5KLVK

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
LTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5klvK00
2J59M 3CLQA 4IFDK 1L0NK 3M9QA 1SQPK 2WSFH 2FYUK 2O01H 2LKMA 2WSEH 1NTKK 1NU1K 1SQXK 5KLVK 1SQBK 2OARA 1NTZK 1NTMK 1SQVK 1SQQK 3LW5H 3G3ZA 1L0LK 2WSCH
chains in the Genus database with same CATH superfamily
1KZUB 3BCCE 2W8ZA 3H1JG 1Q90D 2QM7A 4AQRD 3TGUJ 4U3FG 4RESB 4Y99C 5B5EE 3L4FA 1G1IA 4BRYA 3NMDA 4LGDE 2FXOA 2QA4P 1SQVE 3L72D 4D6TE 3FWLA 3H1KG 3PRJA 1ZN5A 5AW4B 4H13D 3SWFA 1A02J 1NTKK 5CBOA 2QSIA 1MZ9A 5AW9B 3H1JE 1YJNP 1T8ZA 1K05A 2J5UA 3H32B 4U3FE 1IFPA 1SS1A 2YO3A 3AE5C 3FXEA 3RK3C 2A45G 3H1KE 5CCHD 1W2BO 2K3RA 3A0BE 4IL6H 5KKZB 2M8RA 2A06G 4LLHA 1NTMK 2Y9ZA 1SQPJ 1IFJA 2UWJE 2IBZG 1WT6A 1S5LE 4K3AA 3WUVA 1FU1A 3AEAC 3FX0A 2XNDH 4QMAA 1M1JB 3Q5SA 4XE5B 1NKNA 1E79H 3CCVP 1X8YA 3AE3C 2XKMA 2ZFCA 2E76C 3AEFC 1PV3A 2IBZE 3IFMA 1KB9H 1R5LA 2D2CD 4WVZA 1DEEG 1ZOYC 3HD7D 4UB8E 5KLVK 3KHUA 2OYIB 2Z5IA 1CZQA 2R5BA 4JQ0D 2M5AB 2B89A 3JSVC 1PZQA 3IAOA 3A5TA 3RGUA 1RF1A 3H1HD 2YIUC 5APQA 5KAFE 2P10A 3MZWB 2E74D 1PGOA 1VPCA 4EI2A 5CHXA 1OWAA 1FAVA 2WSCJ 3CCSP 2J59M 1SFCD 1JY3P 3L70D 3USSA 1BGYJ 1AQ5A 3EWKA 1LT9A 1BDCA 3UIAA 1EDIA 2E43A 4PD4H 1L0LJ 1PGQA 1SQBK 3N4XA 1NTMG 1YQ4C 1KQSO 5AW0B 1OMIA 3M9QA 3MHVA 1JMBA 3KDPB 4OGQC 1NAFA 3O6QA 3CCUP 1Q82Q 3U1AA 1L4AA 1HF9A 1NTME 1LTBC 3G4SP 3CPWO 2AEFA 4NPDA 1QL1A 1WMKA 2FYUK 1JEKA 4BRYB 3AE7C 4I1LA 4D6TJ 2SPZA 4AYCA 1J1EB 2RH0A 4YTPC 3WU2E 3RL0D 4WB4A 2B88A 1KQGB 5DJTB 3NXSA 1MFZA 4N78E 1YJWP 2O01H 2ZT9D 3RK2C 1VQMP 1SQQJ 3H1HG 5AVXB 1NTZG 3S9OA 1H8AA 3H1KJ 3M0DC 4DT0A 3CX5I 1KFMA 1LT9C 1VQPP 3WUTA 1YTZI 5AVYB 3H1HE 2IFMA 3L71J 1NTZE 1KILA 2AXTE 4HB1A 3VP9A 2FFDA 1S72P 1FS0E 2FBWC 1VF5B 1VQOP 5L8RJ 3VP8A 4GT1A 2Z4EA 2OTLP 2OYOA 1FDIA 2Z5HA 3PH0A 5CBNA 1N73A 3VOPA 3I55P 3CCLP 3PLNA 3SFEC 1OXZA 1T3JA 1RQUA 1NGMB 2KZJA 3S4RA 2E75D 3AE4C 1LTGC 1N8RQ 3TGUG 1KORA 1U7JA 2QJPC 1MV8A 1RF0A 1RF1B 3V2NA 1U7MA 1LJ2A 3SWYA 2YO2A 2E75B 5TISH 3SWKA 4H44D 1JY3N 3B5NA 1LWUA 1IJDB 1ZXGA 1H0TB 2PFXA 5EFWB 2HODB 1LT9B 3ZDMA 3TGUE 1NTKJ 5K5GB 2XV5A 1FJKA 1BGYD 1YTZT 4R4LA 2KZIA 2W83C 1IFDA 1DEBA 3CXHD 3CL3D 1L0LD 2LR2A 5AW8B 4PD4I 4RO0A 2FFDC 1LTJC 1SQPG 3H32A 1P84H 2HG5D 1J2JB 3H1LE 1FZCA 3HUSA 1NTMJ 4WY4C 1NU1K 1L4AB 2WT7A 2OTKE 3L37A 1M1KQ 3V5BA 3BVHA 2QJYB 4JPZB 1QL2A 2R3SA 2JWAA 3MD0A 4PV1B 1PIXA 1SQPE 2POHA 2NPSC 1HGZA 1EDJA 5CCHA 1RH5B 2K9YA 2KI7B 1M1JA 1RE3A 1S9KD 1SQVD 4NPEA 1KYOE 4D6TD 2C9NY 1BCCG 5KLVJ 1LTIC 3H1JD 3S1KA 1YJ9P 3C8VA 1CSBA 3K5BA 4EDFA 1LNQA 1R8EA 3B5NC 4K35A 1SQQD 2P2UA 2YMKA 4I7ZB 2R5DA 5BVZA 1OZHA 1UIXA 1NH4A 2P58A 3H1KD 2PP6A 1BCCE 1N7LA 4PJ0E 3E1IA 1USDA 1NTZJ 2HLOA 2PAJA 1IFIA 1SQXK 2M5AA 1KILB 5AVUB 3HD7A 4HYTB 3QH9A 3MIWA 1URQD 2N1TD 3LW5H 1L0LG 3L71D 1Y8AA 1FE6A 1QGKB 2WTYA 1CI6A 3D70A 3CX5E 2Q1KA 5APVA 3D6ZA 1SQBJ 2WPVB 1HWTC 2FYNB 2KB7P 1X79B 1YITP 5KKZC 1N73B 2L5GB 3MTUE 4CPGA 4ZNCA 1NYHA 4IL6E 1L0LE 1SFCA 1IC2A 1T3UA 3L35A 5CCHC 1ZMEC 3FWNA 1N7SD 1OVVA 1M1JC 2KNCA 2KUBA 5CJ4A 3SFDC 1NU1E 1LT1A 1VQ5P 2BCCJ 4ZKPA 1N86A 4H0LD 4IFMA 2IDBA 1N2DC 4OWFA 1ZR4A 1IO4A 5AVRB 3KQGA 1T2KD 2YNYA 5H2FH 1R5SA 3L73J 4HH2A 3B5NB 4XA4A 1LWUB 3CCMP 3OA7A 1KB9E 3KYQA 1SQQG 3M0AA 2OYIC 1Q2NA 1S9KE 1QVGO 1NTKD 5KJ7D 1SQXG 1OFCX 1YQ3C 1JOCA 5E79H 3V2RA 2KOGA 2NRGA 4NPFX 3LW5J 3CCEP 3H1LJ 1GL2D 1SQQE 2J58A 1FZCB 2WSSH 4H13B 4AUWA 3HUSB 3L71G 2WT7B 3G9RA 3U1CA 2JP3A 3D71A 1NTMD 1SQXE 3RBZA 3B71A 1VQNP 1NVOA 2QM8A 2OTJP 4PD4E 2JKVA 3GLMA 3PP5A 2ZAEB 2WPQA 2N9YB 3L71E 2W6AA 5C39A 5APYA 5CJ0A 1GW3A 1EDLA 1FZAA 1PFIA 3CC4P 3VYIA 3W67A 3NTNA 3TK1A 4N78D 1FC2C 3F5HA 5AVVB 1BSHA 1X0TA 4R4MA 3MP7B 1NHLA 5KLVD 3VMXA 1BCCJ 1EC5A 5GTHH 2P67A 2QJKB 2RN0A 3GHGA 1RY3A 1J1EC 3T97A 2D2CB 2G3AA 3IN6A 