5KLVK

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
LTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5klvK00
1SQXK 1SQPK 3M9QA 1NTZK 1L0NK 1SQBK 3G3ZA 2FYUK 5KLVK 1L0LK 3CLQA 1NTKK 2OARA 2WSFH 2LKMA 1SQVK 2WSEH 1NU1K 2O01H 2WSCH 3LW5H 4IFDK 2J59M 1SQQK 1NTMK
chains in the Genus database with same CATH superfamily
4WY4D 2KYVA 3QWOC 3WUTA 2FYUE 2HG5D 2WSEJ 2QSIA 1NTZD 2IYPA 3IAOA 1AJYA 2A06E 3HE4A 1KN7A 3V2PA 3SFEC 2K9YA 2QJKB 3KHUA 4D6TD 1L0ND 1S5LX 4ZMDA 4QMAA 2WVRA 3WMM0 2FFDB 4XA4A 3T97A 2P67A 2DW3A 3H1JE 1LTIC 1BCCD 4UB8E 2FKWB 1WT6A 3FX0A 1SVFA 3HD7D 2QRXA 3RK2D 5K5GB 4I7ZC 2XNDH 5B5EE 4DZOA 1KORA 1NTZG 2Q7CA 3AE1C 3V4WA 4IOIH 1JOCA 3CC2P 4WB4A 4GIFA 2AEFA 2I1KA 1GU5A 3GG2A 2GM4A 1JMMA 1FZEA 1FE6A 4YXWH 1S4XA 3B71A 1M1JB 1L0NG 3P8MC 1JY2P 1MV8A 2QA4P 2N9YB 1IK7A 1VQ4P 2Z5IA 2IX7C 1BDCA 2W6JH 4A7PA 1AQTA 1OZHA 1YQ3C 3SWFA 1BCCG 1SQXD 2K1AA 4BWNA 3VMYA 1RF0C 5AW0B 1DD4A 4XE5B 2R5BA 2KZIA 1FZCB 3CI9A 5CJ0A 2KP8A 3PJSK 1SQBG 3CCJP 1RF1C 4Y28J 2Y0DA 1DIPA 1WMKA 2ZYGA 1Q81Q 1J2JB 3L75G 1Y9BA 3RK2B 3GHGA 1SQQD 3USSA 2KSJA 3CX5E 4PV1D 2FFDA 3RL0g 1EZVI 2BASA 3BCCD 2POHA 1N86A 3SWYA 2KS1B 1ZR4A 2IYOA 4WY4A 1H89A 3L74J 2FYUD 1SQXG 2K88A 2BEQD 1URQC 3H1HD 2YMYA 1KILC 1PV3A 1HH0A 3K5BA 4WWIA 1FZBA 4UB8H 1VQ7P 2HYNA 4KHXA 3EQ2A 1L4AB 2YKOA 2W27A 1SQQG 2YNYA 3L70E 1RE4A 2E75D 3NXSA 4PV1B 2Q9IA 3KDPB 1X9VA 3CPWO 3BCCG 3TGUJ 2A45I 3AE5C 4WVZA 1VQ8P 2GUSA 1T3UA 1N73C 1YTZT 2FYUG 5DJTB 1R5LA 3HD7A 3H1KE 2E5YA 1SQPJ 1ZLLA 3H1HG 1KILD 2QJPB 4N78E 5DJUB 1RY3A 2YIUC 5KLVD 1HBWA 1N2DC 2WSCJ 3OA7A 4O9BA 1OXZA 2B9BA 2C9LY 2YKQA 1GK4A 1ZR2A 3CWBE 2KS1A 1N7SB 5AVZB 3CX5H 3GLMA 5AW8B 3AEDC 3L72D 2O01J 2QVAA 5CCGC 3N7NA 2QEXP 1H0TB 1M7LA 5BU8B 1IZNB 1XTCC 3TSIA 1NO4A 1VQ5P 1LT1A 2B87B 2KNCB 1AA0A 3CCLP 3MP7B 5GTIH 1Y47A 5KLVG 2XNXA 2FYNB 2HR3A 1Q7YQ 1NTME 2ZT9B 3G3ZA 3D71A 1JNMA 1PZQA 2FBWC 1ZOYC 5GTHH 3VYIA 4ASVA 4R4LA 1JTHB 3M06A 1NOHA 1NTKD 3L72G 2K37A 3LIDA 2D2CC 2H88C 4AUWA 2WQYC 2P7JA 1VF5D 1USEA 2QM8A 2PFXA 1AQ5A 4LGDE 4JQ0D 4H13D 2J58A 2OYIB 4JPZB 2RKLA 1T6AA 1T3JA 3RK3C 2IBZG 1LTBC 5TJHA 1BDDA 2KB7P 3TF5A 1H0TA 5KKZB 1SQPG 1L0LD 5AW2B 3AEEC 3LW5J 4U7JA 2RN0A 3NMDA 4I2LC 1S72P 1NTKG 1FJPA 1FZAA 3GF3A 3H1KD 3Q5RA 1CSBA 2KNCA 2B87A 3D6ZA 3L73E 4PD4D 3CMEP 2L91A 5TISE 1NU1J 4K35A 1MKMA 1VF5B 1M1KQ 3VMZA 2E5TA 5CHXA 1EC5A 1LTSC 1EDKA 2M3EA 5BU5A 1K8AQ 2C9NY 4R4MA 4H13B 3V2RA 2P1JA 1YJWP 4I1LA 2HODB 2WSFH 1SQVK 1JTHA 1RQVA 2ZYDA 1ZMEC 3H1IE 3NTNA 1LJ2A 4YXDC 1L0LG 4EYYQ 1HGZA 1ZV8A 3V5BA 1IFNA 1BE3E 2H7HA 2JR8A 4BXLA 2ZAEB 2QE7H 3H1KG 3UIAA 2KXPB 4DT0A 4KJMA 1Z56A 3GHGC 2P2UA 2YMKA 1BGYD 3L71E 5APWA 1LTTC 2V7QH 3AE4C 1LTAC 3VMXA 2FFDC 3OJAB 2OYHA 2FXPA 1NTZJ 1CW5A 3C9IA 2GUVA 1SQBK 1J1DB 2G8YA 1K04A 1NTMD 3IF4A 1PPJD 4JF7A 1MZ9A 2YO2A 4H44B 3MD0A 2OTKE 4WY4C 1A02J 2R5DA 4B86A 4D6TJ 2BCCE 3V4QA 1OVVA 1L0NJ 1LGHB 1DX7A 3A0BE 1PGPA 1LWUB 3CMAP 4NPDA 1KQFB 4DCKA 1BCCJ 1M1JC 5H2FE 1BGYG 4M3LA 3GMAA 2HODA 1PFIA 1RE4C 3HE5B 3KPEA 1QEXA 2QIWA 5TISH 3CXHI 1NTMG 1G1JA 1PPJG 1S1CX 2JWAA 4U3FD 4DJGA 1E79H 1NAYA 2IBZI 3SFDC 1U57A 3O6QB 4ASWA 3HD7C 3O8ZA 1OW6A 1NU1G 4HH2A 2I1JA 1OFCX 2AXCA 2L5GB 3RK2C 1Q90D 1D7MA 3L73D 2M0BA 3E1IA 2ZJSE 1SQXJ 1FU1A 1KYOD 1NJIQ 2IDBA 3VP8A 1JY3O 1GW4A 3CCSP 1RE3A 3TNUB 1SQQJ 1KV4A 2ITAA 4U3FG 1PP9E 3H1ID 3G4SP 1QLED 5AVWB 3CC7P 3MGNA 1CI6B 1FJKA 4OGQD 1LWUA 2WT7B 1GW3A 1R8EA 1KQLA 3BCCJ 2Q5UA 5KLIB 1IJDB 4IFMA 3HE5A 2FYUJ 1H8AA 1J1EB 4PV1C 2NPSD 3A0BH 1P84I 1OVUA 1FZGA 3H1HJ 4UB6E 3VN0A 4IL6X 1W2BO 4PJ0H 2IPPA 2XU6A 5AW3B 4D6TG 2ZFCA 1NKZB 2XV5A 1KD1Q 5H2FH 1IFJA 2LXBA 2KK7A 2PGDA 3Q3DA 3O6QA 2M5AB 3H1IG 1YITP 2GA1A 1SP4A 1IFPA 5KAFE 1LTJB 1VPCA 2Y9ZA 2KZJA 4OGQB 5EFWB 1L4AD 1R5SA 2E74D 1BSHA 3M9BA 3M9QA 2QJYB 1EQ7A 5AVYB 