2ZVNB

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
85
structure length
85
Chain Sequence
SLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBC protein
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 38
structure length 85
sequence length 85
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2zvnB00
3JSVC 3F89A 4BWNA 4OWFA 2ZVNB 2ZVOB 2V4HA 3FX0A
chains in the Genus database with same CATH superfamily
1BCCE 3AEGC 3CX5D 3BCCD 2E76C 4TT3H 1RF1C 3OA7A 2A06G 1TU3F 3O8ZA 2YNYA 1SQPD 2FYUJ 1M1JB 2QEXP 1DD4A 3KPEA 1QEXA 1KYOI 3MUDC 3VP8A 5AVYB 3Q3DA 2WQYC 1EDJA 3CPWO 2OQQA 2XZRA 4ZNCA 2QG4A 3CWBE 3RL0g 3GLMA 3H1KJ 5AW6B 1R8EA 2BCCE 4KJMA 1LT1A 5B5EE 1NHLA 1AQ5A 1FS0E 2IPPA 2N1TC 3MUDA 1S72P 2HFED 4PD4H 1J1DC 2ZAEB 2ZYGA 3RK3C 2C9LY 2FYUG 1GD2E 1RF0C 2A45H 1HJBA 1H8AA 1SFCC 1ZOYC 2J5UA 2WSSH 5BU5A 1SQBD 2HLOA 1IFJA 5AW2B 1HBWA 2Q9IA 2Q6QA 1JM0A 3WUVA 2K37A 2OTKE 1HJ0A 1ZR4A 2J58A 2N1TA 2K9JA 5CHXA 3EWKA 5APQA 3H1KG 3HE4B 2H88C 1DX7A 3CL3D 5APVA 5TISE 1X0TA 4I2LC 1CI6B 1GW4A 1SFCA 3IFMA 1IJDB 1FZCC 1FOSE 3AEDC 4K3AA 2C0WA 5CCHD 1N8RQ 1JY2P 2BEZF 1YTZT 3FXEA 2NPSC 1FDOA 3L71E 5EFWB 2JWAA 1HTLC 4CPGA 2MKVA 1ZP0C 3OW2O 1N73C 1JEKA 2FYZA 2ITAA 2WITA 1FZCA 1DH3A 2W6BA 4JYBA 3SSUA 1E5WA 1KFNA 2E43A 1JMMA 1NTME 1M57D 3H1IJ 2VRSA 3CI9A 2E76B 1RF1B 2AEFA 4UB6E 5CCGC 2ZJSE 5GTIE 3N7NA 2NPSA 3FX0A 1GL2C 2WWWA 1NTKD 3PP5A 3ITKA 1YYCA 2O3JA 1N73A 1MV8A 1X22A 4KT0J 4HYTB 1PPJD 1KTMA 4AQRD 3KZIE 3L36A 2Y9YA 4OVNF 1JB0J 2KOGA 1ZR2A 3H1JJ 3WUTA 4R4MA 2Q3IA 5CCGA 5H2FE 4ASWA 1BCCJ 1OVUA 3C9IA 4RO0A 2E5YA 3M9HA 2E75D 3L73E 1BE3D 4ASVA 3PLNA 2KSJA 4B86A 5APTA 1L0LD 1HVVA 3WU2H 2KNCA 2N1TB 3H1IG 2IYPA 2A06E 3C1LA 2M0BA 1KC8Q 3A0HE 3CCMP 1KB9D 4AUWA 1FJPA 1J1DB 1PL5A 3U59A 3GF7A 1IC2A 1DIPA 4XE5B 3VTPC 3RK3B 3HE5B 1OZHA 2KIKA 2QM8A 2IDBA 2RKLA 4HKZH 4WWIA 1SFCB 3AE5C 2M8RA 4W7YA 4LC1A 1D7MA 3E7KA 1GZLA 1JTHA 1SVFA 1VQKP 3CWBJ 2OGUA 3HUSC 1VQMP 4U3FD 1KQGB 2KS1A 2BCCJ 1KILE 1K05A 1ZRTD 2WMMA 3L74D 3H1JG 4W80A 3IAOA 5CBNA 1GU5A 3SWYA 1BCCG 1GU4A 2WSEH 1OFCX 1HGZA 2G8YA 2FFDC 4EOTA 1M7LA 3HTKB 3I5CA 4TLFA 1AA0A 3AEBC 1URQC 1FZCB 3AEEC 2QVAA 3A3YB 2QSIA 5H2FH 3A0BE 4JYCA 3H1LE 2FYUE 1LGHB 1NTMK 3AE9C 1IFPA 4YXDC 3IR9A 1OX3A 1YTZI 1Y47A 2NPSB 3BCCJ 4JPZB 3L72D 1AVOA 3CMEP 1YQ4C 2B9BA 5TJHA 3A0HH 4DZOA 1EZVE 1N73B 3CWBG 1JY3O 1VQNP 2XNDH 1A02F 5KAFE 2P7JA 1URQA 1NYHA 3EQ2A 3AEAC 3H1KE 4RKUJ 1Z56A 2JJLA 3NXSA 2JEEA 1N7SD 3C8VA 2W83C 1RHZB 2W8ZA 3E1IA 1FDMA 1GL2B 3H1HJ 1AJYA 3V5BA 2HPCA 4LLHA 1U7MA 4PJ0E 3S9OA 3I56P 3HD7C 1T6AA 3MIWA 4D6TD 2Y9ZA 5KLIC 5CJ4A 1FU1A 5KLVE 2YXQB 5AW4B 3GHGB 2NRGA 3BCCG 2OYHC 5DJTB 4K35A 2O01N 1YJNP 2QJKC 3E1RA 1VQ5P 