2BASA 1AV1A 3HD7B 2LKMA 1NTKG 3RBXA 1IZNB 1NTZD 2MJZA 1BE3J 3VMYA 2IFNA 5APUA 1CI6B 2G8YA 1UIIA 2E5YA 1H0TA 2KS1B 2BEQD 3RK3D 1YI2P 2HODA 1K73Q 4TLFA 2AEMA 1SQBD 2E74B 1YIJP 1HGVA 1NTKE 3H25A 3VMAA 1SFCB 3A0BH 1JMMA 3M9HA 2I1KA 3GW6A 1NU1J 2QVAA 2KNCB 3PTZA 2CPBA 1VF5C 2Q9IA 1S5LH 1KYOI 2W27A 3L74G 2B87A 4LC1A 5AW5B 3W68A 3JC22 2O1JA 3HE5A 2GUSA 3CWBJ 2A45H 5GTIE 1JUNA 1L0NK 2CK3H 5AVWB 3N7NA 3L73D 2R44A 5KLVG 2C0XA 1GDTA 3IF4A 5CCGD 3TGUD 3L74E 4UB8H 3BATA 1FBMA 3MGNA 3H6PA 3WMM0 1GU4A 1RF1C 1HH0A 1DH3A 2BEZF 4N3YB 4HJGH 2E75C 3RL0B 1GW4A 5KLVE 2Q3EA 5TISE 2QEXP 3H1LD 1IK9A 1SQXJ 2H89C 3C9IA 2ZT9B 3KZIH 1EXIA 2IYPA 2OGUA 2KYVA 3AEDC 3Q1MA 2IX7C 1SQBG 1HUCA 1Y9BA 1SQPD 1USEA 2V7QH 1AVYA 4OGQD 1S3JA 4JF7A 5AVQB 1KYOD 3VN0A 3RK3E 1L4AC 1P84E 3L36A 5AW7B 1M90Q 1SQBE 1G1JA 1URQA 2QJYC 1X22A 2BCCG 1PL5A 1YHQP 1OVUA 3B8EB 2FYUG 2WSEH 4PV1C 3L73G 3NFQA 3GHGB 1KB9I 2Y0EA 4W7ZA 3AECC 1PPJG 3T97B 1BCCD 2RMZA 1MUUA 5M1BA 1HVVA 2K9JA 2KK7A 3G6EP 2BCCE 2O01J 2LXBA 3RK2D 2FYUE 1N7SA 1FZFA 2OARA 3OW2O 3L73E 3Q3DA 4I7ZC 3CX5D 1PPJE 1T6AA 4EIJA 1BDDA 3H1LG 1E5WA 1IFMA 4H44B 4IOIH 4DCKA 3HE4A 1EZVG 4RJTA 1KILC 3KXDA 1PGPA 2OYHA 5BU5A 3R2PA 3II6A 4BWNA 1JTHA 2WQYC 1NU1D 2B87B 4O9BA 2AXTH 2H8PD 3BRTB 5BU8B 4GOFA 2FYNC 2HYNA 3HE5B 5AW1B 2DW3A 2XNXA 4JBZA 1N73C 4OH8B 1FOSE 3VTPC 1EZVE 1GL2A 3AEBC 1NO4A 2O01N 1WRGA 2WSFH 3V4WA 1M56D 2WSEJ 3L74J 1KB9D 3AE8C 1SLQA 1ZR2A 2KLUA 1ZLLA 4WBAA 2YKOA 2YXQB 3G3ZA 3M91A 1RF0C 3LIDA 3JCUH 4L76A 3M06A 2B9BA 2KIKA 3A7OA 3G71P 4M3LA 1NWQA 1GD2E 4ZKUA 3GF7A 1M57D 1N7SC 4C7RA 1NOHA 3CD6P 5H2FE 1LWUC 1G2CA 1SQVK 1BE3G 4WWIA 1GK4A 3TF5A 2KP8A 2M3EA 1FOSF 3H1IG 1SQXD 2M0BA 1VL2A 5APXA 3AEEC 1DD4A 1ZRTE 1NKZB 1EQ7A 4PD4D 2R32A 1S5LX 1U57A 2M3BA 5E79E 3CCQP 1BE3E 3TNUA 3CCJP 1FZCC 2W6BA 4H13C 5KLIB 3HUSC 4YXWH 3P8CE 3Q5RA 4WY4D 1NU1G 4A7PA 2P7JA 3H1IE 2KS1A 1HJ0A 1URQB 2N1TB 3AE9C 4BXLA 1VQ6P 2H7HA 3L75G 1MKMA 4TT3H 3WUUA 4YXDC 4UB6H 1FZBA 2R3CA 1KV4A 1DIPA 3AE6C 3A0HH 3CWBG 4I6MC 2ZYAA 4KJMA 1JB0J 2NPSD 3CCRP 1RE3C 2IYOA 4XFJA 4L73A 1L0NJ 2K9JB 4C46A 2ZXXA 3MUDA 5KAIH 3V2QA 1IK7A 2VRSA 1Q86Q 2FYUJ 1OW7A 3L75E 1J1DB 1XTCC 1N7SB 2K37A 3EQ2A 3CWBE 1DX7A 2P1JA 3TYYA 2K88A 4H0LB 2XDJA 1JM0A 2Y0DA 2AXCA 3CI9A 2QJKC 1KQLA 2KXPB 4DJGA 5GTHE 2D2CC 1X9VA 3HE4B 2E42A 2JR8A 3CMEP 5B66H 3HD7C 2JDIH 4DZOA 4PJ0H 3M9BA 1PGJA 2OYHB 3V4QA 5CCGA 1JTHB 4GOEA 2KSJA 3R4YA 1OIPA 1QVFO 1SVFA 2YKQA 2LXCB 1P84I 1GTWA 2E74C 1GL2B 2H43A 2FXMA 3CX5H 2N9BA 2WSCH 1SFCC 3F89A 1KILE 1W2EA 1KTMA 2FYZA 2Q3IA 2W6JH 2YMYA 1KD1Q 1VQ8P 3CXHH 4ASVA 3L74D 2HFED 1HBWA 1S2EA 2ITAA 1IFNA 3MUDC 1FZEA 1EXJA 2JO1A 4W7YA 1JCCA 2E5TA 4Z1MH 4U7JA 2YKPA 3E1RA 1G2CB 2GM4A 1LGHB 2A06E 2ZYDA 4GIFA 2ZVNB 1JO5A 5DJUB 1VQ4P 4GODA 2JEEA 1LP1B 5B5EH 3TDKA 5AVSB 4Y99B 1RE4A 5CCGC 1VQLP 1W5CE 1Q7YQ 3RL0C 3TNUB 2QRXA 3GMAA 3H1IJ 2FKWB 1MFTA 3L72G 1HJBA 4KHXA 4B86A 1JY2O 1P84D 2ZT9C 5AVTB 1NTZK 4DOJA 3KZIE 3RL0g 1EZVI 3P32A 3V6IA 3Q5PA 1RQVA 5APTA 4IFDK 3CC2P 1K8AQ 2ZVOB 3RK3B 3M0DA 1FDOA 4C7NB 2HR3A 3L72E 1PP9J 2WMMA 3U59A 2KSEA 3EFGA 1VQKP 3L75J 4ASWA 1M7LA 1GU5A 1DD3A 4JYCA 1L0ND 3HTKA 1TU3F 4JYBA 2BCCD 2WPRA 2QIWA 4MN4C 2E76D 2FYUD 3P8MC 5KTBA 2WWWA 3V2PA 2W90A 2Q5UA 2JWDA 5AW6B 2L91A 1AFOA 2PGDA 3PJSK 3TSIA 3BCCJ 5AW3B 3AEGC 1PPJD 3GHGC 2ZYGA 2HPCA 2E76B 1FDMA 1FJPA 2RKLA 2YXRB 1RE4C 3D6YA 1QLED 1SQVJ 1KN7A 3I56P 2PRRA 3H1JJ 5KAFH 2NZ2A 1GMJA 3A3YB 4U3FJ 1M8OB 1H88A 2YIUB 1Z56A 4H44C 1EZVD 3BRVB 1YBKA 2GUVA 4ZMDA 2IZ0A 2O1KA 2XZRA 3PHLA 3L70G 3O8ZA 2WPSA 1XTGB 3EFFK 1VF5D 4YPCA 2AEJA 2H88C 2FXPA 3CXHI 2WVRA 5CMZA 4W80A 2N1TA 1L0NG 3KPEA 1YYCA 1LTJA 5AW2B 1HTLC 1SQPK 4OGQB 1S1CX 2ZJSE 1GK6A 3L70E 1ZW0A 4WY4A 5GTIH 1ZP0C 4I2LC 1Q81Q 4HKZH 3OJAB 1L0NE 1ZRTD 3WU2H 1OVRA 1JY2P 3JCUE 2NPSA 5APWA 