1QL1A 4L74A 2IZ0A 3AE9C 4JYBA 3OAKA 1AVOA 4W7ZA 2E75C 3CCMP 2NPSB 1CI6A 1HTLC 1KB9I 3AECC 5KLVJ 1E5WA 5CCHD 3PP5A 4LC1A 1QVGO 3QH9A 1Q2NA 1DH3A 3PHLA 1QL2A 2A06D 5E79E 2FYNC 3CD6P 2M8RA 3L72J 2V4HA 2OARA 2ZXEB 2E74B 1M1JA 3S1KA 1N7SD 5B5EH 5CBOA 1LTGC 1LT9B 2XKMA 2M5AA 1KFNA 2OTJP 1S5LE 3FWLA 1BSNA 1PP9D 1A02F 1LTJA 1N8RQ 3ABVC 4UB6H 2AEJA 3H1JD 1HWTC 1S9KE 1FZCA 2Q1KA 3H1LE 2WZ7A 3CC4P 2C0WA 1JY3N 2OYIC 1JEKA 2A06G 1U7JA 3MHVA 1VQOP 1NTKJ 2OYHC 2ZT9D 2HPCB 3U1CA 1JY2O 2NPSA 4LLHA 1EXJA 1EDJA 3AE6C 1AVYA 3G6EP 1S2EA 1UIIA 5KTBA 1Q86Q 1JUNA 3IN6A 2JWDA 1ZP0C 5C39A 2WPSA 4L76A 2K3RA 2PP6A 3H1JG 3E1RA 1GZLA 1VQNP 3P8CE 4ZKUA 5APYA 1W2EA 1VF5C 1VQ6P 5KAIE 1IC2A 3L36A 3SSUA 3RK3E 1L0LJ 1L4AA 2Q3IA 4H13C 1LT9A 2O1KA 1L2PA 3H1KJ 1NKNA 3CX5D 1U7MA 3JC22 2OQQA 5E79H 1PL5A 2JDIH 2YKPA 3W67A 3A0HE 3CL3D 4CPGA 5APVA 3RL0D 3D6YA 3M0DA 1KFMA 1NAFA 2XDJA 3H32B 1EZVE 1T2KC 5L8RJ 5CCHA 3PTZA 1IO4A 1S5LH 3R4YA 2B89A 1G1IA 4BRYB 3EWKA 1PGQA 3TK1A 2R32A 2HPCA 1J1DC 3V2NA 3U1AA 4RJTA 1NU1K 3KZIE 2Y9YA 1N7SA 3E7KA 4RESB 1RE3C 3L70D 1K9MQ 1BGYJ 2KSEA 1GL2D 1Y8AA 5AVXB 3EFFK 1LWUC 3B5ND 1S9KD 5AVSB 2Y0EA 1GMJA 1T2KD 1NTMJ 2WPRA 3AEFC 3IR9A 3H1LD 3RL0B 4Y99C 1SFCD 1FBMA 1NGMB 4H0LD 4N78D 1ZW0A 2V7QJ 3IFMA 3RBZA 2ZYAA 4IFFA 5AW4B 1NYHA 4N3YB 4H44D 3M9HA 1NTZK 1USDA 5AVRB 3WUUA 1OIPA 2W6BA 2KUBA 1X22A 3CWBD 3FXEA 3L70G 3H32A 1EDLA 3VTPC 1K05A 3PH0A 2LR2A 4N6JA 5AW1B 3Q1MA 1SQVE 2H89C 3AE2C 3AEGC 2JEEA 2JKVA 4BRYA 1GL2B 2RMZA 3MIWA 1JY2N 1ZXGA 2Y0CA 4HB1A 1L0NK 2WSSH 1FC2C 1L0NE 4U3FJ 1CZQA 3B5NB 2QJKC 1KC8Q 2OYIA 1SFCB 4OH8B 3FXDA 1JB0J 1SLQA 4ZNCA 3WUVA 1YTZI 4H0LB 1XTGB 3L73J 4EDFA 1SQBE 2Z4EA 2IFMA 1KMIZ 2XZRA 1EDIA 4GDOA 3CWBG 3L4FA 3KZIH 3Q5SA 3L75E 3ITKA 1EZVD 5KLIC 1KTMA 4RO0A 1IFDA 4EI2A 2M3BA 3KYQA 3MTUE 1DEEG 2K9JB 4Z1MH 1JCCA 1FAVA 2Q6QA 1VL2A 4TT3H 3H1IJ 3AEAC 1HJBA 1IFMA 3LIEA 4IFDK 1SQXK 1SQXE 2A45H 3M0AA 3A7OA 2QG4A 2YO3A 2N1TD 3FGAD 1LTJC 3HUSB 1GL2A 2WMMA 2P10A 1YJNP 1FZCC 1SQQK 4OGQC 2KLUA 2H43A 1SQQE 2CPSA 3VP9A 1EZVG 3B5NA 1N7LA 3C1LA 2QJYC 2JO1A 2R3CA 5AVQB 1SFCA 3EFGA 2OGUA 3AE7C 2JP3A 4W80A 3BCCE 1H88A 2KOGA 2OTLP 1HVVA 2O01N 2NPSC 2FYUK 1AV1A 3BRVB 3CLQA 3RGUA 3VOPA 1YBKA 2LKMA 3CCRP 3H1HE 3GF7A 1SQVD 3ZDMA 2K9JA 3L37A 2N1TB 3GHGB 2ZVNB 1BE3D 2E76D 5KJ7D 1L4AC 2A45G 2E74C 1LT9C 3L73G 1OX3A 3L71D 2W83C 4PD4I 2MJZA 4NPFX 2G3AA 2WSEH 3HUSA 1SQBD 3TDKA 5APTA 4WY4B 5APSA 4GOFA 3M0DC 4JBZA 4XFJA 4L73A 3PLNA 1KILE 3L75D 1SQVG 5CCHC 3VMAA 3W68A 5M1BA 3NFQA 5KLVK 2E43A 2WWWA 5KLVE 2BCCD 1GD2E 1K73Q 2QJPC 1BE3G 5CMZA 1PP9J 1UIXA 3L74E 2WTYA 1FOSF 3Q2YA 1HUCA 1M8OB 3H1JJ 1KZUB 2E76B 3N4XA 3L71G 3L72E 1AFOA 1N7SC 1FDMA 1DEBA 3HTKB 1X79B 4HKZH 3TNUA 2W6AA 1S3JA 1YI2P 2J59M 3GW6A 1JM0A 3HD7B 2N1TA 1VDFA 2WT7A 1GTWA 3JCUE 4OWFA 3CXHE 2AEMA 1PGOA 3TGUE 2N9BA 2BCCG 3BRTB 1M90Q 4I6MC 1IFIA 2IBZE 1FDOA 4NPEA 2HFED 1SQPK 1RQUA 3I56P 1SQPE 2JJLA 2FYZA 5B66E 1YJ9P 1QVFO 2ZT9C 1NTKK 1VQMP 1NTKE 1M57D 1PIXA 5GTIE 4L75A 1OWAA 1OW7A 1JO5A 4GOEA 3MUDA 3D70A 4AQRD 4I7ZB 1FDIA 5GTHE 1Q82Q 2NZ2A 2IZ1A 2HLOA 2LXCB 1ZRTE 5KJ7A 2IFNA 2R44A 4YPCA 3CCVP 3G71P 1GU4A 2WITA 1YIJP 1L0LK 1FS0E 2PAJA 1MUUA 1L0LE 3HTKA 5KAFH 2B88A 3P7KA 2Z5HA 1OMIA 2O1JA 5KKZC 4IL6E 1KYOI 1URQD 3CCQP 2R3SA 4PD4E 3RL0C 2P58A 1P84E 2PRRA 1QGKB 1PP9G 1QX8A 2AXTE 3S9OA 1LNQA 3KQGA 1RF1B 3L70J 1FZFA 4C7RA 3JSVC 3L74D 1GDTA 4C46A 3JCUH 4YTPC 4ZKPA 2FXOA 5CBNA 3CXHH 2Q3EA 4K3AA 2CK3H 3Q5PA 3H1LJ 2E75B 4OVNF 3H25A 3SWKA 3B8EB 3L35A 3C8VA 3R2PA 1VQKP 4HYTB 3CCEP 3AEBC 5B66H 1W5CE 1GL2C 1JMBA 5APQA 3V2QA 1HGVA 5AW7B 3AE8C 1BGYE 2KIKA 3B5NC 3G9RA 3II6A 2E42A 3CXHD 1URQB 2UWJE 3TGUD 2WSCH 1KILB 1SFCC 3CWBJ 1NTMK 1KB9E 3BATA 2IBZD 1NH4A 1NVOA 1PPJE 2QM7A 4H0LC 3L74G 4TLFA 3WU2E 4EOTA 1HF9A 1SQPD 2O3JA 1FOSE 1VQLP 