5KLVK

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
LTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5klvK00
3LW5H 5KLVK 1NTZK 2WSEH 1L0NK 1NTKK 3CLQA 1NU1K 2J59M 2WSFH 1SQQK 2OARA 2LKMA 2WSCH 3G3ZA 1L0LK 4IFDK 1SQBK 3M9QA 1SQXK 1SQPK 1SQVK 2O01H 2FYUK 1NTMK
chains in the Genus database with same CATH superfamily
1NTKD 2IBZE 3C8VA 3VMAA 2XU6A 2HR3A 1KILE 2E42A 5CJ4A 1S2EA 3Q5PA 1J1DB 5AW9B 1BCCJ 1NU1G 3H1IG 1SQXE 3H25A 4PV1B 1QLED 3WUVA 1NTZE 3PTZA 4JYBA 1OX3A 2BCCJ 3L72G 1NTMJ 3L75D 3CCJP 4RJTA 3SFDC 5KLVJ 2W8ZA 4K35A 1NO4A 5CCHC 4XFJA 2G3AA 2NPSA 3OAKA 3MD0A 3AEBC 4W80A 1NTMK 1X22A 3TSIA 1URQD 1M8OB 5KLVK 3H1IE 1VQ4P 1SP4A 4TT3H 1YHQP 3M0AA 3D6YA 1RHZB 1CZQA 1DIPA 3L70J 2A45H 3F5HA 1T2KD 1P84I 5AVXB 1ZRTD 4LLHA 5APSA 5CCGA 4B86A 3P8MC 4L74A 3VYIA 3LIEA 2E74D 1IFDA 2WSEH 1IZNB 3L71J 2P1JA 2GUVA 4IOIH 1IK9A 3USSA 3CXHE 1LNQA 3H1JD 4ZKUA 1GTWA 1L4AA 3MGNA 2R5BA 1NHLA 4N6JA 2HLOA 1OIPA 1KB9D 3A0HH 1FZCB 2IBZD 2Z4EA 2QJKB 1SQVG 1YJ9P 2ZJSE 3B5NC 3SWFA 3RK2C 3RL0B 2AEMA 5AVWB 3JC22 2M8RA 2OYOA 5AVZB 1QX8A 4GDOA 1S4XA 1NTZD 1GK6A 3SWKA 1IFMA 1IFPA 5B5EH 1S9KE 5KLIC 3E7KA 1PFIA 3OA7A 3H1KJ 1R5SA 2M3BA 2IFMA 2R3CA 4NPEA 1SQVE 1FS0E 2FYNC 2P2UA 3AE8C 4MN4C 3CCUP 4U7JA 3L73J 4R4MA 3A3YB 3RK3B 1USEA 1NU1D 3CC7P 1XTGB 1R8EA 3L74J 1DD3A 1KFNA 2R5DA 3CCMP 1LT9A 2OTJP 3P32A 3UIAA 3G6EP 2O3JA 4WBAA 1Q81Q 3L72D 1LT9C 1VQ8P 1EXJA 3KPEA 3IAOA 3L35A 2BEZF 4TLFA 1X9VA 1GW4A 1BE3J 1OVUA 3HD7C 2FYUD 2LKMA 3AE9C 5APXA 4I6MC 4D6TG 1BGYJ 2A06D 4N3YB 2K9JA 2KIKA 3A0HE 4W7ZA 1EDIA 1NTKK 2B87B 1Y47A 1YJNP 3QWOC 1SQBE 2FY8A 1L0NJ 4C46A 3CC2P 1AJYA 3IR9A 2Q1KA 1HTLC 1HJ0A 1KFMA 5KJ7D 1TU3F 2V7QJ 2R44A 2JDIH 1L0NK 3BCCJ 4D6TE 3TDKA 1USDA 1EDJA 1AVOA 2OGUA 2YIUC 3AEFC 2H88C 5CBOA 2C0XA 2HODB 3L4FA 1VQ9P 3OW2O 1OVRA 1PP9D 1FBMA 2Q5UA 3IF4A 1S9KD 1NWQA 1K8AQ 2B88A 5TJHA 3E1IA 4DJGA 2YKOA 2A45I 4HB1A 1SFCA 1JCCA 3Q5SA 1FAVA 1SQVD 1LTAC 3WMM0 2QSIA 1SFCC 1VQNP 3M91A 5GTHH 4PJ0H 2YMKA 1PPJE 3KZIE 3B5NB 1NKZB 3RK2B 3VMXA 1VQMP 2J59M 1JY2P 2H43A 4H13C 1PZQA 2ZAEB 3TGUG 1JOCA 1AVYA 1EDKA 1YQ3C 1A02F 2R3SA 3CI9A 3LW5J 3CL3D 3V4WA 1N2DC 2V7QH 5KLIB 4H0LD 1JUNA 2OYHC 1L0LE 1EZVE 1LT1A 4WY4C 2B89A 2ZT9C 1URQA 1JY3O 3F89A 2IPPA 4ASVA 2FYNB 1OWAA 4AYCA 2L91A 3A7OA 1OW8A 4JYCA 1BDDA 2YMYA 2J58A 1NVOA 1LWUA 1OW7A 1SQXJ 2WSSH 1LTGC 4GODA 3TGUE 1CW5A 4HJGH 1LWUC 3P8CE 4YPCA 3R4YA 1QL2A 1GDTA 3S1KA 1LT9B 1SQXK 4K3AA 1VQLP 1N8RQ 1U7MA 1NTZK 1H8AA 1RE3C 3WU2E 3HD7B 1ZN5A 4U3FJ 1Q2NA 1VF5D 2LXBA 2KI7B 3I56P 1IJDB 3N4XA 3CX5D 2I1KA 1KB9H 1NU1K 3IN6A 1CSBA 1LTBC 4ZMDA 1HVVA 1YQ4C 3M9QA 3E1RA 4YTPC 1KILC 1ZP0C 1H88A 5APTA 1K73Q 2OYIA 2YIUB 1EZVI 2YXQB 1FU1A 1VQPP 1LGHB 1QGKB 3H1HG 2WT7A 1HH0A 3AE5C 1RF0C 1X8YA 1GL2D 1IC2A 1Z56A 4H44D 5M1BA 2M5AA 1SFCB 5E79H 2KS1A 1ZRTE 4Y28J 3C1LA 2JWAA 2N1TD 3MHVA 1W2BO 1RH5B 3CWBJ 2QG4A 2E5YA 4H13B 4W7YA 1KQFB 1N73A 4C7NA 1M90Q 2OQQA 1RQUA 3K5BA 1IFJA 3H1JE 5EFWB 1GU4A 3M9BA 2OYHB 3L74D 3AEDC 3N7NA 2KLUA 2ZT9B 3CXHH 1N86A 4L73A 2HYNA 1N7LA 1BSHA 1SQVK 1URQB 2CK3H 3AEAC 1H0TB 1JMBA 2P7JA 3H1LG 2K3RA 2WSEJ 5BVZA 1YTZT 1FZAA 3V2NA 2D2CD 1KQGB 1LWUB 2B9BA 5KJ7A 1YJWP 5L8RJ 1MZ9A 3ABVC 5AW4B 1S5LE 2KSJA 2H89C 2XDJA 2VRSA 2QM7A 3HUSA 3SWYA 2AXTE 1JY3P 2KUBA 4Z1MH 2E75D 3HUSC 3H1LE 1KQSO 3NFQA 2WPVB 5KKZC 1SQPG 1SQBJ 4RKUJ 1SQQD 2FYUG 3HE4A 1OVVA 2NPSC 1M7LA 1NU1E 1YIJP 5E79E 2A06G 1WRGA 1JNMA 4UB6H 1T3UA 3G3ZA 1SQBK 3L72E 1JM0A 4D6TJ 5BU5A 3H6PA 1KILB 3VMYA 3NTNA 5CCGC 1YTZI 4C7RA 1NJIQ 4OGQD 3H1HD 2ZVOB 1JY2O 2WSCH 3BASA 1SQPE 2WMMA 2FYUE 2PRRA 1FOSF 1LJ2A 2GM4A 3AECC 3JSVC 1FOSE 2A06E 2WPQA 1KB9I 1G2CB 3HRNA 1P84D 3EQ2A 5KAFH 2YKPA 2WT7B 2IBZI 2Z5IA 1PP9G 1L4AC 1LTIC 2BASA 2HPCA 1YBKA 1QL1A 1ZW0A 5APWA 1Q86Q 2O1KA 2KS1B 2FFDA 2QJYC 2ZYGA 4YXDC 