4WY4B

Crystal structure of autophagic snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
ESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4B00
3B5ND 5CCGD 3P8CE 1NHLA 2NPSC 3HD7C 3B5NA 5CCGA 2N1TD 3RK2C 3RL0B 5CCHC 1KILD 1KILB 2KOGA 1URQD 2N1TA 1GL2C 1N7SA 4W7ZA 5KJ7A 4W7YA 1URQA 4OH8B 3B5NB 4N78E 1SFCD 1L4AC 1T3JA 2NPSA 3HD7A 3TSIA 1SFCA 2N1TB 3RK3C 1N7SB 1N7SD 2PP6A 5KJ7D 3KYQA 1URQB 1GL2A 2XDJA 3PP5A 4WY4C 4LGDE 2NPSD 2NPSB 4JF7A 1XTGB 3HD7D 3HD7B 2YMYA 1JTHA 1SFCB 3RK2B 3RK2D 1L4AA 5CCHD 1HVVA 3M0DC 3VOPA 5CCHA 1GL2B 1GL2D 3RL0C 2HFED 4WY4D 1KILC 1JTHB 1URQC 4WY4A 1L4AB 1L4AD 2M8RA 3HTKB 3B5NC 2HG5D 5CCGC 1SFCC 3RK3B 3RK3D 3RL0D 2N1TC 4W80A 1N7SC 4WY4B 5KJ7C 2H8PD 2WZ7A 1KILA
chains in the Genus database with same CATH superfamily
3G3ZA 1FZBA 1NTMG 3B5ND 1JY3N 4BRYB 3A3YB 2DW3A 1NHLA 3FXDA 4EYYQ 1LWUC 4YXDC 1NKNA 3KPEA 4Y99C 3RBXA 1D7MA 2Y9YA 3P8CD 3M0DA 3V4QA 4N3YB 2N1TA 2J58A 2WWWA 1BGYD 1NAFA 2IYOA 1Z56A 5AVRB 3CXHD 3CXHI 1L4AC 3L75J 3TK1A 1LTTC 1G1IA 3AEBC 1N8RQ 5K5GB 1HBWA 3U1AA 1SQXD 2QIWA 3H1HE 1CZQA 3V4WA 1S5LH 5APYA 4D6TG 1Y8AA 2OYIC 2NPSB 2P1JA 4L75A 2KLUA 1KN7A 2OGUA 3R2PA 3RK2B 1PIXA 1JY2N 1IFJA 2ZVOB 3PRJA 1BCCG 1N73B 3C8VA 2IPPA 3IFMA 4GT1A 2FYUG 4OWFA 1KFMA 2E5YA 3AE6C 1YTZI 3M0AA 1BE3E 4C7NB 1RHZB 2K9JB 2ZT9B 2BEQD 2RKLA 4OGQB 1KILA 1USDA 3CLQA 3E1RA 3MD0A 2R5BA 1KB9H 5APXA 2W27A 1NU1K 1JOCA 1M56D 2FXOA 1OW7A 2JR8A 1K04A 2N1TD 4RKUJ 4XFJA 3WU2H 1S4XA 4UB8H 1SVFA 3I55P 1VQMP 2QEXP 1BCCJ 4H0LB 1G1JA 1PGOA 1N86A 3LIDA 5APSA 2QJPB 2QJKC 2FYUJ 3H1ID 1L0LK 3ABVC 5AW3B 1WMKA 3L72G 5TJHA 1NTZG 4Y28J 1IFIA 1SQQK 1K9MQ 1LGHB 3CCVP 2ZYAA 1VQ9P 2A45I 1LP1A 5KAFE 1VF5B 1HVVA 1NTKE 1RQUA 2HFED 3H6PA 3B8EB 4HB1A 2QJYB 1QLED 2FYNB 1JM0A 3M9HA 3BRTB 3JCUE 3P7KA 1S5LX 1W5CE 1Y9BA 3CWBG 2KS1B 1H8AA 3C1LA 1U7MA 4AYCA 4EI2A 4ZKUA 4WY4B 1BE3D 4HKZH 3TF5A 3H1JG 3H1LJ 2I1KA 1PV3A 1G2CB 2AXTE 2Q7CA 1IFDA 1XTCC 4H13D 1MZ9A 4N78D 4HH2A 1RH5B 4W7ZA 1LT9C 3Q3DA 4OGQC 5AVZB 2HPCB 1FDIA 2WVRA 2E76D 3CWBJ 3RK3C 3VTPC 2AEFA 3EFFK 2XNXA 4H0LC 2FFDB 4YXWH 1SQPK 3H1JJ 2OTLP 1M7LA 3SWYA 2UWJE 2NPSD 3I56P 1IC2A 4DCKA 2QJPC 3L70J 2QSIA 3RK2D 1QEXA 3HE5A 5BU8B 1GK6A 2WSEJ 1VQNP 1S9KE 4JBZA 1VQKP 5BVZA 1NO4A 1DD3A 5APVA 2OYHC 2KLVA 1NTKD 4ZNCA 4C46A 1X0TA 2M8RA 1AFOA 2P10A 2QM7A 3AEAC 2K9YA 1VF5C 1PFIA 3OW2O 3GHGC 4GOFA 