1LP1B 1M56D 2O01H 3AE3C 1NU1E 4C7NB 4H44C 1NWQA 1WRGA 5CCGD 2SPZA 1HJ0A 1MFTA 1RF0A 1YQ4C 2FY8A 2WSFJ 1N73B 1X0TA 1RF1A 2KI7B 3RBXA 2I8DA 1KQSO 1MFZA 4IL6H 3TGUG 4PD4H 1G2CB 1ZRTD 2OYHB 1P84H 2C0XA 2AXTH 3I55P 3BVHA 1VQ9P 2RH0A 4U3FE 2YIUB 3U59A 4WBAA 3M91A 3HUSC 1T8ZA 5KAIH 2W90A 2D2CD 1OW8A 3H6PA 4GT1A 3FWNA 4EIJA 1NTZE 2WPVB 3F89A 1PGJA 1URQA 1P84D 3KXDA 3P32A 1EXIA 2MKVA 1KILA 4GKGA 1KYOE 4JYCA 5AW9B 3A0HH 4D6TE 3H1LG 3P8CD 1NHLA 2H8PD 1LP1A 4HJGH 2W8ZA 1IK9A 3RK3D 4W7YA 5AVTB 4C7NA 2J5UA 1JY3P 3B4SA 3LW5H 2WPQA 2BEZF 3A5TA 1KB9H 1BCCE 2OYOA 2YXQB 5CJ4A 1YHQP 3F5HA 3WU2H 1YYCA 1N73A 2FXMA 2N1TC 3HRNA 1X8YA 3PRJA 3MZWB 4RKUJ 5AVVB 2D2CB 4MN4C 1KQGB 3I5CA 1G2CA 2VRSA 3HE4B 3CCUP 1KB9D 1VQPP 5AW6B 1SQVJ 1J1EC 5AW5B 1SS1A 3A2AA 2CPBA 1GK6A 3BASA 1OVRA 5AVUB 3V6IA 3A3YB 5BVZA 1BE3J 1NU1D 2ZVOB 5APUA 3RK3B 3T97B 3TYYA 4GODA 5CCGA 3S4RA 3MUDC 3CX5I 4PJ0E 3OW2O 3L71J 4DOJA 4Y99B 1TU3F 1ZN5A 2YXRB 4AYCA 1SQBJ 1RHZB 2E76C 5KJ7C 3L75J 4KT0J 2NRGA 2ZXXA 2KLVA 1JCDA 1DD3A 1KYOH 1RH5B 2BCCJ 5APXA
chains in the Genus database with same CATH topology
1IC2A 4WY4D 1LTSC 3L36A 2KYVA 2WT7A 5BU5A 1GTWA 2C9NY 1L4AA 2Q3IA 3V2RA 2HG5D 2P1JA 4I1LA 2HODB 2WSFH 1LT9A 1SQVK 1JTHA 2N9BA 2O1KA 3BRTB 1NKNA 4I6MC 3HE4A 3NTNA 1IFIA 3V2PA 1HGZA 1ZV8A 3V5BA 1IFNA 2HFED 1SQPK 2YKPA 2H7HA 2JJLA 2FYZA 3CL3D 3UIAA 5APVA 1NTKK 3RL0D 3M0DA 1KFMA 1NAFA 2XDJA 1Z56A 3H32B 1T2KC 3GHGC 2P2UA 5CCHA 3WMM0 5APWA 2FFDB 1LTTC 1IO4A 1OWAA 4XA4A 1LTAC 3VMXA 2FFDC 3T97A 1JO5A 2P67A 3OJAB 2OYHA 1G1IA 1CW5A 1LTIC 3C9IA 3MUDA 2GUVA 1SQBK 1J1DB 2FKWB 4AQRD 1WT6A 3TK1A 1SVFA 2R32A 3HD7D 2HPCA 1J1DC 4JF7A 3V2NA 3U1AA 1MZ9A 3RK2D 1NU1K 2YO2A 4DZOA 2HLOA 3MD0A 2Q7CA 4WY4C 3V4WA 1A02J 2R5DA 4B86A 5KJ7A 2IFNA 1JOCA 4WB4A 1N7SA 3V4QA 1GU4A 4GIFA 2WITA 2I1KA 4RESB 1RE3C 1LGHB 1GU5A 2GM4A 1L0LK 2PAJA 1JMMA 1FZEA 1MUUA 1DX7A 3HTKA 1GL2D 1LWUB 5AVXB 3P7KA 2Z5HA 1LWUC 1M1JB 3B5ND 1S9KD 3P8MC 5AVSB 2O1JA 1JY2P 1MV8A 1M1JC 1T2KD 2WPRA 3IR9A 3RL0B 2Z5IA 4Y99C 1SFCD 1URQD 1FBMA 2IX7C 4M3LA 3RL0C 2HODA 1PFIA 1RE4C 3HE5B 3KPEA 3SWFA 3VMYA 1RF0C 5AW0B 1G1JA 4XE5B 2R5BA 1FZCB 4N78D 3CI9A 3KQGA 1RF1B 3IFMA 5CJ0A 2KP8A 1FZFA 4C7RA 1RF1C 4IFFA 5AW4B 1GDTA 4N3YB 3M9HA 1NTZK 1J2JB 4C46A 3HD7C 3O8ZA 5AVRB 3RK2B 3GHGA 4ZKPA 4HH2A 2I1JA 2KSJA 2L5GB 2W6BA 3RK2C 3H32A 3VTPC 2FFDA 5AW1B 4N6JA 3E1IA 3B8EB 3L35A 2JEEA 3R2PA 1GL2B 3MIWA 2BASA 1JY2N 4HYTB 1FU1A 2POHA 1N86A 1GL2C 1L0NK 5APQA 3V2QA 1CZQA 3SWYA 3B5NB 3VP8A 1ZR4A 1HGVA 5AW7B 4WY4A 3B5NC 3II6A 1H89A 1JY3O 1GW4A 2E42A 2OYIA 1SFCB 1URQB 4OH8B 1SLQA 2WSCH 1RE3A 1KILB 3TNUB 1SFCC 1URQC 1YTZI 2YMYA 1NTMK 1KILC 1HH0A 3BATA 5AVWB 1XTGB 1NH4A 3MGNA 1CI6B 1FJKA 1FZBA 2QM7A 2HYNA 1LWUA 4EOTA 2WT7B 2Z4EA 2IFMA 4KHXA 3EQ2A 2XZRA 1L4AB 1GW3A 2YKOA 2W27A 1KQLA 1FOSE 2Q5UA 2YNYA 3L4FA 2O01H 1IJDB 4C7NB 1IFDA 1NWQA 1RE4A 1WRGA 4IFMA 5CCGD 2M3BA 3KYQA 3MTUE 3NXSA 2Q9IA 3HE5A 1RF0A 3KDPB 1X9VA 1H8AA 1J1EB 1JCCA 2NPSD 1FAVA 2A45I 1FZGA 1N73B 3VN0A 1RF1A 2IPPA 2XU6A 2GUSA 1T3UA 1HJBA 5AW3B 1N73C 1YTZT 1IFMA 2ZFCA 1NKZB 3LIEA 2XV5A 1MFZA 1IFJA 3HD7A 4IFDK 1SQXK 1ZLLA 1G2CB 2OYHB 2A45H 1SP4A 3M0AA 1KILD 3A7OA 2C0XA 3BVHA 2YO3A 4N78E 1LTJB 3U59A 2N1TD 1VPCA 1RY3A 1HBWA 1N2DC 1LTJC 3OA7A 4O9BA 1OXZA 3HUSB 4WBAA 1GL2A 2C9LY 2YKQA 1GK4A 1L4AD 3M91A 1FZCC 1SQQK 3HUSC 1T8ZA 1ZR2A 2H43A 2CPSA 3VP9A 3M9BA 3M9QA 3B5NA 1EQ7A 1N7SB 1N7LA 3H6PA 5AVYB 4GT1A 4EIJA 1QL1A 5AVZB 2R3CA 5AW8B 5AVQB 1SFCA 1URQA 3P32A 3EFGA 4JYBA 3OAKA 1KILA 4W7ZA 4W80A 5CCGC 3N7NA 5APYA 1H88A 2KOGA 1HVVA 4GKGA 2NPSB 4JYCA 1CI6A 5AW9B 1HTLC 1M7LA 5BU8B 2NPSC 1XTCC 3P8CD 2FYUK 3TSIA 1E5WA 3BRVB 1NHLA 3CLQA 5CCHD 1NO4A 2H8PD 3VOPA 3PP5A 4LC1A 1IK9A 2LKMA 3RK3D 4W7YA 5AVTB 1DH3A 4C7NA 1QL2A 1JY3P 3LW5H 2WPQA 3A5TA 2XNXA 3L37A 