQLP 5CCGA 2IBZI 5DJTB 2OYHC 2J59M 1S5LH 4OGQC 3Q5PA 2H89C 5AVRB 4IFMA 2YMYA 2M5AA 3H25A 3AE6C 2JP3A 4EYYQ 4OH8B 4H13C 2QSIA 1BE3D 3RBXA 3H1JE 3ABVC 4WWIA 3GMAA 4H44C 1L0LD 4HJGH 3A0HH 3CCLP 2AXTH 3B5NB 2O01J 2KSEA 4IL6X 4W7YA 2YIUB 1BSHA 2E5TA 2HFED 1BCCJ 2A45H 4GT1A 1PL5A 2OYOA 2R5BA 1SQVD 2R3CA 2KXPB 1LTSC 2OQQA 1NAYA 1IC2A 1NHLA 2KNCB 2WT7B 1M1JC 2FYUK 2WSEH 4D6TG 1P84H 1JNMA 3L73D 2E76B 2L5GB 2M3BA 3HE4A 4EDFA 1OW7A 1SQPJ 3E1IA 3L72E 1KYOI 2QG4A 2W90A 1K9MQ 1K73Q 1ZR4A 1GZLA 2WVRA 2W6JH 3H1IJ 3HUSC 1BCCG 3A2AA 1NYHA 1A02F 1CI6B 3M91A 4H0LB 1JB0J 1JY3P 3EFFK 1N7LA 2RMZA 1ZOYC 3TDKA 2VRSA 1BSNA 1GL2D 1M7LA 2D2CB 3H1KE 1KB9H 3CCRP 2N9BA 3I55P 2I8DA 3L74D 3CCEP 3C9IA 4UB6E 1NU1J 4YXDC 3IN6A 1ZW0A 2A06G 3U1CA 4HYTB 1BE3E 1SQXJ 2QEXP 1KFMA 4UB8E 2QA4P 1S2EA 1PP9E 3P8MC 3G9RA 1VF5B 3AEAC 1OXZA 1YTZI 1SQVK 2H43A 3NFQA 1YQ3C 2QJKB 2W6AA 3ITKA 2P7JA 2AEJA 1AA0A 3B5NA 5KKZB 3H1JJ 1LT9A 3V4QA 3AEBC 1ZLLA 1NU1G 5AVSB 2KIKA 1L4AB 1SQBD 1KYOE 2Y0CA 2KNCA 1CZQA 3GG2A 1JMMA 1S3JA 2QJYC 1RQVA 2R44A 3FWNA 1VDFA 3RK2B 1OIPA 2N1TC 5APSA 2ZXEB 3BCCD 3H1LJ 4BRYA 2RKLA 2R3SA 2FYNC 1OVUA 3CCUP 2FYUJ 4GDOA 3LIDA 5AW5B 1FJPA 2JO1A 3L74E 3FGAD 4AQRD 2W8ZA 3JC22 3GLMA 3M0DC 3CL3D 2N1TD 3L70D 3CC2P 3G3ZA 3VN0A 3FX0A 4LC1A 1WMKA 1VQMP 1KD1Q 3H1KJ 3VOPA 2BCCD 4GIFA 3F5HA 4A7PA 3SFEC 1N73B 2OYIA 1KILC 3L72G 2E75D 3B4SA 2QM8A 3WU2H 1HUCA 1JY3N 4L74A 4EIJA 2W27A 3VP9A 1BE3J 3OAKA 1HJBA 3LIEA 1SQBK 5CBNA 1ZRTD 2E74B 1JY2P 1JY2O 2GA1A 2IBZG 1L0LJ 1VQ9P 3E7KA 1HJ0A 4OWFA 2V7QJ 1N7SB 1SQBE 1BGYD 3HTKB 3H1KG 2KLUA 2P2UA 1KMIZ 1JM0A 2WWWA 3H32B 1SQVJ 3KZIH 2WTYA 2FXMA 5AVVB 2B89A 2CK3H 1FC2C 1BE3G 1J1DC 3L73J 1RF1C 5KLVD 1FDMA 1FU1A 3S4RA 1PP9G 4IOIH 2WPSA 2GM4A 3PJSK 3C1LA 4PD4D 2YKOA 2KYVA 1EXJA 2KB7P 4I7ZB 2KUBA 3TSIA 4MN4C 4U3FD 3WUVA 4WY4A 4DOJA 2BCCE 3L74J 3V2NA 2FFDB 1VQNP 3VYIA 3WMM0 2KP8A 3D70A 1JTHB 1OZHA 4LGDE 1GK4A 2Z5HA 5KLIC 2WSCH 1ZRTE 4TLFA 5AVUB 3TF5A 2PAJA 2XDJA 4XA4A 3RGUA 2YXQB 1IFJA 1BGYE 2WITA 1KILE 1N7SC 1SQQG 3RL0g 1FZFA 3VMXA 5KLVK 1DEBA 2ZYAA 3HTKA 3AE7C 4NPEA 2ZAEB 1FDIA 5AW9B 5KJ7C 5APVA 3H32A 1LTAC 1SQBJ 1LTJC 1LTIC 1W5CE 1E79H 1IFNA 3TGUD 4RESB 2Z5IA 1LT1A 3BRTB 1OWAA 1OMIA 3IR9A 3NXSA 1DIPA 1JY2N 1FE6A 3V2RA 1T3UA 1JCDA 3CX5H 1OX3A 5KJ7D 3BCCJ 2RH0A 5B5EE 3BVHA 4EI2A 3HE5B 3B71A 1EDIA 1M1KQ 1SQBG 1KORA 3SSUA 1N8RQ 3L71D 1PPJE 1ZXGA 3VTPC 3FWLA 4ASVA 4LLHA 3L70J 1XTCC 2KZJA 