2W6BA 1ZMEC 1SVFA 3H32B 3PJSK 3GW6A 1HF9A 5B66E 1L0LJ 4IL6E 1RE4A 5AVSB 1PP9E 2C9NY 4L76A 1RE4C 1X79B 4BXLA 3H1LD 3SFEC 3GMAA 1L0LK 2IX7C 2PFXA 4UB6E 3AE3C 4GIFA 1MFZA 2LR2A 1BCCG 3GHGA 3JCUH 1PGQA 3VOPA 4DZOA 3GHGC 2E43A 4HKZH 3KZIH 1CI6A 2KSEA 2O01H 2C9LY 2BCCG 1LTJA 5KLVG 1ZR2A 3CXHI 5AW6B 5AVYB 3RBZA 3RL0D 2WSFH 4DCKA 3EFGA 1SQPD 1G1IA 1VQ7P 4RO0A 3HUSB 5KAFE 1NTKJ 5KTBA 1KTMA 4L75A 4GOFA 1GL2A 5KKZB 3U59A 2NPSB 2I1JA 3L70G 4JPZB 5AVRB 2BCCE 1UIXA 3L71G 3L75J 3RK3D 3O6QA 2POHA 3PP5A 3BRVB 1WT6A 1R5LA 2MKVA 3EWKA 3BATA 3AE1C 1HUCA 1FZEA 3M0DA 4ZNCA 3U1AA 2NZ2A 3M0DC 4UB8E 4R4LA 1PGPA 4PD4E 2XNXA 4N78D 3WU2H 2V4HA 1DEEG 3CX5E 1LTTC 2WWWA 1JCDA 2HFED 3MZWB 3L71E 2Y0DA 1L4AB 3KXDA 1JEKA 3JCUE 2FXPA 5CCHD 3RBXA 2K9YA 2GA1A 3CPWO 3C9IA 4I7ZC 5AW2B 2QJYB 4JQ0D 2P67A 1HWTC 5CMZA 3H1JJ 3FWNA 4EI2A 1KMIZ 3D70A 1L2PA 4DT0A 3VN0A 3H1KG 2O01N 1ZXGA 5APQA 4EYYQ 1BCCD 2KB7P 1URQC 3L74G 2BEQD 5AW8B 1JMMA 1BSNA 1RF1A 1IO4A 4WB4A 3PHLA 1KYOE 1K04A 2QVAA 1NTZJ 2BCCD 1T2KC 1UIIA 1NTMD 1FZBA 3GHGB 5KLVD 1K05A 2ZVNB 4BRYA 3CCEP 2E74C 3SSUA 2Y9YA 1BE3G 5GTIH 2KK7A 4OGQC 4EOTA 3B5ND 4AUWA 3CD6P 2Y9ZA 2W27A 4Y99C 3L74E 2QEXP 3TF5A 3AE2C 1NU1J 2P58A 3H1IJ 4HYTB 2KXPB 2IDBA 3FX0A 4PD4D 3L70D 1VQ6P 4JBZA 1ZR4A 1GL2B 1L0NG 2J5UA 2FXOA 2K9JB 1OXZA 3L72J 4OH8B 3L71D 1EXIA 1SQQG 2IFNA 2AXCA 1G1JA 1MKMA 5CBNA 2PGDA 2AEFA 2QA4P 2YNYA 2K1AA 2E76D 3BCCG 5DJTB 2XKMA 3B4SA 5BU8B 2FKWB 1Y8AA 3ZDMA 1S5LH 1JTHA 2RMZA 1Y9BA 3M9HA 1W5CE 4IFMA 5AVQB 1SQPK 4YXWH 2OYIC 4I2LC 2FYUK 1OMIA 2AXTH 1SQQE 1M56D 3CCQP 2XNDH 3ITKA 1T6AA 1NKNA 2DW3A 3HD7D 2KLVA 1HGVA 3G4SP 3BCCE 1RQVA 2KYVA 2JWDA 2Y0EA 2Q7CA 2R32A 1QEXA 1VQKP 2ZXEB 1HGZA 2YKQA 1E5WA 1KYOD 1PIXA 4I7ZB 3CCSP 5GTIE 1GD2E 3H1HE 3V6IA 1IK7A 2CPSA 3H1KD 4WVZA 2NRGA 1N73C 2WPSA 3TYYA 1LTSC 3L73D 2H7HA 2M3EA 1SQVJ 4A7PA 1X0TA 3V5BA 1P84E 1FDIA 2H8PD 2JP3A 4BWNA 1Q7YQ 1BDCA 3HE5A 2WPRA 2Y0CA 1S72P 4GOEA 1DD4A 1GU5A 3HTKA 2YO2A 3QH9A 1PGJA 2WSCJ 1BE3D 1J1EC 1LP1A 1EDLA 5AVTB 5AW7B 5KJ7C 4XE5B 3T97A 2E74B 1BGYD 5H2FE 4BRYB 2Q9IA 4OGQB 1NH4A 4U3FG 2CPBA 4Y99B 1N7SD 5B66H 4H13D 4IL6H 3L36A 1L0ND 1WMKA 3V2PA 2IYPA 3S9OA 3Q3DA 3V2QA 2KP8A 2IZ1A 1DX7A 3S4RA 3CLQA 1E79H 5CCHA 3PLNA 5CJ0A 3WUTA 3V2RA 3IFMA 4WY4D 3BCCD 2ZT9D 1AQ5A 5AW0B 2Q3IA 2B87A 4U3FE 4AQRD 1M1JA 3NMDA 4M3LA 1M1JC 1S3JA 1ZOYC 2OTLP 1FJPA 2UWJE 2LXCB 4GT1A 1JTHB 5K5GB 2OYIB 4PV1D 1FZFA 4H0LC 4NPFX 2ZYDA 3OJAB 3PRJA 3KYQA 2HODA 3FWLA 1QVFO 4HH2A 1HJBA 2O01J 2N9YB 1KZUB 1AFOA 1MUUA 3CWBG 2M5AB 3FGAD 3RK3E 2RKLA 4LGDE 2L5GB 2WSFJ 3AE4C 3CCVP 2FFDC 1EC5A 1U57A 1S5LX 3B5NA 1A02J 3B71A 1N73B 3CCRP 4C7NB 5APUA 1KILD 4N78E 1PGOA 2AEJA 3VP8A 1VDFA 2A45G 1SQXD 4KJMA 4UB8H 1VF5C 1PV3A 4PD4H 1OW6A 3CMAP 3CWBE 3VP9A 1GK4A 4NPDA 3TGUJ 3CX5H 4XA4A 2QJPC 1NYHA 3HE5B 1PL5A 3VTPC 1NOHA 1EQ7A 3GG2A 5APVA 3KHUA 1RY3A 1Q82Q 3HTKB 2FXMA 1J1EB 2P10A 3A0BH 1OFCX 4U3FD 4ZKPA 2E76C 3MTUE 3H1ID 3AE6C 1NTMG 1LP1B 1W2EA 5CHXA 3T97B 2KOGA 1KQLA 1LTJC 2Q6QA 1FDMA 1VQ5P 2ITAA 3RL0g 2K88A 1SQBG 2WQYC 1BCCE 1NAFA 2ZXXA 3HD7A 4KHXA 1NAYA 1GL2C 1HBWA 3HE4B 4H44C 3TK1A 1AQTA 1U7JA 3NXSA 2PP6A 3RGUA 2JO1A 2N1TA 1NTME 3U1CA 1QVGO 4IFDK 3CXHD 1GZLA 5KLVE 3MP7B 1KYOH 2N1TC 1K9MQ 1JY2N 2KNCA 1GMJA 1JO5A 3PH0A 1J2JB 3V4QA 1M1JB 4EIJA 1T3JA 3KDPB 1JB0J 1AV1A 3I55P 1Q90D 1GW3A 2WVRA 1SQQJ 4IL6X 3L70E 2GUSA 2E5TA 5AW5B 4H0LB 2QRXA 4QMAA 1FDOA 2HG5D 3MIWA 3A5TA 1PPJG 1SLQA 1SQQK 3TNUA 5B5EE 3CWBD 2IYOA 3MUDA 2JJLA 3MUDC 1VQOP 2HPCB 1IFNA 2JEEA 2FYZA 3H1HJ 1YI2P 3A0BE 2D2CC 2NPSD 2QE7H 1ZLLA 4LC1A 1FZGA 3KQGA 2FFDB 1FE6A 3O8ZA 1L0LG 1EZVG 3BRTB 4OWFA 1T8ZA 1YITP 1N7SA 1XTCC 3L37A 4OVNF 1N7SC 5CCGD 2E75C 3M06A 2MJZA 1VF5B 5AW1B 1D7MA 3L73G 3D71A 1FC2C 3A2AA 2RN0A 5TISH 2OYHA 2QJPB 4WY4A 2JKVA 2RH0A 3W68A 2OARA 1RF1C 1ZV8A 