5CJ4A 2M8RA 2N1TB 3G3ZA 1JNMA 1YYCA 1N73A 2FXMA 2N1TC 3GHGB 2OARA 2ZXEB 3HRNA 1X8YA 5KJ7D 1M1JA 1N7SD 3VYIA 1L4AC 1LTGC 1LT9B 2A45G 1JTHB 3M06A 1NOHA 5AVVB 2XKMA 1LT9C 1KFNA 3I5CA 1G2CA 3LIDA 2VRSA 4AUWA 3HE4B 2P7JA 1A02F 1LTJA 2MJZA 5AW6B 1J1EC 5AW5B 1HWTC 1S9KE 2QM8A 3A2AA 1FZCA 2WSEH 4LGDE 1AQ5A 3HUSA 5APTA 4WY4B 2CPBA 1GK6A 5APSA 2J58A 2WZ7A 3BASA 5AVUB 2C0WA 3M0DC 2OYIB 3A3YB 1JY3N 2OYIC 5BVZA 5APUA 3RK3B 5CCHC 3TYYA 3NFQA 5KLVK 1T3JA 3RK3C 2E43A 2WWWA 1GD2E 2OYHC 5CCGA 1LTBC 2KB7P 2HPCB 3U1CA 1JY2O 5AW2B 5CMZA 2NPSA 4LLHA 4DOJA 2WTYA 1FOSF 4Y99B 3NMDA 1ZN5A 1HUCA 4I2LC 4AYCA 1FJPA 1FZAA 1KZUB 1CSBA 3N4XA 5KJ7C 1AFOA 5KTBA 1N7SC 1JUNA 1FDMA 1DEBA 2WPSA 3HTKB 1X79B 2PP6A 3TNUA 2W6AA 2KLVA 1JCDA 1GZLA 3VMZA 2J59M 3P8CE 5CHXA 4ZKUA 3HD7B 2N1TA 1W2EA 1VDFA 5APXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX K;  1SQP K;  3M9Q A;  1NTZ K;  1L0N K;  1SQB K;  3G3Z A;  2FYU K;  5KLV K;  1L0L K;  3CLQ A;  1NTK K;  2OAR A;  2WSF H;  2LKM A;  1SQV K;  2WSE H;  1NU1 K;  2O01 H;  2WSC H;  3LW5 H;  4IFD K;  2J59 M;  1SQQ K;  1NTM K; 
#chains in the Genus database with same CATH topology
 4WY4 D;  2KYV A;  3QWO C;  3WUT A;  2FYU E;  2HG5 D;  2WSE J;  2QSI A;  1NTZ D;  2IYP A;  3IAO A;  1AJY A;  2A06 E;  3HE4 A;  1KN7 A;  3V2P A;  3SFE C;  2K9Y A;  2QJK B;  3KHU A;  4D6T D;  1L0N D;  1S5L X;  4ZMD A;  4QMA A;  2WVR A;  3WMM 0;  2FFD B;  4XA4 A;  3T97 A;  2P67 A;  2DW3 A;  3H1J E;  1LTI C;  1BCC D;  4UB8 E;  2FKW B;  1WT6 A;  3FX0 A;  1SVF A;  3HD7 D;  2QRX A;  3RK2 D;  5K5G B;  4I7Z C;  2XND H;  5B5E E;  4DZO A;  1KOR A;  1NTZ G;  2Q7C A;  3AE1 C;  3V4W A;  4IOI H;  1JOC A;  3CC2 P;  4WB4 A;  4GIF A;  2AEF A;  2I1K A;  1GU5 A;  3GG2 A;  2GM4 A;  1JMM A;  1FZE A;  1FE6 A;  4YXW H;  1S4X A;  3B71 A;  1M1J B;  1L0N G;  3P8M C;  1JY2 P;  1MV8 A;  2QA4 P;  2N9Y B;  1IK7 A;  1VQ4 P;  2Z5I A;  2IX7 C;  1BDC A;  2W6J H;  4A7P A;  1AQT A;  1OZH A;  1YQ3 C;  3SWF A;  1BCC G;  1SQX D;  2K1A A;  4BWN A;  3VMY A;  1RF0 C;  5AW0 B;  1DD4 A;  4XE5 B;  2R5B A;  2KZI A;  1FZC B;  3CI9 A;  5CJ0 A;  2KP8 A;  3PJS K;  1SQB G;  3CCJ P;  1RF1 C;  4Y28 J;  2Y0D A;  1DIP A;  1WMK A;  2ZYG A;  1Q81 Q;  1J2J B;  3L75 G;  1Y9B A;  3RK2 B;  3GHG A;  1SQQ D;  3USS A;  2KSJ A;  3CX5 E;  4PV1 D;  2FFD A;  3RL0 g;  1EZV I;  2BAS A;  3BCC D;  2POH A;  1N86 A;  3SWY A;  2KS1 B;  1ZR4 A;  2IYO A;  4WY4 A;  1H89 A;  3L74 J;  2FYU D;  1SQX G;  2K88 A;  2BEQ D;  1URQ C;  3H1H D;  2YMY A;  1KIL C;  1PV3 A;  1HH0 A;  3K5B A;  4WWI A;  1FZB A;  4UB8 H;  1VQ7 P;  2HYN A;  4KHX A;  3EQ2 A;  1L4A B;  2YKO A;  2W27 A;  1SQQ G;  2YNY A;  3L70 E;  1RE4 A;  2E75 D;  3NXS A;  4PV1 B;  2Q9I A;  3KDP B;  1X9V A;  3CPW O;  3BCC G;  3TGU J;  2A45 I;  3AE5 C;  4WVZ A;  1VQ8 P;  2GUS A;  1T3U A;  1N73 C;  1YTZ T;  2FYU G;  5DJT B;  1R5L A;  3HD7 A;  3H1K E;  2E5Y A;  1SQP J;  1ZLL A;  3H1H G;  1KIL D;  2QJP B;  4N78 E;  5DJU B;  1RY3 A;  2YIU C;  5KLV D;  1HBW A;  1N2D C;  2WSC J;  3OA7 A;  4O9B A;  1OXZ A;  2B9B A;  2C9L Y;  2YKQ A;  1GK4 A;  1ZR2 A;  3CWB E;  2KS1 A;  1N7S B;  5AVZ B;  3CX5 H;  3GLM A;  5AW8 B;  3AED C;  3L72 D;  2O01 J;  2QVA A;  5CCG C;  3N7N A;  2QEX P;  1H0T B;  1M7L A;  5BU8 B;  1IZN B;  1XTC C;  3TSI A;  1NO4 A;  1VQ5 P;  1LT1 A;  2B87 B;  2KNC B;  1AA0 A;  3CCL P;  3MP7 B;  5GTI H;  1Y47 A;  5KLV G;  2XNX A;  2FYN B;  2HR3 A;  1Q7Y Q;  1NTM E;  2ZT9 B;  3G3Z A;  3D71 A;  1JNM A;  1PZQ A;  2FBW C;  1ZOY C;  5GTH H;  3VYI A;  4ASV A;  4R4L A;  1JTH B;  3M06 A;  1NOH A;  1NTK D;  3L72 G;  2K37 A;  3LID A;  2D2C C;  2H88 C;  4AUW A;  2WQY C;  2P7J A;  1VF5 D;  1USE A;  2QM8 A;  2PFX A;  1AQ5 A;  4LGD E;  4JQ0 D;  4H13 D;  2J58 A;  2OYI B;  4JPZ B;  2RKL A;  1T6A A;  1T3J