5KLVK

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
b'LTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5klvK00
3CLQA 2J59M 2O01H 2FYUK 3M9QA 1SQVK 1SQBK 1L0LK 1NTZK 1NU1K 1SQQK 2WSFH 3LW5H 1L0NK 1SQPK 1NTMK 1SQXK 2OARA 4IFDK 1NTKK 5KLVK 2WSEH 3G3ZA 2WSCH 2LKMA
chains in the Genus database with same CATH superfamily
1H0TB 1VQOP 1AJYA 2FKWB 3M0AA 1K8AQ 2Q3EA 4D6TE 3PJSK 1VDFA 2YMYA 3F5HA 3H1KE 4LLHA 2O01N 2YIUB 4ASWA 1RE4A 2AXTH 1S9KD 1ZRTD 5AVUB 5KLIC 1JEKA 2FYZA 1S5LE 3HE5A 1ZLLA 1GK4A 2BEZF 3H1KD 3HUSB 1BDCA 1L0NG 1L0NK 1NTMG 1NTMK 1JCCA 1L4AB 4BXLA 4GOFA 3AEGC 2LKMA 1NJIQ 2WT7A 3W67A 5KLVE 1JY3N 2E76D 2WSEJ 3JC22 2OQQA 1T3JA 2JO1A 3RK2B 2W6AA 1DEBA 4GKGA 2P10A 3H1HJ 3H1JD 2Q7CA 3B5NB 3Q3DA 1FU1A 3HD7A 1OZHA 3HUSC 1JY3P 1DEEG 3VMYA 1L4AC 1XTGB 2P7JA 3AEAC 2I1KA 1LT9B 1RF1B 4W7YA 1AV1A 1IZNB 3A0HH 2J5UA 1LTBC 1EQ7A 4H0LB 5BVZA 5CCHC 1LTAC 1KB9H 3KZIH 3GHGA 1OVRA 3RK2C 1IFPA 1L2PA 2R5DA 3CCRP 3B5NC 3NXSA 5AW7B 2LR2A 1P84E 1LTSC 3P8MC 3L71D 3GG2A 2JWAA 3F89A 3P8CE 4B86A 2KS1A 1FDIA 4GODA 3FWLA 5APXA 3IF4A 1M57D 1N7SA 1PP9E 4W80A 3L72J 3L75E 3HE4A 4PD4H 2Z4EA 1BCCE 1J1EB 2I8DA 3H1ID 3WU2E 3Q5SA 1MFZA 3M06A 3V2PA 5KJ7C 3L75D 3JSVC 3JCUH 1LWUB 1HH0A 1BSNA 3LW5H 1VQ6P 1M7LA 2SPZA 2CPBA 1NU1E 1ZW0A 2WITA 4HB1A 4RO0A 2QM8A 3H1LD 1J1EC 3II6A 1KQFB 3O6QA 2BCCE 3CXHE 1N73B 1HGVA 1NU1D 5GTIE 1GDTA 1YIJP 1M1JC 2K88A 1JO5A 2QA4P 1OW7A 3H1HG 1YYCA 3VP9A 4C7RA 1M56D 1HJ0A 4Y99B 1QVFO 1X9VA 1JTHA 3CXHD 2YKPA 1GK6A 3D71A 2ZXEB 3CX5I 3HD7D 2Z5IA 2NPSD 1VQ9P 3TNUA 2ZT9D 3V5BA 2WSCH 1N73C 5L8RJ 3G4SP 1LTIC 4JBZA 2KI7B 2QSIA 1KILE 3AEDC 1CZQA 3RL0D 1DD3A 3TF5A 2KK7A 3CX5D 2J58A 1KYOE 1JY3O 1YJNP 3M9HA 2P1JA 1KILD 3H1IJ 2H43A 1TU3F 4K3AA 1MUUA 5AW5B 2Q9IA 4H13B 3L72G 2AXCA 4AYCA 1Q2NA 2JR8A 1KC8Q 1JNMA 1LTGC 1N7SD 3BCCJ 5AW9B 1EDJA 1NVOA 2POHA 2ZFCA 1GL2A 3KPEA 1S5LX 3I5CA 1KMIZ 3KQGA 2KLVA 4RESB 3MUDC 2JDIH 4H13C 3L36A 1NKNA 1LTJA 1T6AA 3GF7A 3CWBJ 1W5CE 3H1JG 1OXZA 1EDKA 3PP5A 1VQ4P 2WMMA 5AVVB 3CCEP 3V4WA 4LC1A 1PPJD 4OH8B 1NTME 1QLED 5KAFH 2Q1KA 4TT3H 5APUA 3Q1MA 2FYNB 1NTKJ 3AE1C 1IFMA 2D2CD 3P32A 3SWKA 3L71G 1H0TA 5CCGD 4O9BA 2DW3A 2FXMA 1IFDA 3EFFK 3L70J 2HR3A 2HPCB 4ZKUA 1QX8A 2FYUE 1G2CA 1YQ4C 1SQQD 3IFMA 2FYNC 2LXBA 4OGQB 1QVGO 4BWNA 1DD4A 3H1IG 1LGHB 1NH4A 1KFNA 2WPRA 3MP7B 3A7OA 1W2EA 4WY4D 2KB7P 3WU2H 3FX0A 2IYPA 2PP6A 5KTBA 3AEBC 1G1IA 2VRSA 3T97B 3RGUA 3BRTB 3BCCG 1PV3A 2MJZA 5B5EE 2B89A 2MKVA 2WSFH 4PD4I 1JY2P 4L73A 3H1LG 1NTZE 1ZN5A 4H44C 1YJWP 2W90A 4EOTA 1JMBA 2GM4A 4WBAA 2WQYC 2GUSA 3TDKA 2NZ2A 1EZVE 1PZQA 3CXHH 3C8VA 1LT9A 1RF1A 3CWBG 5C39A 5GTIH 1L0NJ 1USDA 4LGDE 4PD4D 1GW4A 1R5LA 1L0LE 4N6JA 3EQ2A 2O3JA 3NMDA 3TK1A 2A06E 1N8RQ 3L74E 1BGYE 4RJTA 3FWNA 1EDLA 2R3SA 3CCSP 4DZOA 5GTHH 2QM7A 4I7ZB 1L0LD 3GLMA 1NTKK 3CMEP 3L74D 3LIEA 1JUNA 1BGYD 2QG4A 3ABVC 1JMMA 1LJ2A 5APSA 3V2QA 1HGZA 3ZDMA 4OVNF 1KN7A 2BEQD 1U7JA 1XTCC 3L70G 2QJYB 3R2PA 1RF0A 4U3FJ 1VF5B 4R4MA 5AVYB 1AVOA 1SQXD 4DT0A 2M5AB 4ZMDA 1LWUA 1R8EA 2H88C 3IAOA 2HLOA 1NO4A 5KLIB 1SP4A 4IL6E 1GL2C 1YHQP 1SLQA 2WWWA 4GT1A 2E5TA 1DH3A 3MTUE 2QJYC 3AE6C 5CJ4A 1VF5C 1N7LA 2P58A 1WMKA 3RK3D 2KNCB 3CC4P 1SQBJ 2CPSA 3SSUA 2K9JB 3EFGA 1CI6B 4D6TD 3I55P 1GD2E 2ZXXA 3RK2D 2GUVA 4PV1B 2B9BA 3S4RA 2FFDA 3GF3A 3B5ND 1PPJG 1S3JA 2ZJSE 2OARA 4IFDK 2FY8A 4QMAA 1ZV8A 2OTLP 3LW5J 3BRVB 4WB4A 3CI9A 3KYQA 1M90Q 2N9BA 3IN6A 3PRJA 1FBMA 1JB0J 1JY2O 1WT6A 3N7NA 3VMZA 3AE3C 4H0LD 3SFEC 4A7PA 2G3AA 4PV1C 2R3CA 3SWYA 2NPSA 4XE5B 5KLVD 1HBWA 4HYTB 5APYA 4M3LA 3WMM0 2OYHA 2FXPA 1SQQG 1SQQK 1URQC 4N3YB 1IFJA 4KT0J 3L73J 5CJ0A 5KKZB 4I6MC 3AE8C 1SQVE 2M0BA 3PTZA 1J2JB 4U3FG 1HUCA 1P84I 2WSCJ 1KILA 3M0DA 2B87B 4JPZB 1PL5A 3RL0g 1SQVD 1HJBA 2OYIB 1FOSF 1E79H 2IBZE 2KZJA 1SFCA 2Z5HA 1Q81Q 1Q86Q 5B66E 