2ZVNB

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
85
structure length
85
Chain Sequence
b'SLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBC protein
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 38
structure length 85
sequence length 85
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2zvnB00
4BWNA 2ZVOB 2V4HA 3JSVC 3F89A 3FX0A 4OWFA 2ZVNB
chains in the Genus database with same CATH superfamily
1EZVI 1LTIC 2W8ZA 2OTJP 3V2RA 4OWFA 3R4YA 5APSA 4WVZA 1PGOA 3L70G 4LLHA 4WY4C 2XDJA 2G3AA 3CC4P 1ZLLA 3U59A 3CXHD 1MFTA 2ZXEB 2QRXA 2IYPA 1YQ3C 1VDFA 3KZIH 1KYOE 3NMDA 3TNUA 1LTJA 1H0TA 1NWQA 5AW8B 2KNCB 2CPSA 1RE3A 1A02J 2ZVOB 1SQVK 3G9RA 3L73J 4D6TD 2O01H 4PD4I 1VQ5P 4HYTB 3G3ZA 1HWTC 1BE3J 1RF0A 2O1KA 1VQ8P 2YMYA 4IL6E 2QJKC 1S2EA 1IFPA 2QIWA 2IPPA 1URQC 2R5DA 5BU8B 1K04A 1NTKK 2BEQD 3HD7D 3H25A 5AW5B 2WSFJ 1IFNA 5KLVD 5AVZB 2FY8A 1OW8A 1GK4A 3AEFC 2Q5UA 3QWOC 1KN7A 2NPSD 2HYNA 3H1HG 1KYOD 2KOGA 1KILC 2C9LY 1LTTC 2AEMA 3L75E 2BCCJ 3L71J 5KKZC 1KILD 4W80A 2A45G 2QG4A 3H32B 3CX5I 1VQ6P 3MGNA 1FU1A 1N73B 3L72G 3M9QA 1ZN5A 1VQOP 1CI6B 1PPJG 3MUDC 1YJNP 3HE5A 1YIJP 1TU3F 3UIAA 1PP9E 3B5NB 1FZEA 1SQVG 2E76B 3OA7A 4W7ZA 1OW6A 3VP8A 2Z5HA 1GW3A 3B8EB 4GIFA 2VRSA 2WSCJ 1U7JA 4QMAA 1X8YA 4EDFA 1YTZT 1K05A 3E1RA 2E74D 2ZAEB 2OTKE 1MUUA 3H1KD 3RBZA 1YQ4C 1RH5B 1S4XA 1NTKG 3LW5J 4ZKPA 5C39A 3H1HD 1JMBA 1BGYD 3H1IE 1GL2C 4PV1D 1FDMA 1AQTA 1ZRTE 2E5YA 4H44C 3VOPA 2QJPB 1HJ0A 2M3BA 2V4HA 2E75D 2FXOA 4H0LD 2K9JB 3FGAD 1P84I 1FZAA 1DD3A 3USSA 1HF9A 4JQ0D 4ZKUA 1YHQP 3L35A 2PP6A 3L72D 1W2BO 1PZQA 2ZFCA 1M1KQ 1SS1A 1OIPA 2MJZA 1L0NK 1JCCA 1L0LK 3C9IA 2DW3A 1JY3P 3D71A 2YKOA 2N1TA 1GU4A 3FX0A 1JY2P 3TGUJ 1HVVA 2YXRB 4AUWA 3BATA 3PTZA 4RJTA 1G2CB 5AVWB 1N7SC 3H1ID 2BCCE 3L71E 3SWYA 1WT6A 4H13B 2R3SA 3NXSA 1ZRTD 2FFDA 2FXMA 3AEAC 3G4SP 1IC2A 3H1LE 2FYNC 2Z5IA 2XNXA 4L76A 1EZVE 4UB6E 1KMIZ 2GA1A 1HBWA 5AW3B 1LT9A 2IZ0A 1IJDB 4C7RA 2J5UA 2K37A 4IL6X 1VF5B 2KK7A 1EDLA 2V7QH 1OZHA 3T97A 1KV4A 4MN4C 1FBMA 2WPSA 3U1CA 1KFNA 2N9BA 1R5LA 1KB9I 3BASA 2D2CC 3H1JG 3CC2P 3LIDA 1L0NG 3HE4B 1L0LG 3CWBG 3AE2C 3L74G 1M8OB 3W67A 4HH2A 1K8AQ 1KYOH 4WY4A 3CCJP 3H1LD 4I6MC 2YKPA 2LKMA 3RK3D 3GF7A 2KLUA 4JPZB 4OVNF 5CCHC 1JO5A 2XNDH 2Y0EA 3B5ND 4EIJA 2E76D 4U3FJ 1S9KE 3HUSB 3RK2C 1M7LA 3AE4C 2WTYA 1S1CX 2R3CA 1GZLA 1ZXGA 2H8PD 1EXIA 4EYYQ 1IFMA 5AW6B 3VMXA 3Q3DA 5H2FE 3HD7A 2XU6A 2J58A 5CJ4A 1DEBA 1ZMEC 2P1JA 3JSVC 2RN0A 5TISE 1JNMA 1RHZB 4N78E 1FZGA 3O6QB 4OGQD 2IFMA 1MV8A 1L0ND 2IZ1A 4LC1A 2A45I 2FYUJ 5APXA 4TT3H 1NTZE 2L91A 1KILA 1PGPA 1URQB 1SP4A 2KB7P 5KLVK 1OWAA 1OFCX 2LXBA 5APTA 2JWDA 2B87B 3L4FA 3L70J 1YJWP 1J1DC 1SFCB 3PHLA 2P2UA 4I7ZB 