4YTPC 2FFDA 1L2PA 1PIXA 1JTHA 1SQPE 1HH0A 1S1CX 2DW3A 1KQSO 2BCCJ 3MGNA 1M1JB 3PP5A 2ZYGA 4RKUJ 5AW8B 3H1IE 1CW5A 4AUWA 3R2PA 3PH0A 5AW2B 2M3EA 2PP6A 4JQ0D 5KAFH 1EXIA 1G1IA 4XE5B 3G4SP 1RE4A 3HUSB 1ZP0C 2YXRB 3V6IA 1URQC 1Y9BA 3L75E 1G2CB 2WSFH 1BGYJ 2KI7B 3CWBG 1SLQA 2BCCG 2IYPA 4HB1A 1NTMD 2BEQD 2V4HA 1SQXE 3HD7D 1VQOP 1GW3A 5AVWB 2WSSH 1YYCA 2OYHA 1URQD 1L0ND 2ZT9C 5AVXB 3CPWO 5KLVJ 4UB6H 5AVTB 3CCJP 3P8CE 5M1BA 2W83C 1BGYG 4IL6E 4M3LA 1M8OB 3HE5A 2I1KA 1T3JA 5CCGD 3KPEA 1YBKA 4WBAA 2G8YA 2ZT9D 4U3FJ 1RHZB 1FZBA 2M8RA 2FY8A 3PTZA 1IFIA 2K9JB 2R32A 1AJYA 3USSA 2OTLP 3NTNA 5B66E 2H7HA 1JMBA 5H2FH 1FS0E 4L76A 3IFMA 1GU4A 2KLVA 1OVRA 4DZOA 2IX7C 3JSVC 1GL2C 1M1JA 1U7MA 3H1LE 2A45I 2NZ2A 3HRNA 5E79E 1NKZB 1KYOH 1J1EB 3Q5RA 2FYUE 4B86A 2QJYB 2LXBA 1H89A 1NTMK 1P84D 2N1TB 1FBMA 5CJ4A 2Q3IA 1ZN5A 2FYNB 1JY3O 3HUSA 5K5GB 1R5LA 2P10A 1G2CA 4JYCA 1PPJG 3E1RA 2E75B 1IJDB 2QRXA 5GTHH 5KAIH 1S9KD 3L75J 2O01N 3MTUE 1GTWA 1SQPG 4NPDA 1YQ4C 3TGUJ 1L0LK 2QE7H 1KB9D 3H1IG 3KYQA 3M9HA 2WMMA 2GUSA 5CHXA 1L0LE 1KILB 3GHGC 1S5LX 1NTKD 3WUTA 3G71P 5APTA 1T2KC 1N2DC 2JKVA 3L75G 2PFXA 1HGZA 5CCHC 1SQVE 3A0HE 2H8PD 4DJGA 3L71J 4C7NB 3IAOA 3V4WA 1SQXG 2JEEA 1OFCX 3L73E 1LT9C 2MKVA 2WT7A 2K9YA 3T97B 1T2KD 1J1EC 3BATA 4I2LC 3CI9A 4NPFX 1YIJP 1VQ8P 1YI2P 5CCHD 3EQ2A 1X22A 4ZNCA 1J1DB 1HBWA 1QLED 3WUUA 1QEXA 1RF1B 3LW5J 3BASA 1EZVD 1KQLA 3H1JG 3B5ND 1HF9A 3VMYA 1W2EA 5TISH 3CCMP 1S9KE 1CI6A 4I6MC 4JPZB 4ZKPA 2E75C 3AE8C 4N78D 4PJ0H 2JJLA 3A3YB 1NTZD 3RL0C 2I1JA 1NTKK 1Q86Q 1NTMJ 2G3AA 3N7NA 5BVZA 1SFCC 1VQ7P 2HODB 4YPCA 3H1LG 3SWFA 1NTKE 2E42A 5CMZA 3V2QA 5KLIB 2FYUG 1XTGB 2Q5UA 4IFDK 3GW6A 3RK3C 3ZDMA 1W2BO 1KILA 1RE3C 2P1JA 3K5BA 3RL0D 2OYIC 3U59A 1S4XA 3JCUH 2P58A 3AEEC 2D2CD 1SFCD 1D7MA 3M0AA 1IFMA 1MV8A 3OJAB 1GK6A 5GTIH 2LR2A 1PGJA 1KN7A 1ZV8A 1ZR2A 1RQUA 3CXHH 1RH5B 3I5CA 3RK3D 1L4AA 1FAVA 2PGDA 2NRGA 1LTJB 3T97A 2LXCB 3B8EB 3BCCE 2B88A 2OARA 1L0LG 3AEGC 1NTZK 4C46A 1RF1A 2WSEJ 3AE5C 2XZRA 4PD4I 1JUNA 4KT0J 3MD0A 1SQVG 1Y8AA 1KFNA 2B87B 1OW8A 2O01H 4IFFA 3L70E 4D6TD 4W7ZA 4KHXA 2A45G 1H0TB 3L73G 1LWUC 2IYOA 1NO4A 4WY4C 2Q9IA 3L37A 3MHVA 3A0BH 3QH9A 2AEMA 2HODA 3IF4A 2OGUA 1HGVA 1N73A 2SPZA 4GOEA 3AE2C 4Y28J 1GW4A 3W68A 3AE1C 1YITP 3Q5SA 2JDIH 1YHQP 1NTKJ 2KOGA 3WU2E 2C0WA 3GF7A 2QJPC 1GDTA 3D6YA 1NJIQ 4WY4D 2BASA 3L74G 1PV3A 3AE4C 4BWNA 2WZ7A 2YMKA 1URQB 1N7SA 2A06D 3AE3C 4QMAA 4TT3H 2C9LY 