5KKZC 1MZ9A 1P84D 2IDBA 3P8CD 4C7NA 1OIPA 3RBZA 2IZ0A 1KD1Q 3B4SA 4D6TJ 2KZIA 2YKQA 3E1RA 2YKOA 3BATA 2ZVOB 3H1KJ 1VQLP 4GDOA 2E76C 1E5WA 2PRRA 2OYIC 1SQBG 1PP9D 1SQBK 2WSSH 1BE3E 1M1JB 2E74B 1RE3A 1LP1B 1PGQA 2O01J 3FXEA 2L91A 1BCCD 2A45H 4JYCA 3BCCE 1FS0E 4PJ0E 2R5BA 1GTWA 1UIXA 2J59M 3O8ZA 3AEFC 4IFMA 1OW8A 2N1TB 1BE3D 3H1JJ 2C9LY 1VQ7P 3CXHI 1X0TA 3KXDA 1FZCA 3S1KA 2OTKE 1A02J 2IYOA 1H8AA 1YBKA 3TSIA 2E74C 1IJDB 3CWBE 3H32B 4ZNCA 3OA7A 3AE4C 1D7MA 3TGUE 5AW0B 4DCKA 3PLNA 3QWOC 2BCCD 1KQLA 4JF7A 1SQPE 5CCGA 2N1TC 1PFIA 1SQXG 2XKMA 5AVZB 3GW6A 3OAKA 2O1JA 3L73G 2M8RA 3L71J 3T97A 3WUTA 3TGUD 5AW8B 2BASA 5BU5A 1NTKE 3EWKA 4H13D 1SQPD 3MGNA 2HODB 2WPVB 3KDPB 2XNXA 2Q3IA 3CCVP 1M8OB 1KYOI 3CL3D 2QEXP 4Z1MH 2RMZA 4WY4A 2K1AA 3U59A 2WT7B 4TLFA 4IL6X 2W27A 3LIDA 3U1CA 1RE4C 1U7MA 1SFCD 2YO2A 3GMAA 1KYOD 4D6TG 3L75J 1AQTA 1OVVA 3HD7B 2M3BA 1QL2A 1BCCJ 1GW3A 2ZT9B 3H1KG 4ZKPA 4I2LC 1S5LH 1VQPP 1GZLA 1JCDA 1PIXA 1H88A 1RHZB 3CMAP 3H1LJ 3RL0B 5APQA 1T2KD 3WUUA 1FZFA 2KLUA 4UB8E 2WSFJ 1NU1J 4AUWA 1ZXGA 2Y0CA 5AW1B 2K9YA 1OMIA 2Y9YA 3HD7C 2L5GB 5AVXB 2KS1B 2Q5UA 2ZT9C 1K9MQ 1YTZT 2ZVNB 3AECC 2RH0A 1T3UA 1FC2C 1VPCA 3RL0C 1T8ZA 3VN0A 1L0NE 1IFIA 1N7SB 1S4XA 2ZYAA 3GHGC 4HKZH 2P67A 3HE4B 4OGQD 3AE7C 1KQGB 2V7QH 1NTMD 4OWFA 1P84H 1EXJA 3E7KA 2Y0DA 2H89C 1Y47A 2P2UA 1S2EA 3A5TA 1OWAA 1N7SC 1KV4A 3BVHA 2K37A 5B66H 1R5SA 1RY3A 4GOEA 5AVQB 2H7HA 1AFOA 4W7ZA 4H44B 3HUSA 1PGJA 2FYUD 4WWIA 1L4AA 3V2RA 3L75G 4GIFA 5H2FE 1KB9E 5AW4B 1QL1A 2E5YA 3KZIE 1YQ3C 1KTMA 1BCCG 4L75A 1GMJA 5CCHA 2QRXA 4CPGA 3CC7P 1RQUA 3UIAA 3C1LA 4PJ0H 2WZ7A 1IO4A 1EC5A 3B5NA 2IFMA 2E43A 1EZVI 5E79E 3AE9C 1MKMA 1NU1G 2D2CC 1NU1K 3U1AA 4HH2A 2XU6A 2KIKA 1NTZD 2A45I 5AVTB 3C9IA 3MZWB 1GU5A 1OFCX 3FXDA 1NOHA 1EZVD 4NPEA 1IFNA 1A02F 1SS1A 2QJPB 4I1LA 2B87A 3B8EB 3JCUE 1X22A 2YO3A 3PHLA 5KJ7A 2A06D 2C0WA 2RKLA 3MHVA 3G6EP 2O1KA 2E75B 3SWFA 1SQQJ 1KQSO 2JWDA 1GL2B 3H1HE 4L74A 1KYOH 2HYNA 5AVSB 2QJPC 4NPFX 3AEEC 1M1JA 4IFFA 4EDFA 3E1IA 2E75C 5CBNA 1JM0A 1EDIA 1LTTC 1YITP 3D70A 5CBOA 1UIIA 4DJGA 4PV1D 4HJGH 2QVAA 2W8ZA 1HVVA 3Q2YA 5EFWB 2W83C 3S9OA 1ZMEC 2M3EA 1KORA 1L4AD 1JOCA 2W6JH 1N73A 1LTJC 1FE6A 2PGDA 4UB8H 2Y9ZA 1CSBA 3H32A 1NTZJ 1AVYA 3L72E 5CCHD 1S9KE 1ZRTE 1X79B 3Q5RA 4C46A 2IPPA 2IZ1A 1G2CB 1K73Q 3L72D 1L0LJ 2ZYGA 1URQB 2KUBA 5AVRB 2AEMA 1FZEA 3L74J 2HODA 1OW6A 2WPQA 1BGYJ 1AQ5A 2ZYDA 2NRGA 5AVWB 1U57A 3H1JE 4RKUJ 2ITAA 1LT1A 1S72P 3RK3B 1H89A 3M91A 2OGUA 2XNDH 2YIUC 1OX3A 2RN0A 3MUDA 1SQXJ 5KJ7D 2C0XA 2IFNA 3CC2P 2KSEA 1Q90D 3A2AA 3AE5C 3FGAD 2FYUG 2FYUK 3CD6P 2JKVA 2JJLA 5DJUB 5KAIE 5KAFE 2ZAEB 4JQ0D 3RK3C 3L71E 2E76B 2IBZI 4BRYB 1G1JA 3NFQA 5H2FH 2PAJA 1Y9BA 3CLQA 3H6PA 2E74D 2XV5A 3CCQP 1HTLC 2G8YA 5B5EH 1Y8AA 1DIPA 2V4HA 2IBZD 3D6YA 3HTKB 2W6BA 3N4XA 1LT9C 1RF1C 5TISE 1RQVA 2N1TD 3H1IE 5E79H 3G3ZA 5TJHA 4KHXA 3CCMP 1N86A 4H0LC 1NTZG 1NTZK 2KSJA 4UB6E 1FZBA 1LNQA 1EZVG 2YNYA 2YXRB 2JP3A 1RH5B 1L0LG 1L0LK 2A45G 1KFMA 3H1LE 1FJPA 2A06G 2C9NY 3L74G 1MFTA 5KLVJ 2WVRA 2HPCA 1BGYG 1W2BO 1M1KQ 3BCCD 5AW3B 2YMKA 3VOPA 2WSEH 4L76A 2I1JA 2R44A 1ZOYC 1RF0C 2GA1A 3B71A 1SQXK 2E42A 3CWBD 2KOGA 1LWUC 5BU8B 1NAYA 1SQVJ 4R4LA 4K35A 3VMXA 2PFXA 3HE5B 3VYIA 4EI2A 2FFDB 2V7QJ 5GTHE 3ITKA 3D6ZA 1DX7A 4IL6H 1NYHA 3HRNA 4JYBA 3CX5E 2Y0EA 2AEFA 2JEEA 1NTKD 1CW5A 3L70E 5AW6B 3CCUP 1HWTC 2CK3H 1X8YA 4Y99C 1PP9J 2YXQB 2FFDC 1FOSE 1VQ8P 1VL2A 2NPSB 3K5BA 5CHXA 3L70D 4NPDA 2IX7C 2OYHB 3G9RA 1OVUA 1BE3J 3OJAB 3A0BE 3Q5PA 1NHLA 3GHGB 2O01H 3TYYA 2XDJA 2HG5D 1KILB 2NPSC 1WRGA 2QE7H 5M1BA 1BDDA 1SFCB 5KLVG 2KXPB 5KLVK 1IK7A 2BCCJ 2OYHC 3V2NA 2WPSA 2OYOA 4DOJA 2QJKB 1FJKA 3MD0A 2UWJE 1PPJE 4KJMA 3CPWO 2AXTE 2M5AA 4C7NB 1IK9A 1ZR4A 3TGUJ 1QGKB 3R4YA 1SQPJ 4Y28J 2KYVA 1KILC 3M0DC 3AE2C 2LXCB 2WTYA 3V6IA 3VMAA 1L0ND 