2M0BA 2WZ7A 1H0TA 1IFIA 1L4AD 2XV5A 3H1KE 2E76B 3FXEA 4EDFA 4CPGA 5DJUB 3CCLP 1CI6B 2K37A 3H1LJ 3L73E 1SQBD 4KT0J 4PD4I 1J1DC 3FXDA 3RK2D 1LTJB 1NTKG 1FJKA 3CX5I 3G71P 1BGYG 4I1LA 3AEEC 4PV1C 2G8YA 5AVUB 1YYCA 1P84H 1KC8Q 1RE3A 1MV8A 3I5CA 1KORA 4D6TD 1VL2A 2W83C 2W6AA 1SS1A 4H44B 2KZIA 2I8DA 2N9BA 2IZ0A 4DOJA 2ZYAA 1BE3E 3L75G 2ZFCA 2YO3A 1DEBA 1S1CX 3BVHA 4IFFA 2N1TB 5KAIH 1NTKE 1M57D 3LW5H 1OZHA 2WITA 1SQPJ 5GTHE 1BGYE 2FYUJ 4PJ0E 2W6JH 4ASWA 2KNCB 3GLMA 3O6QB 2JR8A 2PAJA 1KILA 5H2FH 3CC4P 1H89A 5C39A 1KV4A 1PPJD 1MFTA 1L0NE 2WTYA 2SPZA 3R2PA 4JF7A 2XZRA 3Q2YA 3L75E 5TISE 3W67A 3GF7A 2Z5HA 1KYOI 1M1KQ 1G2CA 3TNUB 4GKGA 2OTKE 1RF0A 2FBWC 3B8EB 2C0WA 1L0LD 2D2CB 1EZVD 3AEGC 5AW3B 2Q3EA 3H1JG 1FZCA 1FZCC 3EFFK 1PP9J 1KD1Q 3VMZA 4RESB 1DH3A 3P7KA 2QJKC 3LIDA 2KZJA 4O9BA 5APYA 3G9RA 3CMEP 3TGUD 1JY3N 3RL0C 3H32A 1NGMB 3P8CD 1N7SB 2IBZG 2YXRB 2E75B 1VPCA 3Q1MA 2QIWA 3II6A 4WWIA 3D6ZA 1SQXG 3AE7C 3Q5RA 1NTZG 3WUUA 2W90A 4WY4B 5KAIE 1RF1B 2QM8A 1KB9E 1KN7A 2O1JA 5AVVB 3RK3C 1SFCD 1AA0A 3GF3A
chains in the Genus database with same CATH topology
2XNXA 1N73B 1IJDB 3N4XA 4N78D 4C7NB 5APUA 1KILD 4N78E 2I1KA 2XU6A 3VP8A 1VDFA 1NU1K 1LTTC 5CJ4A 2E42A 1J1DB 2A45G 2WWWA 1JCDA 1CSBA 2HFED 5AW9B 1LTBC 1L4AB 1HVVA 3VP9A 1GK4A 3M9QA 5CCHD 4XA4A 1KILC 3HE5B 3C9IA 4JYBA 1H88A 3VTPC 5APTA 5AW2B 1NOHA 1EQ7A 5APVA 2P67A 1HWTC 2OYIA 1NO4A 5CMZA 1RY3A 3HTKB 2FXMA 5CCHC 1J1EB 2NPSA 1FU1A 1LGHB 3OAKA 4ZKPA 3MD0A 4W80A 1NTMK 3MTUE 3TSIA 2WT7A 1HH0A 1URQD 5KLVK 1W2EA 3VN0A 1RF0C 1SP4A 5CHXA 1X8YA 2KOGA 1KQLA 3M0AA 1LTJC 1GL2D 1IC2A 1CZQA 1FDMA 1Z56A 2A45H 1T2KD 5APQA 1SFCB 5AVXB 5APSA 4LLHA 2KB7P 5CCGA 1URQC 4B86A 3P8MC 3VYIA 5AW8B 1NAFA 1JMMA 3LIEA 2N1TD 3HD7A 1IFDA 1RF1A 2WSEH 4KHXA 1IO4A 4WB4A 1GL2C 2P1JA 2GUVA 1HBWA 3HE4B 3TK1A 1T2KC 3NXSA 2PP6A 1IK9A 4W7YA 1FZBA 1N73A 3GHGB 2N1TA 4C7NA 3U1CA 4IFDK 1GZLA 2N1TC 4ZKUA 1IFJA 1JY2N 1GTWA 1L4AA 4EOTA 3B5ND 1JO5A 3MGNA 1J2JB 3V4QA 1M1JB 4EIJA 1T3JA 2R5BA 3KDPB 1GU4A 4AUWA 2W27A 1NHLA 3M9BA 2OYHB 4N6JA 2HLOA 4Y99C 3N7NA 1N86A 1GW3A 1FZCB 2HYNA 4HYTB 1N7LA 1SQVK 1URQB 2Z4EA 2P7JA 2GUSA 1ZR4A 5AW5B 3B5NC 5BVZA 3SWFA 1YTZT 3RK2C 3RL0B 2HG5D 1GL2B 1FZAA 3MIWA 3V2NA 3A5TA 1OXZA 1SLQA 1LWUB 1SQQK 4OH8B 3TNUA 5AVWB 2M8RA 5KJ7A 2IFNA 3MUDA 5AVZB 1MZ9A 1G1JA 2JJLA 5AW4B 1GK6A 2YNYA 1IFMA 2KSJA 2HPCB 1IFNA 2JEEA 2FYZA 2XKMA 1S9KE 2XDJA 2NPSD 2VRSA 2QM7A 5BU8B 3HUSA 2FKWB 1PFIA 1ZLLA 3OA7A 3SWYA 4LC1A 1FZGA 1JTHA 1JY3P 3KQGA 3M9HA 2M3BA 2IFMA 2R3CA 3HUSC 2FFDB 2P2UA 3O8ZA 3NFQA 4IFMA 5AVQB 1SQPK 3BRTB 4I2LC 2FYUK 3A3YB 2OYIC 3RK3B 1T8ZA 3HE4A 1N7SA 2NPSC 1M7LA 1XTGB 1XTCC 3L37A 1KFNA 1N7SC 1NKNA 2R5DA 5CCGD 3M06A 1WRGA 1LT9A 2MJZA 3P32A 1JNMA 3UIAA 1T3UA 5AW1B 3G3ZA 3HD7D 2KLVA 4WBAA 1HGVA 1SQBK 1LT9C 2KYVA 2Q7CA 3KPEA 2R32A 2ZXEB 1HGZA 3A2AA 5BU5A 3H6PA 2YKQA 2OYHA 1KILB 1E5WA 4WY4A 3VMYA 3NTNA 3L35A 5CCGC 1YTZI 4C7RA 1X9VA 1GW4A 2OARA 3HD7C 1RF1C 2LKMA 1ZV8A 1JY2O 2WSCH 3BASA 2WZ7A 1GD2E 1IFIA 5APXA 4I6MC 1FOSF 2GM4A 2CPSA 1L4AD 2XV5A 1FOSE 2WPQA 1N73C 2WPSA 4N3YB 3TYYA 1LTSC 1G2CB 4W7ZA 3HRNA 2H7HA 1CI6B 3EQ2A 2YKPA 3V5BA 1NTKK 2WT7B 1J1DC 2H8PD 3RK2D 1LTJB 2Z5IA 4C46A 1FJKA 1L4AC 1LTIC 2BASA 4I1LA 3IR9A 2HPCA 3HE5A 5AVUB 1QL1A 1YYCA 2WPRA 1HTLC 1RE3A 1MV8A 5APWA 1KFMA 5KJ7D 3I5CA 2O1KA 1L0NK 2FFDA 2W6BA 1GU5A 3HTKA 2W6AA 2YO2A 1SVFA 3H32B 1J1EC 2N9BA 4DOJA 2ZFCA 2C0XA 2YO3A 5AVTB 1DEBA 2HODB 3L4FA 5AW7B 4XE5B 3T97A 5KJ7C 3BVHA 4IFFA 2N1TB 1RE4A 3LW5H 1FBMA 2Q5UA 5AVSB 1S9KD 1NWQA 2WITA 2C9NY 2Q9IA 3E1IA 1RE4C 1X79B 2YKOA 2A45I 1NH4A 1SFCA 1JCCA 1FAVA 2CPBA 4Y99B 1LTAC 3WMM0 1N7SD 2PAJA 1L0LK 3L36A 1KILA 1SFCC 2IX7C 1H89A 3M91A 3V2PA 2WTYA 3V2QA 2KP8A 3B5NB 4GIFA 1NKZB 1DX7A 3R2PA 4JF7A 3RK2B 3VMXA 1MFZA 2XZRA 3GHGA 3CLQA 