5AW6B 5AW0B 4RJTA 5KLVE 5KJ7A 3CMEP 2P67A 3CCSP 1LTJA 1U57A 1N86A 4PD4E 1VQ6P 5BU5A 2ZT9B 3CC4P 2FXOA 1PZQA 1VPCA 2IFMA 1NU1D 3TNUB 1USDA 4U3FE 1IK9A 2NPSC 1T6AA 2FBWC 3PLNA 3CMAP 3Q3DA 4ASWA 2B87A 2HLOA 2IZ1A 3CX5D 3S1KA 3CLQA 1HWTC 3P7KA 1LGHB 1NTZJ 2E43A 2JR8A 2WPQA 3EWKA 4W80A 5AVQB 2QIWA 4CPGA 1SVFA 1G1JA 2NPSD 2HPCB 3BCCG 1T8ZA 1GL2B 1X79B 2PRRA 1PGPA 3AEFC 1CSBA 3MUDC 3QWOC 3PHLA 4YXWH 1EDLA 1RF0C 1JEKA 2Q1KA 3HD7C 2KZIA 1DEEG 1FOSE 5AW4B 1LJ2A 3N4XA 3HE4B 3L4FA 4ZKUA 2XNDH 3L70G 1E5WA 1KZUB 4K3AA 1VQKP 2OTKE 4KJMA 3TGUE 2O1JA 1FZCC 3L72D 3M06A 2K88A 2ZVOB 3L35A 4Z1MH 5CCGC 1K8AQ 2K3RA 1YTZT 2IBZD 1H8AA 2AEFA 5BU8B 1DD4A 2POHA 1OVVA 1X8YA 1GD2E 1FDOA 4JF7A 2W6BA 4Y99C 1SS1A 3H1KD 1LP1B 1QGKB 3CX5E 2CPBA 3GHGB 3TNUA 2RN0A 4UB8H 3L71E 3CC7P 3AEDC 2V7QH 2YNYA 3W67A 4D6TJ 2XNXA 1IZNB 3AE9C 1LNQA 4OVNF 1DH3A 5KLVG 1PP9D 2XU6A 1USEA 3L36A 3TYYA 2WQYC 4RO0A 4OGQD 1PFIA 1LT9B 1PGOA 5EFWB 2HPCA 2E5YA 1NGMB 3MP7B 1HVVA 1VQ5P 1GL2A 4H13D 4DT0A 4WB4A 1NWQA 4U3FG 2AXCA 2WSCJ 4H44D 4PV1C 3P32A 1P84I 5KAFE 5APYA 1KYOD 1KQFB 1AVYA 2O1KA 2J58A 1DD3A 1L0NK 1NTME 3A5TA 3G6EP 4BRYB 1MFTA 2HR3A 1L0NE 2YO2A 4I1LA 3RL0B 2IBZE 1R8EA 1KC8Q 4PV1D 3R4YA 3Q2YA 1S5LE 1SFCB 1KB9I 1YJ9P 1SQQD 4K35A 2WPRA 1IFPA 1JCCA 2Y0EA 5AW7B 1LP1A 3RK3B 4L75A 3GHGA 2OYIB 4GKGA 1IO4A 1M56D 1MKMA 2AXTE 2ZYDA 3TGUG 1VQPP 5CCHA 5APQA 4AYCA 2L91A 3B5NC 1WT6A 2K9JA 2ZFCA 5APUA 1Q81Q 2YIUC 3VMAA 4O9BA 5APWA 5H2FE 1NKNA 4R4MA 1P84E 3KXDA 1EQ7A 1FJKA 3EFGA 1QVFO 3M9BA 2Q6QA 1QL2A 1EDKA 1EZVI 1LTTC 2UWJE 2E76C 3L71G 1EDJA 5CJ0A 2N1TA 3O6QB 5CBOA 5AW3B 2JWDA 1SQQK 2KS1B 2Q3EA 4H0LC 1MFZA 3F89A 5L8RJ 3L72J 3FXEA 5GTHE
chains in the Genus database with same CATH topology
3JSVC 2ZVNB 2ZVOB 3FX0A 4OWFA 4BWNA 3F89A 2V4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV C;  2ZVN B;  2ZVO B;  3FX0 A;  4OWF A;  4BWN A;  3F89 A;  2V4H A; 
#chains in the Genus database with same CATH topology
 5KAI E;  1KB9 E;  3VP8 A;  3H1H D;  1HTL C;  3AEC C;  1QVG O;  1SQQ E;  1LWU B;  2E76 D;  5KTB A;  1MUU A;  2WSF J;  3M0D A;  2D2C C;  1WRG A;  2IPP A;  4WY4 B;  1L0N J;  2XV5 A;  4R4L A;  2HYN A;  1SFC A;  2HG5 D;  1KTM A;  3V5B A;  1FOS F;  3D6Z A;  4H0L D;  1BDD A;  3CWB D;  3V2P A;  1R5S A;  2FKW B;  1GU5 A;  1RE3 A;  1ZME C;  1NVO A;  2QJP B;  1VF5 C;  1NTM G;  3Q1M A;  1X9V A;  2QJK C;  3VMZ A;  2Y9Z A;  4GOF A;  1GMJ A;  2QM7 A;  