5KAIH 4H44D 1SFCC 1SQVG 1SQVK 4YTPC 2QJKC 1YI2P 1PGPA 1NAFA 3G71P 4IOIH 3PH0A 3WUVA 2KNCA 2HFED 1AA0A 1SQQE 2K9JA 2IBZG 1CI6A 2B88A 1NGMB 3VTPC 4U7JA 1BSHA 1T2KC 5APWA 3O6QB 1FZCB 3I56P 1ZP0C 5APVA 3H25A 5TISH 3M9BA 4U3FE 1S1CX 3A0HE 1FZGA 1PP9G 2D2CB 1KB9I 1RE3C 3L35A 2Q6QA 3IR9A 2FBWC 1Z56A 1VQ5P 1URQA 1K04A 1YJ9P 3M9QA 3RBXA 4YXWH 4UB6H 1YTZI 1JTHB 4U3FD 1BE3G 1JY2N 1Q82Q 3CCJP 2K3RA 1KB9D 3TNUB 1GU4A 1FZCC 1QEXA 4MN4C 3BASA 3NTNA 3MIWA 1FDMA 1FZAA 2AEJA 4OGQC 1NKZB 3A3YB 3L37A 3L4FA 5DJTB 4PD4E 1K05A 1SQBE 3P7KA 3W68A 1MV8A 2E75D 4WY4B 5CCGC 2BCCG 1GL2D 4YPCA 1PGOA 2KP8A 3CCLP 4YXDC 3USSA 1NTMJ 1SQBD 4BRYA 2OYIA 3TGUG 1VF5D 5K5GB 1SQPG 3OW2O 1SQPK 1HF9A 1J1DB 5CMZA 2QIWA 1FAVA 2H8PD 2FXOA 4WY4C 1ZR2A 1VQMP 1EXIA 3CX5H 3HTKA 1NTKG 4N78E 1KZUB 2R32A 1FDOA 2FYUJ 1IC2A 4XFJA 1Q7YQ 1LTJB 1VQNP 1SQXE 4WVZA 3KHUA 2N9YB 3L73E 3H1HD 1J1DC 1LP1A 1USEA 1VQKP 4N78D 3VP8A 5APTA 3V4QA 3QH9A 4XA4A 4I7ZC 2N1TA 2OTJP 3L73D 5AW2B 4EIJA 3SFDC 4EYYQ 1NWQA 1SVFA 3A0BH 2XZRA 4ASVA 1N2DC 1URQD 4AQRD 3RK3E
chains in the Genus database with same CATH topology
2VRSA 1GW3A 3BRTB 1N86A 2FKWB 3M0AA 4ZKPA 4I2LC 1NTZK 1GZLA 1JCDA 1VDFA 2MJZA 2YMYA 1H88A 2KSJA 1FZBA 3RL0B 2WSFH 1JY2P 5APQA 2YNYA 1T2KD 4LLHA 1ZN5A 4EOTA 1FZFA 2GM4A 4WBAA 1RE4A 1S9KD 2GUSA 4AUWA 5AVUB 5AW1B 1L0LK 2A45G 1KFMA 2FYZA 1FJPA 3HE5A 3HD7C 1ZLLA 1LT9A 1RF1A 1GK4A 2C9NY 2L5GB 5AVXB 2Q5UA 3HUSB 2HPCA 1YTZT 4LGDE 1L0NK 1NTMK 1JCCA 1GW4A 1L4AB 5AW3B 4N6JA 3EQ2A 3NMDA 3TK1A 3VOPA 1T3UA 2WSEH 2LKMA 2I1JA 1VPCA 2WT7A 3RL0C 1T8ZA 3VN0A 1IFIA 1N7SB 1RF0C 1JY3N 3GHGC 4DZOA 2P67A 3HE4B 2QM7A 1T3JA 3RK2B 2W6AA 1DEBA 4GKGA 1SQXK 2E42A 2Q7CA 1NTKK 3B5NB 1FU1A 2KOGA 3LIEA 1LWUC 3HD7A 5BU8B 1JUNA 3HUSC 1JY3P 3VMYA 3VMXA 1JMMA 1L4AC 1XTGB 2P7JA 5APSA 3HE5B 2I1KA 3V2QA 3VYIA 1HGZA 2FFDB 1LT9B 1RF1B 4W7YA 2P2UA 1DX7A 3A5TA 1XTCC 1OWAA 1N7SC 3HRNA 1LTBC 1EQ7A 3R2PA 4JYBA 5BVZA 5CCHC 1LTAC 3BVHA 1RF0A 3GHGA 1RY3A 5AVQB 5AVYB 3RK2C 2JEEA 2R5DA 1CW5A 2H7HA 3B5NC 5AW6B 3NXSA 5AW7B 1HWTC 1AFOA 1LTSC 3P8MC 4W7ZA 3P8CE 1LWUA 4B86A 2HLOA 3HUSA 1X8YA 1NO4A 4Y99C 1L4AA 1SP4A 1GL2C 3V2RA 2FFDC 1FOSE 4GIFA 5APXA 1SLQA 2NPSB 2WWWA 4GT1A 5AW4B 1QL1A 1DH3A 5CHXA 3MTUE 2IX7C 1N7SA 5CJ4A 2OYHB 4W80A 5CCHA 3HE4A 1N7LA 3UIAA 2Z4EA 3OJAB 1J1EB 2WZ7A 1IO4A 3B5NA 3RK3D 1MFZA 2IFMA 1NHLA 2E43A 3GHGB 2O01H 2CPSA 3TYYA 3EFGA 1CI6B 3M06A 3V2PA 5KJ7C 1GD2E 2XDJA 1NU1K 3RK2D 2GUVA 2HG5D 1KILB 2FFDA 2NPSC 1LWUB 1WRGA 1HH0A 3B5ND 3U1AA 4HH2A 2XU6A 3LW5H 1M7LA 2A45I 1SFCB 2OARA 4IFDK 5AVTB 5KLVK 2OYHC 2CPBA 3V2NA 2WPSA 3C9IA 4DOJA 1GU5A 2WITA 1ZV8A 1NOHA 1FJKA 3BRVB 2QM8A 4WB4A 3MD0A 3CI9A 3KYQA 1IFNA 1A02F 1J1EC 2N9BA 3II6A 1FBMA 4C7NB 1IK9A 1JY2O 1WT6A 3N7NA 4I1LA 3VMZA 3B8EB 1ZR4A 1N73B 1HGVA 2YO3A 1GDTA 1M1JC 5KJ7A 2KYVA 1KILC 3M0DC 1JO5A 2C0WA 2R3CA 1YYCA 2WTYA 3SWYA 2NPSA 3VP9A 4C7RA 4XE5B 2O1KA 1HBWA 4HYTB 5APYA 1SFCC 4M3LA 3WMM0 4Y99B 1SQVK 3SWFA 1X9VA 1JTHA 2OYHA 2YKPA 1GL2B 1GK6A 1SQQK 1URQC 4N3YB 1IFJA 2ZXEB 1NAFA 5CJ0A 3HD7D 2Z5IA 4I6MC 2NPSD 2HYNA 5AVSB 3TNUA 3V5BA 2WSCH 1J2JB 2HFED 1N73C 1LTIC 1HUCA 1CI6A 3VTPC 1M1JA 1CZQA 4IFFA 3RL0D 1T2KC 5APWA 1KILA 3M0DA 1FZCB 3E1IA 1HJBA 5APVA 3M9BA 2OYIB 1FOSF 2J58A 1SFCA 1LTTC 2Z5HA 1FZGA 1JY3O 1RE3C 3L35A 3M9HA 3IR9A 1Z56A 2P1JA 1URQA 1KILD 3M9QA 2H43A 1HVVA 1MZ9A 3P8CD 4C7NA 1YTZI 1MUUA 1JTHB 5AW5B 2Q9IA 1L4AD 1JOCA 1N73A 1LTJC 2YKQA 4AYCA 1JY2N 2YKOA 3BATA 3TNUB 1GU4A 1JNMA 1FZCC 1LTGC 1CSBA 3H32A 1N7SD 1E5WA 5AW9B 2OYIC 5CCHD 1S9KE 3BASA 1SQBK 1M1JB 2POHA 3NTNA 3MIWA 1X79B 1FDMA 2ZFCA 1GL2A 1FZAA 1RE3A 4C46A 3KPEA 3I5CA 1NKZB 2A45H 3A3YB 2IPPA 3L4FA 3L37A 3KQGA 2KLVA 4JYCA 3P7KA 1MV8A 1G2CB 4RESB 4WY4B 5CCGC 2R5BA 1GTWA 2J59M 3O8ZA 3L36A 1URQB 4IFMA 1NKNA 2N1TB 1GL2D 5AVRB 1LTJA 