2J59M 1JY2P 5CJ0A 5CCHA 2H43A 3VOPA 3V2RA 2Z5HA 3IFMA 4WY4D 4DZOA 3GHGC 1AQ5A 2E43A 1JOCA 1G2CA 3TNUB 5AW0B 1CI6A 2Q3IA 4GKGA 2O01H 1RF0A 4AQRD 2C9LY 1A02F 3B8EB 1M1JA 3CI9A 1LTJA 3CL3D 2C0WA 3NMDA 3V4WA 1N2DC 4M3LA 1ZR2A 1M1JC 5AW6B 5AVYB 3RL0D 5AW3B 1JUNA 2WSFH 2OYHC 1FZCA 4WY4C 3EFGA 1G1IA 1URQA 1FJPA 1JY3O 3HUSB 2IPPA 1OWAA 4AYCA 3A7OA 1FZCC 4GT1A 1JTHB 5KTBA 3VMZA 4RESB 1DH3A 4JYCA 3P7KA 4O9BA 3LIDA 2OYIB 1FZFA 5APYA 1GL2A 2YMYA 2J58A 3U59A 1LWUA 1JY3N 2NPSB 1LTGC 3RL0C 3H32A 1CW5A 2I1JA 3P8CD 3OJAB 1LWUC 1N7SB 1VPCA 3P8CE 3KYQA 2HODA 5AVRB 1QL2A 3II6A 4HH2A 1HJBA 1GDTA 1LT9B 1SQXK 1KZUB 1AFOA 1MUUA 3RK3D 2POHA 1NTZK 3PP5A 3BRVB 1WT6A 1H8AA 4LGDE 2L5GB 1RE3C 4WY4B 3BATA 3HD7B 1HUCA 1ZN5A 2FFDC 1RF1B 1FZEA 2QM8A 3M0DA 3U1AA 2O1JA 5AVVB 3B5NA 1A02J 3M0DC 3RK3C 1SFCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 H;  5KLV K;  1NTZ K;  2WSE H;  1L0N K;  1NTK K;  3CLQ A;  1NU1 K;  2J59 M;  2WSF H;  1SQQ K;  2OAR A;  2LKM A;  2WSC H;  3G3Z A;  1L0L K;  4IFD K;  1SQB K;  3M9Q A;  1SQX K;  1SQP K;  1SQV K;  2O01 H;  2FYU K;  1NTM K; 
#chains in the Genus database with same CATH topology
 1NTK D;  2IBZ E;  3C8V A;  3VMA A;  2XU6 A;  2HR3 A;  1KIL E;  2E42 A;  5CJ4 A;  1S2E A;  3Q5P A;  1J1D B;  5AW9 B;  1BCC J;  1NU1 G;  3H1I G;  1SQX E;  3H25 A;  4PV1 B;  1QLE D;  3WUV A;  1NTZ E;  3PTZ A;  4JYB A;  1OX3 A;  2BCC J;  3L72 G;  1NTM J;  3L75 D;  3CCJ P;  4RJT A;  3SFD C;  5KLV J;  2W8Z A;  4K35 A;  1NO4 A;  5CCH C;  4XFJ A;  2G3A A;  2NPS A;  3OAK A;  3MD0 A;  3AEB C;  4W80 A;  1NTM K;  1X22 A;  3TSI A;  1URQ D;  1M8O B;  5KLV K;  3H1I E;  1VQ4 P;  1SP4 A;  4TT3 H;  1YHQ P;  3M0A A;  3D6Y A;  1RHZ B;  1CZQ A;  1DIP A;  3L70 J;  2A45 H;  3F5H A;  1T2K D;  1P84 I;  5AVX B;  1ZRT D;  4LLH A;  5APS A;  5CCG A;  4B86 A;  3P8M C;  4L74 A;  3VYI A;  3LIE A;  2E74 D;  1IFD A;  2WSE H;  1IZN B;  3L71 J;  2P1J A;  2GUV A;  4IOI H;  1IK9 A;  3USS A;  3CXH E;  1LNQ A;  3H1J D;  4ZKU A;  1GTW A;  1L4A A;  3MGN A;  2R5B A;  1NHL A;  4N6J A;  2HLO A;  1OIP A;  1KB9 D;  3A0H H;  1FZC B;  2IBZ D;  2Z4E A;  2QJK B;  1SQV G;  1YJ9 P;  2ZJS E;  3B5N C;  3SWF A;  3RK2 C;  3RL0 B;  2AEM A;  5AVW B;  3JC2 2;  2M8R A;  2OYO A;  5AVZ B;  1QX8 A;  4GDO A;  1S4X A;  1NTZ D;  1GK6 A;  3SWK A;  1IFM A;  1IFP A;  5B5E H;  1S9K E;  5KLI C;  3E7K A;  1PFI A;  3OA7 A;  3H1K J;  1R5S A;  2M3B A;  2IFM A;  2R3C A;  4NPE A;  1SQV E;  1FS0 E;  2FYN C;  2P2U A;  3AE8 C;  4MN4 C;  3CCU P;  4U7J A;  3L73 J;  4R4M A;  3A3Y B;  3RK3 B;  1USE A;  1NU1 D;  3CC7 P;  1XTG B;  1R8E A;  3L74 J;  1DD3 A;  1KFN A;  2R5D A;  3CCM P;  1LT9 A;  2OTJ P;  3P32 A;  3UIA A;  3G6E P;  2O3J A;  4WBA A;  1Q81 Q;  3L72 D;  1LT9 C;  1VQ8 P;  1EXJ A;  3KPE A;  3IAO A;  3L35 A;  2BEZ F;  4TLF A;  1X9V A;  1GW4 A;  1BE3 J;  1OVU A;  3HD7 C;  2FYU D;  2LKM A;  3AE9 C;  5APX A;  4I6M C;  4D6T G;  1BGY J;  2A06 D;  4N3Y B;  2K9J A;  2KIK A;  3A0H E;  4W7Z A;  1EDI A;  1NTK K;  2B87 B;  1Y47 A;  1YJN P;  3QWO C;  1SQB E;  2FY8 A;  1L0N J;  4C46 A;  3CC2 P;  1AJY A;  3IR9 A;  2Q1K A;  1HTL C;  1HJ0 A;  1KFM A;  5KJ7 D;  1TU3 F;  2V7Q J;  2R44 A;  2JDI H;  1L0N K;  3BCC J;  4D6T E;  3TDK A;  1USD A;  1EDJ A;  1AVO A;  2OGU A;  2YIU C;  3AEF C;  2H88 C;  5CBO A;  2C0X A;  2HOD B;  3L4F A;  1VQ9 P;  3OW2 O;  1OVR A;  1PP9 D;  1FBM A;  2Q5U A;  3IF4 A;  1S9K D;  1NWQ A;  1K8A Q;  2B88 A;  5TJH A;  3E1I A;  4DJG A;  2YKO A;  2A45 I;  4HB1 A;  1SFC A;  1JCC A;  3Q5S A;  1FAV A;  1SQV D;  1LTA C;  3WMM 0;  2QSI A;  1SFC C;  1VQN P;  3M91 A;  5GTH H;  4PJ0 H;  2YMK A;  1PPJ E;  3KZI E;  3B5N B;  1NKZ B;  3RK2 B;  3VMX A;  1VQM P;  2J59 M;  1JY2 P;  2H43 A;  4H13 C;  1PZQ A;  2ZAE B;  3TGU G;  1JOC A;  1AVY A;  1EDK