5KLVK

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
LTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5klvK00
2WSFH 1SQVK 2WSCH 1NTZK 2LKMA 2OARA 1SQBK 1NU1K 2O01H 3G3ZA 2J59M 1NTMK 3CLQA 2WSEH 5KLVK 2FYUK 1L0LK 4IFDK 1L0NK 1SQQK 1SQXK 1SQPK 1NTKK 3LW5H 3M9QA
chains in the Genus database with same CATH superfamily
1BGYD 3M91A 4HH2A 3RK2B 3H1KG 2UWJE 2I1KA 2C0WA 3AE9C 3M9HA 2HPCA 3O6QA 1PGJA 5AVYB 1E5WA 2MJZA 2YNYA 3L75E 4JF7A 4OGQD 3S1KA 2ZT9B 2J58A 2QA4P 1A02F 1CI6B 1VPCA 1N86A 3H1LJ 3D6ZA 2N9YB 3RL0D 1L0LJ 2BASA 1BGYJ 1JY3O 2O01N 2W8ZA 3IFMA 5TJHA 1EZVE 2HYNA 1QL1A 4H44C 2IBZG 3CX5E 2D2CD 2POHA 3HRNA 4GKGA 3KQGA 3BASA 3WUVA 4L74A 4HB1A 4LLHA 1VDFA 1RE3A 4XA4A 1AFOA 2KZIA 4U3FE 3SSUA 2H43A 1NU1D 1FDOA 1PV3A 3H1IJ 2FXPA 2ZXEB 1ZRTD 4QMAA 5M1BA 4RESB 3FX0A 1DIPA 1Q86Q 5AW7B 1PP9D 2LR2A 2KS1B 4H44B 2OYIA 2BEZF 5AW1B 3L70J 1N73B 1HWTC 2O1KA 2K9JB 1S3JA 2E75B 4N78D 5CMZA 3TK1A 1NJIQ 3CXHH 1LTJC 1H89A 3PHLA 2SPZA 2XNXA 1N7LA 5GTIH 3HD7D 3KXDA 1YQ4C 1GK4A 2K88A 1SQXG 1BE3D 4HJGH 1NGMB 2LKMA 2C0XA 4W7YA 2YXRB 3BCCD 5CCGC 1SVFA 1H8AA 1NTZJ 3CWBJ 1KZUB 1BCCG 1UIIA 4OH8B 5B5EE 3H1JD 3AE7C 2W90A 3RBXA 2W27A 3V4WA 3WU2H 3AEBC 2KK7A 3EFGA 1S4XA 3AE5C 4LC1A 5CCGA 3I56P 4O9BA 1EDJA 2FYUK 3GHGA 1L0LK 3L74E 1XTGB 3L73G 5GTIE 1HGZA 5KAFE 3L71E 3A5TA 2BEQD 4JYCA 4WWIA 1NTZE 2QVAA 3L74J 4NPDA 1P84H 3HUSC 2E75C 1HTLC 3H1ID 3P7KA 3R4YA 3L71D 4PD4H 1N73C 4KJMA 1HBWA 1L2PA 4JYBA 1LP1A 1M7LA 3W67A 3CC4P 3M9QA 2VRSA 2P2UA 3RL0C 5K5GB 3CCJP 1P84D 1KB9D 4MN4C 1S5LE 2DW3A 5KLIB 1NU1J 1RE4C 1SQPE 1X22A 2AXTH 1L0LD 1MKMA 3II6A 4M3LA 3TSIA 3L72J 1OVUA 4TT3H 1VQOP 1YYCA 3L70G 1D7MA 4EI2A 4WVZA 3CXHE 1OIPA 1SFCA 2YMYA 4A7PA 4CPGA 2XV5A 2ZT9D 1FOSF 1AQ5A 3IR9A 4WY4A 1VQ8P 1PGPA 1N8RQ 1JY2O 1SQQJ 2FY8A 2RN0A 2R5DA 1URQC 1SQPJ 1L0LE 1VF5D 2KNCA 1IC2A 1SQPD 2ZJSE 3MP7B 3PTZA 4N78E 2E76C 1VF5C 5H2FH 3RK2C 2NZ2A 4ZMDA 2ZXXA 5KTBA 1S72P 3V4QA 1SQVJ 1WMKA 2W6BA 2WWWA 2JDIH 1N7SC 1YIJP 3SWKA 4BXLA 2N1TA 4GOFA 2P7JA 3L37A 3V2QA 3L73J 2A06D 2O01J 3VP9A 2WSSH 1NTZK 2YIUB 3NTNA 4GOEA 4DOJA 5KLVE 1LTGC 2R44A 2E43A 1XTCC 3EQ2A 1OW8A 3PH0A 4Z1MH 2AXCA 2B87B 3L74D 3L71G 1YJWP 1JB0J 4D6TG 2L91A 3CCRP 1AV1A 2XZRA 3KZIE 4L75A 4ASVA 1ZN5A 5KAIE 1LTAC 1BGYE 1HJ0A 1S5LH 4YXDC 1PFIA 1MFZA 5H2FE 3BCCE 3H32A 1K9MQ 1VQPP 2KP8A 1T2KD 1QEXA 2P58A 3U59A 1NTZD 5AVTB 3E7KA 4YPCA 4C46A 4H0LD 1OWAA 2M8RA 2XU6A 1N7SB 2IPPA 2OTJP 1X8YA 1RF1B 2OYHA 2K9YA 3FXDA 4L73A 1PP9E 4KT0J 1SQPG 3AEEC 1SQBE 1NTKG 3KYQA 1SFCB 5AVUB 2KXPB 2QE7H 3HTKA 3JCUE 1SQXE 1KILC 1LT1A 4HYTB 1SQVG 2JEEA 4U3FG 4NPEA 3GHGC 1LT9A 1GL2D 1SQBD 2C9LY 1NVOA 1EZVD 5APSA 1KQLA 1BDCA 3H1HJ 4DZOA 3L36A 1KORA 1YJ9P 1IK7A 1W5CE 1S9KE 1GL2B 1L0NK 2ZYGA 3L4FA 3L74G 1LTJA 1S2EA 1ZRTE 4WBAA 1NKZB 3Q5PA 1NTMD 2RKLA 1FZEA 4IOIH 1IFPA 5EFWB 3O6QB 1LGHB 1FAVA 2H89C 2KOGA 1BCCE 2Q1KA 2FYUD 3LW5H 1FZGA 3VOPA 1ZP0C 1CI6A 4WB4A 3H1JJ 4AQRD 2KYVA 1M1JC 3L72E 2WVRA 2WZ7A 1NU1G 3NMDA 4W80A 5AW6B 3IN6A 4WY4D 2WPQA 2KLVA 1IO4A 3L72G 1NKNA 2NPSC 2WT7A 2FXOA 1DX7A 3VP8A 1S5LX 2H88C 2IYOA 2O01H 2NRGA 1VQ7P 2K1AA 1PIXA 1SQQE 3H1LG 1CZQA 1LTSC 1NTMK 1KYOD 1OXZA 2KUBA 1BGYG 3USSA 1S1CX 2P10A 3TGUE 2QRXA 3H1KD 3LIDA 3PLNA 3RBZA 2ITAA 3TDKA 1ZR4A 1FE6A 3H1HD 2GA1A 3P8CD 3TGUJ 5BVZA 3AECC 3V5BA 2K9JA 2N1TD 2Q5UA 1SQQK 5KJ7A 3FWNA 5CJ4A 1KYOH 1HJBA 1H0TA 2Q3IA 5KJ7C 3Q2YA 5AVVB 1GDTA 2GUVA 2YKPA 2IBZD 2KIKA 3CX5H 2OYOA 1GW3A 1MV8A 2LXCB 3HTKB 2Y0CA 5B66E 1GMJA 1K05A 1RY3A 2W83C 4IL6E 1KILE 1FDMA 2XKMA 2M0BA 3PRJA 1EZVI 2CPSA 3GG2A 1LNQA 1USEA 3FXEA 4R4MA 2NPSB 1JY3P 1JY3N 3LW5J 4RKUJ 3RK3E 1SQBK 1VQ6P 3OAKA 5KLVJ 3CCLP 1P84E 1L0NE 2FYUG 3MHVA 4UB8E 2XDJA 3TNUB 2YO2A 2V4HA 5E79E 3AE8C 3GF7A 1FZCC 1GW4A 1L0ND 1Q2NA 2WSEH 3GW6A 1URQB 3H1IE 1NYHA 3CXHI 3ITKA 