2KP8A 2C9LY 1FZEA 2HODA 1OXZA 2WPQA 1FZCA 1AQ5A 3PP5A 1A02J 2OYIA 5AVVB 1H8AA 5AVWB 3TSIA 1IJDB 3V4WA 1SQPK 1J1DB 4LC1A 3H32B 3RK3B 3OA7A 4OH8B 1H89A 5CMZA 3M91A 1FAVA 2H8PD 5AW0B 4WY4C 1ZR2A 5APUA 1KQLA 4JF7A 3MUDA 5CCGA 5KJ7D 2C0XA 1IFMA 2N1TC 1PFIA 2XKMA 3HTKA 2IFNA 3P32A 5AVZB 3OAKA 2O1JA 2M8RA 4N78E 1KZUB 2R32A 3A2AA 3T97A 1IC2A 5AW8B 2BASA 2FYUK 1LTJB 4O9BA 5CCGD 5BU5A 2JJLA 2FXMA 3MGNA 2HODB 1IFDA 1J1DC 3KDPB 3RK3C 2XNXA 2Q3IA 2HPCB 4N78D 3VP8A 4ZKUA 1G1JA 3CL3D 3NFQA 5APTA 3V4QA 1QL2A 1G2CA 2PAJA 4WY4A 3U59A 4XA4A 2WT7B 3CLQA 3IFMA 2N1TA 3H6PA 2W27A 2XV5A 5AW2B 4EIJA 3LIDA 3U1CA 1HTLC 1LGHB 1NWQA 1NH4A 1SVFA 1KFNA 1RE4C 1SFCD 2WPRA 3A7OA 2YO2A 1W2EA 4WY4D 2KB7P 2XZRA 3HTKB 2W6BA 3N4XA 2PP6A 1N2DC 1LT9C 1URQD 4AQRD 5KTBA 1RF1C 2N1TD 3HD7B 3G3ZA 1G1IA 2M3BA 4KHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLQ A;  2J59 M;  2O01 H;  2FYU K;  3M9Q A;  1SQV K;  1SQB K;  1L0L K;  1NTZ K;  1NU1 K;  1SQQ K;  2WSF H;  3LW5 H;  1L0N K;  1SQP K;  1NTM K;  1SQX K;  2OAR A;  4IFD K;  1NTK K;  5KLV K;  2WSE H;  3G3Z A;  2WSC H;  2LKM A; 
#chains in the Genus database with same CATH topology
 1H0T B;  1VQO P;  1AJY A;  2FKW B;  3M0A A;  1K8A Q;  2Q3E A;  4D6T E;  3PJS K;  1VDF A;  2YMY A;  3F5H A;  3H1K E;  4LLH A;  2O01 N;  2YIU B;  4ASW A;  1RE4 A;  2AXT H;  1S9K D;  1ZRT D;  5AVU B;  5KLI C;  1JEK A;  2FYZ A;  1S5L E;  3HE5 A;  1ZLL A;  1GK4 A;  2BEZ F;  3H1K D;  3HUS B;  1BDC A;  1L0N G;  1L0N K;  1NTM G;  1NTM K;  1JCC A;  1L4A B;  4BXL A;  4GOF A;  3AEG C;  2LKM A;  1NJI Q;  2WT7 A;  3W67 A;  5KLV E;  1JY3 N;  2E76 D;  2WSE J;  3JC2 2;  2OQQ A;  1T3J A;  2JO1 A;  3RK2 B;  2W6A A;  1DEB A;  4GKG A;  2P10 A;  3H1H J;  3H1J D;  2Q7C A;  3B5N B;  3Q3D A;  1FU1 A;  3HD7 A;  1OZH A;  3HUS C;  1JY3 P;  1DEE G;  3VMY A;  1L4A C;  1XTG B;  2P7J A;  3AEA C;  2I1K A;  1LT9 B;  1RF1 B;  4W7Y A;  1AV1 A;  1IZN B;  3A0H H;  2J5U A;  1LTB C;  1EQ7 A;  4H0L B;  5BVZ A;  5CCH C;  1LTA C;  1KB9 H;  3KZI H;  3GHG A;  1OVR A;  3RK2 C;  1IFP A;  1L2P A;  2R5D A;  3CCR P;  3B5N C;  3NXS A;  5AW7 B;  2LR2 A;  1P84 E;  1LTS C;  3P8M C;  3L71 D;  3GG2 A;  2JWA A;  3F89 A;  3P8C E;  4B86 A;  2KS1 A;  1FDI A;  4GOD A;  3FWL A;  5APX A;  3IF4 A;  1M57 D;  1N7S A;  1PP9 E;  4W80 A;  3L72 J;  3L75 E;  3HE4 A;  4PD4 H;  2Z4E A;  1BCC E;  1J1E B;  2I8D A;  3H1I D;  3WU2 E;  3Q5S A;  1MFZ A;  3M06 A;  3V2P A;  5KJ7 C;  3L75 D;  3JSV C;  3JCU H;  1LWU B;  1HH0 A;  1BSN A;  3LW5 H;  1VQ6 P;  1M7L A;  2SPZ A;  2CPB A;  1NU1 E;  1ZW0 A;  2WIT A;  4HB1 A;  4RO0 A;  2QM8 A;  3H1L D;  1J1E C;  3II6 A;  1KQF B;  3O6Q A;  2BCC E;  3CXH E;  1N73 B;  1HGV A;  1NU1 D;  5GTI E;  1GDT A;  1YIJ P;  1M1J C;  2K88 A;  1JO5 A;  2QA4 P;  1OW7 A;  3H1H G;  1YYC A;  3VP9 A;  4C7R A;  1M56 D;  1HJ0 A;  4Y99 B;  1QVF O;  1X9V A;  1JTH A;  3CXH D;  2YKP A;  1GK6 A;  3D71 A;  2ZXE B;  3CX5 I;  3HD7 D;  2Z5I A;  2NPS D;  1VQ9 P;  3TNU A;  2ZT9 D;  3V5B A;  2WSC H;  1N73 C;  5L8R J;  3G4S P;  1LTI C;  4JBZ A;  2KI7 B;  2QSI A;  1KIL E;  3AED C;  1CZQ A;  3RL0 D;  1DD3 A;  3TF5 A;  2KK7 A;  3CX5 D;  2J58 A;  1KYO E;  1JY3 O;  1YJN P;  3M9H A;  2P1J A;  1KIL D;  3H1I J;  2H43 A;  1TU3 F;  4K3A A;  1MUU A;  5AW5 B;  2Q9I A;  4H13 B;  3L72 G;  2AXC A;  4AYC A;  1Q2N A;  2JR8 A;  1KC8 Q;  1JNM A;  1LTG C;  1N7S D;  3BCC J;  5AW9 B;  1EDJ A;  1NVO A;  2POH A;  2ZFC A;  1GL2 A;  3KPE A;  1S5L X;  3I5C A;  1KMI Z;  3KQG A;  2KLV A;  4RES B;  3MUD C;  2JDI H;  4H13 C;  3L36 A;  1NKN A;  1LTJ A;  1T6A A;  3GF7 A;  3CWB J;  1W5C E;  3H1J G;  1OXZ A;  1EDK A;  3PP5 A;  1VQ4 P;  2WMM A;  5AVV B;  3CCE P;  3V4W A;  4LC1 A;  1PPJ D;  4OH8 B;  1NTM E;  1QLE D;  5KAF H;  2Q1K A;  4TT3 H;  5APU A;  3Q1M A;  2FYN