A;  1YQ3 C;  1A02 F;  2R3S A;  3CI9 A;  3LW5 J;  3CL3 D;  3V4W A;  1N2D C;  2V7Q H;  5KLI B;  4H0L D;  1JUN A;  2OYH C;  1L0L E;  1EZV E;  1LT1 A;  4WY4 C;  2B89 A;  2ZT9 C;  1URQ A;  1JY3 O;  3F89 A;  2IPP A;  4ASV A;  2FYN B;  1OWA A;  4AYC A;  2L91 A;  3A7O A;  1OW8 A;  4JYC A;  1BDD A;  2YMY A;  2J58 A;  1NVO A;  1LWU A;  1OW7 A;  1SQX J;  2WSS H;  1LTG C;  4GOD A;  3TGU E;  1CW5 A;  4HJG H;  1LWU C;  3P8C E;  4YPC A;  3R4Y A;  1QL2 A;  1GDT A;  3S1K A;  1LT9 B;  1SQX K;  4K3A A;  1VQL P;  1N8R Q;  1U7M A;  1NTZ K;  1H8A A;  1RE3 C;  3WU2 E;  3HD7 B;  1ZN5 A;  4U3F J;  1Q2N A;  1VF5 D;  2LXB A;  2KI7 B;  3I56 P;  1IJD B;  3N4X A;  3CX5 D;  2I1K A;  1KB9 H;  1NU1 K;  3IN6 A;  1CSB A;  1LTB C;  4ZMD A;  1HVV A;  1YQ4 C;  3M9Q A;  3E1R A;  4YTP C;  1KIL C;  1ZP0 C;  1H88 A;  5APT A;  1K73 Q;  2OYI A;  2YIU B;  1EZV I;  2YXQ B;  1FU1 A;  1VQP P;  1LGH B;  1QGK B;  3H1H G;  2WT7 A;  1HH0 A;  3AE5 C;  1RF0 C;  1X8Y A;  1GL2 D;  1IC2 A;  1Z56 A;  4H44 D;  5M1B A;  2M5A A;  1SFC B;  5E79 H;  2KS1 A;  1ZRT E;  4Y28 J;  3C1L A;  2JWA A;  2N1T D;  3MHV A;  1W2B O;  1RH5 B;  3CWB J;  2QG4 A;  2E5Y A;  4H13 B;  4W7Y A;  1KQF B;  1N73 A;  4C7N A;  1M90 Q;  2OQQ A;  1RQU A;  3K5B A;  1IFJ A;  3H1J E;  5EFW B;  1GU4 A;  3M9B A;  2OYH B;  3L74 D;  3AED C;  3N7N A;  2KLU A;  2ZT9 B;  3CXH H;  1N86 A;  4L73 A;  2HYN A;  1N7L A;  1BSH A;  1SQV K;  1URQ B;  2CK3 H;  3AEA C;  1H0T B;  1JMB A;  2P7J A;  3H1L G;  2K3R A;  2WSE J;  5BVZ A;  1YTZ T;  1FZA A;  3V2N A;  2D2C D;  1KQG B;  1LWU B;  2B9B A;  5KJ7 A;  1YJW P;  5L8R J;  1MZ9 A;  3ABV C;  5AW4 B;  1S5L E;  2KSJ A;  2H89 C;  2XDJ A;  2VRS A;  2QM7 A;  3HUS A;  3SWY A;  2AXT E;  1JY3 P;  2KUB A;  4Z1M H;  2E75 D;  3HUS C;  3H1L E;  1KQS O;  3NFQ A;  2WPV B;  5KKZ C;  1SQP G;  1SQB J;  4RKU J;  1SQQ D;  2FYU G;  3HE4 A;  1OVV A;  2NPS C;  1M7L A;  1NU1 E;  1YIJ P;  5E79 E;  2A06 G;  1WRG A;  1JNM A;  4UB6 H;  1T3U A;  3G3Z A;  1SQB K;  3L72 E;  1JM0 A;  4D6T J;  5BU5 A;  3H6P A;  1KIL B;  3VMY A;  3NTN A;  5CCG C;  1YTZ I;  4C7R A;  1NJI Q;  4OGQ D;  3H1H D;  2ZVO B;  1JY2 O;  2WSC H;  3BAS A;  1SQP E;  2WMM A;  2FYU E;  2PRR A;  1FOS F;  1LJ2 A;  2GM4 A;  3AEC C;  3JSV C;  1FOS E;  2A06 E;  2WPQ A;  1KB9 I;  1G2C B;  3HRN A;  1P84 D;  3EQ2 A;  5KAF H;  2YKP A;  2WT7 B;  2IBZ I;  2Z5I A;  1PP9 G;  1L4A C;  1LTI C;  2BAS A;  2HPC A;  1YBK A;  1QL1 A;  1ZW0 A;  5APW A;  1Q86 Q;  2O1K A;  2KS1 B;  2FFD A;  2QJY C;  2ZYG A;  4YXD C;  2W6B A;  1ZME C;  1SVF A;  3H32 B;  3PJS K;  3GW6 A;  1HF9 A;  5B66 E;  1L0L J;  4IL6 E;  1RE4 A;  5AVS B;  1PP9 E;  2C9N Y;  4L76 A;  1RE4 C;  1X79 B;  4BXL A;  3H1L D;  3SFE C;  3GMA A;  1L0L K;  2IX7 C;  2PFX A;  4UB6 E;  3AE3 C;  4GIF A;  1MFZ A;  2LR2 A;  1BCC G;  3GHG A;  3JCU H;  1PGQ A;  3VOP A;  4DZO A;  3GHG C;  2E43 A;  4HKZ H;  3KZI H;  1CI6 A;  2KSE A;  2O01 H;  2C9L Y;  2BCC G;  1LTJ A;  5KLV G;  1ZR2 A;  3CXH I;  5AW6 B;  5AVY B;  3RBZ A;  3RL0 D;  2WSF H;  4DCK A;  3EFG A;  1SQP D;  1G1I A;  1VQ7 P;  4RO0 A;  3HUS B;  5KAF E;  1NTK J;  5KTB A;  1KTM A;  4L75 A;  4GOF A;  1GL2 A;  5KKZ B;  3U59 A;  2NPS B;  2I1J A;  3L70 G;  4JPZ B;  5AVR B;  2BCC E;  1UIX A;  3L71 G;  3L75 J;  3RK3 D;  3O6Q A;  2POH A;  3PP5 A;  3BRV B;  1WT6 A;  1R5L A;  2MKV A;  3EWK A;  3BAT A;  3AE1 C;  1HUC A;  1FZE A;  3M0D A;  4ZNC A;  3U1A A;  2NZ2 A;  3M0D C;  4UB8 E;  4R4L A;  1PGP A;  4PD4 E;  2XNX A;  4N78 D;  3WU2 H;  2V4H A;  1DEE G;  3CX5 E;  1LTT C;  2WWW A;  1JCD A;  2HFE D;  3MZW B;  3L71 E;  2Y0D A;  1L4A B;  3KXD A;  1JEK A;  3JCU E;  2FXP A;  5CCH D;  3RBX A;  2K9Y A;  2GA1 A;  3CPW O;  3C9I A;  4I7Z C;  5AW2 B;  2QJY B;  4JQ0 D;  2P67 A;  1HWT C;  5CMZ A;  3H1J J;  3FWN A;  