4IOIH 5AW0B 5AW7B 2GA1A 3A0BH 1NTMJ 2JDIH 2WPRA 1PGOA 4BWNA 5AVXB 1DEBA 1IFMA 2KZJA 3HD7A 1NU1K 1G2CA 5M1BA 3AEFC 3L75D 3TF5A 4PD4D 2ZVNB 3H1HG 3TGUJ 2WT7A 4ZKPA 2WSFJ 1VL2A 2M5AA 4EYYQ 4L73A 1GTWA 1SP4A 2QJYC 4LGDE 1IFDA 4M3LA 2LKMA 3W68A 3Q5SA 2J59M 4RESB 3HUSB 3JSVC 1HWTC 2CK3H 1FZGA 1FZEA 1AV1A 4PJ0H 3RBXA 3NTNA 4IL6H 1OVVA 1NTMG 2KUBA 2YMYA 1JCDA 2FFDB 1OW6A 5KAIE 1N86A 1L0LK 1KILC 2WTYA 2B87B 2YKOA 1IZNB 1JY2N 2C9NY 1BGYD 1URQB 2WSCJ 2E74C 2HODA 3VMAA 3MHVA 2P1JA 4KHXA 3TGUG 5BU8B 2D2CC 1LJ2A 1NU1J 2YMKA 2QJPC 1NAYA 3RGUA 1KD1Q 3L70E 2DW3A 2HPCB 3WMM0 4PV1C 3R2PA 4NPFX 1VQ9P 1EDLA 2H8PD 3HRNA 2G3AA 4H0LC 5KLVK 4BRYA 1PZQA 4N78E 3BASA 2Y0DA 3S1KA 1YI2P 1RE4A 1PFIA 3H1LJ 3JCUH 1E79H 3KQGA 1RQVA 1YIJP 2FKWB 2WVRA 1S2EA 2FXOA 1X8YA 2JR8A 1W5CE 4WY4B 1L0ND 1L0LJ 2KYVA 1NU1G 5KAIH 2IZ0A 1ZW0A 4H13C 2OYHB 2QIWA 2KI7B 2QJKB 4OWFA 4OGQB 3VMYA 2IFNA 1SS1A 2ZXEB 2OYIC 3K5BA 2AXTE 2P58A 1H89A 3BVHA 1Q81Q 3S4RA 3B5ND 1SQQK 1KQSO 1OIPA 4MN4C 2PGDA 3CCSP 2QRXA 1P84I 4Y99C 3H1LG 4GIFA 1L4AB 1LP1B 2K9YA 5KLVJ 1HH0A 1K8AQ 1LT9B 4GKGA 2IBZD 2QJYB 5APXA 3CX5E 2OYIA 3BCCE 1L0LG 1EZVG 2B89A 3D6YA 4WY4D 3AE8C 1RH5B 3TNUA 3KXDA 1QGKB 1G1IA 2YKQA 1KV4A 1NO4A 4C46A 3M0DC 4OGQD 5DJUB 3G4SP 3LW5J 1KILB 2KXPB 5AW5B 1S5LX 2FBWC 1HGVA 1LTSC 1JNMA 1EZVI 2E74B 1NTZD 1LTJA 4GODA 3H6PA 2L91A 1IFIA 3H1HE 2R5DA 1UIXA 5B5EH 2O01J 3M0AA 1KYOD 5KLVG 2D2CB 1USDA 2AXTH 3L73D 2QJPB 1FDIA 1SQQJ 1SQVD 4GDOA 1L4AD 1UIIA 2FXMA 1MFTA 2W6AA 3M0DA 3VOPA 3CXHE 2A06D 2E42A 3EFGA 3F89A 1N7SA 2ZVOB 1VF5C 1LTTC 3PJSK 4UB8E 2KSEA 2KP8A 1QLED 2SPZA 1SQBE 1IK9A 2AEMA 2OYOA 4L74A 3AE2C 1EDKA 2W6JH 4NPDA 4Z1MH 1LTBC 3QH9A 2XKMA 3A2AA 3CCEP 1FJKA 1KILD 3KDPB 4GOFA 3TGUE 3L70J 5TISH 3MD0A 2M3EA 5KJ7C 4H13B 3MTUE 4C7RA 1SQQG 2C0XA 2D2CD 2P67A 3L75J 3LIDA 2PFXA 2OTJP 1LNQA 2FYUD 4YXWH 3EFFK 1J1EC 2ZT9C 3M06A 1NOHA 4D6TG 1H88A 2K9JB 1MKMA 1K73Q 3TNUB 3F5HA 1M8OB 3B4SA 2E76D 2QA4P 5KJ7A 3CXHH 1SQPK 4I6MC 1L2PA 4Y99B 2BEQD 4EDFA 3V2PA 2E5TA 1MFZA 3FXDA 1NJIQ 3P7KA 3AE6C 2R32A 3H1KD 1LWUA 3L70G 4UB6H 5GTIH 1NU1E 1GK6A 4WVZA 1N2DC 1P84E 1VQ7P 4ZMDA 1BGYJ 4DJGA 2M3BA 1CW5A 2I8DA 3T97A 3L75G 1WT6A 3R4YA 4N3YB 3KZIH 1U7JA 2GM4A 2Z5IA 3M91A 2WSFH 1SQXD 1M1KQ 1K04A 5KTBA 3H32A 4QMAA 1S5LE 2N9YB 2N1TD 1VQ4P 4I7ZC 1PP9J 5K5GB 4L76A 1FZBA 2XDJA 3CD6P 3RK3D 1SQBK 1BE3E 2ZFCA 3V2QA 1DD3A 1YJ9P 4C7NA 1SFCD 1L0LE 1CZQA 3TYYA 1ZMEC 3SFDC 1SQPJ 1AVYA 4IFMA 1BGYG 3RK2C 2WSCH 1VF5B 1KB9E 3NMDA 1VQ8P 5E79E 3Q5PA 1KORA 3CCJP 2JKVA 2YO2A 3PHLA 3TDKA 5AVRB 1P84H 5APSA 3L4FA 2YKPA 3FWLA 2KZIA 3P8CD 1NTZK 2KNCB 3A5TA 1OXZA 1QL1A 2K88A 1PP9G 1ZRTE 3L74E 3CCUP 2B88A 3USSA 4XA4A 1FZAA 1VDFA 3Q1MA 1SQVK 2V4HA 