4C7N A;  1L0N G;  4L73 A;  1AQT A;  1NAF A;  1PP9 J;  1Q90 D;  2YO3 A;  5KKZ C;  1UII A;  3U1A A;  5AW1 B;  3KHU A;  4ZMD A;  2ZVN B;  1RY3 A;  1EZV E;  1M90 Q;  1KIL D;  1L4A C;  1VF5 D;  3S9O A;  3CXH D;  3CXH I;  2IZ0 A;  2WPV B;  1JO5 A;  1NOH A;  2FXP A;  4PD4 H;  4N78 E;  1UIX A;  2C9N Y;  3RK2 C;  1TU3 F;  3KDP B;  1VL2 A;  4HH2 A;  1NTZ E;  5TIS E;  2IDB A;  5TJH A;  2NPS B;  1AFO A;  2KSJ A;  3O6Q A;  3KQG A;  3NMD A;  3H1H E;  1S72 P;  1L4A D;  5B5E H;  2FYZ A;  4PJ0 E;  2KS1 A;  2J5U A;  2BEZ F;  3CCV P;  3RBZ A;  2O3J A;  3D71 A;  3SFD C;  5DJU B;  3O8Z A;  1LWU A;  3RK2 D;  1YJN P;  1BCC D;  5C39 A;  3CWB E;  4C7R A;  1Z56 A;  1SQQ J;  3FXD A;  1LTG C;  2ZXX A;  4N3Y B;  1PPJ D;  1N73 C;  1KV4 A;  1FZE A;  3HD7 B;  4U7J A;  2Q7C A;  4WVZ A;  5AVZ B;  1J2J B;  1YJW P;  2IFN A;  2H88 C;  3JCU E;  1SQP D;  3RK3 E;  4EOT A;  4DCK A;  2E74 C;  3CD6 P;  2M0B A;  3H1I D;  5GTI E;  1FZA A;  1K05 A;  2R5D A;  3UIA A;  1K04 A;  1IK7 A;  3MIW A;  1IFD A;  2GUV A;  4JYB A;  1FZC B;  3CXH E;  3H6P A;  3KZI E;  3II6 A;  4HKZ H;  1MZ9 A;  1NTK G;  1AV1 A;  2JWA A;  1EC5 A;  2Y0D A;  1H88 A;  3I56 P;  3L75 D;  1LTB C;  2E74 D;  3OW2 O;  1PGQ A;  1QX8 A;  2YKP A;  2K37 A;  4JBZ A;  3SWY A;  2OYH B;  1N7S D;  4D6T E;  4Y99 B;  1Y47 A;  2YKQ A;  1Q7Y Q;  1SQX D;  4OGQ B;  2M5A B;  1Q82 Q;  2MJZ A;  2NPS A;  4IL6 H;  1KQG B;  4I7Z C;  3SWK A;  3C8V A;  3CX5 I;  3PRJ A;  2OTJ P;  2Y9Y A;  3M9Q A;  4H13 B;  3CCQ P;  1H0T A;  1BCC E;  3H1H J;  3P8C D;  1AQ5 A;  4H44 B;  1FZG A;  1Q2N A;  3H1J D;  1EZV G;  3A0B E;  1SQP K;  3TK1 A;  1U7J A;  2FFD C;  5B66 H;  1NH4 A;  1A02 J;  4GOD A;  3LW5 H;  2Z4E A;  3CWB J;  1VQ4 P;  3OA7 A;  5E79 H;  1M57 D;  1OW6 A;  3MUD A;  2C0X A;  2A06 E;  3GF3 A;  1RF0 A;  1QL1 A;  3A7O A;  1NTZ G;  3HD7 A;  4N6J A;  1JOC A;  4PV1 B;  3H1H G;  2B9B A;  2KK7 A;  1URQ A;  1RE4 C;  1DX7 A;  3H1L D;  4XFJ A;  3MZW B;  2K1A A;  5AVY B;  2FYU D;  1X0T A;  2CPS A;  1NU1 K;  2XKM A;  2LKM A;  2N9Y B;  1FZC A;  2ITA A;  5APX A;  1BDC A;  1SP4 A;  3BRV B;  2QVA A;  1SQX K;  4BXL A;  1AVO A;  1NU1 E;  2ZJS E;  1VQL P;  5CCG A;  2IBZ I;  5DJT B;  2OYH C;  2J59 M;  1S5L H;  4OGQ C;  3Q5P A;  2H89 C;  5AVR B;  4IFM A;  2YMY A;  2M5A A;  3H25 A;  3AE6 C;  2JP3 A;  4EYY Q;  4OH8 B;  4H13 C;  2QSI A;  1BE3 D;  3RBX A;  3H1J E;  3ABV C;  4WWI A;  3GMA A;  4H44 C;  1L0L D;  