5AVZB 1BE3D 2V4HA 3P8CD 1OX3A 3FXDA 3H1ID 1VDFA 4OVNF 3RK2B 5TJHA 1ZV8A 4IL6X 4N6JA 3L72J 4EOTA 2Y0CA 1OW6A 2IZ1A 4RKUJ 1KFNA 2V7QJ 3E7KA 1LTAC 3VMZA 1Y47A 5KLIC 3P7KA 1K9MQ 5KJ7A 1PP9D 1L4AD 3HTKB 3B4SA 1URQC 2N1TC 3L75D 3BASA 3Q2YA 1L0LK 4IFFA 2I8DA 3CLQA 1AA0A 4EYYQ 2WITA 1JNMA 3O6QB 3GF3A 2CPSA 3CWBD 3ITKA 1KMIZ 1S4XA 2QG4A 1VQ9P 2Y9YA 1JCDA 2A45I 3C1LA 3ABVC 4PV1D 1L2PA 1NAYA 3AE1C 4UB6E 3OAKA 2O3JA 1H89A 2HPCB 1FZGA 3A0HE 3BCCD 3QWOC 2Q7CA 2IBZI 1KC8Q 1VQ7P 2MKVA 4GKGA 1J1DC 5KAIE 2WZ7A 1AQTA 2C0WA 3IR9A 4Y28J 2QJPB 4H0LC 3CMAP 1T2KC 1QX8A 3CC7P 1EDKA 1A02F 2KLVA 1K04A 1KQFB 4U3FD 1LP1A 4KT0J 2K1AA 3AE2C 1KILD 1SQQK 3HRNA 5B66E 2OQQA 2OYHC 1OW8A 2C9LY 3LIEA 3I5CA 2OYIA 3GG2A 3H1HJ 5KJ7C 2ZXEB 1BGYG 1BSNA 1GZLA 2FFDB 1PP9G 2FY8A 1LTJB 2JJLA 1GL2C 3L70J 2GA1A 2WSFJ 1D7MA 4WY4B 2A06D 1BGYE 4C7NA 2QE7H 1NJIQ 3A2AA 1AJYA 2IBZD 3CXHE 1JY3O 3BCCG 1PP9E 1RHZB 2XU6A 1JY2N 3SSUA 2IPPA 2NPSB 1KYOH 1LTTC 4L74A 1AVOA 2I1JA 1LTSC 4GDOA 2Q6QA 3FGAD 3B5ND 5APSA 1SQVG 4L75A 4D6TG 1CW5A 1SP4A 1QEXA
chains in the Genus database with same CATH topology
1QL2A 2FKWB 1KZUB 1HJBA 4KHXA 3MD0A 4B86A 1JY2O 2POHA 4JF7A 2NPSC 5AVQB 1HGZA 3VN0A 5AVTB 2QM7A 5CCHA 4AQRD 4RESB 4Y99C 1L4AC 1NTZK 1M1JA 1RE3A 1S9KD 4DOJA 3L36A 5AW7B 3L4FA 1G1IA 2C9NY 3P32A 1G1JA 3NMDA 5APTA 1URQA 4LGDE 4IFDK 3RK3B 1ZN5A 3M0DA 5AW4B 1LTIC 4C7NB 3B8EB 3SWFA 1A02J 2WSEH 1CSBA 1NTKK 1MZ9A 5AW9B 3NFQA 3B5NC 3U59A 3GHGB 3EFGA 4W7ZA 2P2UA 1T8ZA 1M7LA 1GU5A 2R5DA 3H32B 5BVZA 4JYCA 3HTKA 1NH4A 1MUUA 4JYBA 2WPRA 1HVVA 2PP6A 2YO3A 1N7LA 3P8MC 5KTBA 3RK3C 2WWWA 3E1IA 3V2PA 2A45G 5CCHD 2Q5UA 2HLOA 2PAJA 5AW6B 1IFIA 3RK2D 1SQXK 2M8RA 1AFOA 1N7SA 1FZFA 1KILB 3TSIA 5AVUB 3HD7A 2OARA 5AW3B 4HYTB 3GHGC 4LLHA 1NTMK 3MIWA 1URQD 2N1TD 3LW5H 1IFJA 2HPCA 1WT6A 1FDMA 1FJPA 4EIJA 1FU1A 1E5WA 2WTYA 1CI6A 5APVA 1IFMA 1M1JB 1RE4C 1HWTC 4XE5B 1NKNA 2KB7P 1X79B 1N73B 2L5GB 3MTUE 3HE4A 1X8YA 1KILC 2XKMA 2OYHA 5BU5A 3R2PA 1SFCA 1IC2A 2ZFCA 3II6A 1JTHA 1T3UA 3L35A 3IFMA 3A3YB 5CCHC 1H88A 1Z56A 4O9BA 1N7SD 2H8PD 3BRTB 1M1JC 3HD7D 5KLVK 5BU8B 5CJ4A 2HYNA 3HE5B 3BRVB 5AW1B 2XNXA 1N73C 4OH8B 4ZKPA 1N86A 2GUVA 2OYIB 4IFMA 2Z5IA 1FOSE 3VTPC 1ZR4A 1N2DC 1IO4A 1CZQA 5AVRB 1GL2A 3KQGA 1T2KD 2R5BA 2YNYA 1NO4A 2O1KA 2XZRA 3O8ZA 2WPSA 1WRGA 3A5TA 2WSFH 4HH2A 3V4WA 1XTGB 1RF1A 3B5NB 4XA4A 1SLQA 1LWUB 1ZR2A 5APQA 1ZLLA 3OA7A 4WBAA 2YKOA 3KYQA 1VPCA 5CHXA 5CMZA 3M0AA 3G3ZA 1OWAA 3M91A 1FAVA 1RF0C 4W80A 2N1TA 2J59M 1SFCD 3LIDA 1JY3P 2OYIC 1S9KE 3KPEA 1YYCA 1LTJA 5AW2B 3M06A 1HTLC 3A7OA 1GD2E 1NWQA 1SQPK 4M3LA 1AQ5A 4ZKUA 5KJ7D 1GK6A 1LT9A 1N7SC 3UIAA 1JOCA 4C7RA 2E43A 4WY4A 1NOHA 3V2RA 2KOGA 1SQBK 3N4XA 1LWUC 1G2CA 5AW0B 4I2LC 1SQVK 1GL2D 1GK4A 2J58A 3M9QA 3OJAB 1FZCB 4AUWA 3HUSB 2KP8A 2WT7B 1FOSF 3KDPB 3U1CA 5APXA 1JY2P 1NAFA 2NPSA 5APWA 1NKZB 3U1AA 1EQ7A 2R32A 5AVZB 2M3BA 1L4AA 2QM8A 1LTBC 3P8CD 3TNUA 3PP5A 1QL1A 1VDFA 1FZCC 2W6BA 3RK2B 3HUSC 2FYUK 2WPQA 3P8CE 1ZV8A 4WY4D 2W6AA 5APYA 2P7JA 4I1LA 5CJ0A 1GW3A 1URQB 2N1TB 4AYCA 1FZAA 1J1EB 1PFIA 4N6JA 3VYIA 3RL0D 2H7HA 4EOTA 3NTNA 4WB4A 3TK1A 4N78D 1FZBA 2R3CA 1KFNA 5AVVB 1LTAC 3NXSA 3VMZA 1NHLA 1MFZA 4I6MC 4N78E 2O01H 2NPSD 3RK2C 3P7KA 3VMXA 5KJ7A 5AVXB 1RE3C 1L4AD 3HTKB 2P67A 1H8AA 1URQC 2N1TC 4C46A 3BASA 3GHGA 1J1EC 1RY3A 1L0LK 4IFFA 3MUDA 3V2QA 3CLQA 3M0DC 2WITA 2VRSA 1JNMA 3T97A 1KFMA 1LT9C 1J1DB 1XTCC 2CPSA 1N7SB 2BASA 1JCDA 3HD7B 2A45I 1YTZI 2LKMA 3EQ2A 3OAKA 2MJZA 1DX7A 2P1JA 3VMYA 3TYYA 1H89A 2HPCB 1FZGA 2IFNA 5AVYB 2XDJA 5APUA 2IFMA 3CI9A 1KILA 2Q7CA 1CI6B 3VP9A 1KQLA 2FFDA 3RK3D 2HODA 4GKGA 1J1DC 3VP8A 4GT1A 1X9VA 2WZ7A 3HE4B 2E42A 2Z4EA 2C0WA 3HD7C 4DZOA 3IR9A 1HGVA 3M9BA 2OYHB 3V4QA 2Z5HA 1SFCB 5CCGA 1JTHB 1N73A 1JMMA 3M9HA 3VOPA 1T2KC 2I1KA 2KSJA 1A02F 2KLVA 2CPBA 