1S9KD 2NPSD 2YIUC 3H1ID 1SQPG 1USEA 3AE1C 1JTHB 2AEJA 3FGAD 1HUCA 2PAJA 2RH0A 1SQBJ 1VQOP 2KS1B 1J1EB 2ZT9B 3JC22 1W2BO 5AW8B 3WUUA 3CX5I 1YQ3C 1M1JA 2Q7CA 3VYIA 5CCHC 3L72E 4WB4A 1NTKK 5CCGD 5KAFH 5AVWB 1GL2D 3H1JD 5KKZC 1NWQA 1PGPA 1PGQA 2I1JA 1BCCD 1S3JA 2WPQA 4N78D 1SQQE 4L75A 4ZKUA 3D70A 2XNXA 2PRRA 1JY3P 5CCHA 3CCQP 4C7NB 3G6EP 4A7PA 2W90A 4D6TE 1SQBG 4DOJA 1KQLA 1FAVA 3CXHI 1AQTA 4JQ0D 1J2JB 5BVZA 1A02J 4W7ZA 3G9RA 3CWBD 1RE4C 1QVFO 2BCCD 5APUA 2ZYAA 3OAKA 3LW5H 1NTKJ 1DEEG 3RK2B 3HE4A 5AW1B 2E75C 2UWJE 3L75E 4O9BA 4PD4E 1H0TA 2KLVA 1CI6A 1T2KC 2O01H 3V2RA 3CCRP 1FZFA 5APWA 1SQXK 3PTZA 4HJGH 1WMKA 3HD7B 1S4XA 1OWAA 1U57A 3AE4C 3CCVP 1R5SA 2OARA 1G2CB 1URQD 1JY2O 1BE3J 5KLIB 1M56D 1OW7A 1RE3C 1NAFA 2WT7B 1EC5A 2WPVB 1Q86Q 2YIUB 4EI2A 1JCCA 2M5AB 5GTHE 1EXJA 2MJZA 1BGYE 3CCLP 3SFEC 1NTKG 4HH2A 3D71A 1AFOA 3H1HD 1RF1A 2CPSA 1PPJG 3RK2D 2V7QJ 3L71D 2JWDA 1S1CX 1LTAC 4U3FJ 2Z5HA 3VP9A 2JO1A 2N9BA 3L74J 1KMIZ 1RE3A 3CXHD 1X79B 3MZWB 1JUNA 1PP9E 1NVOA 5KKZB 1BE3G 1M90Q 3Q2YA 1IK7A 1LTJC 2LR2A 1NTMD 2HODB 3HD7D 1Q2NA 2Z4EA 1SQXJ 3A7OA 2PP6A 1BSHA 1SQPE 2FY8A 1CSBA 1HF9A 4XFJA 3P32A 4I1LA 5AVVB 2ZXXA 3PH0A 3TGUD 1N7SC 3TSIA 1VPCA 3L72J 2NZ2A 1L0NE 1ZV8A 2Q5UA 5AVUB 4BRYB 5B66E 1QL2A 4U3FG 1RF0A 3HE5A 4GOEA 1H0TB 5GTHH 3GMAA 1KB9I 3L74G 1T3JA 3V2NA 4JBZA 1YBKA 3MP7B 1FE6A 2R44A 5AVQB 4R4LA 4H44C 1GK4A 4PV1B 3G3ZA 3H25A 2LXBA 1SQXG 3WU2E 4H0LB 2E75B 1X9VA 4D6TJ 3O6QA 1EXIA 1Q82Q 2I1KA 2W27A 2WZ7A 3HTKA 3TK1A 3CX5H 1MUUA 3PRJA 3V6IA 3U1AA 3RL0C 2IBZE 3L72G 2Q3EA 3U1CA 1NU1D 4NPEA 3D6ZA 3B71A 1VQLP 1P84D 2OTLP 4DT0A 1XTGB 2K3RA 4Y28J 2L5GB 2R5BA 2E74D 3Q5RA 1SLQA 2XU6A 2IZ1A 4WBAA 5C39A 4IL6X 2H43A 4YTPC 1NH4A 1FOSF 5CBOA 5B66H 1EQ7A 1LWUC 3GHGC 1NTZE 2OYIB 3H1LD 4PV1D 3VN0A 1QX8A 1KN7A 4H0LD 1KYOE 1GL2A 1Y9BA 1ZN5A 1SQVE 1N7LA 2IX7C 1T2KD 1EZVD 4UB8H 2QM7A 5AVTB 3P8MC 3AECC 3GHGA 1L0NK 1LTJB 2R3SA 3GW6A 1OVRA 4IFDK 3ZDMA 1JY3N 1NKZB 2XV5A 1R5LA 3UIAA 4IFFA 3G71P 4H13D 1FBMA 1YJWP 1NTKE 2IYOA 1NKNA 3CMAP 4JF7A 3IF4A 2A45G 1PPJE 1N7SB 3VMXA 5KLVD 1BSNA 3M9BA 1OMIA 1T8ZA 1JO5A 2RN0A 2P10A 1IFNA 3O6QB 3FWNA 2POHA 3KYQA 2R3CA 3V4WA 5AVSB 3L35A 2FYNC 1Q90D 2GUVA 3IN6A 4PD4I 1ZLLA 3NFQA 1PIXA 2Y0EA 1VQPP 2YXRB 1YITP 1K9MQ 2RMZA 2HR3A 2HG5D 2A45I 3HUSA 5CMZA 1JOCA 1KYOH 1BDCA 4H44B 1XTCC 2AXCA 2Y0CA 3OJAB 4EIJA 2BASA 2FFDA 3I55P 1L0NJ 2B87A 3B5NC 2BCCG 2JP3A 2KK7A 3SWKA 4OH8B 3CC4P 3RL0B 1QVGO 2O1KA 3L37A 3QWOC 2O1JA 4YPCA 1G1JA 1SQQD 1IO4A 4U3FE 2ZYDA 1YHQP 3B8EB 4BXLA 1WRGA 5L8RJ 1M1JC 3LIEA 5AVZB 5AW3B 3BRVB 4IL6E 1LTGC 1RY3A 3L71J 4U7JA 3MGNA 1S5LH 3II6A 4WY4C 1SQXE 3B5NA 3W67A 5CJ0A 1KFMA 3CC2P 1LWUB 3ABVC 2H89C 4H44D 3CC7P 3RBZA 1RQUA 