4HJG H;  3A0H H;  3CCL P;  2AXT H;  3B5N B;  2O01 J;  2KSE A;  4IL6 X;  4W7Y A;  2YIU B;  1BSH A;  2E5T A;  2HFE D;  1BCC J;  2A45 H;  4GT1 A;  1PL5 A;  2OYO A;  2R5B A;  1SQV D;  2R3C A;  2KXP B;  1LTS C;  2OQQ A;  1NAY A;  1IC2 A;  1NHL A;  2KNC B;  2WT7 B;  1M1J C;  2FYU K;  2WSE H;  4D6T G;  1P84 H;  1JNM A;  3L73 D;  2E76 B;  2L5G B;  2M3B A;  3HE4 A;  4EDF A;  1OW7 A;  1SQP J;  3E1I A;  3L72 E;  1KYO I;  2QG4 A;  2W90 A;  1K9M Q;  1K73 Q;  1ZR4 A;  1GZL A;  2WVR A;  2W6J H;  3H1I J;  3HUS C;  1BCC G;  3A2A A;  1NYH A;  1A02 F;  1CI6 B;  3M91 A;  4H0L B;  1JB0 J;  1JY3 P;  3EFF K;  1N7L A;  2RMZ A;  1ZOY C;  3TDK A;  2VRS A;  1BSN A;  1GL2 D;  1M7L A;  2D2C B;  3H1K E;  1KB9 H;  3CCR P;  2N9B A;  3I55 P;  2I8D A;  3L74 D;  3CCE P;  3C9I A;  4UB6 E;  1NU1 J;  4YXD C;  3IN6 A;  1ZW0 A;  2A06 G;  3U1C A;  4HYT B;  1BE3 E;  1SQX J;  2QEX P;  1KFM A;  4UB8 E;  2QA4 P;  1S2E A;  1PP9 E;  3P8M C;  3G9R A;  1VF5 B;  3AEA C;  1OXZ A;  1YTZ I;  1SQV K;  2H43 A;  3NFQ A;  1YQ3 C;  2QJK B;  2W6A A;  3ITK A;  2P7J A;  2AEJ A;  1AA0 A;  3B5N A;  5KKZ B;  3H1J J;  1LT9 A;  3V4Q A;  3AEB C;  1ZLL A;  1NU1 G;  5AVS B;  2KIK A;  1L4A B;  1SQB D;  1KYO E;  2Y0C A;  2KNC A;  1CZQ A;  3GG2 A;  1JMM A;  1S3J A;  2QJY C;  1RQV A;  2R44 A;  3FWN A;  1VDF A;  3RK2 B;  1OIP A;  2N1T C;  5APS A;  2ZXE B;  3BCC D;  3H1L J;  4BRY A;  2RKL A;  2R3S A;  2FYN C;  1OVU A;  3CCU P;  2FYU J;  4GDO A;  3LID A;  5AW5 B;  1FJP A;  2JO1 A;  3L74 E;  3FGA D;  4AQR D;  2W8Z A;  3JC2 2;  3GLM A;  3M0D C;  3CL3 D;  2N1T D;  3L70 D;  3CC2 P;  3G3Z A;  3VN0 A;  3FX0 A;  4LC1 A;  1WMK A;  1VQM P;  1KD1 Q;  3H1K J;  3VOP A;  2BCC D;  4GIF A;  3F5H A;  4A7P A;  3SFE C;  1N73 B;  2OYI A;  1KIL C;  3L72 G;  2E75 D;  3B4S A;  2QM8 A;  3WU2 H;  1HUC A;  1JY3 N;  4L74 A;  4EIJ A;  2W27 A;  3VP9 A;  1BE3 J;  3OAK A;  1HJB A;  3LIE A;  1SQB K;  5CBN A;  1ZRT D;  2E74 B;  1JY2 P;  1JY2 O;  2GA1 A;  2IBZ G;  1L0L J;  1VQ9 P;  3E7K A;  1HJ0 A;  4OWF A;  2V7Q J;  1N7S B;  1SQB E;  1BGY D;  3HTK B;  3H1K G;  2KLU A;  2P2U A;  1KMI Z;  1JM0 A;  2WWW A;  3H32 B;  1SQV J;  3KZI H;  2WTY A;  2FXM A;  5AVV B;  2B89 A;  2CK3 H;  1FC2 C;  1BE3 G;  1J1D C;  3L73 J;  1RF1 C;  5KLV D;  1FDM A;  1FU1 A;  3S4R A;  1PP9 G;  4IOI H;  2WPS A;  2GM4 A;  3PJS K;  3C1L A;  4PD4 D;  2YKO A;  2KYV A;  1EXJ A;  2KB7 P;  4I7Z B;  2KUB A;  3TSI