2H43A 2WITA 1CW5A 4L74A 4C46A 5B66E 3SWKA 1Y9BA 5KKZB 4N78D 2JWAA 1SQXG 4H13D 2JP3A 3OW2O 1T2KC 4ZNCA 1SLQA 3CCUP 5DJUB 1L2PA 3CC7P 3V2NA 1NU1D 3RL0B 2M5AB 2Y9YA 4U7JA 2OYHA 1NTZD 3BCCE 3N7NA 1NKZB 2W83C 1D7MA 1NTME 4D6TG 1HGZA 4U3FE 2KP8A 2A06E 1LT9C 1QLED 1GDTA 3LIEA 1LP1A 5KJ7D 2KSJA 3VTPC 4EOTA 3AE9C 3CCLP 2HPCA 2YIUC 3A5TA 2H88C 1NGMB 1HGVA 1R8EA 1RQVA 1QX8A 1JTHA 1BSNA 1AVYA 1SQBE 3H1HJ 5M1BA 1Y47A 5KLVG 4R4MA 5KAFH 1FZFA 4BRYA 1SQQD 1ZP0C 2NRGA 1GL2B 2YO3A 3VP9A 3Q5PA 1CZQA 4C7NB 2P67A 4KT0J 1ZR2A 2KZJA 2YO2A 1LWUC 1H8AA 4YPCA 3BCCD 1SQXD 3BVHA 1FDOA 3L72J 1SQPE 2A06D 3C8VA 2BASA 1NYHA 4UB8H 4NPFX 1JM0A 1N7SA 3A3YB 1SQVJ 3P8MC 4UB6H 1BDCA 1EQ7A 2Y9ZA 1FE6A 2K3RA 5AW9B 1AQ5A 1KB9E 1HTLC 1SQBD 4L73A 3CCVP 2HODA 3PJSK 3TNUB 1NJIQ 1LTJB 1H0TB 3HD7C 1S3JA 1AVOA 1NTKJ 1PGQA 1QL2A 1L4AB 5APWA 4L75A 4BXLA 1UIIA 3H1KG 2XKMA 2NPSC 2H89C 1CSBA 3IFMA 3LW5H 1K9MQ 5CCGD 3L75G 3V6IA 1KZUB 5AVSB 3MTUE 1BGYG 3CD6P 1Q90D 3CL3D 1M56D 1YI2P 3A7OA 3Q5SA 2WSEH 3M0AA 3RL0g 1PP9G 1PIXA 1NKNA 4AQRD 1SFCD 5BU5A 1MZ9A 2K1AA 1GK6A 3B5NA 3KYQA 5CCHA 2NZ2A 3AEGC 1FZCC 3V5BA 1JCDA 2P10A 5GTIH 2SPZA 2IBZE 2E74C 5CMZA 1S5LH 3GHGA 1BCCJ 2O01J 4AYCA 3RL0D 5H2FH 2QE7H 1NH4A 3WUUA 3H1IG 3HE5B 3CX5H 2OYHC 2Q6QA 3PRJA 3AE6C 3O8ZA 2KXPB 5TISH 2ZJSE 1UIXA 2HG5D 3L75D 2KS1A 4PV1C 1SQVE 1ZR4A 3S1KA 3AEEC 1W5CE 3II6A 3L73E 2ZT9B 3L36A 2E75C 4H0LC 1GMJA 2Q3IA 1S72P 1BE3E 3CCSP 1KORA 2POHA 1PP9D 3KDPB 4BWNA 2Y0DA 1HUCA 1G1IA 1FJPA 1IZNB 3F89A 1DX7A 2UWJE 2P7JA 3KHUA 3H1JJ 3WUVA 1L0LJ 5AVXB 4WBAA 4ZMDA 3CWBJ 5GTHE 3L74J 5B66H 3CXHI 3M9BA 5KAFE 5CJ0A 1RF1A 1OVVA 1GU5A 3HTKA 1QGKB 1LTAC 1Y8AA 3H1LG 4DJGA 3L73D 1T3JA 2AEJA 2QVAA 3W68A 3A0BE 1IO4A 4UB8E 5AW0B 1BE3D 2N1TB 2OQQA 4KJMA 3Q2YA 4B86A 1YBKA 2AEFA 1N8RQ 2PFXA 1DIPA 4O9BA 1EDKA 1USEA 2QJYB 3EQ2A 2W6AA 1L4AD 1G1JA 2J59M 4IFMA 3AEBC 2FFDB 1KQGB 1BCCE 1NU1K 1T8ZA 1N86A 1NTZK 1KYOI 2C9NY 5AVQB 3FWLA 3HE4A 4Y99B 4XFJA 4JYBA 2BCCD 5APUA 3L71D 4RESB 2FBWC 3EFGA 2PAJA 3RK3C 1ZOYC 1A02F 4PD4E 2YIUB 1EDIA 1J1EB 1MKMA 3QH9A 3B5NC 3T97B 1EZVD 5AVYB 1LWUA 2E76C 4GODA 3HUSA 3OAKA 2XZRA 5AW1B 3EWKA 1SQQK 1NHLA 2ITAA 3H1JE 2E42A 1EDJA 2OYIA 1KB9H 1L0LE 1KTMA 3WMM0 2HFED 5AVTB 1RQUA 3L74E 4WY4B 2YNYA 1AJYA 3GHGC 4K3AA 1SQXK 1IFIA 1NAYA 5GTIE 3TGUE 1NTMK 3JC22 1VQMP 2OTLP 1M57D 3A0HE 3SWFA 4CPGA 2KLVA 1IK7A 4IFFA 2R32A 1AFOA 1S5LE 1Q81Q 3A2AA 1JOCA 3D6YA 3GG2A 4W7YA 3AE3C 2Q9IA 2WPQA 3O6QA 3CLQA 1E79H 3CX5E 4D6TJ 1NU1G 2KIKA 4OGQC 4PD4D 5CCGA 2Q3EA 2QJPC 1NTZG 1DD4A 2NPSA 1MFZA 4LGDE 1VQPP 3AECC 1SQBK 1NAFA 2V7QJ 2MKVA 4GOEA 4JBZA 1JUNA 1Q86Q 1M90Q 2QJKB 3HD7B 1QVGO 1S9KD 3AE7C 3AE8C 2JO1A 3G71P 5KLVJ 2PRRA 3SFDC 1J2JB 3TGUD 3GF3A 