1VQ6P 1VF5D 1BDDA 4OGQC 1L0NG 2WPSA 1MZ9A 3T97B 3RK3E 2CPBA 3L70D 4N6JA 1PGJA 3SWFA 2P2UA 1KB9H 4WY4A 3RL0D 5E79H 3AE7C 4HB1A 3H32B 2KB7P 2WSEJ 4GT1A 2OYHA 1Q7YQ 2H7HA 3GG2A 1L4AC 1Y8AA 2FXPA 2V7QH 5AW9B 3L71G 1LT9C 1NTZJ 3V4QA 5KJ7D 1GW3A 1T3UA 3BATA 2HYNA 3P8CE 3JCUE 1NGMB 2FYUK 3CLQA 3L73J 1KQFB 1SQVJ 3N4XA 1LTIC 2IBZG 2QE7H 3GF3A 2YO3A 5APYA 2ZT9D 2GUSA 1L4AA 1LP1A 2IFMA 2Q1KA 4I7ZB 1S9KE 1JMBA 3KHUA 3H1IE 2FYNB 1LT9A 2K1AA 1KZUB 4RJTA 3BRTB 1PV3A 1EDIA 2LXCB 2IBZI 3M9QA 1OW8A 1GMJA 1NTZG 4DCKA 2KLUA 3AE3C 4AYCA 1FC2C 1KILA 1PP9D 3VMZA 3B5NB 1W2EA 3H1JE 3L73G 1GDTA 1ZXGA 1SQVG
chains in the Genus database with same CATH topology
3JSVC 3F89A 4BWNA 4OWFA 2ZVNB 2ZVOB 2V4HA 3FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV C;  3F89 A;  4BWN A;  4OWF A;  2ZVN B;  2ZVO B;  2V4H A;  3FX0 A; 
#chains in the Genus database with same CATH topology
 1BCC E;  3AEG C;  3CX5 D;  3BCC D;  2E76 C;  4TT3 H;  1RF1 C;  3OA7 A;  2A06 G;  1TU3 F;  3O8Z A;  2YNY A;  1SQP D;  2FYU J;  1M1J B;  2QEX P;  1DD4 A;  3KPE A;  1QEX A;  1KYO I;  3MUD C;  3VP8 A;  5AVY B;  3Q3D A;  2WQY C;  1EDJ A;  3CPW O;  2OQQ A;  2XZR A;  4ZNC A;  2QG4 A;  3CWB E;  3RL0 g;  3GLM A;  3H1K J;  5AW6 B;  1R8E A;  2BCC E;  4KJM A;  1LT1 A;  5B5E E;  1NHL A;  1AQ5 A;  1FS0 E;  2IPP A;  2N1T C;  3MUD A;  1S72 P;  2HFE D;  4PD4 H;  1J1D C;  2ZAE B;  2ZYG A;  3RK3 C;  2C9L Y;  2FYU G;  1GD2 E;  1RF0 C;  2A45 H;  1HJB A;  1H8A A;  1SFC C;  1ZOY C;  2J5U A;  2WSS H;  5BU5 A;  1SQB D;  2HLO A;  1IFJ A;  5AW2 B;  1HBW A;  2Q9I A;  2Q6Q A;  1JM0 A;  3WUV A;  2K37 A;  2OTK E;  1HJ0 A;  1ZR4 A;  2J58 A;  2N1T A;  2K9J A;  5CHX A;  3EWK A;  5APQ A;  3H1K G;  3HE4 B;  2H88 C;  1DX7 A;  3CL3 D;  5APV A;  5TIS E;  1X0T A;  4I2L C;  1CI6 B;  1GW4 A;  1SFC A;  3IFM A;  1IJD B;  1FZC C;  1FOS E;  3AED C;  4K3A A;  2C0W A;  5CCH D;  1N8R Q;  1JY2 P;  2BEZ F;  1YTZ T;  3FXE A;  2NPS C;  1FDO A;  3L71 E;  5EFW B;  2JWA A;  1HTL C;  4CPG A;  2MKV A;  1ZP0 C;  3OW2 O;  1N73 C;  1JEK A;  2FYZ A;  2ITA A;  2WIT A;  1FZC A;  1DH3 A;  2W6B A;  4JYB A;  3SSU A;  1E5W A;  1KFN A;  2E43 A;  1JMM A;  1NTM E;  1M57 D;  3H1I J;  2VRS A;  3CI9 A;  2E76 B;  1RF1 B;  2AEF A;  4UB6 E;  5CCG C;  2ZJS E;  5GTI E;  3N7N A;  2NPS A;  3FX0 A;  1GL2 C;  2WWW A;  1NTK D;  3PP5 A;  3ITK A;  1YYC A;  2O3J A;  1N73 A;  1MV8 A;  1X22 A;  4KT0 J;  4HYT B;  1PPJ D;  1KTM A;  4AQR D;  3KZI E;  3L36 A;  2Y9Y A;  4OVN F;  1JB0 J;  2KOG A;  1ZR2 A;  3H1J J;  3WUT A;  4R4M A;  2Q3I A;  5CCG A;  5H2F E;  4ASW A;  1BCC J;  1OVU A;  3C9I A;  4RO0 A;  2E5Y A;  3M9H A;  2E75 D;  3L73 E;  1BE3 D;  4ASV A;  3PLN A;  2KSJ A;  4B86 A;  5APT A;  1L0L D;  1HVV A;  3WU2 H;  2KNC A;  2N1T B;  3H1I G;  2IYP A;  2A06 E;  3C1L A;  2M0B A;  1KC8 Q;  3A0H E;  3CCM P;  1KB9 D;  4AUW A;  1FJP A;  1J1D B;  1PL5 A;  3U59 A;  3GF7 A;  1IC2 A;  1DIP A;  4XE5 B;  3VTP C;  3RK3 B;  3HE5 B;  1OZH A;  2KIK A;  2QM8 A;  2IDB A;  2RKL A;  4HKZ H;  4WWI A;  1SFC B;  3AE5 C;  2M8R A;  4W7Y A;  4LC1 A;  1D7M A;  3E7K A;  1GZL A;  1JTH A;  1SVF A;  1VQK P;  3CWB J;  2OGU A;  3HUS C;  1VQM P;  4U3F D;  1KQG B;  2KS1 A;  2BCC J;  1KIL E;  1K05 A;  1ZRT D;  2WMM A;  3L74 D;  3H1J G;  4W80 A;  3IAO A;  5CBN A;  1GU5 A;  3SWY A;  1BCC G;  1GU4 A;  2WSE H;  1OFC X;  1HGZ A;  2G8Y A;  2FFD C;  4EOT A;  1M7L A;  3HTK B;  3I5C A;  4TLF A;  1AA0 A;  3AEB C;  1URQ C;  1FZC B;  3AEE C;  2QVA A;  3A3Y B;  2QSI A;  5H2F H;  3A0B E;  4JYC A;  3H1L E;  2FYU E;  1LGH B;  1NTM K;  3AE9 C;  1IFP A;  4YXD C;  3IR9 A;  1OX3 A;  1YTZ I;  1Y47 A;  2NPS B;  3BCC J;  4JPZ B;  3L72 D;  1AVO A;  3CME P;  1YQ4 C;  2B9B A;  5TJH A;  3A0H H;  4DZO A;  1EZV E;  1N73 B;  3CWB G;  1JY3 O;  1VQN P;  2XND H;  1A02 F;  5KAF E;  2P7J A;  1URQ A;  1NYH A;  3EQ2 A;  3AEA C;  3H1K E;  4RKU J;  1Z56 A;  2JJL A;  3NXS A;  2JEE A;  1N7S D;  3C8V A;  2W83 C;  1RHZ B;  2W8Z A;  3E1I A;  1FDM A;  1GL2 B;  3H1H J;  1AJY A;  3V5B A;  2HPC A;  4LLH A;  1U7M A;  4PJ0 E;  3S9O A;  3I56 P;  3HD7 C;  1T6A A;  3MIW A;  4D6T D;  2Y9Z A;  5KLI C;  5CJ4 A;  1FU1 A;  5KLV E;  2YXQ B;  5AW4 B;  3GHG B;  2NRG A;  3BCC G;  2OYH C;  5DJT B;  4K35 A;  2O01 N;  1YJN P;  2QJK C;  3E1R A;  1VQ5 P;  4IOI H;  5AW0 B;  5AW7 B;  2GA1 A;  3A0B H;  1NTM J;  2JDI H;  2WPR A;  1PGO A;  4BWN A;  5AVX B;  1DEB A;  1IFM A;  2KZJ A;  3HD7 A;  1NU1 K;  1G2C A;  5M1B A;  3AEF C;  3L75 D;  3TF5 A;  4PD4 D;  2ZVN B;  3H1H G;  3TGU J;  2WT7 A;  4ZKP A;  2WSF J;  1VL2 A;  2M5A A;  4EYY Q;  4L73 A;  1GTW A;  1SP4 A;  2QJY C;  4LGD E;  1IFD A;  4M3L A;  2LKM A;  3W68 A;  3Q5S A;  2J59 M;  4RES B;  3HUS B;  3JSV C;  1HWT C;  2CK3 H;  1FZG A;  1FZE A;  1AV1 A;  4PJ0 H;  3RBX A;  3NTN A;  4IL6 H;  1OVV A;  1NTM G;  2KUB A;  2YMY A;  1JCD A;  2FFD B;  1OW6 A;  5KAI E;  1N86 A;  1L0L K;  1KIL C;  2WTY A;  2B87 B;  2YKO A;  1IZN B;  1JY2 N;  2C9N Y;  1BGY D;  1URQ B;  2WSC J;  2E74 C;  2HOD A;  3VMA A;  3MHV A;  2P1J A;  4KHX A;  3TGU G;  5BU8 B;  2D2C C;  1LJ2 A;  1NU1 J;  2YMK A;  2QJP C;  1NAY A;  3RGU A;  1KD1 Q;  3L70 E;  2DW3 A;  2HPC B;  3WMM 0;  4PV1 C;  3R2P A;  4NPF X;  1VQ9 P;  1EDL A;  2H8P D;  3HRN A;  2G3A A;  4H0L C;  5KLV K;  4BRY A;  1PZQ A;  4N78 E;  3BAS A;  2Y0D A;  3S1K A;  1YI2 P;  1RE4 A;  1PFI A;  3H1L J;  3JCU H;  1E79 H;  3KQG A;  1RQV