1OXZA 1SVFA 2YKQA 1T3JA 2Q9IA 1GTWA 2W27A 1GL2B 4LC1A 5AW5B 2H43A 1KILD 2FXMA 1LTGC 2N9BA 1SQQK 3HRNA 2O1JA 2OYHC 2WSCH 3HE5A 2C9LY 2GUSA 1SFCC 3LIEA 1MV8A 1RF0A 3I5CA 2A45H 1JUNA 1L0NK 1W2EA 2FYZA 1RF1B 3V2NA 2OYIA 2Q3IA 2YMYA 5AVWB 3N7NA 5KJ7C 2ZXEB 3SWYA 2YO2A 1GZLA 2C0XA 2HFED 1HBWA 1GDTA 1JY3N 1IFNA 2FFDB 5CCGD 3B5NA 1LWUA 1LTJB 1IJDB 1FZEA 2JJLA 1GL2C 2HODB 4W7YA 1LT9B 1JCCA 3BATA 1FBMA 3MGNA 3H6PA 2XV5A 3WMM0 1FJKA 2YKPA 1GU4A 4WY4B 1RF1C 1YTZT 1HH0A 1DH3A 4N3YB 1G2CB 2GM4A 1IFDA 1DEBA 1LGHB 4C7NA 3RL0B 1GW4A 3CL3D 3A2AA 5AW8B 4GIFA 2FFDC 1JY3O 1JO5A 1LTJC 2XU6A 1JY2N 1IK9A 2JEEA 3H32A 2IPPA 2NPSB 3C9IA 2HG5D 1J2JB 1LTTC 1FZCA 5AVSB 3HUSA 4WY4C 2I1JA 1LTSC 1NU1K 1L4AB 4Y99B 2WT7A 2KYVA 1RE4A 2IX7C 3B5ND 5CCGC 3L37A 3V5BA 5APSA 3BVHA 1HUCA 3RL0C 3TNUB 1CW5A 1SP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  3CLQ A;  4IFD K;  1L0N K;  3M9Q A;  1SQP K;  2WSF H;  2FYU K;  2O01 H;  2LKM A;  2WSE H;  1NTK K;  1NU1 K;  1SQX K;  5KLV K;  1SQB K;  2OAR A;  1NTZ K;  1NTM K;  1SQV K;  1SQQ K;  3LW5 H;  3G3Z A;  1L0L K;  2WSC H; 
#chains in the Genus database with same CATH topology
 1KZU B;  3BCC E;  2W8Z A;  3H1J G;  1Q90 D;  2QM7 A;  4AQR D;  3TGU J;  4U3F G;  4RES B;  4Y99 C;  5B5E E;  3L4F A;  1G1I A;  4BRY A;  3NMD A;  4LGD E;  2FXO A;  2QA4 P;  1SQV E;  3L72 D;  4D6T E;  3FWL A;  3H1K G;  3PRJ A;  1ZN5 A;  5AW4 B;  4H13 D;  3SWF A;  1A02 J;  1NTK K;  5CBO A;  2QSI A;  1MZ9 A;  5AW9 B;  3H1J E;  1YJN P;  1T8Z A;  1K05 A;  2J5U A;  3H32 B;  4U3F E;  1IFP A;  1SS1 A;  2YO3 A;  3AE5 C;  3FXE A;  3RK3 C;  2A45 G;  3H1K E;  5CCH D;  1W2B O;  2K3R A;  3A0B E;  4IL6 H;  5KKZ B;  2M8R A;  2A06 G;  4LLH A;  1NTM K;  2Y9Z A;  1SQP J;  1IFJ A;  2UWJ E;  2IBZ G;  1WT6 A;  1S5L E;  4K3A A;  3WUV A;  1FU1 A;  3AEA C;  3FX0 A;  2XND H;  4QMA A;  1M1J B;  3Q5S A;  4XE5 B;  1NKN A;  1E79 H;  3CCV P;  1X8Y A;  3AE3 C;  2XKM A;  2ZFC A;  2E76 C;  3AEF C;  1PV3 A;  2IBZ E;  3IFM A;  1KB9 H;  1R5L A;  2D2C D;  4WVZ A;  1DEE G;  1ZOY C;  3HD7 D;  4UB8 E;  5KLV K;  3KHU A;  2OYI B;  2Z5I A;  1CZQ A;  2R5B A;  4JQ0 D;  2M5A B;  2B89 A;  3JSV C;  1PZQ A;  3IAO A;  3A5T A;  3RGU A;  1RF1 A;  3H1H D;  2YIU C;  5APQ A;  5KAF E;  2P10 A;  3MZW B;  2E74 D;  1PGO A;  1VPC A;  4EI2 A;  5CHX A;  1OWA A;  1FAV A;  2WSC J;  3CCS P;  2J59 M;  1SFC D;  1JY3 P;  3L70 D;  3USS A;  1BGY J;  1AQ5 A;  3EWK A;  1LT9 A;  1BDC A;  3UIA A;  1EDI A;  2E43 A;  4PD4 H;  1L0L J;  1PGQ A;  1SQB K;  3N4X A;  1NTM G;  1YQ4 C;  1KQS O;  5AW0 B;  1OMI A;  3M9Q A;  3MHV A;  1JMB A;  3KDP B;  4OGQ C;  1NAF A;  3O6Q A;  3CCU P;  1Q82 Q;  3U1A A;  1L4A A;  1HF9 A;  1NTM E;  1LTB C;  3G4S P;  3CPW O;  2AEF A;  4NPD A;  1QL1 A;  1WMK A;  2FYU K;  1JEK A;  4BRY B;  3AE7 C;  4I1L A;  4D6T J;  2SPZ A;  4AYC A;  1J1E B;  2RH0 A;  4YTP C;  3WU2 E;  3RL0 D;  4WB4 A;  2B88 A;  1KQG B;  5DJT B;  3NXS A;  1MFZ A;  4N78 E;  1YJW P;  2O01 H;  2ZT9 D;  3RK2 C;  1VQM P;  1SQQ J;  3H1H G;  5AVX B;  1NTZ G;  3S9O A;  1H8A A;  3H1K J;  3M0D C;  4DT0 A;  3CX5 I;  1KFM A;  1LT9 C;  1VQP P;  3WUT A;  1YTZ I;  5AVY B;  3H1H E;  2IFM A;  3L71 J;  1NTZ E;  1KIL A;  2AXT E;  4HB1 A;  3VP9 A;  2FFD A;  1S72 P;  1FS0 E;  2FBW C;  1VF5 B;  1VQO P;  5L8R J;  3VP8 A;  4GT1 A;  2Z4E A;  2OTL P;  2OYO A;  1FDI A;  2Z5H A;  3PH0 A;  5CBN A;  1N73 A;  3VOP A;  3I55 P;  3CCL P;  3PLN A;  3SFE C;  1OXZ A;  1T3J A;  1RQU A;  1NGM B;  2KZJ A;  3S4R A;  2E75 D;  3AE4 C;  1LTG C;  1N8R Q;  3TGU G;  1KOR A;  1U7J A;  2QJP C;  1MV8 A;  1RF0 A;  1RF1 B;  3V2N A;  1U7M A;  1LJ2 A;  3SWY A;  2YO2 A;  2E75 B;  5TIS H;  3SWK A;  4H44 D;  1JY3 N;  3B5N A;  1LWU A;  1IJD B;  1ZXG A;  1H0T B;  2PFX A;  5EFW B;  2HOD B;  1LT9 B;  3ZDM