3D71A 1U57A 1RF0A 1UIXA 4ZNCA 1GL2C 1FZFA 5B5EH 2D2CC 2IFMA 5AW8B 1YTZT 2JJLA 3NFQA 1KMIZ 4I6MC 1JM0A 1K04A 2PRRA 3QH9A 1JNMA 3VMAA 1ZMEC 1DEEG 2G3AA 1KFMA 1PP9J 3SWYA 3CCQP 1ZV8A 3HE5B 4RJTA 2L5GB 3TGUG 3L73D 3CWBE 3LIEA 5B66H 1NOHA 3SFDC 2KI7B 2Z4EA 1HH0A 2WSCH 1LT9C 4K3AA 1FU1A 4JQ0D 3D70A 1RQVA 1NWQA 1IFNA 1QGKB 1KB9I 1PPJD 4I7ZB 5AVQB 4WY4B 2FYZA 1VF5B 1VL2A 1U7MA 2M5AB 1OZHA 3H1IG 3MUDA 4UB8H 5C39A 1BE3E 2I8DA 3L75G 2JO1A 3H1HE 4XFJA 3AE4C 3A3YB 2QJPC 3FGAD 3TF5A 1T2KC 1FZCB 2OYHB 2A06G 2IDBA 1DD4A 3I5CA 5DJTB 3V6IA 1SQQD 2FKWB 1TU3F 1J1EB 1M8OB 2Y0DA 1JY2N 1JY2P 1N2DC 1GK6A 1SQXJ 1Q81Q 1SP4A 5CCHD 4PD4D 3IF4A 2O1JA 2IYPA 1M1JA 1BCCJ 1RE3C 5E79H 2E5TA 1EXIA 2ZYDA 4Y99B 1GL2A 4GODA 1X9VA 1KQGB 2K3RA 1LTJB 2ZAEB 3BRTB 1RF0C 3L70E 5KKZC 2B87A 1DEBA 3CI9A 3CX5D 2H8PD 3L35A 1NAYA 3K5BA 2Z5IA 3RK3C 1M90Q 1KD1Q 1SQVE 2ZYAA 2IZ0A 1LP1B 1ZOYC 1USDA 2JKVA 3M0DA 4Y99C 2PAJA 2WPRA 1VQKP 3AE3C 2WPVB 2J59M 2ZVOB 1PP9G 3B5NB 2E76D 3MZWB 1LTTC 1T3JA 2A45I 1J1DC 2YKQA 2XNDH 1P84I 3AE1C 2WT7B 3G71P 1URQD 4C7NA 3CX5I 1N7SA 1QL2A 5CJ0A 1PPJG 3UIAA 2W6JH 3ZDMA 3D6YA 1RF1A 1IFMA 2ZT9C 4PJ0E 3S4RA 1SQXD 1PPJE 1BE3G 4ZKUA 3N7NA 1JUNA 2KB7P 3AEGC 3AE6C 4PD4E 1BSHA 1G2CA 1X0TA 2KNCB 2NPSD 1ZLLA 5BU8B 1JEKA 1RF1C 2M5AA 1EDLA 2KSJA 1SQVK 2JWAA 4AUWA 2FXMA 4UB6E 3WUTA 3HD7C 3Q5RA 1VQMP 2E42A 5CHXA 3CMAP 5AVSB 5KLVG 5APUA 2WSCJ 1RE4A 2WITA 1JTHA 2FYNC 4OVNF 1KQFB 1SQBJ 1RH5B 1SLQA 2CPBA 2KLUA 1HGVA 3CWBG 3R2PA 3W68A 1K73Q 1JO5A 3ABVC 2I1JA 1GU4A 3H1KJ 3L73E 1L0NJ 3HD7A 4KHXA 2P67A 2YXQB 2QM8A 1M1JB 3A0BH 3AEFC 3IAOA 5APYA 5AVWB 3U1AA 4BRYA 4DJGA 3VN0A 3HUSA 1HF9A 1SQVD 1NTKE 3H1LE 3H1LD 1L0LG 4C7RA 2A06E 3VMZA 1OX3A 1KILD 1URQA 2N9BA 2QJYC 2G8YA 3KDPB 3A0HE 3PP5A 4IFMA 5GTHH 1SS1A 1JOCA 5APQA 4D6TJ 2KZJA 5AW9B 2P1JA 2BCCJ 2J5UA 3M06A 4PV1B 2Q6QA 3OJAB 2YIUC 1FOSE 1LWUA 1ZW0A 3B5NA 1YITP 1BE3J 2YO3A 1NTMG 1FS0E 2QEXP 3CD6P 2AEMA 2IZ1A 4ZKPA 2QJYB 1YHQP 4C7NB 2HODB 3KZIH 2FFDB 4GT1A 2WSFJ 3HE4A 1DD3A 2QG4A 3G3ZA 4H0LC 3S9OA 3CMEP 3U1CA 1FJPA 3F5HA 2B89A 1SFCC 1JCDA 4N6JA 2KS1A 2OYIB 4AYCA 2OTLP 1N73A 1Y8AA 2B9BA 3MD0A 3RK3B 2W6AA 1T3UA 1AQTA 4H44D 1Z56A 2HR3A 2M3BA 1J2JB 2BCCE 1L4AA 3SFEC 1FZBA 1FBMA 1QLED 1SQXK 2FYNB 4LGDE 3V2PA 2RH0A 3C9IA 2YKOA 1IK9A 2E5YA 2PGDA 5CBOA 1L0NG 2FYUE 1E79H 2Y9YA 2JWDA 1OW7A 5AW5B 3V2RA 1OVVA 3Q3DA 2HFED 1LJ2A 1KYOE 3H6PA 4GIFA 4K35A 4W7ZA 4BWNA 3AE2C 1N7SD 1HVVA 1Q82Q 3FWLA 3HD7B 5CCHA 4OGQB 3C1LA 3CCUP 3BCCJ 1OFCX 1AA0A 3P32A 4BRYB 1M1KQ 3T97A 1PGOA 2LXBA 2HPCB 2FYUJ 3HUSB 2M3EA 3MGNA 3RK2D 3M0DC 2ZFCA 1ZR2A 3B5ND 3M0AA 5APWA 3H1JE 4PD4I 4DCKA 1GD2E 1K8AQ 1KFNA 1NTMJ 3BRVB 3G9RA 1T6AA 3VMXA 1PGQA 2HG5D 3F89A 3HE5A 1EQ7A 3B5NC 5GTHE 3CCVP 3WU2E 1IFIA 2OYHC 2PFXA 1HUCA 1ZXGA 1SQPK 1Y9BA 2D2CB 1NTKK 3GMAA 1L4AC 1SQQG 2B88A 2Y0EA 1EZVG 2QM7A 1H88A 4EYYQ 2HODA 2H7HA 2OGUA 3VTPC 2FFDA 3GLMA 1JCCA 3HE4B 2OYIC 5TISE 3CC7P 2QSIA 1FZCA 3Q5SA 1VQ5P 2IX7C 1RQUA 1NU1E 3E1RA 1G1IA 2K37A 3N4XA 1QX8A 1EC5A 1JMBA 2AEJA 1X79B 2R32A 3JSVC 1VQ4P 3VYIA 2FFDC 4ASWA 1KN7A 4H13C 2WTYA 2NPSA 2OTKE 2V7QJ 3MUDC 3PJSK 1A02J 4RO0A 2PP6A 1R5SA 5CBNA 1OMIA 1T8ZA 5KLVK 2Q9IA 1OVRA 5APVA 2YMKA 2JP3A 2E76B 3H25A 3B4SA 4XE5B 1JMMA 1AVOA 3L72D 3BVHA 1RHZB 3BCCG 4H13B 3WMM0 1OW6A 1KB9H 3L70D 2Y9ZA 1EDKA 1IFJA 1FZAA 1NAFA 2RMZA 3MIWA 2R3SA 1BSNA 3B71A 4L76A 4OWFA 4I2LC 2HLOA 5AW4B 3G6EP 3JC22 1GU5A 1VQNP 1EDIA 2E74D 2KSEA 3G4SP 4JPZB 3T97B 1Y47A 4EOTA 1MUUA 1YTZI 2E74C 2OARA 5KJ7D 1W2EA 4WY4C 3A2AA 1PL5A 4NPFX 1NU1K 1R8EA 3M9BA 5AW0B 1KILA 1GZLA 1U7JA 5APTA 3V2NA 2WMMA 5BU5A 4TLFA 1J1DB 2QJKB 3CCSP 1IZNB 2O3JA 2FBWC 3C8VA 4JBZA 5CCHC 4IFDK 2WSEJ 4B86A 2WPSA 1BDDA 2BCCD 4U3FJ 3OW2O 4R4LA 4GDOA 2QJPB 3CWBD 1KB9E 1LTIC 1VQ9P 2Q3EA 3MTUE 1VQLP 1YBKA 2JR8A 2R3CA 3CL3D 1GTWA 