A;  1YIJ P;  2FKW B;  2WVR A;  1S2E A;  2FXO A;  1X8Y A;  2JR8 A;  1W5C E;  4WY4 B;  1L0N D;  1L0L J;  2KYV A;  1NU1 G;  5KAI H;  2IZ0 A;  1ZW0 A;  4H13 C;  2OYH B;  2QIW A;  2KI7 B;  2QJK B;  4OWF A;  4OGQ B;  3VMY A;  2IFN A;  1SS1 A;  2ZXE B;  2OYI C;  3K5B A;  2AXT E;  2P58 A;  1H89 A;  3BVH A;  1Q81 Q;  3S4R A;  3B5N D;  1SQQ K;  1KQS O;  1OIP A;  4MN4 C;  2PGD A;  3CCS P;  2QRX A;  1P84 I;  4Y99 C;  3H1L G;  4GIF A;  1L4A B;  1LP1 B;  2K9Y A;  5KLV J;  1HH0 A;  1K8A Q;  1LT9 B;  4GKG A;  2IBZ D;  2QJY B;  5APX A;  3CX5 E;  2OYI A;  3BCC E;  1L0L G;  1EZV G;  2B89 A;  3D6Y A;  4WY4 D;  3AE8 C;  1RH5 B;  3TNU A;  3KXD A;  1QGK B;  1G1I A;  2YKQ A;  1KV4 A;  1NO4 A;  4C46 A;  3M0D C;  4OGQ D;  5DJU B;  3G4S P;  3LW5 J;  1KIL B;  2KXP B;  5AW5 B;  1S5L X;  2FBW C;  1HGV A;  1LTS C;  1JNM A;  1EZV I;  2E74 B;  1NTZ D;  1LTJ A;  4GOD A;  3H6P A;  2L91 A;  1IFI A;  3H1H E;  2R5D A;  1UIX A;  5B5E H;  2O01 J;  3M0A A;  1KYO D;  5KLV G;  2D2C B;  1USD A;  2AXT H;  3L73 D;  2QJP B;  1FDI A;  1SQQ J;  1SQV D;  4GDO A;  1L4A D;  1UII A;  2FXM A;  1MFT A;  2W6A A;  3M0D A;  3VOP A;  3CXH E;  2A06 D;  2E42 A;  3EFG A;  3F89 A;  1N7S A;  2ZVO B;  1VF5 C;  1LTT C;  3PJS K;  4UB8 E;  2KSE A;  2KP8 A;  1QLE D;  2SPZ A;  1SQB E;  1IK9 A;  2AEM A;  2OYO A;  4L74 A;  3AE2 C;  1EDK A;  2W6J H;  4NPD A;  4Z1M H;  1LTB C;  3QH9 A;  2XKM A;  3A2A A;  3CCE P;  1FJK A;  1KIL D;  3KDP B;  4GOF A;  3TGU E;  3L70 J;  5TIS H;  3MD0 A;  2M3E A;  5KJ7 C;  4H13 B;  3MTU E;  4C7R A;  1SQQ G;  2C0X A;  2D2C D;  2P67 A;  3L75 J;  3LID A;  2PFX A;  2OTJ P;  1LNQ A;  2FYU D;  4YXW H;  3EFF K;  1J1E C;  2ZT9 C;  3M06 A;  1NOH A;  4D6T G;  1H88 A;  2K9J B;  1MKM A;  1K73 Q;  3TNU B;  3F5H A;  1M8O B;  3B4S A;  2E76 D;  2QA4 P;  5KJ7 A;  3CXH H;  1SQP K;  4I6M C;  1L2P A;  4Y99 B;  2BEQ D;  4EDF A;  3V2P A;  2E5T A;  1MFZ A;  3FXD A;  1NJI Q;  3P7K A;  3AE6 C;  2R32 A;  3H1K D;  1LWU A;  3L70 G;  4UB6 H;  5GTI H;  1NU1 E;  1GK6 A;  4WVZ A;  1N2D C;  1P84 E;  1VQ7 P;  4ZMD A;  1BGY J;  4DJG A;  2M3B A;  1CW5 A;  2I8D A;  3T97 A;  3L75 G;  1WT6 A;  3R4Y A;  4N3Y B;  3KZI H;  1U7J A;  2GM4 A;  2Z5I A;  3M91 A;  2WSF H;  1SQX D;  1M1K Q;  1K04 A;  5KTB A;  3H32 A;  4QMA A;  1S5L E;  2N9Y B;  2N1T D;  1VQ4 P;  4I7Z C;  1PP9 J;  5K5G B;  4L76 A;  1FZB A;  2XDJ A;  3CD6 P;  3RK3 D;  1SQB K;  1BE3 E;  2ZFC A;  3V2Q A;  1DD3 A;  1YJ9 P;  4C7N A;  1SFC D;  1L0L E;  1CZQ A;  3TYY A;  1ZME C;  3SFD C;  1SQP J;  1AVY A;  4IFM A;  1BGY G;  3RK2 C;  2WSC H;  1VF5 B;  1KB9 E;  3NMD A;  1VQ8 P;  5E79 E;  3Q5P A;  1KOR A;  3CCJ P;  2JKV A;  2YO2 A;  3PHL A;  3TDK A;  5AVR B;  