4EI2 A;  1KMI Z;  3D70 A;  1L2P A;  4DT0 A;  3VN0 A;  3H1K G;  2O01 N;  1ZXG A;  5APQ A;  4EYY Q;  1BCC D;  2KB7 P;  1URQ C;  3L74 G;  2BEQ D;  5AW8 B;  1JMM A;  1BSN A;  1RF1 A;  1IO4 A;  4WB4 A;  3PHL A;  1KYO E;  1K04 A;  2QVA A;  1NTZ J;  2BCC D;  1T2K C;  1UII A;  1NTM D;  1FZB A;  3GHG B;  5KLV D;  1K05 A;  2ZVN B;  4BRY A;  3CCE P;  2E74 C;  3SSU A;  2Y9Y A;  1BE3 G;  5GTI H;  2KK7 A;  4OGQ C;  4EOT A;  3B5N D;  4AUW A;  3CD6 P;  2Y9Z A;  2W27 A;  4Y99 C;  3L74 E;  2QEX P;  3TF5 A;  3AE2 C;  1NU1 J;  2P58 A;  3H1I J;  4HYT B;  2KXP B;  2IDB A;  3FX0 A;  4PD4 D;  3L70 D;  1VQ6 P;  4JBZ A;  1ZR4 A;  1GL2 B;  1L0N G;  2J5U A;  2FXO A;  2K9J B;  1OXZ A;  3L72 J;  4OH8 B;  3L71 D;  1EXI A;  1SQQ G;  2IFN A;  2AXC A;  1G1J A;  1MKM A;  5CBN A;  2PGD A;  2AEF A;  2QA4 P;  2YNY A;  2K1A A;  2E76 D;  3BCC G;  5DJT B;  2XKM A;  3B4S A;  5BU8 B;  2FKW B;  1Y8A A;  3ZDM A;  1S5L H;  1JTH A;  2RMZ A;  1Y9B A;  3M9H A;  1W5C E;  4IFM A;  5AVQ B;  1SQP K;  4YXW H;  2OYI C;  4I2L C;  2FYU K;  1OMI A;  2AXT H;  1SQQ E;  1M56 D;  3CCQ P;  2XND H;  3ITK A;  1T6A A;  1NKN A;  2DW3 A;  3HD7 D;  2KLV A;  1HGV A;  3G4S P;  3BCC E;  1RQV A;  2KYV A;  2JWD A;  2Y0E A;  2Q7C A;  2R32 A;  1QEX A;  1VQK P;  2ZXE B;  1HGZ A;  2YKQ A;  1E5W A;  1KYO D;  1PIX A;  4I7Z B;  3CCS P;  5GTI E;  1GD2 E;  3H1H E;  3V6I A;  1IK7 A;  2CPS A;  3H1K D;  4WVZ A;  2NRG A;  1N73 C;  2WPS A;  3TYY A;  1LTS C;  3L73 D;  2H7H A;  2M3E A;  1SQV J;  4A7P A;  1X0T A;  3V5B A;  1P84 E;  1FDI A;  2H8P D;  2JP3 A;  4BWN A;  1Q7Y Q;  1BDC A;  3HE5 A;  2WPR A;  2Y0C A;  1S72 P;  4GOE A;  1DD4 A;  1GU5 A;  3HTK A;  2YO2 A;  3QH9 A;  1PGJ A;  2WSC J;  1BE3 D;  1J1E C;  1LP1 A;  1EDL A;  5AVT B;  5AW7 B;  5KJ7 C;  4XE5 B;  3T97 A;  2E74 B;  1BGY D;  5H2F E;  4BRY B;  2Q9I A;  4OGQ B;  1NH4 A;  4U3F G;  2CPB A;  4Y99 B;  1N7S D;  5B66 H;  4H13 D;  4IL6 H;  3L36 A;  1L0N D;  1WMK A;  3V2P A;  2IYP A;  3S9O A;  3Q3D A;  3V2Q A;  2KP8 A;  2IZ1 A;  1DX7 A;  3S4R A;  3CLQ A;  1E79 H;  5CCH A;  3PLN A;  5CJ0 A;  3WUT A;  3V2R A;  3IFM A;  4WY4 D;  3BCC D;  2ZT9 D;  1AQ5 A;  5AW0 B;  2Q3I A;  2B87 A;  4U3F E;  4AQR D;  1M1J A;  3NMD A;  4M3L A;  1M1J C;  1S3J A;  1ZOY C;  2OTL P;  1FJP A;  2UWJ E;  2LXC B;  4GT1 A;  1JTH B;  5K5G B;  2OYI B;  4PV1 D;  1FZF A;  4H0L C;  4NPF X;  2ZYD A;  3OJA B;  3PRJ A;  3KYQ A;  2HOD A;  3FWL A;  1QVF O;  4HH2 A;  1HJB A;  2O01 J;  2N9Y B;  1KZU B;  1AFO A;  1MUU A;  3CWB G;  2M5A B;  3FGA D;  3RK3 E;  2RKL A;  4LGD E;  2L5G B;  2WSF J;  3AE4 C;  3CCV P;  2FFD C;  1EC5 A;  1U57 A;  1S5L X;  3B5N A;  1A02 J;  3B71 A;  1N73 B;  3CCR P;  4C7N B;  5APU A;  1KIL D;  4N78 E;  1PGO A;  2AEJ A;  3VP8 A;  1VDF A;  2A45 G;  1SQX D;  4KJM A;  4UB8 H;  1VF5 C;  1PV3 A;  4PD4 H;  1OW6 A;  3CMA P;  3CWB E;  3VP9 A;  1GK4 A;  4NPD A;  3TGU J;  3CX5 H;  4XA4 A;  2QJP C;  1NYH A;  3HE5 B;  1PL5 A;  3VTP C;  1NOH A;  1EQ7 A;  3GG2 A;  5APV A;  3KHU A;  1RY3 A;  1Q82 Q;  3HTK B;  2FXM A;  1J1E B;  2P10 A;  3A0B H;  1OFC X;  4U3F D;  4ZKP A;  2E76 C;  3MTU E;  3H1I D;  3AE6 C;  1NTM G;  1LP1 B;  1W2E A;  5CHX A;  3T97 B;  2KOG A;  1KQL A;  1LTJ C;  2Q6Q A;  1FDM A;  1VQ5 P;  2ITA A;  3RL0 g;  2K88 A;  1SQB G;  2WQY C;  1BCC E;  1NAF A;  2ZXX A;  3HD7 A;  4KHX A;  1NAY A;  1GL2 C;  1HBW A;  3HE4 B;  4H44 C;  3TK1 A;  1AQT A;  1U7J A;  3NXS A;  2PP6 A;  3RGU A;  2JO1 A;  2N1T A;  1NTM E;  3U1C A;  1QVG O;  4IFD K;  3CXH D;  1GZL A;  5KLV E;  3MP7 B;  1KYO H;  2N1T C;  1K9M Q;  1JY2 N;  2KNC A;  1GMJ A;  1JO5 A;  3PH0 A;  1J2J B;  3V4Q A;  1M1J B;  4EIJ A;  1T3J A;  3KDP B;  1JB0 J;  1AV1 A;  3I55 P;  1Q90 D;  1GW3 A;  2WVR A;  1SQQ J;  4IL6 X;  3L70 E;  2GUS A;  2E5T A;  5AW5 B;  