1SQPK 1RF1C 2QM8A 1JY3O 1JMMA 1SQQG 1GW4A 4NPDA 1JY2O 2ZVNB 2RKLA 1FZCA 1KILB 4A7PA 3S9OA 1VL2A 2WVRA 3PH0A 3CX5D 4H13C 2O3JA 2WT7B 3V4WA 1W2EA 3BCCG 1PV3A 3P8CE 3PLNA 3FWNA 1NTMG 2M5AA 2I1KA 3CCQP 1X0TA 3IN6A 3M9HA 3P32A 1BDDA 2A06G 1P84E 4YXDC 3JCUE 1YTZI 2FXPA 3SSUA 1M1JA 1N7LA 3TYYA 5KJ7C 1AV1A 1T3UA 2FKWB 5AVUB 2ZYGA 2IFNA 3MHVA 1SQBG 2E74B 1VF5D 4IFDK 1X79B 3U1AA 3H1KJ 2WSSH 4OH8B 4Y28J 3WUTA 3NFQA 2WSFH 3M91A 1IFJA 1BGYJ 5GTHH 1VQ4P 2O01N 2W6JH 2JKVA 3TSIA 2QA4P 1LP1B 3N4XA 3F5HA 3CI9A 4ASVA 1VQ7P 4K35A 4N6JA 2B9BA 1SQPG 2HPCB 4H0LB 1JTHB 4H44B 1PP9J 1JY3N 2FYUE 2KNCA 1JY2N 5KTBA 1NTMD 3HUSC 4U3FD 5APQA 4GT1A 1NO4A 2ZYAA 3A0BH 2KI7B 2M8RA 1X22A 4BRYB 5KLVE 4GOFA 1ZW0A 2OYIC 1FAVA 4WY4D 5DJTB 3ZDMA 3L70E 1K73Q 2WZ7A 1HJBA 3H6PA 3EFFK 1RE4C 3VYIA 3CMEP 2WSCH 2K9YA 3AE1C 1LGHB 3H1IJ 1L4AA 1DEEG 1KILE 1KD1Q 1N7SB 5CCGC 3VMAA 1S5LX 3CMAP 4I2LC 2WQYC 2FYUD 5B5EE 3B71A 1OVUA 2FYNB 2QM7A 3HRNA 2LR2A 1SQPD 1WMKA 2HODB 4KHXA 4N3YB 4PD4H 3I56P 1URQD 3KPEA 3P7KA 3H32A 4RO0A 4M3LA 1PL5A 2M3EA 3CCEP 2CK3H 3OJAB 1VQKP 2ZXXA 1SFCC 2Q7CA 1N73A 3L70D 4I7ZC 3AEDC 1CI6A 3VN0A 1KQFB 3WU2E 5E79H 3KXDA 1U7MA 3H1KE 1IFDA 1KB9D 2B88A 2ZYDA 1FJKA 5BVZA 2IBZG 5KLIC 3H1HE 2D2CB 1XTCC 1BGYE 2OYOA 2HR3A 3BRTB 4XA4A 2GM4A 5AVVB 3VMZA 3RK3B 2JR8A 3RL0C 3A0HH 4HJGH 3H1LJ 3V2QA 2JJLA 3VMYA 2IDBA 3D70A 4ASWA 5AW2B 3RGUA 2Y0CA 2XV5A 3L73G 3L72E 1M1JC 4EI2A 1QVFO 1PPJE 4GKGA 2WPVB 1T6AA 2AXTE 1BE3G 3IF4A 1H89A 2KZIA 4IOIH 1GD2E 3RK2B 3V2PA 3GHGB 2P58A 4WB4A 2C0XA 5EFWB 2K9JA 3M0DA 4PJ0H 1NOHA 1XTGB 2W90A 2I8DA 4XE5B 4YXWH 1IK9A 3CPWO 1OXZA 3D6ZA 3IAOA 2JEEA 2YMKA 3E7KA 3Q5RA 2KS1B 1JB0J 2WSEJ 1NTKE 5CBOA 3TDKA 1KC8Q 5K5GB 4OGQB 3C1LA 2IBZD 1GL2D 3GLMA 4JYCA 1L0NJ 2R5BA 1LNQA 4H44D 2HLOA 5KAIE 1GTWA 2BCCG 3L71G 1G2CA 5L8RJ 1R5SA 1YYCA 1OX3A 1OW7A 1PPJD 2PGDA 5APVA 2KSEA 1FDIA 2OARA 1SQVD 4I1LA 1P84H 1EZVG 3S4RA 1ZV8A 3JCUH 2KYVA 4NPEA 2W27A 3Q1MA 1E5WA 4Z1MH 1KQLA 1J1DB 1LTJC 1FS0E 1RF1B 3G6EP 1RY3A 1RE3C 1VPCA 3HTKB 3KZIE 3CXHH 1BCCG 3E1IA 1L4AC 1YITP 1NTKD 5KJ7A 1N7SD 2KUBA 1EC5A 2WPRA 3RK3E 1DH3A 1RF0C 1NU1J 5APYA 3MIWA 1NTZJ 2BEZF 1USDA 1KFMA 2WWWA 1OVRA 4DZOA 1LT9B 3CCRP 1Q7YQ 2FYZA 3RBXA 1N73C 1LTSC 1U57A 5CHXA 3R2PA 5AVRB 4YTPC 4DT0A 3L37A 3AE5C 2QSIA 3FXDA 4GDOA 2D2CD 5E79E 1FOSE 1SQQJ 3ITKA 3TGUG 1Q2NA 1L0NE 3V4QA 2LXCB 1BCCD 4JF7A 3CWBE 1YJ9P 1PFIA 3BCCJ 1SQXJ 2CPBA 1LTBC 1OMIA 2IX7C 1NTMJ 5CCHD 1LWUB 4DOJA 1NVOA 1VQLP 1RE4A 1EXJA 2GUSA 3MZWB 4RKUJ 4TLFA 2B89A 2ZT9C 3I5CA 5B5EH 2N9YB 4IL6H 2OYIB 2AXCA 1H88A 1Z56A 5CBNA 2ZT9D 3RK2D 1PGJA 2YKQA 3M0DC 1SQBJ 1FC2C 4HB1A 1Q82Q 1URQA 2E43A 3IR9A 4WWIA 3PP5A 4HKZH 5AW4B 4PJ0E 2IYOA 3H1JD 3WU2H 2C0WA 2B87A 