B;  1NTK J;  3AE1 C;  1IFM A;  2D2C D;  3P32 A;  3SWK A;  3L71 G;  1H0T A;  5CCG D;  4O9B A;  2DW3 A;  2FXM A;  1IFD A;  3EFF K;  3L70 J;  2HR3 A;  2HPC B;  4ZKU A;  1QX8 A;  2FYU E;  1G2C A;  1YQ4 C;  1SQQ D;  3IFM A;  2FYN C;  2LXB A;  4OGQ B;  1QVG O;  4BWN A;  1DD4 A;  3H1I G;  1LGH B;  1NH4 A;  1KFN A;  2WPR A;  3MP7 B;  3A7O A;  1W2E A;  4WY4 D;  2KB7 P;  3WU2 H;  3FX0 A;  2IYP A;  2PP6 A;  5KTB A;  3AEB C;  1G1I A;  2VRS A;  3T97 B;  3RGU A;  3BRT B;  3BCC G;  1PV3 A;  2MJZ A;  5B5E E;  2B89 A;  2MKV A;  2WSF H;  4PD4 I;  1JY2 P;  4L73 A;  3H1L G;  1NTZ E;  1ZN5 A;  4H44 C;  1YJW P;  2W90 A;  4EOT A;  1JMB A;  2GM4 A;  4WBA A;  2WQY C;  2GUS A;  3TDK A;  2NZ2 A;  1EZV E;  1PZQ A;  3CXH H;  3C8V A;  1LT9 A;  1RF1 A;  3CWB G;  5C39 A;  5GTI H;  1L0N J;  1USD A;  4LGD E;  4PD4 D;  1GW4 A;  1R5L A;  1L0L E;  4N6J A;  3EQ2 A;  2O3J A;  3NMD A;  3TK1 A;  2A06 E;  1N8R Q;  3L74 E;  1BGY E;  4RJT A;  3FWN A;  1EDL A;  2R3S A;  3CCS P;  4DZO A;  5GTH H;  2QM7 A;  4I7Z B;  1L0L D;  3GLM A;  1NTK K;  3CME P;  3L74 D;  3LIE A;  1JUN A;  1BGY D;  2QG4 A;  3ABV C;  1JMM A;  1LJ2 A;  5APS A;  3V2Q A;  1HGZ A;  3ZDM A;  4OVN F;  1KN7 A;  2BEQ D;  1U7J A;  1XTC C;  3L70 G;  2QJY B;  3R2P A;  1RF0 A;  4U3F J;  1VF5 B;  4R4M A;  5AVY B;  1AVO A;  1SQX D;  4DT0 A;  2M5A B;  4ZMD A;  1LWU A;  1R8E A;  2H88 C;  3IAO A;  2HLO A;  1NO4 A;  5KLI B;  1SP4 A;  4IL6 E;  1GL2 C;  1YHQ P;  1SLQ A;  2WWW A;  4GT1 A;  2E5T A;  1DH3 A;  3MTU E;  2QJY C;  3AE6 C;  5CJ4 A;  1VF5 C;  1N7L A;  2P58 A;  1WMK A;  3RK3 D;  2KNC B;  3CC4 P;  1SQB J;  2CPS A;  3SSU A;  2K9J B;  3EFG A;  1CI6 B;  4D6T D;  3I55 P;  1GD2 E;  2ZXX A;  3RK2 D;  2GUV A;  4PV1 B;  2B9B A;  3S4R A;  2FFD A;  3GF3 A;  3B5N D;  1PPJ G;  1S3J A;  2ZJS E;  2OAR A;  4IFD K;  2FY8 A;  4QMA A;  1ZV8 A;  2OTL P;  3LW5 J;  3BRV B;  4WB4 A;  3CI9 A;  3KYQ A;  1M90 Q;  2N9B A;  3IN6 A;  3PRJ A;  1FBM A;  1JB0 J;  1JY2 O;  1WT6 A;  3N7N A;  3VMZ A;  3AE3 C;  4H0L D;  3SFE C;  4A7P A;  2G3A A;  4PV1 C;  2R3C A;  3SWY A;  2NPS A;  4XE5 B;  5KLV D;  1HBW A;  4HYT B;  5APY A;  4M3L A;  3WMM 0;  2OYH A;  2FXP A;  1SQQ G;  1SQQ K;  1URQ C;  4N3Y B;  1IFJ A;  4KT0 J;  3L73 J;  5CJ0 A;  5KKZ B;  4I6M C;  3AE8 C;  1SQV E;  2M0B A;  3PTZ A;  1J2J B;  4U3F G;  1HUC A;  1P84 I;  2WSC J;  1KIL A;  3M0D A;  2B87 B;  4JPZ B;  1PL5 A;  3RL0 g;  1SQV D;  1HJB A;  2OYI B;  1FOS F;  1E79 H;  2IBZ E;  2KZJ A;  1SFC A;  2Z5H A;  1Q81 Q;  1Q86 Q;  5B66 E;  5KKZ C;  1MZ9 A;  1P84 D;  2IDB A;  3P8C D;  4C7N A;  1OIP A;  3RBZ A;  2IZ0 A;  1KD1 Q;  3B4S A;  4D6T J;  2KZI A;  2YKQ A;  3E1R A;  2YKO A;  3BAT A;  2ZVO B;  3H1K J;  1VQL P;  4GDO A;  2E76 C;  1E5W A;  2PRR A;  2OYI C;  1SQB G;  1PP9 D;  1SQB K;  2WSS H;  1BE3 E;  1M1J B;  2E74 B;  1RE3 A;  1LP1 B;  1PGQ A;  2O01 J;  3FXE A;  2L91 A;  1BCC D;  2A45 H;  4JYC A;  3BCC E;  1FS0 E;  4PJ0 E;  2R5B A;  1GTW A;  1UIX A;  2J59 M;  3O8Z A;  3AEF C;  4IFM A;  1OW8 A;  2N1T B;  1BE3 D;  3H1J J;  2C9L Y;  1VQ7 P;  3CXH I;  1X0T A;  3KXD A;  1FZC A;  3S1K A;  2OTK E;  1A02 J;  2IYO A;  1H8A A;  1YBK A;  3TSI A;  2E74 C;  1IJD B;  3CWB E;  3H32 B;  4ZNC A;  3OA7 A;  3AE4 C;  1D7M A;  3TGU E;  5AW0 B;  4DCK A;  3PLN A;  3QWO C;  2BCC D;  1KQL A;  4JF7 A;  1SQP E;  5CCG A;  2N1T C;  1PFI A;  1SQX G;  2XKM A;  5AVZ B;  3GW6 A;  3OAK A;  2O1J A;  3L73 G;  2M8R A;  3L71 J;  3T97 A;  3WUT A;  3TGU D;  5AW8 B;  2BAS A;  5BU5 A;  1NTK E;  3EWK A;  4H13 D;  1SQP D;  3MGN A;  2HOD B;  2WPV B;  3KDP B;  2XNX A;  2Q3I A;  3CCV P;  1M8O B;  1KYO I;  3CL3 D;  2QEX P;  4Z1M H;  2RMZ A;  4WY4 A;  2K1A A;  3U59 A;  2WT7 B;  4TLF A;  4IL6 X;  2W27 A;  3LID A;  3U1C A;  1RE4 C;  1U7M A;  1SFC D;  2YO2 