A;  3TGU E;  1NTK J;  5K5G B;  2XV5 A;  1FJK A;  1BGY D;  1YTZ T;  4R4L A;  2KZI A;  2W83 C;  1IFD A;  1DEB A;  3CXH D;  3CL3 D;  1L0L D;  2LR2 A;  5AW8 B;  4PD4 I;  4RO0 A;  2FFD C;  1LTJ C;  1SQP G;  3H32 A;  1P84 H;  2HG5 D;  1J2J B;  3H1L E;  1FZC A;  3HUS A;  1NTM J;  4WY4 C;  1NU1 K;  1L4A B;  2WT7 A;  2OTK E;  3L37 A;  1M1K Q;  3V5B A;  3BVH A;  2QJY B;  4JPZ B;  1QL2 A;  2R3S A;  2JWA A;  3MD0 A;  4PV1 B;  1PIX A;  1SQP E;  2POH A;  2NPS C;  1HGZ A;  1EDJ A;  5CCH A;  1RH5 B;  2K9Y A;  2KI7 B;  1M1J A;  1RE3 A;  1S9K D;  1SQV D;  4NPE A;  1KYO E;  4D6T D;  2C9N Y;  1BCC G;  5KLV J;  1LTI C;  3H1J D;  3S1K A;  1YJ9 P;  3C8V A;  1CSB A;  3K5B A;  4EDF A;  1LNQ A;  1R8E A;  3B5N C;  4K35 A;  1SQQ D;  2P2U A;  2YMK A;  4I7Z B;  2R5D A;  5BVZ A;  1OZH A;  1UIX A;  1NH4 A;  2P58 A;  3H1K D;  2PP6 A;  1BCC E;  1N7L A;  4PJ0 E;  3E1I A;  1USD A;  1NTZ J;  2HLO A;  2PAJ A;  1IFI A;  1SQX K;  2M5A A;  1KIL B;  5AVU B;  3HD7 A;  4HYT B;  3QH9 A;  3MIW A;  1URQ D;  2N1T D;  3LW5 H;  1L0L G;  3L71 D;  1Y8A A;  1FE6 A;  1QGK B;  2WTY A;  1CI6 A;  3D70 A;  3CX5 E;  2Q1K A;  5APV A;  3D6Z A;  1SQB J;  2WPV B;  1HWT C;  2FYN B;  2KB7 P;  1X79 B;  1YIT P;  5KKZ C;  1N73 B;  2L5G B;  3MTU E;  4CPG A;  4ZNC A;  1NYH A;  4IL6 E;  1L0L E;  1SFC A;  1IC2 A;  1T3U A;  3L35 A;  5CCH C;  1ZME C;  3FWN A;  1N7S D;  1OVV A;  1M1J C;  2KNC A;  2KUB A;  5CJ4 A;  3SFD C;  1NU1 E;  1LT1 A;  1VQ5 P;  2BCC J;  4ZKP A;  1N86 A;  4H0L D;  4IFM A;  2IDB A;  1N2D C;  4OWF A;  1ZR4 A;  1IO4 A;  5AVR B;  3KQG A;  1T2K D;  2YNY A;  5H2F H;  1R5S A;  3L73 J;  4HH2 A;  3B5N B;  4XA4 A;  1LWU B;  3CCM P;  3OA7 A;  1KB9 E;  3KYQ A;  1SQQ G;  3M0A A;  2OYI C;  1Q2N A;  1S9K E;  1QVG O;  1NTK D;  5KJ7 D;  1SQX G;  1OFC X;  1YQ3 C;  1JOC A;  5E79 H;  3V2R A;  2KOG A;  2NRG A;  4NPF X;  3LW5 J;  3CCE P;  3H1L J;  1GL2 D;  1SQQ E;  2J58 A;  1FZC B;  2WSS H;  4H13 B;  4AUW A;  3HUS B;  3L71 G;  2WT7 B;  3G9R A;  3U1C A;  2JP3 A;  3D71 A;  1NTM D;  1SQX E;  3RBZ A;  3B71 A;  1VQN P;  1NVO A;  2QM8 A;  2OTJ P;  4PD4 E;  2JKV A;  3GLM A;  3PP5 A;  2ZAE B;  2WPQ A;  2N9Y B;  3L71 E;  2W6A A;  5C39 A;  5APY A;  5CJ0 A;  1GW3 A;  1EDL A;  1FZA A;  1PFI A;  3CC4 P;  3VYI A;  3W67 A;  3NTN A;  3TK1 A;  4N78 D;  1FC2 C;  3F5H A;  5AVV B;  1BSH A;  1X0T A;  4R4M A;  3MP7 B;  1NHL A;  5KLV D;  3VMX A;  1BCC J;  1EC5 A;  5GTH H;  2P67 A;  2QJK B;  2RN0 A;  3GHG A;  1RY3 A;  1J1E C;  3T97 A;  2D2C B;  2G3A A;  3IN6 A;  2BAS A;  1AV1 A;  3HD7 B;  2LKM A;  1NTK G;  3RBX A;  1IZN B;  1NTZ D;  2MJZ A;  1BE3 J;  3VMY A;  2IFN A;  5APU A;  1CI6 B;  2G8Y A;  1UII A;  2E5Y A;  1H0T A;  2KS1 B;  2BEQ D;  3RK3 D;  1YI2 P;  2HOD A;  1K73 Q;  4TLF A;  2AEM A;  1SQB D;  2E74 B;  1YIJ P;  1HGV A;  1NTK E;  3H25 A;  3VMA A;  1SFC B;  3A0B H;  1JMM A;  3M9H A;  2I1K A;  3GW6 A;  1NU1 J;  2QVA A;  2KNC B;  3PTZ A;  2CPB A;  1VF5 C;  2Q9I A;  1S5L H;  1KYO I;  2W27 A;  3L74 G;  2B87 A;  4LC1 A;  5AW5 B;  3W68 A;  3JC2 2;  2O1J A;  3HE5 A;  2GUS A;  3CWB J;  2A45 H;  5GTI E;  1JUN A;  1L0N K;  2CK3 H;  5AVW B;  3N7N A;  3L73 D;  2R44 A;  5KLV G;  2C0X A;  1GDT A;  3IF4 A;  5CCG D;  3TGU D;  3L74 E;  4UB8 H;  3BAT A;  1FBM A;  3MGN A;  3H6P A;  3WMM 0;  1GU4 A;  1RF1 C;  1HH0 A;  1DH3 A;  2BEZ F;  4N3Y B;  4HJG H;  2E75 C;  3RL0 B;  1GW4 A;  5KLV E;  2Q3E A;  5TIS E;  2QEX P;  3H1L D;  1IK9 A;  1SQX J;  2H89 C;  3C9I A;  2ZT9 B;  3KZI H;  1EXI A;  2IYP A;  2OGU A;  2KYV A;  3AED C;  3Q1M A;  2IX7 C;  1SQB G;  1HUC A;  1Y9B A;  1SQP D;  1USE A;  2V7Q H;  1AVY A;  4OGQ D;  1S3J A;  4JF7 A;  5AVQ B;  1KYO D;  3VN0 A;  3RK3 E;  1L4A C;  1P84 E;  3L36 A;  5AW7 B;  1M90 Q;  1SQB E;  1G1J A;  1URQ A;  2QJY C;  1X22 A;  