2IBZI 3KQGA 1L0LD 1VQNP 3CWBD 1SFCA 3L74D 2I1JA 1NU1E 2NPSB 2FYUK 3NTNA 4R4LA 1SQPJ 1X9VA 1N2DC 1LTGC 2WT7A 3BRVB 2RMZA 2A45H 4DCKA 2QEXP 2N1TC 3MP7B 3I55P 2WMMA 3MUDA 2H7HA 4U3FG 1BSHA 1AA0A 2N1TD 1WRGA 2Q1KA 2E5TA 2YXQB 2JDIH 2AXTH 2QJYC 2OGUA 5KLIB 2O1JA 1FZCB 3TK1A 1SQQE 1QL1A 3ABVC 2FFDC 1VF5C 3M06A 2R44A 1QEXA 1FOSF 3TF5A 1T2KD 3CXHE 3GMAA 1LT1A 2RH0A 1HH0A 4Y99C 1SQXE 2GUVA 2G8YA 3SFEC 1KQSO 3GW6A 2K88A 2OYHB 3MD0A 3L75J 1M1JB 1GL2A 1SVFA 5KAIH 4PV1B 2FYUG 1JEKA 1FZBA 1J1EC 4C7NA 4D6TE 2W6BA 3FXEA 3P8CD 2L5GB 5AW7B 2M0BA 1LJ2A 3CCMP 2E75B 3K5BA 2Z4EA 1VQ9P 1P84D 3B4SA 5TJHA
chains in the Genus database with same CATH topology
4BWNA 2ZVOB 2V4HA 3JSVC 3F89A 3FX0A 4OWFA 2ZVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWN A;  2ZVO B;  2V4H A;  3JSV C;  3F89 A;  3FX0 A;  4OWF A;  2ZVN B; 
#chains in the Genus database with same CATH topology
 1EZV I;  1LTI C;  2W8Z A;  2OTJ P;  3V2R A;  4OWF A;  3R4Y A;  5APS A;  4WVZ A;  1PGO A;  3L70 G;  4LLH A;  4WY4 C;  2XDJ A;  2G3A A;  3CC4 P;  1ZLL A;  3U59 A;  3CXH D;  1MFT A;  2ZXE B;  2QRX A;  2IYP A;  1YQ3 C;  1VDF A;  3KZI H;  1KYO E;  3NMD A;  3TNU A;  1LTJ A;  1H0T A;  1NWQ A;  5AW8 B;  2KNC B;  2CPS A;  1RE3 A;  1A02 J;  2ZVO B;  1SQV K;  3G9R A;  3L73 J;  4D6T D;  2O01 H;  4PD4 I;  1VQ5 P;  4HYT B;  3G3Z A;  1HWT C;  1BE3 J;  1RF0 A;  2O1K A;  1VQ8 P;  2YMY A;  4IL6 E;  2QJK C;  1S2E A;  1IFP A;  2QIW A;  2IPP A;  1URQ C;  2R5D A;  5BU8 B;  1K04 A;  1NTK K;  2BEQ D;  3HD7 D;  3H25 A;  5AW5 B;  2WSF J;  1IFN A;  5KLV D;  5AVZ B;  2FY8 A;  1OW8 A;  1GK4 A;  3AEF C;  2Q5U A;  3QWO C;  1KN7 A;  2NPS D;  2HYN A;  3H1H G;  1KYO D;  2KOG A;  1KIL C;  2C9L Y;  1LTT C;  2AEM A;  3L75 E;  2BCC J;  3L71 J;  5KKZ C;  1KIL D;  4W80 A;  2A45 G;  2QG4 A;  3H32 B;  3CX5 I;  1VQ6 P;  3MGN A;  1FU1 A;  1N73 B;  3L72 G;  3M9Q A;  1ZN5 A;  1VQO P;  1CI6 B;  1PPJ G;  3MUD C;  1YJN P;  3HE5 A;  1YIJ P;  1TU3 F;  3UIA A;  1PP9 E;  3B5N B;  1FZE A;  1SQV G;  2E76 B;  3OA7 A;  4W7Z A;  1OW6 A;  3VP8 A;  2Z5H A;  1GW3 A;  3B8E B;  4GIF A;  2VRS A;  2WSC J;  1U7J A;  4QMA A;  1X8Y A;  4EDF A;  1YTZ T;  1K05 A;  3E1R A;  2E74 D;  2ZAE B;  2OTK E;  1MUU A;  3H1K D;  3RBZ A;  1YQ4 C;  1RH5 B;  1S4X A;  1NTK G;  3LW5 J;  4ZKP A;  5C39 A;  3H1H D;  1JMB A;  1BGY D;  3H1I E;  1GL2 C;  4PV1 D;  1FDM A;  1AQT A;  1ZRT E;  2E5Y A;  4H44 C;  3VOP A;  2QJP B;  1HJ0 A;  2M3B A;  2V4H A;  2E75 D;  2FXO A;  4H0L D;  2K9J B;  3FGA D;  1P84 I;  1FZA A;  1DD3 A;  3USS A;  1HF9 A;  4JQ0 D;  4ZKU A;  1YHQ P;  3L35 A;  2PP6 A;  3L72 D;  1W2B O;  1PZQ A;  2ZFC A;  1M1K Q;  1SS1 A;  1OIP A;  2MJZ A;  1L0N K;  1JCC