1P84 H;  5APS A;  3L4F A;  2YKP A;  3FWL A;  2KZI A;  3P8C D;  1NTZ K;  2KNC B;  3A5T A;  1OXZ A;  1QL1 A;  2K88 A;  1PP9 G;  1ZRT E;  3L74 E;  3CCU P;  2B88 A;  3USS A;  4XA4 A;  1FZA A;  1VDF A;  3Q1M A;  1SQV K;  2V4H A;  1S9K D;  2NPS D;  2YIU C;  3H1I D;  1SQP G;  1USE A;  3AE1 C;  1JTH B;  2AEJ A;  3FGA D;  1HUC A;  2PAJ A;  2RH0 A;  1SQB J;  1VQO P;  2KS1 B;  1J1E B;  2ZT9 B;  3JC2 2;  1W2B O;  5AW8 B;  3WUU A;  3CX5 I;  1YQ3 C;  1M1J A;  2Q7C A;  3VYI A;  5CCH C;  3L72 E;  4WB4 A;  1NTK K;  5CCG D;  5KAF H;  5AVW B;  1GL2 D;  3H1J D;  5KKZ C;  1NWQ A;  1PGP A;  1PGQ A;  2I1J A;  1BCC D;  1S3J A;  2WPQ A;  4N78 D;  1SQQ E;  4L75 A;  4ZKU A;  3D70 A;  2XNX A;  2PRR A;  1JY3 P;  5CCH A;  3CCQ P;  4C7N B;  3G6E P;  4A7P A;  2W90 A;  4D6T E;  1SQB G;  4DOJ A;  1KQL A;  1FAV A;  3CXH I;  1AQT A;  4JQ0 D;  1J2J B;  5BVZ A;  1A02 J;  4W7Z A;  3G9R A;  3CWB D;  1RE4 C;  1QVF O;  2BCC D;  5APU A;  2ZYA A;  3OAK A;  3LW5 H;  1NTK J;  1DEE G;  3RK2 B;  3HE4 A;  5AW1 B;  2E75 C;  2UWJ E;  3L75 E;  4O9B A;  4PD4 E;  1H0T A;  2KLV A;  1CI6 A;  1T2K C;  2O01 H;  3V2R A;  3CCR P;  1FZF A;  5APW A;  1SQX K;  3PTZ A;  4HJG H;  1WMK A;  3HD7 B;  1S4X A;  1OWA A;  1U57 A;  3AE4 C;  3CCV P;  1R5S A;  2OAR A;  1G2C B;  1URQ D;  1JY2 O;  1BE3 J;  5KLI B;  1M56 D;  1OW7 A;  1RE3 C;  1NAF A;  2WT7 B;  1EC5 A;  2WPV B;  1Q86 Q;  2YIU B;  4EI2 A;  1JCC A;  2M5A B;  5GTH E;  1EXJ A;  2MJZ A;  1BGY E;  3CCL P;  3SFE C;  1NTK G;  4HH2 A;  3D71 A;  1AFO A;  3H1H D;  1RF1 A;  2CPS A;  1PPJ G;  3RK2 D;  2V7Q J;  3L71 D;  2JWD A;  1S1C X;  1LTA C;  4U3F J;  2Z5H A;  3VP9 A;  2JO1 A;  2N9B A;  3L74 J;  1KMI Z;  1RE3 A;  3CXH D;  1X79 B;  3MZW B;  1JUN A;  1PP9 E;  1NVO A;  5KKZ B;  1BE3 G;  1M90 Q;  3Q2Y A;  1IK7 A;  1LTJ C;  2LR2 A;  1NTM D;  2HOD B;  3HD7 D;  1Q2N A;  2Z4E A;  1SQX J;  3A7O A;  2PP6 A;  1BSH A;  1SQP E;  2FY8 A;  1CSB A;  1HF9 A;  4XFJ A;  3P32 A;  4I1L A;  5AVV B;  2ZXX A;  3PH0 A;  3TGU D;  1N7S C;  3TSI A;  1VPC A;  3L72 J;  2NZ2 A;  1L0N E;  1ZV8 A;  2Q5U A;  5AVU B;  4BRY B;  5B66 E;  1QL2 A;  4U3F G;  1RF0 A;  3HE5 A;  4GOE A;  1H0T B;  5GTH H;  3GMA A;  1KB9 I;  3L74 G;  1T3J A;  3V2N A;  4JBZ A;  1YBK A;  3MP7 B;  1FE6 A;  2R44 A;  5AVQ B;  4R4L A;  4H44 C;  1GK4 A;  4PV1 B;  3G3Z A;  3H25 A;  2LXB A;  1SQX G;  3WU2 E;  4H0L B;  2E75 B;  1X9V A;  4D6T J;  3O6Q A;  1EXI A;  1Q82 Q;  2I1K A;  2W27 A;  2WZ7 A;  3HTK A;  3TK1 A;  3CX5 H;  1MUU A;  3PRJ A;  3V6I A;  3U1A A;  3RL0 C;  2IBZ E;  3L72 G;  2Q3E A;  3U1C A;  1NU1 D;  4NPE A;  3D6Z A;  3B71 A;  1VQL P;  1P84 D;  2OTL P;  4DT0 A;  1XTG B;  2K3R A;  4Y28 J;  2L5G B;  2R5B A;  