3L75J 1QVGO 3TNUA 4OGQC 5L8RJ 3H1HG 4HKZH 2AXTE 3KPEA 4D6TE 1Q90D 3SWFA 3AEDC 1L4AB 5KAIH 1G1JA 2WSFH 1IFDA 1W2BO 1LT9B 3O8ZA 2GM4A 4EDFA 3CXHD 2E75D 3L71J 3KHUA 2QIWA 2N1TB 1CW5A 3A7OA 5AW3B 1FJKA 1L4AD 1NTZG 1WRGA 2Z5HA 3GHGB 4PJ0H 1CSBA 3NXSA 3VMYA 3CC2P 3EFFK 1H0TB 3RGUA 1EXJA 2Q7CA 3JCUH 2WQYC 1QVFO 4UB6H 2QJKC 1NH4A 5KAFH 5AVXB 4DT0A 3BATA 1R5LA 5KLVD 1KV4A 4H13D 1NTKD 2V7QH 4Y28J 3RL0g 2A45H 4I7ZC 4EIJA 5KLIC 1NTME 3CCMP 3CCEP 1MZ9A 5DJUB 5CCGD 1LWUB 2MKVA 1YQ3C 3H32B 2AEFA 4H0LB 3EWKA 5AVRB 3E1IA 4D6TD 1S9KD 2IBZI 2R5BA 4PV1D 1YJNP 1Q7YQ 1KC8Q 1NTKJ 4U7JA 3TYYA 1YI2P 1NO4A 5APXA 1G2CB 1M57D 2BCCG 1J1EC 4PV1C 1KILB 5TISH 3GF3A 1DH3A 2C9NY 3RK3D 4I1LA 1LTBC 1PZQA 2E74B 1AJYA 1M56D 3P8MC 5AW2B 1KYOI 5AVZB 3TGUD 1IJDB 3OA7A 3CLQA 2OQQA 1WT6A 2A45G 5KKZB 2ZVNB 3QWOC 4IFFA 1JTHB 3A0HH 2IBZE 1KQSO 2IFNA 3AEAC 1KTMA 4IL6H 3I55P 1NHLA 2CK3H 2N1TC 3L75D 2GUSA 1SFCD 3WUUA 4YXWH 3B8EB 1LWUC 1AVYA 1FDIA 3CPWO 1MFTA 3Q1MA 3P8CE 1BCCD 1FC2C 4IL6X 4U3FD 3A0BE 4YTPC 3RL0B 1SQBG 3H1JG 4N3YB 3H1KE
chains in the Genus database with same CATH topology
3M91A 4HH2A 3RK2B 3M9HA 2I1KA 2C0WA 2HPCA 5AVYB 1E5WA 2MJZA 2YNYA 4JF7A 2J58A 1A02F 1CI6B 1VPCA 1N86A 3RL0D 2BASA 1JY3O 3IFMA 2HYNA 1QL1A 2POHA 3HRNA 4GKGA 3KQGA 3BASA 4LLHA 1VDFA 1RE3A 4XA4A 1AFOA 2H43A 2ZXEB 4RESB 5AW7B 2OYIA 5AW1B 1HWTC 1N73B 2O1KA 4N78D 5CMZA 3TK1A 1H89A 1LTJC 2XNXA 1N7LA 3HD7D 1GK4A 2LKMA 2C0XA 4W7YA 5CCGC 1SVFA 1H8AA 1KZUB 4OH8B 2W27A 3V4WA 4LC1A 3EFGA 5CCGA 4O9BA 2FYUK 3GHGA 1L0LK 1XTGB 1HGZA 3A5TA 4JYCA 3HUSC 1HTLC 3P7KA 1N73C 1HBWA 4JYBA 1M7LA 3M9QA 2VRSA 2P2UA 3RL0C 1RE4C 2OYHB 3II6A 3TSIA 4M3LA 1YYCA 1SFCA 2YMYA 2XV5A 1FOSF 1AQ5A 3IR9A 4WY4A 1JY2O 2R5DA 1URQC 4N78E 1IC2A 3TNUB 3RK2C 5KTBA 3V4QA 2W6BA 2WWWA 1N7SC 2N1TA 2P7JA 3L37A 3V2QA 3VP9A 3NTNA 1NTZK 4DOJA 1LTGC 2E43A 1XTCC 3EQ2A 2XZRA 1ZN5A 1LTAC 1PFIA 1MFZA 3H32A 2KP8A 1T2KD 4C46A 3U59A 5AVTB 1OWAA 2M8RA 2XU6A 1N7SB 2IPPA 1X8YA 1RF1B 2OYHA 3KYQA 1SFCB 5AVUB 3HTKA 1KILC 4HYTB 2JEEA 3GHGC 1LT9A 1GL2D 2C9LY 5APSA 1KQLA 4DZOA 3L36A 1S9KE 1GL2B 1L0NK 3L4FA 1LTJA 4WBAA 1NKZB 1FZEA 1LGHB 1FAVA 2KOGA 3LW5H 1FZGA 3VOPA 1CI6A 4WB4A 4AQRD 2KYVA 1M1JC 2WZ7A 4W80A 1IO4A 3NMDA 5AW6B 4WY4D 2WPQA 2KLVA 1NKNA 2NPSC 2WT7A 1DX7A 3VP8A 2O01H 1CZQA 1LTSC 1NTMK 1OXZA 3LIDA 1ZR4A 3P8CD 5BVZA 3V5BA 2N1TD 2Q5UA 1SQQK 5KJ7A 5CJ4A 1HJBA 2Q3IA 5KJ7C 5AVVB 1GDTA 2GUVA 2YKPA 1GW3A 1MV8A 3HTKB 1RY3A 1FDMA 2XKMA 2CPSA 2NPSB 1JY3P 1JY3N 1SQBK 3OAKA 2XDJA 2YO2A 1FZCC 1GW4A 2WSEH 1URQB 1RF0A 1GL2C 1FZFA 2IFMA 5AW8B 1YTZT 2JJLA 3NFQA 4I6MC 1JNMA 1KFMA 3SWYA 1ZV8A 3HE5B 2L5GB 2Z4EA 3LIEA 1NOHA 1HH0A 2WSCH 1LT9C 1FU1A 1NWQA 1IFNA 5AVQB 4WY4B 2FYZA 3MUDA 3A3YB 1T2KC 1FZCB 3I5CA 2FKWB 1J1EB 1JY2N 1JY2P 1N2DC 1GK6A 1SP4A 5CCHD 2O1JA 1M1JA 1RE3C 4Y99B 1GL2A 1X9VA 1LTJB 3BRTB 1RF0C 3CI9A 1DEBA 3L35A 3RK3C 2H8PD 2Z5IA 3M0DA 4Y99C 2PAJA 2WPRA 2J59M 3B5NB 1LTTC 1T3JA 2A45I 1J1DC 2YKQA 2WT7B 1URQD 4C7NA 5CJ0A 1N7SA 1QL2A 3UIAA 1RF1A 1IFMA 4ZKUA 3N7NA 1JUNA 2KB7P 1G2CA 2NPSD 1ZLLA 5BU8B 1RF1C 2KSJA 1SQVK 4AUWA 2FXMA 3HD7C 2E42A 5CHXA 5AVSB 5APUA 1RE4A 2WITA 1JTHA 2CPBA 1SLQA 1HGVA 3R2PA 1JO5A 2I1JA 1GU4A 4KHXA 3HD7A 2P67A 5AVWB 2QM8A 1M1JB 3U1AA 5APYA 3VN0A 3HUSA 4C7RA 3VMZA 1URQA 1KILD 2N9BA 3KDPB 3PP5A 4IFMA 5APQA 1JOCA 5AW9B 2P1JA 3M06A 3OJAB 1FOSE 1LWUA 3B5NA 2YO3A 4ZKPA 4C7NB 2HODB 2FFDB 4GT1A 3HE4A 3G3ZA 3U1CA 1FJPA 1SFCC 1JCDA 4N6JA 2OYIB 4AYCA 1N73A 3MD0A 3RK3B 2W6AA 1T3UA 1Z56A 2M3BA 1J2JB 1L4AA 1FZBA 1FBMA 1SQXK 4LGDE 3V2PA 3C9IA 2YKOA 1IK9A 5AW5B 3V2RA 2HFED 4GIFA 3H6PA 4W7ZA 1N7SD 1HVVA 3HD7B 5CCHA 2HPCB 3P32A 3T97A 3HUSB 3RK2D 3MGNA 1ZR2A 3M0DC 2ZFCA 3B5ND 3M0AA 5APWA 1GD2E 1KFNA 3BRVB 3VMXA 2HG5D 3HE5A 1EQ7A 3B5NC 1IFIA 2OYHC 1HUCA 1SQPK 1NTKK 1L4AC 