A;  1L0L K;  3C9I A;  2DW3 A;  1JY3 P;  3D71 A;  2YKO A;  2N1T A;  1GU4 A;  3FX0 A;  1JY2 P;  3TGU J;  1HVV A;  2YXR B;  4AUW A;  3BAT A;  3PTZ A;  4RJT A;  1G2C B;  5AVW B;  1N7S C;  3H1I D;  2BCC E;  3L71 E;  3SWY A;  1WT6 A;  4H13 B;  2R3S A;  3NXS A;  1ZRT D;  2FFD A;  2FXM A;  3AEA C;  3G4S P;  1IC2 A;  3H1L E;  2FYN C;  2Z5I A;  2XNX A;  4L76 A;  1EZV E;  4UB6 E;  1KMI Z;  2GA1 A;  1HBW A;  5AW3 B;  1LT9 A;  2IZ0 A;  1IJD B;  4C7R A;  2J5U A;  2K37 A;  4IL6 X;  1VF5 B;  2KK7 A;  1EDL A;  2V7Q H;  1OZH A;  3T97 A;  1KV4 A;  4MN4 C;  1FBM A;  2WPS A;  3U1C A;  1KFN A;  2N9B A;  1R5L A;  1KB9 I;  3BAS A;  2D2C C;  3H1J G;  3CC2 P;  3LID A;  1L0N G;  3HE4 B;  1L0L G;  3CWB G;  3AE2 C;  3L74 G;  1M8O B;  3W67 A;  4HH2 A;  1K8A Q;  1KYO H;  4WY4 A;  3CCJ P;  3H1L D;  4I6M C;  2YKP A;  2LKM A;  3RK3 D;  3GF7 A;  2KLU A;  4JPZ B;  4OVN F;  5CCH C;  1JO5 A;  2XND H;  2Y0E A;  3B5N D;  4EIJ A;  2E76 D;  4U3F J;  1S9K E;  3HUS B;  3RK2 C;  1M7L A;  3AE4 C;  2WTY A;  1S1C X;  2R3C A;  1GZL A;  1ZXG A;  2H8P D;  1EXI A;  4EYY Q;  1IFM A;  5AW6 B;  3VMX A;  3Q3D A;  5H2F E;  3HD7 A;  2XU6 A;  2J58 A;  5CJ4 A;  1DEB A;  1ZME C;  2P1J A;  3JSV C;  2RN0 A;  5TIS E;  1JNM A;  1RHZ B;  4N78 E;  1FZG A;  3O6Q B;  4OGQ D;  2IFM A;  1MV8 A;  1L0N D;  2IZ1 A;  4LC1 A;  2A45 I;  2FYU J;  5APX A;  4TT3 H;  1NTZ E;  2L91 A;  1KIL A;  1PGP A;  1URQ B;  1SP4 A;  2KB7 P;  5KLV K;  1OWA A;  1OFC X;  2LXB A;  5APT A;  2JWD A;  2B87 B;  3L4F A;  3L70 J;  1YJW P;  1J1D C;  1SFC B;  3PHL A;  2P2U A;  4I7Z B;  2H43 A;  2WIT A;  1CW5 A;  4L74 A;  4C46 A;  5B66 E;  3SWK A;  1Y9B A;  5KKZ B;  4N78 D;  2JWA A;  1SQX G;  4H13 D;  2JP3 A;  3OW2 O;  1T2K C;  4ZNC A;  1SLQ A;  3CCU P;  5DJU B;  1L2P A;  3CC7 P;  3V2N A;  1NU1 D;  3RL0 B;  2M5A B;  2Y9Y A;  4U7J A;  2OYH A;  1NTZ D;  3BCC E;  3N7N A;  1NKZ B;  2W83 C;  1D7M A;  1NTM E;  4D6T G;  1HGZ A;  4U3F E;  2KP8 A;  2A06 E;  1LT9 C;  1QLE D;  1GDT A;  3LIE A;  1LP1 A;  5KJ7 D;  2KSJ A;  3VTP C;  4EOT A;  3AE9 C;  3CCL P;  2HPC A;  2YIU C;  3A5T A;  2H88 C;  1NGM B;  1HGV A;  1R8E A;  1RQV A;  1QX8 A;  1JTH A;  1BSN A;  1AVY A;  1SQB E;  3H1H J;  5M1B A;  1Y47 A;  5KLV G;  4R4M A;  5KAF H;  1FZF A;  4BRY A;  1SQQ D;  1ZP0 C;  2NRG A;  1GL2 B;  2YO3 A;  3VP9 A;  3Q5P A;  1CZQ A;  4C7N B;  2P67 A;  4KT0 J;  1ZR2 A;  2KZJ A;  2YO2 A;  1LWU C;  1H8A A;  4YPC A;  3BCC D;  1SQX D;  3BVH A;  1FDO A;  3L72 J;  1SQP E;  2A06 D;  3C8V A;  2BAS A;  1NYH A;  4UB8 H;  4NPF X;  1JM0 A;  1N7S A;  3A3Y B;  1SQV J;  3P8M C;  4UB6 H;  1BDC A;  1EQ7 A;  2Y9Z A;  1FE6 A;  2K3R A;  5AW9 B;  1AQ5 A;  1KB9 E;  1HTL C;  1SQB D;  4L73 