A;  3RK3 C;  2IBZ G;  1LTB C;  5TJH A;  1BDD A;  2KB7 P;  3TF5 A;  1H0T A;  5KKZ B;  1SQP G;  1L0L D;  5AW2 B;  3AEE C;  3LW5 J;  4U7J A;  2RN0 A;  3NMD A;  4I2L C;  1S72 P;  1NTK G;  1FJP A;  1FZA A;  3GF3 A;  3H1K D;  3Q5R A;  1CSB A;  2KNC A;  2B87 A;  3D6Z A;  3L73 E;  4PD4 D;  3CME P;  2L91 A;  5TIS E;  1NU1 J;  4K35 A;  1MKM A;  1VF5 B;  1M1K Q;  3VMZ A;  2E5T A;  5CHX A;  1EC5 A;  1LTS C;  1EDK A;  2M3E A;  5BU5 A;  1K8A Q;  2C9N Y;  4R4M A;  4H13 B;  3V2R A;  2P1J A;  1YJW P;  4I1L A;  2HOD B;  2WSF H;  1SQV K;  1JTH A;  1RQV A;  2ZYD A;  1ZME C;  3H1I E;  3NTN A;  1LJ2 A;  4YXD C;  1L0L G;  4EYY Q;  1HGZ A;  1ZV8 A;  3V5B A;  1IFN A;  1BE3 E;  2H7H A;  2JR8 A;  4BXL A;  2ZAE B;  2QE7 H;  3H1K G;  3UIA A;  2KXP B;  4DT0 A;  4KJM A;  1Z56 A;  3GHG C;  2P2U A;  2YMK A;  1BGY D;  3L71 E;  5APW A;  1LTT C;  2V7Q H;  3AE4 C;  1LTA C;  3VMX A;  2FFD C;  3OJA B;  2OYH A;  2FXP A;  1NTZ J;  1CW5 A;  3C9I A;  2GUV A;  1SQB K;  1J1D B;  2G8Y A;  1K04 A;  1NTM D;  3IF4 A;  1PPJ D;  4JF7 A;  1MZ9 A;  2YO2 A;  4H44 B;  3MD0 A;  2OTK E;  4WY4 C;  1A02 J;  2R5D A;  4B86 A;  4D6T J;  2BCC E;  3V4Q A;  1OVV A;  1L0N J;  1LGH B;  1DX7 A;  3A0B E;  1PGP A;  1LWU B;  3CMA P;  4NPD A;  1KQF B;  4DCK A;  1BCC J;  1M1J C;  5H2F E;  1BGY G;  4M3L A;  3GMA A;  2HOD A;  1PFI A;  1RE4 C;  3HE5 B;  3KPE A;  1QEX A;  2QIW A;  5TIS H;  3CXH I;  1NTM G;  1G1J A;  1PPJ G;  1S1C X;  2JWA A;  4U3F D;  4DJG A;  1E79 H;  1NAY A;  2IBZ I;  3SFD C;  1U57 A;  3O6Q B;  4ASW A;  3HD7 C;  3O8Z A;  1OW6 A;  1NU1 G;  4HH2 A;  2I1J A;  1OFC X;  2AXC A;  2L5G B;  3RK2 C;  1Q90 D;  1D7M A;  3L73 D;  2M0B A;  3E1I A;  2ZJS E;  1SQX J;  1FU1 A;  1KYO D;  1NJI Q;  2IDB A;  3VP8 A;  1JY3 O;  1GW4 A;  3CCS P;  1RE3 A;  3TNU B;  1SQQ J;  1KV4 A;  2ITA A;  4U3F G;  1PP9 E;  3H1I D;  3G4S P;  1QLE D;  5AVW B;  3CC7 P;  3MGN A;  1CI6 B;  1FJK A;  4OGQ D;  1LWU A;  2WT7 B;  1GW3 A;  1R8E A;  1KQL A;  3BCC J;  2Q5U A;  5KLI B;  1IJD B;  4IFM A;  3HE5 A;  2FYU J;  1H8A A;  1J1E B;  4PV1 C;  2NPS D;  3A0B H;  1P84 I;  1OVU A;  1FZG A;  3H1H J;  4UB6 E;  3VN0 A;  4IL6 X;  1W2B O;  4PJ0 H;  2IPP A;  2XU6 A;  5AW3 B;  4D6T G;  2ZFC A;  1NKZ B;  2XV5 A;  1KD1 Q;  5H2F H;  1IFJ A;  2LXB A;  2KK7 A;  2PGD A;  3Q3D A;  3O6Q A;  2M5A B;  3H1I G;  1YIT P;  2GA1 A;  1SP4 A;  1IFP A;  5KAF E;  1LTJ B;  1VPC A;  2Y9Z A;  2KZJ A;  4OGQ B;  5EFW B;  1L4A D;  1R5S A;  2E74 D;  1BSH A;  3M9B A;  3M9Q A;  2QJY B;  1EQ7 A;  5AVY B;  1QL1 A;  4L74 A;  2IZ0 A;  3AE9 C;  4JYB A;  3OAK A;  1AVO A;  4W7Z A;  2E75 C;  3CCM P;  2NPS B;  1CI6 A;  1HTL C;  1KB9 I;  3AEC C;  5KLV J;  1E5W A;  5CCH D;  3PP5 A;  4LC1 A;  1QVG O;  3QH9 A;  1Q2N A;  1DH3 A;  3PHL A;  1QL2 A;  2A06 D;  5E79 E;  2FYN C;  3CD6 P;  2M8R A;  3L72 J;  2V4H A;  2OAR A;  2ZXE B;  2E74 B;  1M1J A;  3S1K A;  1N7S D;  5B5E H;  5CBO A;  1LTG C;  1LT9 B;  2XKM A;  2M5A A;  1KFN A;  2OTJ P;  1S5L E;  3FWL A;  1BSN A;  1PP9 D;  1A02 F;  1LTJ A;  1N8R Q;  3ABV C;  4UB6 H;  2AEJ A;  3H1J D;  1HWT C;  1S9K E;  1FZC A;  2Q1K A;  3H1L E;  2WZ7 A;  3CC4 P;  2C0W A;  1JY3 N;  2OYI C;  1JEK A;  2A06 G;  1U7J A;  3MHV A;  1VQO P;  1NTK J;  2OYH C;  2ZT9 D;  2HPC B;  3U1C A;  1JY2 O;  2NPS A;  4LLH A;  1EXJ A;  1EDJ A;  3AE6 C;  1AVY A;  3G6E P;  1S2E A;  1UII A;  5KTB A;  1Q86 Q;  1JUN A;  3IN6 A;  2JWD A;  1ZP0 C;  5C39 A;  2WPS A;  4L76 A;  2K3R A;  2PP6 A;  3H1J G;  3E1R A;  1GZL A;  1VQN P;  3P8C E;  4ZKU A;  5APY A;  1W2E A;  1VF5 C;  1VQ6 P;  5KAI E;  1IC2 A;  3L36 A;  3SSU A;  3RK3 E;  1L0L J;  1L4A A;  2Q3I A;  4H13 C;  1LT9 A;  2O1K A;  1L2P A;  3H1K J;  1NKN A;  3CX5 D;  1U7M A;  3JC2 2;  2OQQ A;  5E79 H;  1PL5 A;  2JDI H;  2YKP A;  3W67 A;  3A0H E;  3CL3 D;  4CPG A;  5APV A;  3RL0 D;  3D6Y A;  3M0D A;  1KFM A;  1NAF A;  2XDJ A;  3H32 B;  1EZV E;  1T2K C;  5L8R J;  5CCH A;  3PTZ A;  1IO4 A;  1S5L H;  3R4Y A;  2B89 A;  1G1I A;  4BRY B;  3EWK A;  1PGQ A;  3TK1 A;  2R32 A;  2HPC A;  1J1D C;  3V2N A;  3U1A A;  4RJT A;  1NU1 K;  3KZI E;  2Y9Y A;  1N7S A;  3E7K A;  4RES B;  1RE3 C;  3L70 D;  1K9M Q;  1BGY J;  2KSE A;  1GL2 D;  1Y8A A;  5AVX B;  3EFF K;  1LWU C;  3B5N D;  1S9K D;  5AVS B;  2Y0E A;  1GMJ A;  1T2K D;  1NTM J;  2WPR A;  3AEF C;  3IR9 A;  3H1L D;  3RL0 B;  4Y99 C;  1SFC D;  1FBM A;  1NGM B;  4H0L D;  4N78 D;  1ZW0 A;  2V7Q J;  3IFM A;  3RBZ A;  2ZYA A;  4IFF A;  5AW4 B;  1NYH A;  4N3Y B;  4H44 D;  3M9H A;  1NTZ K;  1USD A;  5AVR B;  3WUU A;  1OIP A;  2W6B A;  2KUB A;  1X22 A;  3CWB D;  3FXE A;  3L70 G;  3H32 A;  1EDL A;  3VTP C;  1K05 A;  3PH0 A;  2LR2 A;  4N6J A;  5AW1 B;  3Q1M A;  1SQV E;  2H89 C;  3AE2 C;  3AEG C;  2JEE A;  2JKV A;  4BRY A;  1GL2 B;  2RMZ A;  3MIW A;  1JY2 N;  1ZXG A;  2Y0C A;  4HB1 A;  1L0N K;  2WSS H;  1FC2 C;  1L0N E;  4U3F J;  1CZQ A;  3B5N B;  2QJK C;  1KC8 Q;  2OYI A;  1SFC B;  4OH8 B;  3FXD A;  1JB0 J;  1SLQ A;  4ZNC A;  3WUV A;  1YTZ I;  4H0L B;  1XTG B;  3L73 J;  4EDF A;  1SQB E;  2Z4E A;  2IFM A;  1KMI Z;  2XZR A;  1EDI A;  4GDO A;  3CWB G;  3L4F A;  3KZI H;  3Q5S A;  3L75 E;  3ITK A;  1EZV D;  5KLI C;  1KTM A;  4RO0 A;  1IFD A;  4EI2 A;  2M3B A;  3KYQ A;  3MTU E;  1DEE G;  2K9J B;  4Z1M H;  1JCC A;  1FAV A;  2Q6Q A;  1VL2 A;  4TT3 H;  3H1I J;  3AEA C;  1HJB A;  1IFM A;  3LIE A;  4IFD K;  1SQX K;  1SQX E;  2A45 H;  3M0A A;  3A7O A;  2QG4 A;  2YO3 A;  2N1T D;  3FGA D;  1LTJ C;  3HUS B;  1GL2 A;  2WMM A;  2P10 A;  1YJN P;  1FZC C;  1SQQ K;  4OGQ C;  2KLU A;  2H43 A;  1SQQ E;  2CPS A;  3VP9 A;  1EZV G;  3B5N A;  1N7L A;  3C1L A;  2QJY C;  2JO1 A;  2R3C A;  5AVQ B;  1SFC A;  3EFG A;  2OGU A;  3AE7 C;  2JP3 A;  4W80 A;  3BCC E;  1H88 A;  2KOG A;  2OTL P;  1HVV A;  2O01 N;  2NPS C;  2FYU K;  1AV1 A;  3BRV B;  3CLQ A;  3RGU A;  3VOP A;  1YBK A;  2LKM A;  3CCR P;  3H1H E;  3GF7 A;  1SQV D;  3ZDM A;  2K9J A;  3L37 A;  2N1T B;  3GHG B;  2ZVN B;  1BE3 D;  2E76 D;  5KJ7 D;  1L4A C;  2A45 G;  2E74 C;  1LT9 C;  3L73 G;  1OX3 A;  3L71 D;  2W83 C;  4PD4 I;  2MJZ A;  4NPF X;  2G3A A;  2WSE H;  3HUS A;  1SQB D;  3TDK A;  5APT A;  4WY4 B;  5APS A;  4GOF A;  3M0D C;  4JBZ A;  4XFJ A;  4L73 A;  3PLN A;  1KIL E;  3L75 D;  1SQV G;  5CCH C;  3VMA A;  3W68 A;  5M1B A;  3NFQ A;  5KLV K;  2E43 A;  2WWW A;  5KLV E;  2BCC D;  1GD2 E;  1K73 Q;  2QJP C;  1BE3 G;  5CMZ A;  1PP9 J;  1UIX A;  3L74 E;  2WTY A;  1FOS F;  3Q2Y A;  1HUC A;  1M8O B;  3H1J J;  1KZU B;  2E76 B;  3N4X A;  3L71 G;  3L72 E;  1AFO A;  1N7S C;  1FDM A;  1DEB A;  3HTK B;  1X79 B;  4HKZ H;  3TNU A;  2W6A A;  1S3J A;  1YI2 P;  2J59 M;  3GW6 A;  1JM0 A;  3HD7 B;  2N1T A;  1VDF A;  2WT7 A;  1GTW A;  3JCU E;  4OWF A;  3CXH E;  2AEM A;  1PGO A;  3TGU E;  2N9B A;  2BCC G;  3BRT B;  1M90 Q;  4I6M C;  1IFI A;  2IBZ E;  1FDO A;  4NPE A;  2HFE D;  1SQP K;  1RQU A;  3I56 P;  1SQP E;  2JJL A;  2FYZ A;  5B66 E;  1YJ9 P;  1QVF O;  2ZT9 C;  1NTK K;  1VQM P;  1NTK E;  1M57 D;  1PIX A;  5GTI E;  4L75 A;  1OWA A;  1OW7 A;  1JO5 A;  4GOE A;  3MUD A;  3D70 A;  4AQR D;  4I7Z B;  1FDI A;  5GTH E;  1Q82 Q;  2NZ2 A;  2IZ1 A;  2HLO A;  2LXC B;  1ZRT E;  5KJ7 A;  2IFN A;  2R44 A;  4YPC A;  3CCV P;  3G71 P;  1GU4 A;  2WIT A;  1YIJ P;  1L0L K;  1FS0 E;  2PAJ A;  1MUU A;  1L0L E;  3HTK A;  5KAF H;  2B88 A;  3P7K A;  2Z5H A;  1OMI A;  2O1J A;  5KKZ C;  4IL6 E;  1KYO I;  1URQ D;  3CCQ P;  2R3S A;  4PD4 E;  3RL0 C;  2P58 A;  1P84 E;  2PRR A;  1QGK B;  1PP9 G;  1QX8 A;  2AXT E;  3S9O A;  1LNQ A;  3KQG A;  1RF1 B;  3L70 J;  1FZF A;  4C7R A;  