A;  3GMA A;  1KYO D;  4D6T G;  3L75 J;  1AQT A;  1OVV A;  3HD7 B;  2M3B A;  1QL2 A;  1BCC J;  1GW3 A;  2ZT9 B;  3H1K G;  4ZKP A;  4I2L C;  1S5L H;  1VQP P;  1GZL A;  1JCD A;  1PIX A;  1H88 A;  1RHZ B;  3CMA P;  3H1L J;  3RL0 B;  5APQ A;  1T2K D;  3WUU A;  1FZF A;  2KLU A;  4UB8 E;  2WSF J;  1NU1 J;  4AUW A;  1ZXG A;  2Y0C A;  5AW1 B;  2K9Y A;  1OMI A;  2Y9Y A;  3HD7 C;  2L5G B;  5AVX B;  2KS1 B;  2Q5U A;  2ZT9 C;  1K9M Q;  1YTZ T;  2ZVN B;  3AEC C;  2RH0 A;  1T3U A;  1FC2 C;  1VPC A;  3RL0 C;  1T8Z A;  3VN0 A;  1L0N E;  1IFI A;  1N7S B;  1S4X A;  2ZYA A;  3GHG C;  4HKZ H;  2P67 A;  3HE4 B;  4OGQ D;  3AE7 C;  1KQG B;  2V7Q H;  1NTM D;  4OWF A;  1P84 H;  1EXJ A;  3E7K A;  2Y0D A;  2H89 C;  1Y47 A;  2P2U A;  1S2E A;  3A5T A;  1OWA A;  1N7S C;  1KV4 A;  3BVH A;  2K37 A;  5B66 H;  1R5S A;  1RY3 A;  4GOE A;  5AVQ B;  2H7H A;  1AFO A;  4W7Z A;  4H44 B;  3HUS A;  1PGJ A;  2FYU D;  4WWI A;  1L4A A;  3V2R A;  3L75 G;  4GIF A;  5H2F E;  1KB9 E;  5AW4 B;  1QL1 A;  2E5Y A;  3KZI E;  1YQ3 C;  1KTM A;  1BCC G;  4L75 A;  1GMJ A;  5CCH A;  2QRX A;  4CPG A;  3CC7 P;  1RQU A;  3UIA A;  3C1L A;  4PJ0 H;  2WZ7 A;  1IO4 A;  1EC5 A;  3B5N A;  2IFM A;  2E43 A;  1EZV I;  5E79 E;  3AE9 C;  1MKM A;  1NU1 G;  2D2C C;  1NU1 K;  3U1A A;  4HH2 A;  2XU6 A;  2KIK A;  1NTZ D;  2A45 I;  5AVT B;  3C9I A;  3MZW B;  1GU5 A;  1OFC X;  3FXD A;  1NOH A;  1EZV D;  4NPE A;  1IFN A;  1A02 F;  1SS1 A;  2QJP B;  4I1L A;  2B87 A;  3B8E B;  3JCU E;  1X22 A;  2YO3 A;  3PHL A;  5KJ7 A;  2A06 D;  2C0W A;  2RKL A;  3MHV A;  3G6E P;  2O1K A;  2E75 B;  3SWF A;  1SQQ J;  1KQS O;  2JWD A;  1GL2 B;  3H1H E;  4L74 A;  1KYO H;  2HYN A;  5AVS B;  2QJP C;  4NPF X;  3AEE C;  1M1J A;  4IFF A;  4EDF A;  3E1I A;  2E75 C;  5CBN A;  1JM0 A;  1EDI A;  1LTT C;  1YIT P;  3D70 A;  5CBO A;  1UII A;  4DJG A;  4PV1 D;  4HJG H;  2QVA A;  2W8Z A;  1HVV A;  3Q2Y A;  5EFW B;  2W83 C;  3S9O A;  1ZME C;  2M3E A;  1KOR A;  1L4A D;  1JOC A;  2W6J H;  1N73 A;  1LTJ C;  1FE6 A;  2PGD A;  4UB8 H;  2Y9Z A;  1CSB A;  3H32 A;  1NTZ J;  1AVY A;  3L72 E;  5CCH D;  1S9K E;  1ZRT E;  1X79 B;  3Q5R A;  4C46 A;  2IPP A;  2IZ1 A;  1G2C B;  1K73 Q;  3L72 D;  1L0L J;  2ZYG A;  1URQ B;  2KUB A;  5AVR B;  2AEM A;  1FZE A;  3L74 J;  2HOD A;  1OW6 A;  2WPQ A;  1BGY J;  1AQ5 A;  2ZYD A;  2NRG A;  5AVW B;  1U57 A;  3H1J E;  4RKU J;  2ITA A;  1LT1 A;  1S72 P;  3RK3 B;  1H89 A;  3M91 A;  2OGU A;  2XND H;  2YIU C;  1OX3 A;  2RN0 A;  3MUD A;  1SQX J;  5KJ7 D;  2C0X A;  2IFN A;  3CC2 P;  2KSE A;  1Q90 D;  3A2A A;  3AE5 C;  3FGA D;  2FYU G;  2FYU K;  3CD6 P;  2JKV A;  2JJL A;  5DJU B;  5KAI E;  5KAF E;  2ZAE B;  4JQ0 D;  3RK3 C;  3L71 E;  2E76 B;  2IBZ I;  4BRY B;  1G1J A;  3NFQ A;  5H2F H;  2PAJ A;  1Y9B A;  3CLQ A;  3H6P A;  2E74 D;  2XV5 A;  3CCQ P;  1HTL C;  2G8Y A;  5B5E H;  1Y8A A;  1DIP A;  2V4H A;  2IBZ D;  3D6Y A;  3HTK B;  2W6B A;  3N4X A;  1LT9 C;  1RF1 C;  5TIS E;  1RQV A;  2N1T D;  3H1I E;  5E79 H;  3G3Z A;  5TJH A;  4KHX A;  3CCM P;  1N86 A;  4H0L C;  1NTZ G;  1NTZ K;  2KSJ A;  4UB6 E;  1FZB A;  1LNQ A;  1EZV G;  2YNY A;  2YXR B;  2JP3 A;  1RH5 B;  1L0L G;  1L0L K;  2A45 G;  1KFM A;  3H1L E;  1FJP A;  2A06 G;  2C9N Y;  3L74 G;  1MFT A;  5KLV J;  2WVR A;  2HPC A;  1BGY G;  1W2B O;  1M1K Q;  3BCC D;  5AW3 B;  2YMK A;  3VOP A;  2WSE H;  4L76 A;  2I1J A;  2R44 A;  1ZOY C;  1RF0 C;  2GA1 A;  3B71 A;  1SQX K;  2E42 A;  3CWB D;  2KOG A;  1LWU C;  5BU8 B;  1NAY A;  1SQV J;  4R4L A;  4K35 A;  3VMX A;  2PFX A;  3HE5 B;  3VYI A;  4EI2 A;  2FFD B;  2V7Q J;  5GTH E;  3ITK A;  3D6Z A;  1DX7 A;  4IL6 H;  1NYH A;  3HRN A;  4JYB A;  3CX5 E;  2Y0E A;  2AEF A;  2JEE A;  1NTK D;  1CW5 A;  3L70 E;  5AW6 B;  3CCU P;  1HWT C;  2CK3 H;  1X8Y A;  4Y99 C;  