A;  3CCV P;  2HOD A;  3PJS K;  3TNU B;  1NJI Q;  1LTJ B;  1H0T B;  3HD7 C;  1S3J A;  1AVO A;  1NTK J;  1PGQ A;  1QL2 A;  1L4A B;  5APW A;  4L75 A;  4BXL A;  1UII A;  3H1K G;  2XKM A;  2NPS C;  2H89 C;  1CSB A;  3IFM A;  3LW5 H;  1K9M Q;  5CCG D;  3L75 G;  3V6I A;  1KZU B;  5AVS B;  3MTU E;  1BGY G;  3CD6 P;  1Q90 D;  3CL3 D;  1M56 D;  1YI2 P;  3A7O A;  3Q5S A;  2WSE H;  3M0A A;  3RL0 g;  1PP9 G;  1PIX A;  1NKN A;  4AQR D;  1SFC D;  5BU5 A;  1MZ9 A;  2K1A A;  1GK6 A;  3B5N A;  3KYQ A;  5CCH A;  2NZ2 A;  3AEG C;  1FZC C;  3V5B A;  1JCD A;  2P10 A;  5GTI H;  2SPZ A;  2IBZ E;  2E74 C;  5CMZ A;  1S5L H;  3GHG A;  1BCC J;  2O01 J;  4AYC A;  3RL0 D;  5H2F H;  2QE7 H;  1NH4 A;  3WUU A;  3H1I G;  3HE5 B;  3CX5 H;  2OYH C;  2Q6Q A;  3PRJ A;  3AE6 C;  3O8Z A;  2KXP B;  5TIS H;  2ZJS E;  1UIX A;  2HG5 D;  3L75 D;  2KS1 A;  4PV1 C;  1SQV E;  1ZR4 A;  3S1K A;  3AEE C;  1W5C E;  3II6 A;  3L73 E;  2ZT9 B;  3L36 A;  2E75 C;  4H0L C;  1GMJ A;  2Q3I A;  1S72 P;  1BE3 E;  3CCS P;  1KOR A;  2POH A;  1PP9 D;  3KDP B;  4BWN A;  2Y0D A;  1HUC A;  1G1I A;  1FJP A;  1IZN B;  3F89 A;  1DX7 A;  2UWJ E;  2P7J A;  3KHU A;  3H1J J;  3WUV A;  1L0L J;  5AVX B;  4WBA A;  4ZMD A;  3CWB J;  5GTH E;  3L74 J;  5B66 H;  3CXH I;  3M9B A;  5KAF E;  5CJ0 A;  1RF1 A;  1OVV A;  1GU5 A;  3HTK A;  1QGK B;  1LTA C;  1Y8A A;  3H1L G;  4DJG A;  3L73 D;  1T3J A;  2AEJ A;  2QVA A;  3W68 A;  3A0B E;  1IO4 A;  4UB8 E;  5AW0 B;  1BE3 D;  2N1T B;  2OQQ A;  4KJM A;  3Q2Y A;  4B86 A;  1YBK A;  2AEF A;  1N8R Q;  2PFX A;  1DIP A;  4O9B A;  1EDK A;  1USE A;  2QJY B;  3EQ2 A;  2W6A A;  1L4A D;  1G1J A;  2J59 M;  4IFM A;  3AEB C;  2FFD B;  1KQG B;  1BCC E;  1NU1 K;  1T8Z A;  1N86 A;  1NTZ K;  1KYO I;  2C9N Y;  5AVQ B;  3FWL A;  3HE4 A;  4Y99 B;  4XFJ A;  4JYB A;  2BCC D;  5APU A;  3L71 D;  4RES B;  2FBW C;  3EFG A;  2PAJ A;  3RK3 C;  1ZOY C;  1A02 F;  4PD4 E;  2YIU B;  1EDI A;  1J1E B;  1MKM A;  3QH9 A;  3B5N C;  3T97 B;  1EZV D;  5AVY B;  1LWU A;  2E76 C;  4GOD A;  3HUS A;  3OAK A;  2XZR A;  5AW1 B;  3EWK A;  1SQQ K;  1NHL A;  2ITA A;  3H1J E;  2E42 A;  1EDJ A;  2OYI A;  1KB9 H;  1L0L E;  1KTM A;  3WMM 0;  2HFE D;  5AVT B;  1RQU A;  3L74 E;  4WY4 B;  2YNY A;  1AJY A;  3GHG C;  4K3A A;  1SQX K;  1IFI A;  1NAY A;  5GTI E;  3TGU E;  1NTM K;  3JC2 2;  1VQM P;  2OTL P;  1M57 D;  3A0H E;  3SWF A;  4CPG A;  2KLV A;  1IK7 A;  4IFF A;  2R32 A;  1AFO A;  1S5L E;  1Q81 Q;  3A2A A;  1JOC A;  3D6Y A;  3GG2 A;  4W7Y A;  3AE3 C;  2Q9I A;  2WPQ A;  3O6Q A;  3CLQ A;  1E79 H;  3CX5 E;  4D6T J;  1NU1 G;  2KIK A;  4OGQ C;  4PD4 D;  5CCG A;  2Q3E A;  2QJP C;  1NTZ G;  1DD4 A;  2NPS A;  1MFZ A;  4LGD E;  