2E74 D;  3Q5R A;  1SLQ A;  2XU6 A;  2IZ1 A;  4WBA A;  5C39 A;  4IL6 X;  2H43 A;  4YTP C;  1NH4 A;  1FOS F;  5CBO A;  5B66 H;  1EQ7 A;  1LWU C;  3GHG C;  1NTZ E;  2OYI B;  3H1L D;  4PV1 D;  3VN0 A;  1QX8 A;  1KN7 A;  4H0L D;  1KYO E;  1GL2 A;  1Y9B A;  1ZN5 A;  1SQV E;  1N7L A;  2IX7 C;  1T2K D;  1EZV D;  4UB8 H;  2QM7 A;  5AVT B;  3P8M C;  3AEC C;  3GHG A;  1L0N K;  1LTJ B;  2R3S A;  3GW6 A;  1OVR A;  4IFD K;  3ZDM A;  1JY3 N;  1NKZ B;  2XV5 A;  1R5L A;  3UIA A;  4IFF A;  3G71 P;  4H13 D;  1FBM A;  1YJW P;  1NTK E;  2IYO A;  1NKN A;  3CMA P;  4JF7 A;  3IF4 A;  2A45 G;  1PPJ E;  1N7S B;  3VMX A;  5KLV D;  1BSN A;  3M9B A;  1OMI A;  1T8Z A;  1JO5 A;  2RN0 A;  2P10 A;  1IFN A;  3O6Q B;  3FWN A;  2POH A;  3KYQ A;  2R3C A;  3V4W A;  5AVS B;  3L35 A;  2FYN C;  1Q90 D;  2GUV A;  3IN6 A;  4PD4 I;  1ZLL A;  3NFQ A;  1PIX A;  2Y0E A;  1VQP P;  2YXR B;  1YIT P;  1K9M Q;  2RMZ A;  2HR3 A;  2HG5 D;  2A45 I;  3HUS A;  5CMZ A;  1JOC A;  1KYO H;  1BDC A;  4H44 B;  1XTC C;  2AXC A;  2Y0C A;  3OJA B;  4EIJ A;  2BAS A;  2FFD A;  3I55 P;  1L0N J;  2B87 A;  3B5N C;  2BCC G;  2JP3 A;  2KK7 A;  3SWK A;  4OH8 B;  3CC4 P;  3RL0 B;  1QVG O;  2O1K A;  3L37 A;  3QWO C;  2O1J A;  4YPC A;  1G1J A;  1SQQ D;  1IO4 A;  4U3F E;  2ZYD A;  1YHQ P;  3B8E B;  4BXL A;  1WRG A;  5L8R J;  1M1J C;  3LIE A;  5AVZ B;  5AW3 B;  3BRV B;  4IL6 E;  1LTG C;  1RY3 A;  3L71 J;  4U7J A;  3MGN A;  1S5L H;  3II6 A;  4WY4 C;  1SQX E;  3B5N A;  3W67 A;  5CJ0 A;  1KFM A;  3CC2 P;  1LWU B;  3ABV C;  2H89 C;  4H44 D;  3CC7 P;  3RBZ A;  1RQU A;  1VQ6 P;  1VF5 D;  1BDD A;  4OGQ C;  1L0N G;  2WPS A;  1MZ9 A;  3T97 B;  3RK3 E;  2CPB A;  3L70 D;  4N6J A;  1PGJ A;  3SWF A;  2P2U A;  1KB9 H;  4WY4 A;  3RL0 D;  5E79 H;  3AE7 C;  4HB1 A;  3H32 B;  2KB7 P;  2WSE J;  4GT1 A;  2OYH A;  1Q7Y Q;  2H7H A;  3GG2 A;  1L4A C;  1Y8A A;  2FXP A;  2V7Q H;  5AW9 B;  3L71 G;  1LT9 C;  1NTZ J;  3V4Q A;  5KJ7 D;  1GW3 A;  1T3U A;  3BAT A;  2HYN A;  3P8C E;  3JCU E;  1NGM B;  2FYU K;  3CLQ A;  3L73 J;  1KQF B;  1SQV J;  3N4X A;  1LTI C;  2IBZ G;  2QE7 H;  3GF3 A;  2YO3 A;  5APY A;  2ZT9 D;  2GUS A;  1L4A A;  1LP1 A;  2IFM A;  2Q1K A;  4I7Z B;  1S9K E;  1JMB A;  3KHU A;  3H1I E;  2FYN B;  1LT9 A;  2K1A A;  1KZU B;  4RJT A;  3BRT B;  1PV3 A;  1EDI A;  2LXC B;  2IBZ I;  3M9Q A;  1OW8 A;  1GMJ A;  1NTZ G;  4DCK A;  2KLU A;  3AE3 C;  4AYC A;  1FC2 C;  1KIL A;  1PP9 D;  3VMZ A;  3B5N B;  1W2E A;  3H1J E;  3L73 G;  1GDT A;  1ZXG A;  1SQV G; 
#chains in the Genus database with same CATH homology
 3JSV C;  3F89 A;  4BWN A;  4OWF A;  2ZVN B;  2ZVO B;  2V4H A;  3FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...