1PP9 J;  2YXQ B;  2FFD C;  1FOS E;  1VQ8 P;  1VL2 A;  2NPS B;  3K5B A;  5CHX A;  3L70 D;  4NPD A;  2IX7 C;  2OYH B;  3G9R A;  1OVU A;  1BE3 J;  3OJA B;  3A0B E;  3Q5P A;  1NHL A;  3GHG B;  2O01 H;  3TYY A;  2XDJ A;  2HG5 D;  1KIL B;  2NPS C;  1WRG A;  2QE7 H;  5M1B A;  1BDD A;  1SFC B;  5KLV G;  2KXP B;  5KLV K;  1IK7 A;  2BCC J;  2OYH C;  3V2N A;  2WPS A;  2OYO A;  4DOJ A;  2QJK B;  1FJK A;  3MD0 A;  2UWJ E;  1PPJ E;  4KJM A;  3CPW O;  2AXT E;  2M5A A;  4C7N B;  1IK9 A;  1ZR4 A;  3TGU J;  1QGK B;  3R4Y A;  1SQP J;  4Y28 J;  2KYV A;  1KIL C;  3M0D C;  3AE2 C;  2LXC B;  2WTY A;  3V6I A;  3VMA A;  1L0N D;  5KAI H;  4H44 D;  1SFC C;  1SQV G;  1SQV K;  4YTP C;  2QJK C;  1YI2 P;  1PGP A;  1NAF A;  3G71 P;  4IOI H;  3PH0 A;  3WUV A;  2KNC A;  2HFE D;  1AA0 A;  1SQQ E;  2K9J A;  2IBZ G;  1CI6 A;  2B88 A;  1NGM B;  3VTP C;  4U7J A;  1BSH A;  1T2K C;  5APW A;  3O6Q B;  1FZC B;  3I56 P;  1ZP0 C;  5APV A;  3H25 A;  5TIS H;  3M9B A;  4U3F E;  1S1C X;  3A0H E;  1FZG A;  1PP9 G;  2D2C B;  1KB9 I;  1RE3 C;  3L35 A;  2Q6Q A;  3IR9 A;  2FBW C;  1Z56 A;  1VQ5 P;  1URQ A;  1K04 A;  1YJ9 P;  3M9Q A;  3RBX A;  4YXW H;  4UB6 H;  1YTZ I;  1JTH B;  4U3F D;  1BE3 G;  1JY2 N;  1Q82 Q;  3CCJ P;  2K3R A;  1KB9 D;  3TNU B;  1GU4 A;  1FZC C;  1QEX A;  4MN4 C;  3BAS A;  3NTN A;  3MIW A;  1FDM A;  1FZA A;  2AEJ A;  4OGQ C;  1NKZ B;  3A3Y B;  3L37 A;  3L4F A;  5DJT B;  4PD4 E;  1K05 A;  1SQB E;  3P7K A;  3W68 A;  1MV8 A;  2E75 D;  4WY4 B;  5CCG C;  2BCC G;  1GL2 D;  4YPC A;  1PGO A;  2KP8 A;  3CCL P;  4YXD C;  3USS A;  1NTM J;  1SQB D;  4BRY A;  2OYI A;  3TGU G;  1VF5 D;  5K5G B;  1SQP G;  3OW2 O;  1SQP K;  1HF9 A;  1J1D B;  5CMZ A;  2QIW A;  1FAV A;  2H8P D;  2FXO A;  4WY4 C;  1ZR2 A;  1VQM P;  1EXI A;  3CX5 H;  3HTK A;  1NTK G;  4N78 E;  1KZU B;  2R32 A;  1FDO A;  2FYU J;  1IC2 A;  4XFJ A;  1Q7Y Q;  1LTJ B;  1VQN P;  1SQX E;  4WVZ A;  3KHU A;  2N9Y B;  3L73 E;  3H1H D;  1J1D C;  1LP1 A;  1USE A;  1VQK P;  4N78 D;  3VP8 A;  5APT A;  3V4Q A;  3QH9 A;  4XA4 A;  4I7Z C;  2N1T A;  2OTJ P;  3L73 D;  5AW2 B;  4EIJ A;  3SFD C;  4EYY Q;  1NWQ A;  1SVF A;  3A0B H;  2XZR A;  4ASV A;  1N2D C;  1URQ D;  4AQR D;  3RK3 E; 
#chains in the Genus database with same CATH homology
 2VRS A;  1GW3 A;  3BRT B;  1N86 A;  2FKW B;  3M0A A;  4ZKP A;  4I2L C;  1NTZ K;  1GZL A;  1JCD A;  1VDF A;  2MJZ A;  2YMY A;  1H88 A;  2KSJ A;  1FZB A;  3RL0 B;  2WSF H;  1JY2 P;  5APQ A;  2YNY A;  1T2K D;  4LLH A;  1ZN5 A;  4EOT A;  1FZF A;  2GM4 A;  4WBA A;  1RE4 A;  1S9K D;  2GUS A;  4AUW A;  5AVU B;  5AW1 B;  1L0L K;  2A45 G;  1KFM A;  2FYZ A;  1FJP A;  3HE5 A;  3HD7 C;  1ZLL A;  1LT9 A;  1RF1 A;  1GK4 A;  2C9N Y;  2L5G B;  5AVX B;  2Q5U A;  3HUS B;  2HPC A;  1YTZ T;  4LGD E;  1L0N K;  1NTM K;  1JCC A;  1GW4 A;  1L4A B;  5AW3 B;  4N6J A;  3EQ2 A;  3NMD A;  3TK1 A;  3VOP A;  1T3U A;  2WSE H;  2LKM A;  2I1J A;  1VPC A;  2WT7 A;  3RL0 C;  1T8Z A;  3VN0 A;  1IFI A;  1N7S B;  1RF0 C;  1JY3 N;  3GHG C;  4DZO A;  2P67 A;  3HE4 B;  2QM7 A;  1T3J A;  3RK2 B;  2W6A A;  1DEB A;  4GKG A;  1SQX K;  2E42 A;  2Q7C A;  1NTK K;  3B5N B;  1FU1 A;  2KOG A;  3LIE A;  1LWU C;  3HD7 A;  5BU8 B;  1JUN A;  3HUS C;  1JY3 P;  3VMY A;  3VMX A;  1JMM A;  1L4A C;  1XTG B;  2P7J A;  5APS A;  3HE5 B;  2I1K A;  3V2Q A;  3VYI A;  1HGZ A;  2FFD B;  1LT9 B;  1RF1 B;  4W7Y A;  2P2U A;  1DX7 A;  3A5T A;  1XTC C;  1OWA A;  1N7S C;  3HRN A;  1LTB C;  1EQ7 A;  3R2P A;  4JYB A;  5BVZ A;  5CCH C;  1LTA C;  3BVH A;  1RF0 A;  3GHG A;  1RY3 A;  5AVQ B;  5AVY B;  3RK2 C;  2JEE A;  2R5D A;  1CW5 A;  2H7H A;  3B5N C;  5AW6 B;  3NXS A;  5AW7 B;  1HWT C;  1AFO A;  1LTS C;  3P8M C;  4W7Z A;  3P8C E;  1LWU A;  4B86 A;  2HLO A;  3HUS A;  1X8Y A;  1NO4 A;  