1VQP P;  3AEC C;  1SQB K;  1NAF A;  2V7Q J;  2MKV A;  4GOE A;  4JBZ A;  1JUN A;  1Q86 Q;  1M90 Q;  2QJK B;  3HD7 B;  1QVG O;  1S9K D;  3AE7 C;  3AE8 C;  2JO1 A;  3G71 P;  5KLV J;  2PRR A;  3SFD C;  1J2J B;  3TGU D;  3GF3 A;  1SQP K;  1RF1 C;  2QM8 A;  1JY3 O;  1JMM A;  1SQQ G;  1GW4 A;  4NPD A;  1JY2 O;  2ZVN B;  2RKL A;  1FZC A;  1KIL B;  4A7P A;  3S9O A;  1VL2 A;  2WVR A;  3PH0 A;  3CX5 D;  4H13 C;  2O3J A;  2WT7 B;  3V4W A;  1W2E A;  3BCC G;  1PV3 A;  3P8C E;  3PLN A;  3FWN A;  1NTM G;  2M5A A;  2I1K A;  3CCQ P;  1X0T A;  3IN6 A;  3M9H A;  3P32 A;  1BDD A;  2A06 G;  1P84 E;  4YXD C;  3JCU E;  1YTZ I;  2FXP A;  3SSU A;  1M1J A;  1N7L A;  3TYY A;  5KJ7 C;  1AV1 A;  1T3U A;  2FKW B;  5AVU B;  2ZYG A;  2IFN A;  3MHV A;  1SQB G;  2E74 B;  1VF5 D;  4IFD K;  1X79 B;  3U1A A;  3H1K J;  2WSS H;  4OH8 B;  4Y28 J;  3WUT A;  3NFQ A;  2WSF H;  3M91 A;  1IFJ A;  1BGY J;  5GTH H;  1VQ4 P;  2O01 N;  2W6J H;  2JKV A;  3TSI A;  2QA4 P;  1LP1 B;  3N4X A;  3F5H A;  3CI9 A;  4ASV A;  1VQ7 P;  4K35 A;  4N6J A;  2B9B A;  1SQP G;  2HPC B;  4H0L B;  1JTH B;  4H44 B;  1PP9 J;  1JY3 N;  2FYU E;  2KNC A;  1JY2 N;  5KTB A;  1NTM D;  3HUS C;  4U3F D;  5APQ A;  4GT1 A;  1NO4 A;  2ZYA A;  3A0B H;  2KI7 B;  2M8R A;  1X22 A;  4BRY B;  5KLV E;  4GOF A;  1ZW0 A;  2OYI C;  1FAV A;  4WY4 D;  5DJT B;  3ZDM A;  3L70 E;  1K73 Q;  2WZ7 A;  1HJB A;  3H6P A;  3EFF K;  1RE4 C;  3VYI A;  3CME P;  2WSC H;  2K9Y A;  3AE1 C;  1LGH B;  3H1I J;  1L4A A;  1DEE G;  1KIL E;  1KD1 Q;  1N7S B;  5CCG C;  3VMA A;  1S5L X;  3CMA P;  4I2L C;  2WQY C;  2FYU D;  5B5E E;  3B71 A;  1OVU A;  2FYN B;  2QM7 A;  3HRN A;  2LR2 A;  1SQP D;  1WMK A;  2HOD B;  4KHX A;  4N3Y B;  4PD4 H;  3I56 P;  1URQ D;  3KPE A;  3P7K A;  3H32 A;  4RO0 A;  4M3L A;  1PL5 A;  2M3E A;  3CCE P;  2CK3 H;  3OJA B;  1VQK P;  2ZXX A;  1SFC C;  2Q7C A;  1N73 A;  3L70 D;  4I7Z C;  3AED C;  1CI6 A;  3VN0 A;  1KQF B;  3WU2 E;  5E79 H;  3KXD A;  1U7M A;  3H1K E;  1IFD A;  1KB9 D;  2B88 A;  2ZYD A;  1FJK A;  5BVZ A;  2IBZ G;  5KLI C;  3H1H E;  2D2C B;  1XTC C;  1BGY E;  2OYO A;  2HR3 A;  3BRT B;  4XA4 A;  2GM4 A;  5AVV B;  3VMZ A;  3RK3 B;  2JR8 A;  3RL0 C;  3A0H H;  4HJG H;  3H1L J;  3V2Q A;  2JJL A;  3VMY A;  2IDB A;  3D70 A;  4ASW A;  5AW2 B;  3RGU A;  2Y0C A;  2XV5 A;  3L73 G;  3L72 E;  1M1J C;  4EI2 A;  1QVF O;  1PPJ E;  4GKG A;  2WPV B;  1T6A A;  2AXT E;  1BE3 G;  3IF4 A;  1H89 A;  2KZI A;  4IOI H;  1GD2 E;  3RK2 B;  3V2P A;  3GHG B;  2P58 A;  4WB4 A;  2C0X A;  5EFW B;  2K9J A;  3M0D A;  4PJ0 H;  1NOH A;  1XTG B;  2W90 A;  2I8D A;  4XE5 B;  4YXW H;  1IK9 A;  3CPW O;  1OXZ A;  3D6Z A;  3IAO A;  2JEE A;  2YMK A;  3E7K A;  