3JSV C;  3L74 D;  1GDT A;  4C46 A;  3JCU H;  4YTP C;  4ZKP A;  2FXO A;  5CBN A;  3CXH H;  2Q3E A;  4K3A A;  2CK3 H;  3Q5P A;  3H1L J;  2E75 B;  4OVN F;  3H25 A;  3SWK A;  3B8E B;  3L35 A;  3C8V A;  3R2P A;  1VQK P;  4HYT B;  3CCE P;  3AEB C;  5B66 H;  1W5C E;  1GL2 C;  1JMB A;  5APQ A;  3V2Q A;  1HGV A;  5AW7 B;  3AE8 C;  1BGY E;  2KIK A;  3B5N C;  3G9R A;  3II6 A;  2E42 A;  3CXH D;  1URQ B;  2UWJ E;  3TGU D;  2WSC H;  1KIL B;  1SFC C;  3CWB J;  1NTM K;  1KB9 E;  3BAT A;  2IBZ D;  1NH4 A;  1NVO A;  1PPJ E;  2QM7 A;  4H0L C;  3L74 G;  4TLF A;  3WU2 E;  4EOT A;  1HF9 A;  1SQP D;  2O3J A;  1FOS E;  1VQL P;  1LP1 B;  1M56 D;  2O01 H;  3AE3 C;  1NU1 E;  4C7N B;  4H44 C;  1NWQ A;  1WRG A;  5CCG D;  2SPZ A;  1HJ0 A;  1MFT A;  1RF0 A;  1YQ4 C;  2FY8 A;  2WSF J;  1N73 B;  1X0T A;  1RF1 A;  2KI7 B;  3RBX A;  2I8D A;  1KQS O;  1MFZ A;  4IL6 H;  3TGU G;  4PD4 H;  1G2C B;  1ZRT D;  2OYH B;  1P84 H;  2C0X A;  2AXT H;  3I55 P;  3BVH A;  1VQ9 P;  2RH0 A;  4U3F E;  2YIU B;  3U59 A;  4WBA A;  3M91 A;  3HUS C;  1T8Z A;  5KAI H;  2W90 A;  2D2C D;  1OW8 A;  3H6P A;  4GT1 A;  3FWN A;  4EIJ A;  1NTZ E;  2WPV B;  3F89 A;  1PGJ A;  1URQ A;  1P84 D;  3KXD A;  3P32 A;  1EXI A;  2MKV A;  1KIL A;  4GKG A;  1KYO E;  4JYC A;  5AW9 B;  3A0H H;  4D6T E;  3H1L G;  3P8C D;  1NHL A;  2H8P D;  1LP1 A;  4HJG H;  2W8Z A;  1IK9 A;  3RK3 D;  4W7Y A;  5AVT B;  4C7N A;  2J5U A;  1JY3 P;  3B4S A;  3LW5 H;  2WPQ A;  2BEZ F;  3A5T A;  1KB9 H;  1BCC E;  2OYO A;  2YXQ B;  5CJ4 A;  1YHQ P;  3F5H A;  3WU2 H;  1YYC A;  1N73 A;  2FXM A;  2N1T C;  3HRN A;  1X8Y A;  3PRJ A;  3MZW B;  4RKU J;  5AVV B;  2D2C B;  4MN4 C;  1KQG B;  3I5C A;  1G2C A;  2VRS A;  3HE4 B;  3CCU P;  1KB9 D;  1VQP P;  5AW6 B;  1SQV J;  1J1E C;  5AW5 B;  1SS1 A;  3A2A A;  2CPB A;  1GK6 A;  3BAS A;  1OVR A;  5AVU B;  3V6I A;  3A3Y B;  5BVZ A;  1BE3 J;  1NU1 D;  2ZVO B;  5APU A;  3RK3 B;  3T97 B;  3TYY A;  4GOD A;  5CCG A;  3S4R A;  3MUD C;  3CX5 I;  4PJ0 E;  3OW2 O;  3L71 J;  4DOJ A;  4Y99 B;  1TU3 F;  1ZN5 A;  2YXR B;  4AYC A;  1SQB J;  1RHZ B;  2E76 C;  5KJ7 C;  3L75 J;  4KT0 J;  2NRG A;  2ZXX A;  2KLV A;  1JCD A;  1DD3 A;  1KYO H;  1RH5 B;  2BCC J;  5APX A; 
#chains in the Genus database with same CATH homology
 1IC2 A;  4WY4 D;  1LTS C;  3L36 A;  2KYV A;  2WT7 A;  5BU5 A;  1GTW A;  2C9N Y;  1L4A A;  2Q3I A;  3V2R A;  2HG5 D;  2P1J A;  4I1L A;  2HOD B;  2WSF H;  1LT9 A;  1SQV K;  1JTH A;  2N9B A;  2O1K A;  3BRT B;  1NKN A;  4I6M C;  3HE4 A;  3NTN A;  1IFI A;  3V2P A;  1HGZ A;  1ZV8 A;  3V5B A;  1IFN A;  2HFE D;  1SQP K;  2YKP A;  2H7H A;  2JJL A;  2FYZ A;  3CL3 D;  3UIA A;  5APV A;  1NTK K;  3RL0 D;  3M0D A;  1KFM A;  1NAF A;  2XDJ A;  1Z56 A;  3H32 B;  1T2K C;  3GHG C;  2P2U A;  5CCH A;  3WMM 0;  5APW A;  2FFD B;  1LTT C;  1IO4 A;  1OWA A;  4XA4 A;  1LTA C;  3VMX A;  2FFD C;  3T97 A;  1JO5 A;  2P67 A;  3OJA B;  2OYH A;  1G1I A;  1CW5 A;  1LTI C;  3C9I A;  3MUD A;  2GUV A;  1SQB K;  1J1D B;  2FKW B;  4AQR D;  1WT6 A;  3TK1 A;  1SVF A;  2R32 A;  3HD7 D;  2HPC A;  1J1D C;  4JF7 A;  3V2N A;  3U1A A;  1MZ9 A;  3RK2 D;  1NU1 K;  2YO2 A;  4DZO A;  2HLO A;  3MD0 A;  2Q7C A;  4WY4 C;  3V4W A;  1A02 J;  2R5D A;  4B86 A;  5KJ7 A;  2IFN A;  1JOC A;  4WB4 A;  1N7S A;  3V4Q A;  1GU4 A;  4GIF A;  2WIT A;  2I1K A;  4RES B;  1RE3 C;  1LGH B;  1GU5 A;  2GM4 A;  1L0L K;  2PAJ A;  1JMM A;  1FZE A;  1MUU A;  1DX7 A;  3HTK A;  1GL2 D;  1LWU B;  5AVX B;  3P7K A;  2Z5H A;  1LWU C;  1M1J B;  3B5N D;  1S9K D;  3P8M C;  5AVS B;  2O1J A;  1JY2 P;  1MV8 A;  1M1J C;  1T2K D;  2WPR A;  3IR9 A;  3RL0 B;  2Z5I A;  4Y99 C;  1SFC D;  1URQ D;  1FBM A;  2IX7 C;  4M3L A;  3RL0 C;  2HOD A;  1PFI A;  1RE4 C;  3HE5 B;  3KPE A;  3SWF A;  3VMY A;  1RF0 C;  5AW0 