2QM7A 1H88A 2H7HA 2HODA 3VTPC 2FFDA 1JCCA 3HE4B 2OYIC 1FZCA 2IX7C 1G1IA 3N4XA 1X79B 2R32A 3VYIA 2FFDC 2WTYA 2NPSA 1A02J 2PP6A 5KLVK 1T8ZA 2Q9IA 5APVA 4XE5B 1JMMA 3BVHA 3WMM0 1IFJA 1FZAA 1NAFA 3MIWA 5AW4B 4I2LC 2HLOA 1GU5A 4EOTA 1MUUA 1YTZI 2OARA 5KJ7D 1W2EA 4WY4C 3A2AA 1NU1K 3M9BA 5AW0B 1KILA 1GZLA 5APTA 3V2NA 5BU5A 1J1DB 5CCHC 4IFDK 4B86A 2WPSA 1LTIC 3MTUE 2R3CA 1GTWA 3CL3D 3TNUA 3KPEA 3SWFA 1L4AB 1G1JA 2WSFH 1IFDA 1LT9B 3O8ZA 2GM4A 2N1TB 1CW5A 3A7OA 5AW3B 1FJKA 1L4AD 1WRGA 3GHGB 2Z5HA 1CSBA 3NXSA 3VMYA 2Q7CA 1NH4A 5AVXB 3BATA 2A45H 4EIJA 1MZ9A 5CCGD 1LWUB 3H32B 1S9KD 5AVRB 3E1IA 2R5BA 3TYYA 1NO4A 5APXA 1G2CB 1J1EC 1KILB 1DH3A 2C9NY 3RK3D 4I1LA 1LTBC 3P8MC 5AW2B 5AVZB 3OA7A 1IJDB 3CLQA 1WT6A 2A45G 4IFFA 1JTHB 2IFNA 1NHLA 2N1TC 2GUSA 1SFCD 3B8EB 1LWUC 3P8CE 3RL0B 4N3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF H;  1SQV K;  2WSC H;  1NTZ K;  2LKM A;  2OAR A;  1SQB K;  1NU1 K;  2O01 H;  3G3Z A;  2J59 M;  1NTM K;  3CLQ A;  2WSE H;  5KLV K;  2FYU K;  1L0L K;  4IFD K;  1L0N K;  1SQQ K;  1SQX K;  1SQP K;  1NTK K;  3LW5 H;  3M9Q A; 
#chains in the Genus database with same CATH topology
 1BGY D;  3M91 A;  4HH2 A;  3RK2 B;  3H1K G;  2UWJ E;  2I1K A;  2C0W A;  3AE9 C;  3M9H A;  2HPC A;  3O6Q A;  1PGJ A;  5AVY B;  1E5W A;  2MJZ A;  2YNY A;  3L75 E;  4JF7 A;  4OGQ D;  3S1K A;  2ZT9 B;  2J58 A;  2QA4 P;  1A02 F;  1CI6 B;  1VPC A;  1N86 A;  3H1L J;  3D6Z A;  2N9Y B;  3RL0 D;  1L0L J;  2BAS A;  1BGY J;  1JY3 O;  2O01 N;  2W8Z A;  3IFM A;  5TJH A;  1EZV E;  2HYN A;  1QL1 A;  4H44 C;  2IBZ G;  3CX5 E;  2D2C D;  2POH A;  3HRN A;  4GKG A;  3KQG A;  3BAS A;  3WUV A;  4L74 A;  4HB1 A;  4LLH A;  1VDF A;  1RE3 A;  4XA4 A;  1AFO A;  2KZI A;  4U3F E;  3SSU A;  2H43 A;  1NU1 D;  1FDO A;  1PV3 A;  3H1I J;  2FXP A;  2ZXE B;  1ZRT D;  4QMA A;  5M1B A;  4RES B;  3FX0 A;  1DIP A;  1Q86 Q;  5AW7 B;  1PP9 D;  2LR2 A;  2KS1 B;  4H44 B;  2OYI A;  2BEZ F;  5AW1 B;  3L70 J;  1N73 B;  1HWT C;  2O1K A;  2K9J B;  1S3J A;  2E75 B;  4N78 D;  5CMZ A;  3TK1 A;  1NJI Q;  3CXH H;  1LTJ C;  1H89 A;  3PHL A;  2SPZ A;  2XNX A;  1N7L A;  5GTI H;  3HD7 D;  3KXD A;  1YQ4 C;  1GK4 A;  2K88 A;  1SQX G;  1BE3 D;  4HJG H;  1NGM B;  2LKM A;  2C0X A;  4W7Y A;  2YXR B;  3BCC D;  5CCG C;  1SVF A;  1H8A A;  1NTZ J;  3CWB J;  1KZU B;  1BCC G;  1UII A;  4OH8 B;  5B5E E;  3H1J D;  3AE7 C;  2W90 A;  3RBX A;  2W27 A;  3V4W A;  3WU2 H;  3AEB C;  2KK7 A;  3EFG A;  1S4X A;  3AE5 C;  4LC1 A;  5CCG A;  3I56 P;  4O9B A;  1EDJ A;  2FYU K;  3GHG A;  1L0L K;  3L74 E;  1XTG B;  3L73 G;  5GTI E;  1HGZ A;  5KAF E;  3L71 E;  3A5T A;  2BEQ D;  4JYC A;  4WWI A;  1NTZ E;  2QVA A;  3L74 J;  4NPD A;  1P84 H;  3HUS C;  2E75 C;  1HTL C;  3H1I D;  3P7K A;  3R4Y A;  3L71 D;  4PD4 H;  1N73 C;  4KJM A;  1HBW A;  1L2P A;  4JYB A;  1LP1 A;  1M7L A;  3W67 A;  3CC4 P;  3M9Q A;  2VRS A;  2P2U A;  3RL0 C;  5K5G B;  3CCJ P;  1P84 D;  1KB9 D;  4MN4 C;  1S5L E;  2DW3 A;  5KLI B;  1NU1 J;  1RE4 C;  1SQP E;  1X22 A;  2AXT H;  1L0L D;  1MKM A;  3II6 A;  4M3L A;  3TSI A;  3L72 J;  1OVU A;  4TT3 H;  1VQO P;  1YYC A;  3L70 G;  1D7M A;  4EI2 A;  4WVZ A;  3CXH E;  1OIP A;  1SFC A;  2YMY A;  4A7P A;  4CPG A;  2XV5 A;  2ZT9 D;  1FOS F;  1AQ5 A;  3IR9 A;  4WY4 A;  1VQ8 P;  1PGP A;  1N8R Q;  1JY2 O;  1SQQ J;  2FY8 A;  2RN0 A;  2R5D A;  1URQ C;  1SQP J;  1L0L E;  1VF5 D;  2KNC A;  1IC2 A;  1SQP D;  2ZJS E;  3MP7 B;  3PTZ A;  4N78 E;  2E76 C;  1VF5 C;  5H2F H;  3RK2 C;  2NZ2 A;  4ZMD A;  2ZXX A;  5KTB A;  1S72 P;  3V4Q A;  1SQV J;  1WMK A;  2W6B A;  2WWW A;  2JDI H;  1N7S C;  1YIJ P;  3SWK A;  4BXL A;  2N1T A;  4GOF A;  2P7J A;  3L37 A;  3V2Q A;  3L73 J;  2A06 D;  2O01 J;  3VP9 A;  2WSS H;  1NTZ K;  2YIU B;  3NTN A;  4GOE A;  4DOJ A;  5KLV