2BCC G;  1PL5 A;  1YHQ P;  1OVU A;  3B8E B;  2FYU G;  2WSE H;  4PV1 C;  3L73 G;  3NFQ A;  3GHG B;  1KB9 I;  2Y0E A;  4W7Z A;  3AEC C;  1PPJ G;  3T97 B;  1BCC D;  2RMZ A;  1MUU A;  5M1B A;  1HVV A;  2K9J A;  2KK7 A;  3G6E P;  2BCC E;  2O01 J;  2LXB A;  3RK2 D;  2FYU E;  1N7S A;  1FZF A;  2OAR A;  3OW2 O;  3L73 E;  3Q3D A;  4I7Z C;  3CX5 D;  1PPJ E;  1T6A A;  4EIJ A;  1BDD A;  3H1L G;  1E5W A;  1IFM A;  4H44 B;  4IOI H;  4DCK A;  3HE4 A;  1EZV G;  4RJT A;  1KIL C;  3KXD A;  1PGP A;  2OYH A;  5BU5 A;  3R2P A;  3II6 A;  4BWN A;  1JTH A;  2WQY C;  1NU1 D;  2B87 B;  4O9B A;  2AXT H;  2H8P D;  3BRT B;  5BU8 B;  4GOF A;  2FYN C;  2HYN A;  3HE5 B;  5AW1 B;  2DW3 A;  2XNX A;  4JBZ A;  1N73 C;  4OH8 B;  1FOS E;  3VTP C;  1EZV E;  1GL2 A;  3AEB C;  1NO4 A;  2O01 N;  1WRG A;  2WSF H;  3V4W A;  1M56 D;  2WSE J;  3L74 J;  1KB9 D;  3AE8 C;  1SLQ A;  1ZR2 A;  2KLU A;  1ZLL A;  4WBA A;  2YKO A;  2YXQ B;  3G3Z A;  3M91 A;  1RF0 C;  3LID A;  3JCU H;  4L76 A;  3M06 A;  2B9B A;  2KIK A;  3A7O A;  3G71 P;  4M3L A;  1NWQ A;  1GD2 E;  4ZKU A;  3GF7 A;  1M57 D;  1N7S C;  4C7R A;  1NOH A;  3CD6 P;  5H2F E;  1LWU C;  1G2C A;  1SQV K;  1BE3 G;  4WWI A;  1GK4 A;  3TF5 A;  2KP8 A;  2M3E A;  1FOS F;  3H1I G;  1SQX D;  2M0B A;  1VL2 A;  5APX A;  3AEE C;  1DD4 A;  1ZRT E;  1NKZ B;  1EQ7 A;  4PD4 D;  2R32 A;  1S5L X;  1U57 A;  2M3B A;  5E79 E;  3CCQ P;  1BE3 E;  3TNU A;  3CCJ P;  1FZC C;  2W6B A;  4H13 C;  5KLI B;  3HUS C;  4YXW H;  3P8C E;  3Q5R A;  4WY4 D;  1NU1 G;  4A7P A;  2P7J A;  3H1I E;  2KS1 A;  1HJ0 A;  1URQ B;  2N1T B;  3AE9 C;  4BXL A;  1VQ6 P;  2H7H A;  3L75 G;  1MKM A;  4TT3 H;  3WUU A;  4YXD C;  4UB6 H;  1FZB A;  2R3C A;  1KV4 A;  1DIP A;  3AE6 C;  3A0H H;  3CWB G;  4I6M C;  2ZYA A;  4KJM A;  1JB0 J;  2NPS D;  3CCR P;  1RE3 C;  2IYO A;  4XFJ A;  4L73 A;  1L0N J;  2K9J B;  4C46 A;  2ZXX A;  3MUD A;  5KAI H;  3V2Q A;  1IK7 A;  2VRS A;  1Q86 Q;  2FYU J;  1OW7 A;  3L75 E;  1J1D B;  1XTC C;  1N7S B;  2K37 A;  3EQ2 A;  3CWB E;  1DX7 A;  2P1J A;  3TYY A;  2K88 A;  4H0L B;  2XDJ A;  1JM0 A;  2Y0D A;  2AXC A;  3CI9 A;  2QJK C;  1KQL A;  2KXP B;  4DJG A;  5GTH E;  2D2C C;  1X9V A;  3HE4 B;  2E42 A;  2JR8 A;  3CME P;  5B66 H;  3HD7 C;  2JDI H;  4DZO A;  4PJ0 H;  3M9B A;  1PGJ A;  2OYH B;  3V4Q A;  5CCG A;  1JTH B;  4GOE A;  2KSJ A;  3R4Y A;  1OIP A;  1QVF O;  1SVF A;  2YKQ A;  2LXC B;  1P84 I;  1GTW A;  2E74 C;  1GL2 B;  2H43 A;  2FXM A;  3CX5 H;  2N9B A;  2WSC H;  1SFC C;  3F89 A;  1KIL E;  1W2E A;  1KTM A;  2FYZ A;  2Q3I A;  2W6J H;  2YMY A;  1KD1 Q;  1VQ8 P;  3CXH H;  4ASV A;  3L74 D;  2HFE D;  1HBW A;  1S2E A;  2ITA A;  1IFN A;  3MUD C;  1FZE A;  1EXJ A;  2JO1 A;  4W7Y A;  1JCC A;  2E5T A;  4Z1M H;  4U7J A;  2YKP A;  3E1R A;  1G2C B;  2GM4 A;  1LGH B;  2A06 E;  2ZYD A;  4GIF A;  2ZVN B;  1JO5 A;  5DJU B;  1VQ4 P;  4GOD A;  2JEE A;  1LP1 B;  5B5E H;  3TDK A;  5AVS B;  4Y99 B;  1RE4 A;  5CCG C;  1VQL P;  1W5C E;  1Q7Y Q;  3RL0 C;  3TNU B;  2QRX A;  3GMA A;  3H1I J;  2FKW B;  1MFT A;  3L72 G;  1HJB A;  4KHX A;  4B86 A;  1JY2 O;  1P84 D;  2ZT9 C;  5AVT B;  1NTZ K;  4DOJ A;  3KZI E;  3RL0 g;  1EZV I;  3P32 A;  3V6I A;  3Q5P A;  1RQV A;  5APT A;  4IFD K;  3CC2 P;  1K8A Q;  2ZVO B;  3RK3 B;  3M0D A;  1FDO A;  4C7N B;  2HR3 A;  3L72 E;  1PP9 J;  2WMM A;  3U59 A;  2KSE A;  3EFG A;  1VQK P;  3L75 J;  4ASW A;  1M7L A;  1GU5 A;  1DD3 A;  4JYC A;  1L0N D;  3HTK A;  1TU3 F;  4JYB A;  2BCC D;  2WPR A;  2QIW A;  4MN4 C;  2E76 D;  2FYU D;  3P8M C;  5KTB A;  2WWW A;  3V2P A;  2W90 A;  2Q5U A;  2JWD A;  5AW6 B;  2L91 A;  1AFO A;  2PGD A;  3PJS K;  3TSI A;  3BCC J;  5AW3 B;  3AEG C;  1PPJ D;  3GHG C;  2ZYG A;  2HPC A;  2E76 B;  1FDM A;  1FJP A;  2RKL A;  2YXR B;  1RE4 C;  3D6Y A;  