4H0L B;  2QRX A;  4QMA A;  1FDO A;  2HG5 D;  3MIW A;  3A5T A;  1PPJ G;  1SLQ A;  1SQQ K;  3TNU A;  5B5E E;  3CWB D;  2IYO A;  3MUD A;  2JJL A;  3MUD C;  1VQO P;  2HPC B;  1IFN A;  2JEE A;  2FYZ A;  3H1H J;  1YI2 P;  3A0B E;  2D2C C;  2NPS D;  2QE7 H;  1ZLL A;  4LC1 A;  1FZG A;  3KQG A;  2FFD B;  1FE6 A;  3O8Z A;  1L0L G;  1EZV G;  3BRT B;  4OWF A;  1T8Z A;  1YIT P;  1N7S A;  1XTC C;  3L37 A;  4OVN F;  1N7S C;  5CCG D;  2E75 C;  3M06 A;  2MJZ A;  1VF5 B;  5AW1 B;  1D7M A;  3L73 G;  3D71 A;  1FC2 C;  3A2A A;  2RN0 A;  5TIS H;  2OYH A;  2QJP B;  4WY4 A;  2JKV A;  2RH0 A;  3W68 A;  2OAR A;  1RF1 C;  1ZV8 A;  2M0B A;  2WZ7 A;  1H0T A;  1IFI A;  1L4A D;  2XV5 A;  3H1K E;  2E76 B;  3FXE A;  4EDF A;  4CPG A;  5DJU B;  3CCL P;  1CI6 B;  2K37 A;  3H1L J;  3L73 E;  1SQB D;  4KT0 J;  4PD4 I;  1J1D C;  3FXD A;  3RK2 D;  1LTJ B;  1NTK G;  1FJK A;  3CX5 I;  3G71 P;  1BGY G;  4I1L A;  3AEE C;  4PV1 C;  2G8Y A;  5AVU B;  1YYC A;  1P84 H;  1KC8 Q;  1RE3 A;  1MV8 A;  3I5C A;  1KOR A;  4D6T D;  1VL2 A;  2W83 C;  2W6A A;  1SS1 A;  4H44 B;  2KZI A;  2I8D A;  2N9B A;  2IZ0 A;  4DOJ A;  2ZYA A;  1BE3 E;  3L75 G;  2ZFC A;  2YO3 A;  1DEB A;  1S1C X;  3BVH A;  4IFF A;  2N1T B;  5KAI H;  1NTK E;  1M57 D;  3LW5 H;  1OZH A;  2WIT A;  1SQP J;  5GTH E;  1BGY E;  2FYU J;  4PJ0 E;  2W6J H;  4ASW A;  2KNC B;  3GLM A;  3O6Q B;  2JR8 A;  2PAJ A;  1KIL A;  5H2F H;  3CC4 P;  1H89 A;  5C39 A;  1KV4 A;  1PPJ D;  1MFT A;  1L0N E;  2WTY A;  2SPZ A;  3R2P A;  4JF7 A;  2XZR A;  3Q2Y A;  3L75 E;  5TIS E;  3W67 A;  3GF7 A;  2Z5H A;  1KYO I;  1M1K Q;  1G2C A;  3TNU B;  4GKG A;  2OTK E;  1RF0 A;  2FBW C;  3B8E B;  2C0W A;  1L0L D;  2D2C B;  1EZV D;  3AEG C;  5AW3 B;  2Q3E A;  3H1J G;  1FZC A;  1FZC C;  3EFF K;  1PP9 J;  1KD1 Q;  3VMZ A;  4RES B;  1DH3 A;  3P7K A;  2QJK C;  3LID A;  2KZJ A;  4O9B A;  5APY A;  3G9R A;  3CME P;  3TGU D;  1JY3 N;  3RL0 C;  3H32 A;  1NGM B;  3P8C D;  1N7S B;  2IBZ G;  2YXR B;  2E75 B;  1VPC A;  3Q1M A;  2QIW A;  3II6 A;  4WWI A;  3D6Z A;  1SQX G;  3AE7 C;  3Q5R A;  1NTZ G;  3WUU A;  2W90 A;  4WY4 B;  5KAI E;  1RF1 B;  2QM8 A;  1KB9 E;  1KN7 A;  2O1J A;  5AVV B;  3RK3 C;  1SFC D;  1AA0 A;  3GF3 A; 
#chains in the Genus database with same CATH homology
 2XNX A;  1N73 B;  1IJD B;  3N4X A;  4N78 D;  4C7N B;  5APU A;  1KIL D;  4N78 E;  2I1K A;  2XU6 A;  3VP8 A;  1VDF A;  1NU1 K;  1LTT C;  5CJ4 A;  2E42 A;  1J1D B;  2A45 G;  2WWW A;  1JCD A;  1CSB A;  2HFE D;  5AW9 B;  1LTB C;  1L4A B;  1HVV A;  3VP9 A;  1GK4 A;  3M9Q A;  5CCH D;  4XA4 A;  1KIL C;  3HE5 B;  3C9I A;  4JYB A;  1H88 A;  3VTP C;  5APT A;  5AW2 B;  1NOH A;  1EQ7 A;  5APV A;  2P67 A;  1HWT C;  2OYI A;  1NO4 A;  5CMZ A;  1RY3 A;  3HTK B;  2FXM A;  5CCH C;  1J1E B;  2NPS A;  1FU1 A;  1LGH B;  3OAK A;  4ZKP A;  3MD0 A;  4W80 A;  1NTM K;  3MTU E;  3TSI A;  2WT7 A;  1HH0 A;  1URQ D;  5KLV K;  1W2E A;  3VN0 A;  1RF0 C;  1SP4 A;  5CHX A;  1X8Y A;  2KOG A;  1KQL A;  3M0A A;  1LTJ C;  1GL2 D;  1IC2 A;  1CZQ A;  1FDM A;  1Z56 A;  2A45 H;  1T2K D;  5APQ A;  1SFC B;  5AVX B;  5APS A;  4LLH A;  2KB7 P;  5CCG A;  1URQ C;  4B86 A;  3P8M C;  3VYI A;  5AW8 B;  1NAF A;  1JMM A;  3LIE A;  2N1T D;  3HD7 A;  1IFD A;  1RF1 A;  2WSE H;  4KHX A;  1IO4 A;  4WB4 A;  1GL2 C;  2P1J A;  2GUV A;  1HBW A;  3HE4 B;  3TK1 A;  1T2K C;  3NXS A;  2PP6 A;  1IK9 A;  4W7Y A;  1FZB A;  1N73 A;  3GHG B;  2N1T A;  4C7N A;  3U1C A;  4IFD K;  1GZL A;  2N1T C;  4ZKU A;  1IFJ A;  1JY2 N;  1GTW A;  1L4A A;  4EOT A;  3B5N D;  1JO5 A;  3MGN A;  1J2J B;  3V4Q A;  1M1J B;  4EIJ A;  1T3J A;  2R5B A;  3KDP B;  1GU4 A;  4AUW A;  2W27 A;  1NHL A;  3M9B A;  2OYH B;  4N6J A;  2HLO A;  4Y99 C;  3N7N A;  1N86 A;  1GW3 A;  1FZC B;  2HYN A;  4HYT B;  1N7L A;  1SQV