E;  1LTG C;  2R44 A;  2E43 A;  1XTC C;  3EQ2 A;  1OW8 A;  3PH0 A;  4Z1M H;  2AXC A;  2B87 B;  3L74 D;  3L71 G;  1YJW P;  1JB0 J;  4D6T G;  2L91 A;  3CCR P;  1AV1 A;  2XZR A;  3KZI E;  4L75 A;  4ASV A;  1ZN5 A;  5KAI E;  1LTA C;  1BGY E;  1HJ0 A;  1S5L H;  4YXD C;  1PFI A;  1MFZ A;  5H2F E;  3BCC E;  3H32 A;  1K9M Q;  1VQP P;  2KP8 A;  1T2K D;  1QEX A;  2P58 A;  3U59 A;  1NTZ D;  5AVT B;  3E7K A;  4YPC A;  4C46 A;  4H0L D;  1OWA A;  2M8R A;  2XU6 A;  1N7S B;  2IPP A;  2OTJ P;  1X8Y A;  1RF1 B;  2OYH A;  2K9Y A;  3FXD A;  4L73 A;  1PP9 E;  4KT0 J;  1SQP G;  3AEE C;  1SQB E;  1NTK G;  3KYQ A;  1SFC B;  5AVU B;  2KXP B;  2QE7 H;  3HTK A;  3JCU E;  1SQX E;  1KIL C;  1LT1 A;  4HYT B;  1SQV G;  2JEE A;  4U3F G;  4NPE A;  3GHG C;  1LT9 A;  1GL2 D;  1SQB D;  2C9L Y;  1NVO A;  1EZV D;  5APS A;  1KQL A;  1BDC A;  3H1H J;  4DZO A;  3L36 A;  1KOR A;  1YJ9 P;  1IK7 A;  1W5C E;  1S9K E;  1GL2 B;  1L0N K;  2ZYG A;  3L4F A;  3L74 G;  1LTJ A;  1S2E A;  1ZRT E;  4WBA A;  1NKZ B;  3Q5P A;  1NTM D;  2RKL A;  1FZE A;  4IOI H;  1IFP A;  5EFW B;  3O6Q B;  1LGH B;  1FAV A;  2H89 C;  2KOG A;  1BCC E;  2Q1K A;  2FYU D;  3LW5 H;  1FZG A;  3VOP A;  1ZP0 C;  1CI6 A;  4WB4 A;  3H1J J;  4AQR D;  2KYV A;  1M1J C;  3L72 E;  2WVR A;  2WZ7 A;  1NU1 G;  3NMD A;  4W80 A;  5AW6 B;  3IN6 A;  4WY4 D;  2WPQ A;  2KLV A;  1IO4 A;  3L72 G;  1NKN A;  2NPS C;  2WT7 A;  2FXO A;  1DX7 A;  3VP8 A;  1S5L X;  2H88 C;  2IYO A;  2O01 H;  2NRG A;  1VQ7 P;  2K1A A;  1PIX A;  1SQQ E;  3H1L G;  1CZQ A;  1LTS C;  1NTM K;  1KYO D;  1OXZ A;  2KUB A;  1BGY G;  3USS A;  1S1C X;  2P10 A;  3TGU E;  2QRX A;  3H1K D;  3LID A;  3PLN A;  3RBZ A;  2ITA A;  3TDK A;  1ZR4 A;  1FE6 A;  3H1H D;  2GA1 A;  3P8C D;  3TGU J;  5BVZ A;  3AEC C;  3V5B A;  2K9J A;  2N1T D;  2Q5U A;  1SQQ K;  5KJ7 A;  3FWN A;  5CJ4 A;  1KYO H;  1HJB A;  1H0T A;  2Q3I A;  5KJ7 C;  3Q2Y A;  5AVV B;  1GDT A;  2GUV A;  2YKP A;  2IBZ D;  2KIK A;  3CX5 H;  2OYO A;  1GW3 A;  1MV8 A;  2LXC B;  3HTK B;  2Y0C A;  5B66 E;  1GMJ A;  1K05 A;  1RY3 A;  2W83 C;  4IL6 E;  1KIL E;  1FDM A;  2XKM A;  2M0B A;  3PRJ A;  1EZV I;  2CPS A;  3GG2 A;  1LNQ A;  1USE A;  3FXE A;  4R4M A;  2NPS B;  1JY3 P;  1JY3 N;  3LW5 J;  4RKU J;  3RK3 E;  1SQB K;  1VQ6 P;  3OAK A;  5KLV J;  3CCL P;  1P84 E;  1L0N E;  2FYU G;  3MHV A;  4UB8 E;  2XDJ A;  3TNU B;  2YO2 A;  2V4H A;  5E79 E;  3AE8 C;  3GF7 A;  1FZC C;  1GW4 A;  1L0N D;  1Q2N A;  2WSE H;  3GW6 A;  1URQ B;  3H1I E;  1NYH A;  3CXH I;  3ITK A;  3D71 A;  1U57 A;  1RF0 A;  1UIX A;  4ZNC A;  1GL2 C;  1FZF A;  5B5E H;  2D2C C;  2IFM A;  5AW8 B;  1YTZ T;  2JJL A;  3NFQ A;  1KMI Z;  4I6M C;  1JM0 A;  1K04 A;  2PRR A;  3QH9 A;  1JNM A;  3VMA A;  1ZME C;  1DEE G;  2G3A A;  1KFM A;  1PP9 J;  3SWY A;  3CCQ P;  1ZV8 A;  3HE5 B;  4RJT A;  2L5G B;  3TGU G;  3L73 D;  3CWB E;  3LIE A;  5B66 H;  1NOH A;  3SFD C;  2KI7 B;  2Z4E A;  1HH0 A;  2WSC H;  1LT9 C;  4K3A A;  1FU1 A;  4JQ0 D;  3D70 A;  1RQV A;  1NWQ A;  1IFN A;  1QGK B;  1KB9 I;  1PPJ D;  4I7Z B;  5AVQ B;  4WY4 B;  2FYZ A;  1VF5 B;  1VL2 A;  1U7M A;  2M5A B;  1OZH A;  3H1I G;  3MUD A;  4UB8 H;  5C39 A;  1BE3 E;  2I8D A;  3L75 G;  2JO1 A;  3H1H E;  4XFJ A;  3AE4 C;  3A3Y B;  2QJP C;  3FGA D;  3TF5 A;  1T2K C;  1FZC B;  2OYH B;  2A06 G;  2IDB A;  1DD4 A;  3I5C A;  5DJT B;  3V6I A;  1SQQ D;  2FKW B;  1TU3 F;  1J1E B;  1M8O B;  2Y0D A;  1JY2 N;  1JY2 P;  1N2D C;  1GK6 A;  1SQX J;  1Q81 Q;  1SP4 A;  5CCH D;  4PD4 D;  3IF4 A;  2O1J A;  2IYP A;  1M1J A;  1BCC J;  1RE3 C;  5E79 H;  2E5T A;  1EXI A;  2ZYD A;  4Y99 B;  1GL2 A;  4GOD A;  1X9V A;  1KQG B;  2K3R A;  1LTJ B;  2ZAE B;  3BRT B;  1RF0 C;  3L70 E;  5KKZ C;  2B87 A;  1DEB A;  3CI9 A;  3CX5 D;  2H8P D;  3L35 A;  1NAY A;  3K5B A;  