1QLE D;  1SQV J;  1KN7 A;  3I56 P;  2PRR A;  3H1J J;  5KAF H;  2NZ2 A;  1GMJ A;  3A3Y B;  4U3F J;  1M8O B;  1H88 A;  2YIU B;  1Z56 A;  4H44 C;  1EZV D;  3BRV B;  1YBK A;  2GUV A;  4ZMD A;  2IZ0 A;  2O1K A;  2XZR A;  3PHL A;  3L70 G;  3O8Z A;  2WPS A;  1XTG B;  3EFF K;  1VF5 D;  4YPC A;  2AEJ A;  2H88 C;  2FXP A;  3CXH I;  2WVR A;  5CMZ A;  4W80 A;  2N1T A;  1L0N G;  3KPE A;  1YYC A;  1LTJ A;  5AW2 B;  1HTL C;  1SQP K;  4OGQ B;  1S1C X;  2ZJS E;  1GK6 A;  3L70 E;  1ZW0 A;  4WY4 A;  5GTI H;  1ZP0 C;  4I2L C;  1Q81 Q;  4HKZ H;  3OJA B;  1L0N E;  1ZRT D;  3WU2 H;  1OVR A;  1JY2 P;  3JCU E;  2NPS A;  5APW A;  5AVZ B;  1BE3 D;  2V4H A;  3P8C D;  1OX3 A;  3FXD A;  3H1I D;  1VDF A;  4OVN F;  3RK2 B;  5TJH A;  1ZV8 A;  4IL6 X;  4N6J A;  3L72 J;  4EOT A;  2Y0C A;  1OW6 A;  2IZ1 A;  4RKU J;  1KFN A;  2V7Q J;  3E7K A;  1LTA C;  3VMZ A;  1Y47 A;  5KLI C;  3P7K A;  1K9M Q;  5KJ7 A;  1PP9 D;  1L4A D;  3HTK B;  3B4S A;  1URQ C;  2N1T C;  3L75 D;  3BAS A;  3Q2Y A;  1L0L K;  4IFF A;  2I8D A;  3CLQ A;  1AA0 A;  4EYY Q;  2WIT A;  1JNM A;  3O6Q B;  3GF3 A;  2CPS A;  3CWB D;  3ITK A;  1KMI Z;  1S4X A;  2QG4 A;  1VQ9 P;  2Y9Y A;  1JCD A;  2A45 I;  3C1L A;  3ABV C;  4PV1 D;  1L2P A;  1NAY A;  3AE1 C;  4UB6 E;  3OAK A;  2O3J A;  1H89 A;  2HPC B;  1FZG A;  3A0H E;  3BCC D;  3QWO C;  2Q7C A;  2IBZ I;  1KC8 Q;  1VQ7 P;  2MKV A;  4GKG A;  1J1D C;  5KAI E;  2WZ7 A;  1AQT A;  2C0W A;  3IR9 A;  4Y28 J;  2QJP B;  4H0L C;  3CMA P;  1T2K C;  1QX8 A;  3CC7 P;  1EDK A;  1A02 F;  2KLV A;  1K04 A;  1KQF B;  4U3F D;  1LP1 A;  4KT0 J;  2K1A A;  3AE2 C;  1KIL D;  1SQQ K;  3HRN A;  5B66 E;  2OQQ A;  2OYH C;  1OW8 A;  2C9L Y;  3LIE A;  3I5C A;  2OYI A;  3GG2 A;  3H1H J;  5KJ7 C;  2ZXE B;  1BGY G;  1BSN A;  1GZL A;  2FFD B;  1PP9 G;  2FY8 A;  1LTJ B;  2JJL A;  1GL2 C;  3L70 J;  2GA1 A;  2WSF J;  1D7M A;  4WY4 B;  2A06 D;  1BGY E;  4C7N A;  2QE7 H;  1NJI Q;  3A2A A;  1AJY A;  2IBZ D;  3CXH E;  1JY3 O;  3BCC G;  1PP9 E;  1RHZ B;  2XU6 A;  1JY2 N;  3SSU A;  2IPP A;  2NPS B;  1KYO H;  1LTT C;  4L74 A;  1AVO A;  2I1J A;  1LTS C;  4GDO A;  2Q6Q A;  3FGA D;  3B5N D;  5APS A;  1SQV G;  4L75 A;  4D6T G;  1CW5 A;  1SP4 A;  1QEX A; 
#chains in the Genus database with same CATH homology
 1QL2 A;  2FKW B;  1KZU B;  1HJB A;  4KHX A;  3MD0 A;  4B86 A;  1JY2 O;  2POH A;  4JF7 A;  2NPS C;  5AVQ B;  1HGZ A;  3VN0 A;  5AVT B;  2QM7 A;  5CCH A;  4AQR D;  4RES B;  4Y99 C;  1L4A C;  1NTZ K;  1M1J A;  1RE3 A;  1S9K D;  4DOJ A;  3L36 A;  5AW7 B;  3L4F A;  1G1I A;  2C9N Y;  3P32 A;  1G1J A;  3NMD A;  5APT A;  1URQ A;  4LGD E;  4IFD K;  3RK3 B;  1ZN5 A;  3M0D A;  5AW4 B;  1LTI C;  4C7N B;  3B8E B;  3SWF A;  1A02 J;  2WSE H;  1CSB A;  1NTK K;  1MZ9 A;  5AW9 B;  3NFQ A;  3B5N C;  3U59 A;  3GHG B;  3EFG A;  4W7Z A;  2P2U A;  1T8Z A;  1M7L A;  1GU5 A;  2R5D A;  3H32 B;  5BVZ A;  4JYC A;  3HTK A;  1NH4 A;  1MUU A;  4JYB A;  2WPR A;  1HVV A;  2PP6 A;  2YO3 A;  1N7L A;  3P8M C;  5KTB A;  3RK3 C;  2WWW A;  3E1I A;  3V2P A;  2A45 G;  5CCH D;  2Q5U A;  2HLO A;  2PAJ A;  5AW6 B;  1IFI A;  3RK2 D;  1SQX K;  2M8R A;  1AFO A;  1N7S A;  1FZF A;  1KIL B;  3TSI A;  5AVU B;  3HD7 A;  2OAR A;  5AW3 B;  4HYT B;  3GHG C;  4LLH A;  1NTM K;  3MIW A;  1URQ D;  2N1T D;  3LW5 H;  1IFJ A;  2HPC A;  1WT6 A;  1FDM A;  1FJP A;  4EIJ A;  1FU1 A;  1E5W A;  2WTY A;  1CI6 A;  5APV A;  1IFM A;  1M1J B;  1RE4 C;  1HWT C;  4XE5 B;  1NKN A;  2KB7 P;  1X79 B;  1N73 B;  2L5G B;  3MTU E;  3HE4 A;  1X8Y A;  1KIL C;  2XKM A;  2OYH A;  5BU5 A;  3R2P A;  1SFC A;  1IC2 A;  2ZFC A;  3II6 A;  1JTH A;  1T3U A;  3L35 A;  3IFM A;  3A3Y B;  5CCH C;  1H88 A;  1Z56 A;  4O9B A;  1N7S D;  2H8P D;  3BRT B;  1M1J C;  3HD7 D;  5KLV K;  5BU8 B;  5CJ4 A;  2HYN A;  3HE5 