K;  1URQ B;  2Z4E A;  2P7J A;  2GUS A;  1ZR4 A;  5AW5 B;  3B5N C;  5BVZ A;  3SWF A;  1YTZ T;  3RK2 C;  3RL0 B;  2HG5 D;  1GL2 B;  1FZA A;  3MIW A;  3V2N A;  3A5T A;  1OXZ A;  1SLQ A;  1LWU B;  1SQQ K;  4OH8 B;  3TNU A;  5AVW B;  2M8R A;  5KJ7 A;  2IFN A;  3MUD A;  5AVZ B;  1MZ9 A;  1G1J A;  2JJL A;  5AW4 B;  1GK6 A;  2YNY A;  1IFM A;  2KSJ A;  2HPC B;  1IFN A;  2JEE A;  2FYZ A;  2XKM A;  1S9K E;  2XDJ A;  2NPS D;  2VRS A;  2QM7 A;  5BU8 B;  3HUS A;  2FKW B;  1PFI A;  1ZLL A;  3OA7 A;  3SWY A;  4LC1 A;  1FZG A;  1JTH A;  1JY3 P;  3KQG A;  3M9H A;  2M3B A;  2IFM A;  2R3C A;  3HUS C;  2FFD B;  2P2U A;  3O8Z A;  3NFQ A;  4IFM A;  5AVQ B;  1SQP K;  3BRT B;  4I2L C;  2FYU K;  3A3Y B;  2OYI C;  3RK3 B;  1T8Z A;  3HE4 A;  1N7S A;  2NPS C;  1M7L A;  1XTG B;  1XTC C;  3L37 A;  1KFN A;  1N7S C;  1NKN A;  2R5D A;  5CCG D;  3M06 A;  1WRG A;  1LT9 A;  2MJZ A;  3P32 A;  1JNM A;  3UIA A;  1T3U A;  5AW1 B;  3G3Z A;  3HD7 D;  2KLV A;  4WBA A;  1HGV A;  1SQB K;  1LT9 C;  2KYV A;  2Q7C A;  3KPE A;  2R32 A;  2ZXE B;  1HGZ A;  3A2A A;  5BU5 A;  3H6P A;  2YKQ A;  2OYH A;  1KIL B;  1E5W A;  4WY4 A;  3VMY A;  3NTN A;  3L35 A;  5CCG C;  1YTZ I;  4C7R A;  1X9V A;  1GW4 A;  2OAR A;  3HD7 C;  1RF1 C;  2LKM A;  1ZV8 A;  1JY2 O;  2WSC H;  3BAS A;  2WZ7 A;  1GD2 E;  1IFI A;  5APX A;  4I6M C;  1FOS F;  2GM4 A;  2CPS A;  1L4A D;  2XV5 A;  1FOS E;  2WPQ A;  1N73 C;  2WPS A;  4N3Y B;  3TYY A;  1LTS C;  1G2C B;  4W7Z A;  3HRN A;  2H7H A;  1CI6 B;  3EQ2 A;  2YKP A;  3V5B A;  1NTK K;  2WT7 B;  1J1D C;  2H8P D;  3RK2 D;  1LTJ B;  2Z5I A;  4C46 A;  1FJK A;  1L4A C;  1LTI C;  2BAS A;  4I1L A;  3IR9 A;  2HPC A;  3HE5 A;  5AVU B;  1QL1 A;  1YYC A;  2WPR A;  1HTL C;  1RE3 A;  1MV8 A;  5APW A;  1KFM A;  5KJ7 D;  3I5C A;  2O1K A;  1L0N K;  2FFD A;  2W6B A;  1GU5 A;  3HTK A;  2W6A A;  2YO2 A;  1SVF A;  3H32 B;  1J1E C;  2N9B A;  4DOJ A;  2ZFC A;  2C0X A;  2YO3 A;  5AVT B;  1DEB A;  2HOD B;  3L4F A;  5AW7 B;  4XE5 B;  3T97 A;  5KJ7 C;  3BVH A;  4IFF A;  2N1T B;  1RE4 A;  3LW5 H;  1FBM A;  2Q5U A;  5AVS B;  1S9K D;  1NWQ A;  2WIT A;  2C9N Y;  2Q9I A;  3E1I A;  1RE4 C;  1X79 B;  2YKO A;  2A45 I;  1NH4 A;  1SFC A;  1JCC A;  1FAV A;  2CPB A;  4Y99 B;  1LTA C;  3WMM 0;  1N7S D;  2PAJ A;  1L0L K;  3L36 A;  1KIL A;  1SFC C;  2IX7 C;  1H89 A;  3M91 A;  3V2P A;  2WTY A;  3V2Q A;  2KP8 A;  3B5N B;  4GIF A;  1NKZ B;  1DX7 A;  3R2P A;  4JF7 A;  3RK2 B;  3VMX A;  1MFZ A;  2XZR A;  3GHG A;  3CLQ A;  2J59 M;  1JY2 P;  5CJ0 A;  5CCH A;  2H43 A;  3VOP A;  3V2R A;  2Z5H A;  3IFM A;  4WY4 D;  4DZO A;  3GHG C;  1AQ5 A;  2E43 A;  1JOC A;  1G2C A;  3TNU B;  5AW0 B;  1CI6 A;  2Q3I A;  4GKG A;  2O01 H;  1RF0 A;  4AQR D;  2C9L Y;  1A02 F;  3B8E B;  1M1J A;  3CI9 A;  1LTJ A;  3CL3 D;  2C0W A;  3NMD A;  3V4W A;  1N2D C;  4M3L A;  1ZR2 A;  1M1J C;  5AW6 B;  5AVY B;  3RL0 D;  5AW3 B;  1JUN A;  2WSF H;  2OYH C;  1FZC A;  4WY4 C;  3EFG A;  1G1I A;  1URQ A;  1FJP A;  1JY3 O;  3HUS B;  2IPP A;  1OWA A;  4AYC A;  3A7O A;  1FZC C;  4GT1 A;  1JTH B;  5KTB A;  3VMZ A;  4RES B;  1DH3 A;  4JYC A;  3P7K A;  4O9B A;  3LID A;  2OYI B;  1FZF A;  5APY A;  1GL2 A;  2YMY A;  2J58 A;  3U59 A;  1LWU A;  1JY3 N;  2NPS B;  1LTG C;  3RL0 C;  3H32 A;  1CW5 A;  2I1J A;  3P8C D;  3OJA B;  1LWU C;  1N7S B;  1VPC A;  3P8C E;  3KYQ A;  2HOD A;  5AVR B;  1QL2 A;  3II6 A;  4HH2 A;  1HJB A;  1GDT A;  1LT9 B;  1SQX K;  1KZU B;  1AFO A;  1MUU A;  3RK3 D;  2POH A;  1NTZ K;  3PP5 A;  3BRV B;  1WT6 A;  1H8A A;  4LGD E;  2L5G B;  1RE3 C;  4WY4 B;  3BAT A;  3HD7 B;  1HUC A;  1ZN5 A;  2FFD C;  1RF1 B;  1FZE A;  2QM8 A;  3M0D A;  3U1A A;  2O1J A;  5AVV B;  3B5N A;  1A02 J;  3M0D C;  3RK3 C;  1SFC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...