A;  4MN4 C;  4U3F D;  3WUV A;  4WY4 A;  4DOJ A;  2BCC E;  3L74 J;  3V2N A;  2FFD B;  1VQN P;  3VYI A;  3WMM 0;  2KP8 A;  3D70 A;  1JTH B;  1OZH A;  4LGD E;  1GK4 A;  2Z5H A;  5KLI C;  2WSC H;  1ZRT E;  4TLF A;  5AVU B;  3TF5 A;  2PAJ A;  2XDJ A;  4XA4 A;  3RGU A;  2YXQ B;  1IFJ A;  1BGY E;  2WIT A;  1KIL E;  1N7S C;  1SQQ G;  3RL0 g;  1FZF A;  3VMX A;  5KLV K;  1DEB A;  2ZYA A;  3HTK A;  3AE7 C;  4NPE A;  2ZAE B;  1FDI A;  5AW9 B;  5KJ7 C;  5APV A;  3H32 A;  1LTA C;  1SQB J;  1LTJ C;  1LTI C;  1W5C E;  1E79 H;  1IFN A;  3TGU D;  4RES B;  2Z5I A;  1LT1 A;  3BRT B;  1OWA A;  1OMI A;  3IR9 A;  3NXS A;  1DIP A;  1JY2 N;  1FE6 A;  3V2R A;  1T3U A;  1JCD A;  3CX5 H;  1OX3 A;  5KJ7 D;  3BCC J;  2RH0 A;  5B5E E;  3BVH A;  4EI2 A;  3HE5 B;  3B71 A;  1EDI A;  1M1K Q;  1SQB G;  1KOR A;  3SSU A;  1N8R Q;  3L71 D;  1PPJ E;  1ZXG A;  3VTP C;  3FWL A;  4ASV A;  4LLH A;  3L70 J;  1XTC C;  2KZJ A;  4YTP C;  2FFD A;  1L2P A;  1PIX A;  1JTH A;  1SQP E;  1HH0 A;  1S1C X;  2DW3 A;  1KQS O;  2BCC J;  3MGN A;  1M1J B;  3PP5 A;  2ZYG A;  4RKU J;  5AW8 B;  3H1I E;  1CW5 A;  4AUW A;  3R2P A;  3PH0 A;  5AW2 B;  2M3E A;  2PP6 A;  4JQ0 D;  5KAF H;  1EXI A;  1G1I A;  4XE5 B;  3G4S P;  1RE4 A;  3HUS B;  1ZP0 C;  2YXR B;  3V6I A;  1URQ C;  1Y9B A;  3L75 E;  1G2C B;  2WSF H;  1BGY J;  2KI7 B;  3CWB G;  1SLQ A;  2BCC G;  2IYP A;  4HB1 A;  1NTM D;  2BEQ D;  2V4H A;  1SQX E;  3HD7 D;  1VQO P;  1GW3 A;  5AVW B;  2WSS H;  1YYC A;  2OYH A;  1URQ D;  1L0N D;  2ZT9 C;  5AVX B;  3CPW O;  5KLV J;  4UB6 H;  5AVT B;  3CCJ P;  3P8C E;  5M1B A;  2W83 C;  1BGY G;  4IL6 E;  4M3L A;  1M8O B;  3HE5 A;  2I1K A;  1T3J A;  5CCG D;  3KPE A;  1YBK A;  4WBA A;  2G8Y A;  2ZT9 D;  4U3F J;  1RHZ B;  1FZB A;  2M8R A;  2FY8 A;  3PTZ A;  1IFI A;  2K9J B;  2R32 A;  1AJY A;  3USS A;  2OTL P;  3NTN A;  5B66 E;  2H7H A;  1JMB A;  5H2F H;  1FS0 E;  4L76 A;  3IFM A;  1GU4 A;  2KLV A;  1OVR A;  4DZO A;  2IX7 C;  3JSV C;  1GL2 C;  1M1J A;  1U7M A;  3H1L E;  2A45 I;  2NZ2 A;  3HRN A;  5E79 E;  1NKZ B;  1KYO H;  1J1E B;  3Q5R A;  2FYU E;  4B86 A;  2QJY B;  2LXB A;  1H89 A;  1NTM K;  1P84 D;  2N1T B;  1FBM A;  5CJ4 A;  2Q3I A;  1ZN5 A;  2FYN B;  1JY3 O;  3HUS A;  5K5G B;  1R5L A;  2P10 A;  1G2C A;  4JYC A;  1PPJ G;  3E1R A;  2E75 B;  1IJD B;  2QRX A;  5GTH H;  5KAI H;  1S9K D;  3L75 J;  2O01 N;  3MTU E;  1GTW A;  1SQP G;  4NPD A;  1YQ4 C;  