4Y99 C;  1L4A A;  1SP4 A;  1GL2 C;  3V2R A;  2FFD C;  1FOS E;  4GIF A;  5APX A;  1SLQ A;  2NPS B;  2WWW A;  4GT1 A;  5AW4 B;  1QL1 A;  1DH3 A;  5CHX A;  3MTU E;  2IX7 C;  1N7S A;  5CJ4 A;  2OYH B;  4W80 A;  5CCH A;  3HE4 A;  1N7L A;  3UIA A;  2Z4E A;  3OJA B;  1J1E B;  2WZ7 A;  1IO4 A;  3B5N A;  3RK3 D;  1MFZ A;  2IFM A;  1NHL A;  2E43 A;  3GHG B;  2O01 H;  2CPS A;  3TYY A;  3EFG A;  1CI6 B;  3M06 A;  3V2P A;  5KJ7 C;  1GD2 E;  2XDJ A;  1NU1 K;  3RK2 D;  2GUV A;  2HG5 D;  1KIL B;  2FFD A;  2NPS C;  1LWU B;  1WRG A;  1HH0 A;  3B5N D;  3U1A A;  4HH2 A;  2XU6 A;  3LW5 H;  1M7L A;  2A45 I;  1SFC B;  2OAR A;  4IFD K;  5AVT B;  5KLV K;  2OYH C;  2CPB A;  3V2N A;  2WPS A;  3C9I A;  4DOJ A;  1GU5 A;  2WIT A;  1ZV8 A;  1NOH A;  1FJK A;  3BRV B;  2QM8 A;  4WB4 A;  3MD0 A;  3CI9 A;  3KYQ A;  1IFN A;  1A02 F;  1J1E C;  2N9B A;  3II6 A;  1FBM A;  4C7N B;  1IK9 A;  1JY2 O;  1WT6 A;  3N7N A;  4I1L A;  3VMZ A;  3B8E B;  1ZR4 A;  1N73 B;  1HGV A;  2YO3 A;  1GDT A;  1M1J C;  5KJ7 A;  2KYV A;  1KIL C;  3M0D C;  1JO5 A;  2C0W A;  2R3C A;  1YYC A;  2WTY A;  3SWY A;  2NPS A;  3VP9 A;  4C7R A;  4XE5 B;  2O1K A;  1HBW A;  4HYT B;  5APY A;  1SFC C;  4M3L A;  3WMM 0;  4Y99 B;  1SQV K;  3SWF A;  1X9V A;  1JTH A;  2OYH A;  2YKP A;  1GL2 B;  1GK6 A;  1SQQ K;  1URQ C;  4N3Y B;  1IFJ A;  2ZXE B;  1NAF A;  5CJ0 A;  3HD7 D;  2Z5I A;  4I6M C;  2NPS D;  2HYN A;  5AVS B;  3TNU A;  3V5B A;  2WSC H;  1J2J B;  2HFE D;  1N73 C;  1LTI C;  1HUC A;  1CI6 A;  3VTP C;  1M1J A;  1CZQ A;  4IFF A;  3RL0 D;  1T2K C;  5APW A;  1KIL A;  3M0D A;  1FZC B;  3E1I A;  1HJB A;  5APV A;  3M9B A;  2OYI B;  1FOS F;  2J58 A;  1SFC A;  1LTT C;  2Z5H A;  1FZG A;  1JY3 O;  1RE3 C;  3L35 A;  3M9H A;  3IR9 A;  1Z56 A;  2P1J A;  1URQ A;  1KIL D;  3M9Q A;  2H43 A;  1HVV A;  1MZ9 A;  3P8C D;  4C7N A;  1YTZ I;  1MUU A;  1JTH B;  5AW5 B;  2Q9I A;  1L4A D;  1JOC A;  1N73 A;  1LTJ C;  2YKQ A;  4AYC A;  1JY2 N;  2YKO A;  3BAT A;  3TNU B;  1GU4 A;  1JNM A;  1FZC C;  1LTG C;  1CSB A;  3H32 A;  1N7S D;  1E5W A;  5AW9 B;  2OYI C;  5CCH D;  1S9K E;  3BAS A;  1SQB K;  1M1J B;  2POH A;  3NTN A;  3MIW A;  1X79 B;  1FDM A;  2ZFC A;  1GL2 A;  1FZA A;  1RE3 A;  4C46 A;  3KPE A;  3I5C A;  1NKZ B;  2A45 H;  3A3Y B;  2IPP A;  3L4F A;  3L37 A;  3KQG A;  2KLV A;  4JYC A;  3P7K A;  1MV8 A;  1G2C B;  4RES B;  4WY4 B;  5CCG C;  2R5B A;  1GTW A;  2J59 M;  3O8Z A;  3L36 A;  1URQ B;  4IFM A;  1NKN A;  2N1T B;  1GL2 D;  5AVR B;  1LTJ A;  2KP8 A;  2C9L Y;  1FZE A;  2HOD A;  1OXZ A;  2WPQ A;  1FZC A;  1AQ5 A;  3PP5 A;  1A02 J;  2OYI A;  5AVV B;  1H8A A;  5AVW B;  3TSI A;  1IJD B;  3V4W A;  1SQP K;  1J1D B;  4LC1 A;  3H32 B;  3RK3 B;  3OA7 A;  4OH8 B;  1H89 A;  5CMZ A;  3M91 A;  1FAV A;  2H8P D;  5AW0 B;  4WY4 C;  1ZR2 A;  5APU A;  1KQL A;  4JF7 A;  3MUD A;  5CCG A;  5KJ7 D;  2C0X A;  1IFM A;  2N1T C;  1PFI A;  2XKM A;  3HTK A;  2IFN A;  3P32 A;  5AVZ B;  3OAK A;  2O1J A;  2M8R A;  4N78 E;  1KZU B;  2R32 A;  3A2A A;  3T97 A;  1IC2 A;  5AW8 B;  2BAS A;  2FYU K;  1LTJ B;  4O9B A;  5CCG D;  5BU5 A;  2JJL A;  2FXM A;  3MGN A;  2HOD B;  1IFD A;  1J1D C;  3KDP B;  3RK3 C;  2XNX A;  2Q3I A;  2HPC B;  4N78 D;  3VP8 A;  4ZKU A;  1G1J A;  3CL3 D;  3NFQ A;  5APT A;  3V4Q A;  1QL2 A;  1G2C A;  2PAJ A;  4WY4 A;  3U59 A;  4XA4 A;  2WT7 B;  3CLQ A;  3IFM A;  2N1T A;  3H6P A;  2W27 A;  2XV5 A;  5AW2 B;  4EIJ A;  3LID A;  3U1C A;  1HTL C;  1LGH B;  1NWQ A;  1NH4 A;  1SVF A;  1KFN A;  1RE4 C;  1SFC D;  2WPR A;  3A7O A;  2YO2 A;  1W2E A;  4WY4 D;  2KB7 P;  2XZR A;  3HTK B;  2W6B A;  3N4X A;  2PP6 A;  1N2D C;  1LT9 C;  1URQ D;  4AQR D;  5KTB A;  1RF1 C;  2N1T D;  3HD7 B;  3G3Z A;  1G1I A;  2M3B A;  4KHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...