2Z5I A;  3RK3 C;  1M90 Q;  1KD1 Q;  1SQV E;  2ZYA A;  2IZ0 A;  1LP1 B;  1ZOY C;  1USD A;  2JKV A;  3M0D A;  4Y99 C;  2PAJ A;  2WPR A;  1VQK P;  3AE3 C;  2WPV B;  2J59 M;  2ZVO B;  1PP9 G;  3B5N B;  2E76 D;  3MZW B;  1LTT C;  1T3J A;  2A45 I;  1J1D C;  2YKQ A;  2XND H;  1P84 I;  3AE1 C;  2WT7 B;  3G71 P;  1URQ D;  4C7N A;  3CX5 I;  1N7S A;  1QL2 A;  5CJ0 A;  1PPJ G;  3UIA A;  2W6J H;  3ZDM A;  3D6Y A;  1RF1 A;  1IFM A;  2ZT9 C;  4PJ0 E;  3S4R A;  1SQX D;  1PPJ E;  1BE3 G;  4ZKU A;  3N7N A;  1JUN A;  2KB7 P;  3AEG C;  3AE6 C;  4PD4 E;  1BSH A;  1G2C A;  1X0T A;  2KNC B;  2NPS D;  1ZLL A;  5BU8 B;  1JEK A;  1RF1 C;  2M5A A;  1EDL A;  2KSJ A;  1SQV K;  2JWA A;  4AUW A;  2FXM A;  4UB6 E;  3WUT A;  3HD7 C;  3Q5R A;  1VQM P;  2E42 A;  5CHX A;  3CMA P;  5AVS B;  5KLV G;  5APU A;  2WSC J;  1RE4 A;  2WIT A;  1JTH A;  2FYN C;  4OVN F;  1KQF B;  1SQB J;  1RH5 B;  1SLQ A;  2CPB A;  2KLU A;  1HGV A;  3CWB G;  3R2P A;  3W68 A;  1K73 Q;  1JO5 A;  3ABV C;  2I1J A;  1GU4 A;  3H1K J;  3L73 E;  1L0N J;  3HD7 A;  4KHX A;  2P67 A;  2YXQ B;  2QM8 A;  1M1J B;  3A0B H;  3AEF C;  3IAO A;  5APY A;  5AVW B;  3U1A A;  4BRY A;  4DJG A;  3VN0 A;  3HUS A;  1HF9 A;  1SQV D;  1NTK E;  3H1L E;  3H1L D;  1L0L G;  4C7R A;  2A06 E;  3VMZ A;  1OX3 A;  1KIL D;  1URQ A;  2N9B A;  2QJY C;  2G8Y A;  3KDP B;  3A0H E;  3PP5 A;  4IFM A;  5GTH H;  1SS1 A;  1JOC A;  5APQ A;  4D6T J;  2KZJ A;  5AW9 B;  2P1J A;  2BCC J;  2J5U A;  3M06 A;  4PV1 B;  2Q6Q A;  3OJA B;  2YIU C;  1FOS E;  1LWU A;  1ZW0 A;  3B5N A;  1YIT P;  1BE3 J;  2YO3 A;  1NTM G;  1FS0 E;  2QEX P;  3CD6 P;  2AEM A;  2IZ1 A;  4ZKP A;  2QJY B;  1YHQ P;  4C7N B;  2HOD B;  3KZI H;  2FFD B;  4GT1 A;  2WSF J;  3HE4 A;  1DD3 A;  2QG4 A;  3G3Z A;  4H0L C;  3S9O A;  3CME P;  3U1C A;  1FJP A;  3F5H A;  2B89 A;  1SFC C;  1JCD A;  4N6J A;  2KS1 A;  2OYI B;  4AYC A;  2OTL P;  1N73 A;  1Y8A A;  2B9B A;  3MD0 A;  3RK3 B;  2W6A A;  1T3U A;  1AQT A;  4H44 D;  1Z56 A;  2HR3 A;  2M3B A;  1J2J B;  2BCC E;  1L4A A;  3SFE C;  1FZB A;  1FBM A;  1QLE D;  1SQX K;  2FYN B;  4LGD E;  3V2P A;  2RH0 A;  3C9I A;  2YKO A;  1IK9 A;  2E5Y A;  2PGD A;  5CBO A;  1L0N G;  2FYU E;  1E79 H;  2Y9Y A;  2JWD A;  1OW7 A;  5AW5 B;  3V2R A;  1OVV A;  3Q3D A;  2HFE D;  1LJ2 A;  1KYO E;  3H6P A;  4GIF A;  4K35 A;  4W7Z A;  4BWN A;  3AE2 C;  1N7S D;  1HVV A;  1Q82 Q;  3FWL A;  3HD7 B;  5CCH A;  4OGQ B;  3C1L A;  3CCU P;  3BCC J;  1OFC X;  1AA0 A;  3P32 A;  4BRY B;  1M1K Q;  3T97 A;  1PGO A;  2LXB A;  2HPC B;  2FYU J;  3HUS B;  2M3E A;  3MGN A;  3RK2 D;  3M0D C;  2ZFC A;  1ZR2 A;  3B5N D;  3M0A A;  5APW A;  3H1J E;  4PD4 I;  4DCK A;  1GD2 E;  1K8A Q;  1KFN A;  1NTM J;  3BRV B;  3G9R A;  1T6A A;  3VMX A;  1PGQ A;  2HG5 D;  3F89 A;  3HE5 A;  1EQ7 A;  3B5N C;  5GTH E;  3CCV P;  3WU2 E;  1IFI A;  2OYH C;  2PFX A;  1HUC A;  1ZXG A;  1SQP K;  1Y9B A;  2D2C B;  1NTK K;  3GMA A;  1L4A C;  1SQQ G;  2B88 A;  2Y0E A;  1EZV G;  2QM7 A;  1H88 A;  4EYY Q;  2HOD A;  2H7H A;  2OGU A;  3VTP C;  2FFD A;  3GLM A;  1JCC A;  3HE4 B;  2OYI C;  5TIS E;  3CC7 P;  2QSI A;  1FZC A;  3Q5S A;  1VQ5 P;  2IX7 C;  1RQU A;  1NU1 E;  3E1R A;  1G1I A;  2K37 A;  3N4X A;  1QX8 A;  1EC5 A;  1JMB A;  2AEJ A;  1X79 B;  2R32 A;  3JSV C;  1VQ4 P;  3VYI A;  2FFD C;  4ASW A;  1KN7 A;  4H13 C;  2WTY A;  2NPS A;  2OTK E;  2V7Q J;  3MUD C;  3PJS K;  1A02 J;  4RO0 A;  2PP6 A;  1R5S A;  5CBN A;  1OMI A;  1T8Z A;  5KLV K;  2Q9I A;  1OVR A;  5APV A;  2YMK A;  2JP3 A;  2E76 B;  3H25 A;  3B4S A;  4XE5 B;  1JMM A;  1AVO A;  3L72 D;  3BVH A;  1RHZ B;  3BCC G;  4H13 B;  3WMM 0;  1OW6 A;  1KB9 H;  3L70 D;  2Y9Z A;  1EDK A;  1IFJ A;  1FZA A;  1NAF A;  2RMZ A;  3MIW A;  2R3S A;  1BSN A;  3B71 A;  4L76 A;  4OWF A;  4I2L C;  