3TGU J;  1L0L K;  2QE7 H;  1KB9 D;  3H1I G;  3KYQ A;  3M9H A;  2WMM A;  2GUS A;  5CHX A;  1L0L E;  1KIL B;  3GHG C;  1S5L X;  1NTK D;  3WUT A;  3G71 P;  5APT A;  1T2K C;  1N2D C;  2JKV A;  3L75 G;  2PFX A;  1HGZ A;  5CCH C;  1SQV E;  3A0H E;  2H8P D;  4DJG A;  3L71 J;  4C7N B;  3IAO A;  3V4W A;  1SQX G;  2JEE A;  1OFC X;  3L73 E;  1LT9 C;  2MKV A;  2WT7 A;  2K9Y A;  3T97 B;  1T2K D;  1J1E C;  3BAT A;  4I2L C;  3CI9 A;  4NPF X;  1YIJ P;  1VQ8 P;  1YI2 P;  5CCH D;  3EQ2 A;  1X22 A;  4ZNC A;  1J1D B;  1HBW A;  1QLE D;  3WUU A;  1QEX A;  1RF1 B;  3LW5 J;  3BAS A;  1EZV D;  1KQL A;  3H1J G;  3B5N D;  1HF9 A;  3VMY A;  1W2E A;  5TIS H;  3CCM P;  1S9K E;  1CI6 A;  4I6M C;  4JPZ B;  4ZKP A;  2E75 C;  3AE8 C;  4N78 D;  4PJ0 H;  2JJL A;  3A3Y B;  1NTZ D;  3RL0 C;  2I1J A;  1NTK K;  1Q86 Q;  1NTM J;  2G3A A;  3N7N A;  5BVZ A;  1SFC C;  1VQ7 P;  2HOD B;  4YPC A;  3H1L G;  3SWF A;  1NTK E;  2E42 A;  5CMZ A;  3V2Q A;  5KLI B;  2FYU G;  1XTG B;  2Q5U A;  4IFD K;  3GW6 A;  3RK3 C;  3ZDM A;  1W2B O;  1KIL A;  1RE3 C;  2P1J A;  3K5B A;  3RL0 D;  2OYI C;  3U59 A;  1S4X A;  3JCU H;  2P58 A;  3AEE C;  2D2C D;  1SFC D;  1D7M A;  3M0A A;  1IFM A;  1MV8 A;  3OJA B;  1GK6 A;  5GTI H;  2LR2 A;  1PGJ A;  1KN7 A;  1ZV8 A;  1ZR2 A;  1RQU A;  3CXH H;  1RH5 B;  3I5C A;  3RK3 D;  1L4A A;  1FAV A;  2PGD A;  2NRG A;  1LTJ B;  3T97 A;  2LXC B;  3B8E B;  3BCC E;  2B88 A;  2OAR A;  1L0L G;  3AEG C;  1NTZ K;  4C46 A;  1RF1 A;  2WSE J;  3AE5 C;  2XZR A;  4PD4 I;  1JUN A;  4KT0 J;  3MD0 A;  1SQV G;  1Y8A A;  1KFN A;  2B87 B;  1OW8 A;  2O01 H;  4IFF A;  3L70 E;  4D6T D;  4W7Z A;  4KHX A;  2A45 G;  1H0T B;  3L73 G;  1LWU C;  2IYO A;  1NO4 A;  4WY4 C;  2Q9I A;  3L37 A;  3MHV A;  3A0B H;  3QH9 A;  2AEM A;  2HOD A;  3IF4 A;  2OGU A;  1HGV A;  1N73 A;  2SPZ A;  4GOE A;  3AE2 C;  4Y28 J;  1GW4 A;  3W68 A;  3AE1 C;  1YIT P;  3Q5S A;  2JDI H;  1YHQ P;  1NTK J;  2KOG A;  3WU2 E;  2C0W A;  3GF7 A;  2QJP C;  1GDT A;  3D6Y A;  1NJI Q;  4WY4 D;  2BAS A;  3L74 G;  1PV3 A;  3AE4 C;  4BWN A;  2WZ7 A;  2YMK A;  1URQ B;  1N7S A;  2A06 D;  3AE3 C;  4QMA A;  4TT3 H;  2C9L Y;  5AW6 B;  5AW0 B;  4RJT A;  5KLV E;  5KJ7 A;  3CME P;  2P67 A;  3CCS P;  1LTJ A;  1U57 A;  1N86 A;  4PD4 E;  1VQ6 P;  5BU5 A;  2ZT9 B;  3CC4 P;  2FXO A;  1PZQ A;  1VPC A;  2IFM A;  1NU1 D;  3TNU B;  1USD A;  4U3F E;  1IK9 A;  2NPS C;  1T6A A;  2FBW C;  3PLN A;  