B;  3BRV B;  5AW1 B;  2XNX A;  1N73 C;  4OH8 B;  4ZKP A;  1N86 A;  2GUV A;  2OYI B;  4IFM A;  2Z5I A;  1FOS E;  3VTP C;  1ZR4 A;  1N2D C;  1IO4 A;  1CZQ A;  5AVR B;  1GL2 A;  3KQG A;  1T2K D;  2R5B A;  2YNY A;  1NO4 A;  2O1K A;  2XZR A;  3O8Z A;  2WPS A;  1WRG A;  3A5T A;  2WSF H;  4HH2 A;  3V4W A;  1XTG B;  1RF1 A;  3B5N B;  4XA4 A;  1SLQ A;  1LWU B;  1ZR2 A;  5APQ A;  1ZLL A;  3OA7 A;  4WBA A;  2YKO A;  3KYQ A;  1VPC A;  5CHX A;  5CMZ A;  3M0A A;  3G3Z A;  1OWA A;  3M91 A;  1FAV A;  1RF0 C;  4W80 A;  2N1T A;  2J59 M;  1SFC D;  3LID A;  1JY3 P;  2OYI C;  1S9K E;  3KPE A;  1YYC A;  1LTJ A;  5AW2 B;  3M06 A;  1HTL C;  3A7O A;  1GD2 E;  1NWQ A;  1SQP K;  4M3L A;  1AQ5 A;  4ZKU A;  5KJ7 D;  1GK6 A;  1LT9 A;  1N7S C;  3UIA A;  1JOC A;  4C7R A;  2E43 A;  4WY4 A;  1NOH A;  3V2R A;  2KOG A;  1SQB K;  3N4X A;  1LWU C;  1G2C A;  5AW0 B;  4I2L C;  1SQV K;  1GL2 D;  1GK4 A;  2J58 A;  3M9Q A;  3OJA B;  1FZC B;  4AUW A;  3HUS B;  2KP8 A;  2WT7 B;  1FOS F;  3KDP B;  3U1C A;  5APX A;  1JY2 P;  1NAF A;  2NPS A;  5APW A;  1NKZ B;  3U1A A;  1EQ7 A;  2R32 A;  5AVZ B;  2M3B A;  1L4A A;  2QM8 A;  1LTB C;  3P8C D;  3TNU A;  3PP5 A;  1QL1 A;  1VDF A;  1FZC C;  2W6B A;  3RK2 B;  3HUS C;  2FYU K;  2WPQ A;  3P8C E;  1ZV8 A;  4WY4 D;  2W6A A;  5APY A;  2P7J A;  4I1L A;  5CJ0 A;  1GW3 A;  1URQ B;  2N1T B;  4AYC A;  1FZA A;  1J1E B;  1PFI A;  4N6J A;  3VYI A;  3RL0 D;  2H7H A;  4EOT A;  3NTN A;  4WB4 A;  3TK1 A;  4N78 D;  1FZB A;  2R3C A;  1KFN A;  5AVV B;  1LTA C;  3NXS A;  3VMZ A;  1NHL A;  1MFZ A;  4I6M C;  4N78 E;  2O01 H;  2NPS D;  3RK2 C;  3P7K A;  3VMX A;  5KJ7 A;  5AVX B;  1RE3 C;  1L4A D;  3HTK B;  2P67 A;  1H8A A;  1URQ C;  2N1T C;  4C46 A;  3BAS A;  3GHG A;  1J1E C;  1RY3 A;  1L0L K;  4IFF A;  3MUD A;  3V2Q A;  3CLQ A;  3M0D C;  2WIT A;  2VRS A;  1JNM A;  3T97 A;  1KFM A;  1LT9 C;  1J1D B;  1XTC C;  2CPS A;  1N7S B;  2BAS A;  1JCD A;  3HD7 B;  2A45 I;  1YTZ I;  2LKM A;  3EQ2 A;  3OAK A;  2MJZ A;  1DX7 A;  2P1J A;  3VMY A;  3TYY A;  1H89 A;  2HPC B;  1FZG A;  2IFN A;  5AVY B;  2XDJ A;  5APU A;  2IFM A;  3CI9 A;  1KIL A;  2Q7C A;  1CI6 B;  3VP9 A;  1KQL A;  2FFD A;  3RK3 D;  2HOD A;  4GKG A;  1J1D C;  3VP8 A;  4GT1 A;  1X9V A;  2WZ7 A;  3HE4 B;  2E42 A;  2Z4E A;  2C0W A;  3HD7 C;  4DZO A;  3IR9 A;  1HGV A;  3M9B A;  2OYH B;  3V4Q A;  2Z5H A;  1SFC B;  5CCG A;  1JTH B;  1N73 A;  1JMM A;  3M9H A;  3VOP A;  1T2K C;  2I1K A;  2KSJ A;  1A02 F;  2KLV A;  2CPB A;  1OXZ A;  1SVF A;  2YKQ A;  1T3J A;  2Q9I A;  1GTW A;  2W27 A;  1GL2 B;  4LC1 A;  5AW5 B;  2H43 A;  1KIL D;  2FXM A;  1LTG C;  2N9B A;  1SQQ K;  3HRN A;  2O1J A;  2OYH C;  2WSC H;  3HE5 A;  2C9L Y;  2GUS A;  1SFC C;  3LIE A;  1MV8 A;  1RF0 A;  3I5C A;  2A45 H;  1JUN A;  1L0N K;  1W2E A;  2FYZ A;  1RF1 B;  3V2N A;  2OYI A;  2Q3I A;  2YMY A;  5AVW B;  3N7N A;  5KJ7 C;  2ZXE B;  3SWY A;  2YO2 A;  1GZL A;  2C0X A;  2HFE D;  1HBW A;  1GDT A;  1JY3 N;  1IFN A;  2FFD B;  5CCG D;  3B5N A;  1LWU A;  1LTJ B;  1IJD B;  1FZE A;  2JJL A;  1GL2 C;  2HOD B;  4W7Y A;  1LT9 B;  1JCC A;  3BAT A;  1FBM A;  3MGN A;  3H6P A;  2XV5 A;  3WMM 0;  1FJK A;  2YKP A;  1GU4 A;  4WY4 B;  1RF1 C;  1YTZ T;  1HH0 A;  1DH3 A;  4N3Y B;  1G2C B;  2GM4 A;  1IFD A;  1DEB A;  1LGH B;  4C7N A;  3RL0 B;  1GW4 A;  3CL3 D;  3A2A A;  5AW8 B;  4GIF A;  2FFD C;  1JY3 O;  1JO5 A;  1LTJ C;  2XU6 A;  1JY2 N;  1IK9 A;  2JEE A;  3H32 A;  2IPP A;  2NPS B;  3C9I A;  2HG5 D;  1J2J B;  1LTT C;  1FZC A;  5AVS B;  3HUS A;  4WY4 C;  2I1J A;  1LTS C;  1NU1 K;  1L4A B;  4Y99 B;  2WT7 A;  2KYV A;  1RE4 A;  2IX7 C;  3B5N D;  5CCG C;  3L37 A;  3V5B A;  5APS A;  3BVH A;  1HUC A;  3RL0 C;  3TNU B;  1CW5 A;  1SP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...