2HLO A;  5AW4 B;  3G6E P;  3JC2 2;  1GU5 A;  1VQN P;  1EDI A;  2E74 D;  2KSE A;  3G4S P;  4JPZ B;  3T97 B;  1Y47 A;  4EOT A;  1MUU A;  1YTZ I;  2E74 C;  2OAR A;  5KJ7 D;  1W2E A;  4WY4 C;  3A2A A;  1PL5 A;  4NPF X;  1NU1 K;  1R8E A;  3M9B A;  5AW0 B;  1KIL A;  1GZL A;  1U7J A;  5APT A;  3V2N A;  2WMM A;  5BU5 A;  4TLF A;  1J1D B;  2QJK B;  3CCS P;  1IZN B;  2O3J A;  2FBW C;  3C8V A;  4JBZ A;  5CCH C;  4IFD K;  2WSE J;  4B86 A;  2WPS A;  1BDD A;  2BCC D;  4U3F J;  3OW2 O;  4R4L A;  4GDO A;  2QJP B;  3CWB D;  1KB9 E;  1LTI C;  1VQ9 P;  2Q3E A;  3MTU E;  1VQL P;  1YBK A;  2JR8 A;  2R3C A;  3CL3 D;  1GTW A;  3L75 J;  1QVG O;  3TNU A;  4OGQ C;  5L8R J;  3H1H G;  4HKZ H;  2AXT E;  3KPE A;  4D6T E;  1Q90 D;  3SWF A;  3AED C;  1L4A B;  5KAI H;  1G1J A;  2WSF H;  1IFD A;  1W2B O;  1LT9 B;  3O8Z A;  2GM4 A;  4EDF A;  3CXH D;  2E75 D;  3L71 J;  3KHU A;  2QIW A;  2N1T B;  1CW5 A;  3A7O A;  5AW3 B;  1FJK A;  1L4A D;  1NTZ G;  1WRG A;  2Z5H A;  3GHG B;  4PJ0 H;  1CSB A;  3NXS A;  3VMY A;  3CC2 P;  3EFF K;  1H0T B;  3RGU A;  1EXJ A;  2Q7C A;  3JCU H;  2WQY C;  1QVF O;  4UB6 H;  2QJK C;  1NH4 A;  5KAF H;  5AVX B;  4DT0 A;  3BAT A;  1R5L A;  5KLV D;  1KV4 A;  4H13 D;  1NTK D;  2V7Q H;  4Y28 J;  3RL0 g;  2A45 H;  4I7Z C;  4EIJ A;  5KLI C;  1NTM E;  3CCM P;  3CCE P;  1MZ9 A;  5DJU B;  5CCG D;  1LWU B;  2MKV A;  1YQ3 C;  3H32 B;  2AEF A;  4H0L B;  3EWK A;  5AVR B;  3E1I A;  4D6T D;  1S9K D;  2IBZ I;  2R5B A;  4PV1 D;  1YJN P;  1Q7Y Q;  1KC8 Q;  1NTK J;  4U7J A;  3TYY A;  1YI2 P;  1NO4 A;  5APX A;  1G2C B;  1M57 D;  2BCC G;  1J1E C;  4PV1 C;  1KIL B;  5TIS H;  3GF3 A;  1DH3 A;  2C9N Y;  3RK3 D;  4I1L A;  1LTB C;  1PZQ A;  2E74 B;  1AJY A;  1M56 D;  3P8M C;  5AW2 B;  1KYO I;  5AVZ B;  3TGU D;  1IJD B;  3OA7 A;  3CLQ A;  2OQQ A;  1WT6 A;  2A45 G;  5KKZ B;  2ZVN B;  3QWO C;  4IFF A;  1JTH B;  3A0H H;  2IBZ E;  1KQS O;  2IFN A;  3AEA C;  1KTM A;  4IL6 H;  3I55 P;  1NHL A;  2CK3 H;  2N1T C;  3L75 D;  2GUS A;  1SFC D;  3WUU A;  4YXW H;  3B8E B;  1LWU C;  1AVY A;  1FDI A;  3CPW O;  1MFT A;  3Q1M A;  3P8C E;  1BCC D;  1FC2 C;  4IL6 X;  4U3F D;  3A0B E;  4YTP C;  3RL0 B;  1SQB G;  3H1J G;  4N3Y B;  3H1K E; 
#chains in the Genus database with same CATH homology
 3M91 A;  4HH2 A;  3RK2 B;  3M9H A;  2I1K A;  2C0W A;  2HPC A;  5AVY B;  1E5W A;  2MJZ A;  2YNY A;  4JF7 A;  2J58 A;  1A02 F;  1CI6 B;  1VPC A;  1N86 A;  3RL0 D;  2BAS A;  1JY3 O;  3IFM A;  2HYN A;  1QL1 A;  2POH A;  3HRN A;  4GKG A;  3KQG A;  3BAS A;  4LLH A;  1VDF A;  1RE3 A;  4XA4 A;  1AFO A;  2H43 A;  2ZXE B;  4RES B;  5AW7 B;  2OYI A;  5AW1 B;  1HWT C;  1N73 B;  2O1K A;  4N78 D;  5CMZ A;  3TK1 A;  1H89 A;  1LTJ C;  2XNX A;  1N7L A;  3HD7 D;  1GK4 A;  2LKM A;  2C0X A;  4W7Y A;  5CCG C;  1SVF A;  1H8A A;  1KZU B;  4OH8 B;  2W27 A;  3V4W A;  4LC1 A;  3EFG A;  5CCG A;  4O9B A;  2FYU K;  3GHG A;  1L0L K;  1XTG B;  1HGZ A;  3A5T A;  4JYC A;  3HUS C;  1HTL C;  3P7K A;  1N73 C;  1HBW A;  4JYB A;  1M7L A;  3M9Q A;  2VRS A;  2P2U A;  3RL0 C;  1RE4 C;  2OYH B;  3II6 A;  3TSI A;  4M3L A;  1YYC A;  1SFC A;  2YMY A;  2XV5 A;  1FOS F;  1AQ5 A;  3IR9 A;  4WY4 A;  1JY2 O;  2R5D A;  1URQ C;  4N78 E;  1IC2 A;  3TNU B;  3RK2 C;  5KTB A;  3V4Q A;  2W6B A;  2WWW A;  1N7S C;  2N1T A;  2P7J A;  3L37 A;  3V2Q A;  3VP9 A;  3NTN A;  1NTZ K;  4DOJ A;  1LTG C;  2E43 A;  1XTC C;  3EQ2 A;  2XZR A;  1ZN5 A;  1LTA C;  1PFI A;  1MFZ A;  3H32 A;  2KP8 A;  1T2K D;  4C46 A;  3U59 A;  5AVT B;  1OWA A;  2M8R A;  2XU6 A;  1N7S B;  2IPP A;  1X8Y A;  1RF1 B;  2OYH A;  3KYQ A;  1SFC B;  5AVU B;  3HTK A;  1KIL C;  4HYT B;  2JEE A;  3GHG C;  1LT9 A;  1GL2 D;  2C9L Y;  5APS A;  1KQL A;  4DZO A;  3L36 A;  1S9K E;  1GL2 B;  1L0N K;  3L4F A;  1LTJ A;  