3CMA P;  3Q3D A;  4ASW A;  2B87 A;  2HLO A;  2IZ1 A;  3CX5 D;  3S1K A;  3CLQ A;  1HWT C;  3P7K A;  1LGH B;  1NTZ J;  2E43 A;  2JR8 A;  2WPQ A;  3EWK A;  4W80 A;  5AVQ B;  2QIW A;  4CPG A;  1SVF A;  1G1J A;  2NPS D;  2HPC B;  3BCC G;  1T8Z A;  1GL2 B;  1X79 B;  2PRR A;  1PGP A;  3AEF C;  1CSB A;  3MUD C;  3QWO C;  3PHL A;  4YXW H;  1EDL A;  1RF0 C;  1JEK A;  2Q1K A;  3HD7 C;  2KZI A;  1DEE G;  1FOS E;  5AW4 B;  1LJ2 A;  3N4X A;  3HE4 B;  3L4F A;  4ZKU A;  2XND H;  3L70 G;  1E5W A;  1KZU B;  4K3A A;  1VQK P;  2OTK E;  4KJM A;  3TGU E;  2O1J A;  1FZC C;  3L72 D;  3M06 A;  2K88 A;  2ZVO B;  3L35 A;  4Z1M H;  5CCG C;  1K8A Q;  2K3R A;  1YTZ T;  2IBZ D;  1H8A A;  2AEF A;  5BU8 B;  1DD4 A;  2POH A;  1OVV A;  1X8Y A;  1GD2 E;  1FDO A;  4JF7 A;  2W6B A;  4Y99 C;  1SS1 A;  3H1K D;  1LP1 B;  1QGK B;  3CX5 E;  2CPB A;  3GHG B;  3TNU A;  2RN0 A;  4UB8 H;  3L71 E;  3CC7 P;  3AED C;  2V7Q H;  2YNY A;  3W67 A;  4D6T J;  2XNX A;  1IZN B;  3AE9 C;  1LNQ A;  4OVN F;  1DH3 A;  5KLV G;  1PP9 D;  2XU6 A;  1USE A;  3L36 A;  3TYY A;  2WQY C;  4RO0 A;  4OGQ D;  1PFI A;  1LT9 B;  1PGO A;  5EFW B;  2HPC A;  2E5Y A;  1NGM B;  3MP7 B;  1HVV A;  1VQ5 P;  1GL2 A;  4H13 D;  4DT0 A;  4WB4 A;  1NWQ A;  4U3F G;  2AXC A;  2WSC J;  4H44 D;  4PV1 C;  3P32 A;  1P84 I;  5KAF E;  5APY A;  1KYO D;  1KQF B;  1AVY A;  2O1K A;  2J58 A;  1DD3 A;  1L0N K;  1NTM E;  3A5T A;  3G6E P;  4BRY B;  1MFT A;  2HR3 A;  1L0N E;  2YO2 A;  4I1L A;  3RL0 B;  2IBZ E;  1R8E A;  1KC8 Q;  4PV1 D;  3R4Y A;  3Q2Y A;  1S5L E;  1SFC B;  1KB9 I;  1YJ9 P;  1SQQ D;  4K35 A;  2WPR A;  1IFP A;  1JCC A;  2Y0E A;  5AW7 B;  1LP1 A;  3RK3 B;  4L75 A;  3GHG A;  2OYI B;  4GKG A;  1IO4 A;  1M56 D;  1MKM A;  2AXT E;  2ZYD A;  3TGU G;  1VQP P;  5CCH A;  5APQ A;  4AYC A;  2L91 A;  3B5N C;  1WT6 A;  2K9J A;  2ZFC A;  5APU A;  1Q81 Q;  2YIU C;  3VMA A;  4O9B A;  5APW A;  5H2F E;  1NKN A;  4R4M A;  1P84 E;  3KXD A;  1EQ7 A;  1FJK A;  3EFG A;  1QVF O;  3M9B A;  2Q6Q A;  1QL2 A;  1EDK A;  1EZV I;  1LTT C;  2UWJ E;  2E76 C;  3L71 G;  1EDJ A;  5CJ0 A;  2N1T A;  3O6Q B;  5CBO A;  5AW3 B;  2JWD A;  1SQQ K;  2KS1 B;  2Q3E A;  4H0L C;  1MFZ A;  3F89 A;  5L8R J;  3L72 J;  3FXE A;  5GTH E; 
#chains in the Genus database with same CATH homology
 3JSV C;  2ZVN B;  2ZVO B;  3FX0 A;  4OWF A;  4BWN A;  3F89 A;  2V4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...