B;  1G1J A;  4XE5 B;  2R5B A;  1FZC B;  4N78 D;  3CI9 A;  3KQG A;  1RF1 B;  3IFM A;  5CJ0 A;  2KP8 A;  1FZF A;  4C7R A;  1RF1 C;  4IFF A;  5AW4 B;  1GDT A;  4N3Y B;  3M9H A;  1NTZ K;  1J2J B;  4C46 A;  3HD7 C;  3O8Z A;  5AVR B;  3RK2 B;  3GHG A;  4ZKP A;  4HH2 A;  2I1J A;  2KSJ A;  2L5G B;  2W6B A;  3RK2 C;  3H32 A;  3VTP C;  2FFD A;  5AW1 B;  4N6J A;  3E1I A;  3B8E B;  3L35 A;  2JEE A;  3R2P A;  1GL2 B;  3MIW A;  2BAS A;  1JY2 N;  4HYT B;  1FU1 A;  2POH A;  1N86 A;  1GL2 C;  1L0N K;  5APQ A;  3V2Q A;  1CZQ A;  3SWY A;  3B5N B;  3VP8 A;  1ZR4 A;  1HGV A;  5AW7 B;  4WY4 A;  3B5N C;  3II6 A;  1H89 A;  1JY3 O;  1GW4 A;  2E42 A;  2OYI A;  1SFC B;  1URQ B;  4OH8 B;  1SLQ A;  2WSC H;  1RE3 A;  1KIL B;  3TNU B;  1SFC C;  1URQ C;  1YTZ I;  2YMY A;  1NTM K;  1KIL C;  1HH0 A;  3BAT A;  5AVW B;  1XTG B;  1NH4 A;  3MGN A;  1CI6 B;  1FJK A;  1FZB A;  2QM7 A;  2HYN A;  1LWU A;  4EOT A;  2WT7 B;  2Z4E A;  2IFM A;  4KHX A;  3EQ2 A;  2XZR A;  1L4A B;  1GW3 A;  2YKO A;  2W27 A;  1KQL A;  1FOS E;  2Q5U A;  2YNY A;  3L4F A;  2O01 H;  1IJD B;  4C7N B;  1IFD A;  1NWQ A;  1RE4 A;  1WRG A;  4IFM A;  5CCG D;  2M3B A;  3KYQ A;  3MTU E;  3NXS A;  2Q9I A;  3HE5 A;  1RF0 A;  3KDP B;  1X9V A;  1H8A A;  1J1E B;  1JCC A;  2NPS D;  1FAV A;  2A45 I;  1FZG A;  1N73 B;  3VN0 A;  1RF1 A;  2IPP A;  2XU6 A;  2GUS A;  1T3U A;  1HJB A;  5AW3 B;  1N73 C;  1YTZ T;  1IFM A;  2ZFC A;  1NKZ B;  3LIE A;  2XV5 A;  1MFZ A;  1IFJ A;  3HD7 A;  4IFD K;  1SQX K;  1ZLL A;  1G2C B;  2OYH B;  2A45 H;  1SP4 A;  3M0A A;  1KIL D;  3A7O A;  2C0X A;  3BVH A;  2YO3 A;  4N78 E;  1LTJ B;  3U59 A;  2N1T D;  1VPC A;  1RY3 A;  1HBW A;  1N2D C;  1LTJ C;  3OA7 A;  4O9B A;  1OXZ A;  3HUS B;  4WBA A;  1GL2 A;  2C9L Y;  2YKQ A;  1GK4 A;  1L4A D;  3M91 A;  1FZC C;  1SQQ K;  3HUS C;  1T8Z A;  1ZR2 A;  2H43 A;  2CPS A;  3VP9 A;  3M9B A;  3M9Q A;  3B5N A;  1EQ7 A;  1N7S B;  1N7L A;  3H6P A;  5AVY B;  4GT1 A;  4EIJ A;  1QL1 A;  5AVZ B;  2R3C A;  5AW8 B;  5AVQ B;  1SFC A;  1URQ A;  3P32 A;  3EFG A;  4JYB A;  3OAK A;  1KIL A;  4W7Z A;  4W80 A;  5CCG C;  3N7N A;  5APY A;  1H88 A;  2KOG A;  1HVV A;  4GKG A;  2NPS B;  4JYC A;  1CI6 A;  5AW9 B;  1HTL C;  1M7L A;  5BU8 B;  2NPS C;  1XTC C;  3P8C D;  2FYU K;  3TSI A;  1E5W A;  3BRV B;  1NHL A;  3CLQ A;  5CCH D;  1NO4 A;  2H8P D;  3VOP A;  3PP5 A;  4LC1 A;  1IK9 A;  2LKM A;  3RK3 D;  4W7Y A;  5AVT B;  1DH3 A;  4C7N A;  1QL2 A;  1JY3 P;  3LW5 H;  2WPQ A;  3A5T A;  2XNX A;  3L37 A;  5CJ4 A;  2M8R A;  2N1T B;  3G3Z A;  1JNM A;  1YYC A;  1N73 A;  2FXM A;  2N1T C;  3GHG B;  2OAR A;  2ZXE B;  3HRN A;  1X8Y A;  5KJ7 D;  1M1J A;  1N7S D;  3VYI A;  1L4A C;  1LTG C;  1LT9 B;  2A45 G;  1JTH B;  3M06 A;  1NOH A;  5AVV B;  2XKM A;  1LT9 C;  1KFN A;  3I5C A;  1G2C A;  3LID A;  2VRS A;  4AUW A;  3HE4 B;  2P7J A;  1A02 F;  1LTJ A;  2MJZ A;  5AW6 B;  1J1E C;  5AW5 B;  1HWT C;  1S9K E;  2QM8 A;  3A2A A;  1FZC A;  2WSE H;  4LGD E;  1AQ5 A;  3HUS A;  5APT A;  4WY4 B;  2CPB A;  1GK6 A;  5APS A;  2J58 A;  2WZ7 A;  3BAS A;  5AVU B;  2C0W A;  3M0D C;  2OYI B;  3A3Y B;  1JY3 N;  2OYI C;  5BVZ A;  5APU A;  3RK3 B;  5CCH C;  3TYY A;  3NFQ A;  5KLV K;  1T3J A;  3RK3 C;  2E43 A;  2WWW A;  1GD2 E;  2OYH C;  5CCG A;  1LTB C;  2KB7 P;  2HPC B;  3U1C A;  1JY2 O;  5AW2 B;  5CMZ A;  2NPS A;  4LLH A;  4DOJ A;  2WTY A;  1FOS F;  4Y99 B;  3NMD A;  1ZN5 A;  1HUC A;  4I2L C;  4AYC A;  1FJP A;  1FZA A;  1KZU B;  1CSB A;  3N4X A;  5KJ7 C;  1AFO A;  5KTB A;  1N7S C;  1JUN A;  1FDM A;  1DEB A;  2WPS A;  3HTK B;  1X79 B;  2PP6 A;  3TNU A;  2W6A A;  2KLV A;  1JCD A;  1GZL A;  3VMZ A;  2J59 M;  3P8C E;  5CHX A;  4ZKU A;  3HD7 B;  2N1T A;  1W2E A;  1VDF A;  5APX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...