4WBA A;  1NKZ B;  1FZE A;  1LGH B;  1FAV A;  2KOG A;  3LW5 H;  1FZG A;  3VOP A;  1CI6 A;  4WB4 A;  4AQR D;  2KYV A;  1M1J C;  2WZ7 A;  4W80 A;  1IO4 A;  3NMD A;  5AW6 B;  4WY4 D;  2WPQ A;  2KLV A;  1NKN A;  2NPS C;  2WT7 A;  1DX7 A;  3VP8 A;  2O01 H;  1CZQ A;  1LTS C;  1NTM K;  1OXZ A;  3LID A;  1ZR4 A;  3P8C D;  5BVZ A;  3V5B A;  2N1T D;  2Q5U A;  1SQQ K;  5KJ7 A;  5CJ4 A;  1HJB A;  2Q3I A;  5KJ7 C;  5AVV B;  1GDT A;  2GUV A;  2YKP A;  1GW3 A;  1MV8 A;  3HTK B;  1RY3 A;  1FDM A;  2XKM A;  2CPS A;  2NPS B;  1JY3 P;  1JY3 N;  1SQB K;  3OAK A;  2XDJ A;  2YO2 A;  1FZC C;  1GW4 A;  2WSE H;  1URQ B;  1RF0 A;  1GL2 C;  1FZF A;  2IFM A;  5AW8 B;  1YTZ T;  2JJL A;  3NFQ A;  4I6M C;  1JNM A;  1KFM A;  3SWY A;  1ZV8 A;  3HE5 B;  2L5G B;  2Z4E A;  3LIE A;  1NOH A;  1HH0 A;  2WSC H;  1LT9 C;  1FU1 A;  1NWQ A;  1IFN A;  5AVQ B;  4WY4 B;  2FYZ A;  3MUD A;  3A3Y B;  1T2K C;  1FZC B;  3I5C A;  2FKW B;  1J1E B;  1JY2 N;  1JY2 P;  1N2D C;  1GK6 A;  1SP4 A;  5CCH D;  2O1J A;  1M1J A;  1RE3 C;  4Y99 B;  1GL2 A;  1X9V A;  1LTJ B;  3BRT B;  1RF0 C;  3CI9 A;  1DEB A;  3L35 A;  3RK3 C;  2H8P D;  2Z5I A;  3M0D A;  4Y99 C;  2PAJ A;  2WPR A;  2J59 M;  3B5N B;  1LTT C;  1T3J A;  2A45 I;  1J1D C;  2YKQ A;  2WT7 B;  1URQ D;  4C7N A;  5CJ0 A;  1N7S A;  1QL2 A;  3UIA A;  1RF1 A;  1IFM A;  4ZKU A;  3N7N A;  1JUN A;  2KB7 P;  1G2C A;  2NPS D;  1ZLL A;  5BU8 B;  1RF1 C;  2KSJ A;  1SQV K;  4AUW A;  2FXM A;  3HD7 C;  2E42 A;  5CHX A;  5AVS B;  5APU A;  1RE4 A;  2WIT A;  1JTH A;  2CPB A;  1SLQ A;  1HGV A;  3R2P A;  1JO5 A;  2I1J A;  1GU4 A;  4KHX A;  3HD7 A;  2P67 A;  5AVW B;  2QM8 A;  1M1J B;  3U1A A;  5APY A;  3VN0 A;  3HUS A;  4C7R A;  3VMZ A;  1URQ A;  1KIL D;  2N9B A;  3KDP B;  3PP5 A;  4IFM A;  5APQ A;  1JOC A;  5AW9 B;  2P1J A;  3M06 A;  3OJA B;  1FOS E;  1LWU A;  3B5N A;  2YO3 A;  4ZKP A;  4C7N B;  2HOD B;  2FFD B;  4GT1 A;  3HE4 A;  3G3Z A;  3U1C A;  1FJP A;  1SFC C;  1JCD A;  4N6J A;  2OYI B;  4AYC A;  1N73 A;  3MD0 A;  3RK3 B;  2W6A A;  1T3U A;  1Z56 A;  2M3B A;  1J2J B;  1L4A A;  1FZB A;  1FBM A;  1SQX K;  4LGD E;  3V2P A;  3C9I A;  2YKO A;  1IK9 A;  5AW5 B;  3V2R A;  2HFE D;  4GIF A;  3H6P A;  4W7Z A;  1N7S D;  1HVV A;  3HD7 B;  5CCH A;  2HPC B;  3P32 A;  3T97 A;  3HUS B;  3RK2 D;  3MGN A;  1ZR2 A;  3M0D C;  2ZFC A;  3B5N D;  3M0A A;  5APW A;  1GD2 E;  1KFN A;  3BRV B;  3VMX A;  2HG5 D;  3HE5 A;  1EQ7 A;  3B5N C;  1IFI A;  2OYH C;  1HUC A;  1SQP K;  1NTK K;  1L4A C;  2QM7 A;  1H88 A;  2H7H A;  2HOD A;  3VTP C;  2FFD A;  1JCC A;  3HE4 B;  2OYI C;  1FZC A;  2IX7 C;  1G1I A;  3N4X A;  1X79 B;  2R32 A;  3VYI A;  2FFD C;  2WTY A;  2NPS A;  1A02 J;  2PP6 A;  5KLV K;  1T8Z A;  2Q9I A;  5APV A;  4XE5 B;  1JMM A;  3BVH A;  3WMM 0;  1IFJ A;  1FZA A;  1NAF A;  3MIW A;  5AW4 B;  4I2L C;  2HLO A;  1GU5 A;  4EOT A;  1MUU A;  1YTZ I;  2OAR A;  5KJ7 D;  1W2E A;  4WY4 C;  3A2A A;  1NU1 K;  3M9B A;  5AW0 B;  1KIL A;  1GZL A;  5APT A;  3V2N A;  5BU5 A;  1J1D B;  5CCH C;  4IFD K;  4B86 A;  2WPS A;  1LTI C;  3MTU E;  2R3C A;  1GTW A;  3CL3 D;  3TNU A;  3KPE A;  3SWF A;  1L4A B;  1G1J A;  2WSF H;  1IFD A;  1LT9 B;  3O8Z A;  2GM4 A;  2N1T B;  1CW5 A;  3A7O A;  5AW3 B;  1FJK A;  1L4A D;  1WRG A;  3GHG B;  2Z5H A;  1CSB A;  3NXS A;  3VMY A;  2Q7C A;  1NH4 A;  5AVX B;  3BAT A;  2A45 H;  4EIJ A;  1MZ9 A;  5CCG D;  1LWU B;  3H32 B;  1S9K D;  5AVR B;  3E1I A;  2R5B A;  3TYY A;  1NO4 A;  5APX A;  1G2C B;  1J1E C;  1KIL B;  1DH3 A;  2C9N Y;  3RK3 D;  4I1L A;  1LTB C;  3P8M C;  5AW2 B;  5AVZ B;  3OA7 A;  1IJD B;  3CLQ A;  1WT6 A;  2A45 G;  4IFF A;  1JTH B;  2IFN A;  1NHL A;  2N1T C;  2GUS A;  1SFC D;  3B8E B;  1LWU C;  3P8C E;  3RL0 B;  4N3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...