3Q5R A;  2KS1 B;  1JB0 J;  2WSE J;  1NTK E;  5CBO A;  3TDK A;  1KC8 Q;  5K5G B;  4OGQ B;  3C1L A;  2IBZ D;  1GL2 D;  3GLM A;  4JYC A;  1L0N J;  2R5B A;  1LNQ A;  4H44 D;  2HLO A;  5KAI E;  1GTW A;  2BCC G;  3L71 G;  1G2C A;  5L8R J;  1R5S A;  1YYC A;  1OX3 A;  1OW7 A;  1PPJ D;  2PGD A;  5APV A;  2KSE A;  1FDI A;  2OAR A;  1SQV D;  4I1L A;  1P84 H;  1EZV G;  3S4R A;  1ZV8 A;  3JCU H;  2KYV A;  4NPE A;  2W27 A;  3Q1M A;  1E5W A;  4Z1M H;  1KQL A;  1J1D B;  1LTJ C;  1FS0 E;  1RF1 B;  3G6E P;  1RY3 A;  1RE3 C;  1VPC A;  3HTK B;  3KZI E;  3CXH H;  1BCC G;  3E1I A;  1L4A C;  1YIT P;  1NTK D;  5KJ7 A;  1N7S D;  2KUB A;  1EC5 A;  2WPR A;  3RK3 E;  1DH3 A;  1RF0 C;  1NU1 J;  5APY A;  3MIW A;  1NTZ J;  2BEZ F;  1USD A;  1KFM A;  2WWW A;  1OVR A;  4DZO A;  1LT9 B;  3CCR P;  1Q7Y Q;  2FYZ A;  3RBX A;  1N73 C;  1LTS C;  1U57 A;  5CHX A;  3R2P A;  5AVR B;  4YTP C;  4DT0 A;  3L37 A;  3AE5 C;  2QSI A;  3FXD A;  4GDO A;  2D2C D;  5E79 E;  1FOS E;  1SQQ J;  3ITK A;  3TGU G;  1Q2N A;  1L0N E;  3V4Q A;  2LXC B;  1BCC D;  4JF7 A;  3CWB E;  1YJ9 P;  1PFI A;  3BCC J;  1SQX J;  2CPB A;  1LTB C;  1OMI A;  2IX7 C;  1NTM J;  5CCH D;  1LWU B;  4DOJ A;  1NVO A;  1VQL P;  1RE4 A;  1EXJ A;  2GUS A;  3MZW B;  4RKU J;  4TLF A;  2B89 A;  2ZT9 C;  3I5C A;  5B5E H;  2N9Y B;  4IL6 H;  2OYI B;  2AXC A;  1H88 A;  1Z56 A;  5CBN A;  2ZT9 D;  3RK2 D;  1PGJ A;  2YKQ A;  3M0D C;  1SQB J;  1FC2 C;  4HB1 A;  1Q82 Q;  1URQ A;  2E43 A;  3IR9 A;  4WWI A;  3PP5 A;  4HKZ H;  5AW4 B;  4PJ0 E;  2IYO A;  3H1J D;  3WU2 H;  2C0W A;  2B87 A;  2IBZ I;  3KQG A;  1L0L D;  1VQN P;  3CWB D;  1SFC A;  3L74 D;  2I1J A;  1NU1 E;  2NPS B;  2FYU K;  3NTN A;  4R4L A;  1SQP J;  1X9V A;  1N2D C;  1LTG C;  2WT7 A;  3BRV B;  2RMZ A;  2A45 H;  4DCK A;  2QEX P;  2N1T C;  3MP7 B;  3I55 P;  2WMM A;  3MUD A;  2H7H A;  4U3F G;  1BSH A;  1AA0 A;  2N1T D;  1WRG A;  2Q1K A;  2E5T A;  2YXQ B;  2JDI H;  2AXT H;  2QJY C;  2OGU A;  5KLI B;  2O1J A;  1FZC B;  3TK1 A;  1SQQ E;  1QL1 A;  3ABV C;  2FFD C;  1VF5 C;  3M06 A;  2R44 A;  1QEX A;  1FOS F;  3TF5 A;  1T2K D;  3CXH E;  3GMA A;  1LT1 A;  2RH0 A;  1HH0 A;  4Y99 C;  1SQX E;  2GUV A;  2G8Y A;  3SFE C;  1KQS O;  3GW6 A;  2K88 A;  2OYH B;  3MD0 A;  3L75 J;  1M1J B;  1GL2 A;  1SVF A;  5KAI H;  4PV1 B;  2FYU G;  1JEK A;  1FZB A;  1J1E C;  4C7N A;  4D6T E;  2W6B A;  3FXE A;  3P8C D;  2L5G B;  5AW7 B;  2M0B A;  1LJ2 A;  3CCM P;  2E75 B;  3K5B A;  2Z4E A;  1VQ9 P;  1P84 D;  3B4S A;  5TJH A; 
#chains in the Genus database with same CATH homology
 4BWN A;  2ZVO B;  2V4H A;  3JSV C;  3F89 A;  3FX0 A;  4OWF A;  2ZVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...