2B89A 5KJ7C 4C7RA 4QMAA 4YPCA 1X79B 5AVQB 5H2FE 2FYNC 1QGKB 5KLVE 2Q1KA 1L0LJ 2KZIA 4ZKPA 1KYOI 2BCCG 5AW6B 5AW2B 1SQQJ 1ZMEC 4YTPC 1RF1C 3B5NB 1Q86Q 2BASA 5BU5A 3Q5RA 2KUBA 2LKMA 3AE2C 3L73G 1HUCA 3PLNA 4IFFA 3SWFA 3PH0A 2KI7B 4NPFX 3H1KG 2O01J 2IYPA 2E5TA 2FYZA 3TDKA 2K1AA 4DJGA 1BSHA 1GL2B 4R4LA 2BCCJ 3KHUA 1PPJE 2JWDA 1KFNA 2KB7P 2PAJA 4IFMA 2FFDC 3G4SP 1S9KD 3BCCJ 3L74G 1OW6A 2W90A 3GMAA 2Q3EA 2G8YA 2HR3A 4JPZB 3MHVA 1L0NK 1M1KQ 1NVOA 1NTMK 1N7SC 1HGVA 3H1HG 3CCRP 5KLIB 4WVZA 3H32A 3MTUE 1QL2A 3HD7C 1P84I 3TGUJ 1CI6B 2Q5UA 2Z5HA 1J1DC 1SS1A 1SQBE 5KLVD 2YXRB 4WWIA 4KJMA 1S2EA 4U7JA 4N6JA 1JCCA 2WSFJ 1SQPJ 1NU1E 1GMJA 1BGYE 4PV1D 2N1TB 3MGNA 4DT0A 1OZHA 5KAFH 3CXHE 3HUSA 2GUSA 1GZLA 3D70A 3W67A 3B71A 3MUDA 2IZ1A 1HWTC 2N9YB 3AEGC 4JYBA 1YYCA 3H1LD 2V4HA 2AEJA 1R5LA 1PL5A 5L8RJ 3CMAP 2Q6QA 3CI9A 4EDFA 1J2JB 1SQQE 3JCUH 3A5TA 1OVRA 2IBZG 4RO0A 1NWQA 5DJUB 1SP4A 2FYUK 1KZUB 1RE4C 1FU1A 2WPSA 3Q5SA 5AW7B 3CCSP 1SQVG 2M3EA 3AEDC 1PPJD 4BWNA 5APUA 2O3JA 2XV5A 2HG5D 5CCGC 5APWA 1S1CX 1MUUA 5AW8B 1CW5A 1NOHA 1UIIA 4XA4A 4H44B 2AXTH 2O01N 1W2BO 3GLMA 3L71E 1PP9J 2WZ7A 1GK4A 2XKMA 1HTLC 4EOTA 4M3LA 3L70D 1LJ2A 1LTBC 2KNCA 1KILB 3BCCE 5M1BA 5B66E 4I2LC 5AW9B 4W7YA 4JQ0D 1YBKA 1AA0A 1SQBD 1YIJP 5KLIC 1NTZK 1LWUA 3TSIA 1HGZA 3HTKA 1TU3F 4H13B 1NU1D 1FZEA 3H1IE 1VQLP 4RJTA 3IF4A 1VL2A 3VMXA 3Q2YA 1SLQA 2YMYA 1L4AA 1K8AQ 3EWKA 1KORA 2E76B 3M0DC 1E5WA 1L0LD 2YKPA 1YQ4C 1GL2D 3PTZA 4I6MC 2P7JA 1WT6A 2A06G 1L0NJ 3HE4A 4PD4D 1SQQD 1NTMJ 3CCEP 1EDLA 4PD4I 1LP1B 2OYIA 4O9BA 3NMDA 3JC22 5H2FH 2O1KA 3RL0D 1MFZA 2W6AA 2D2CD 1KD1Q 3OAKA 2IZ0A 1KMIZ 4LLHA 2H8PD 2B9BA 4U3FE 1KILE 4GOEA 3AEFC 3L71D 1IK9A 2WQYC 2Y0EA 2BEZF 1YI2P 1KQSO 1Q7YQ 3LW5J 1VQ8P 1VQPP 1JB0J 4D6TJ 1Q90D 3AE9C 3SFEC 1YJNP 2Y9ZA 4OH8B 4XE5B 4N78E 1OXZA 3BCCD 1FOSE 1FAVA 3KQGA 3N4XA 1MV8A 1MFTA 1VQOP 2B88A 1GTWA 1LTJC 1BDCA 3Q5PA 1Q82Q 1FZCA 3NTNA 3VP9A 3FX0A 2L91A 1FOSF 2W6BA 3M9BA 1JTHA 1OX3A 5KKZB 2KIKA 2PFXA 3L36A 1T3UA 3CCUP 1KV4A 3TGUD 2WSSH 2PRRA 3HE5B 1SQXK 2OTKE 1JY3O 1SQPD 3B4SA 2E76C 1DEEG 1EZVG 4H44D 1H0TA 1AQTA 3L75E 1PGJA 2MKVA 3IN6A 2NPSC 5AW4B 3L72J 4U3FD 3RK2C 5B5EE 1NTZJ 1J1EB 2AXCA 2KSEA 1KILD 5EFWB 2W83C 1N73C 5AVWB 3CXHH 3KDPB 4ZMDA 1KYOE 2J5UA 1T3JA 1OVVA 3II6A 4L76A 1CSBA 2GA1A 2K3RA 2YKQA 2SPZA 5AW1B 2HLOA 2R32A 1LT9A 1IFPA 2ZT9C 1PP9D 4GODA 2RH0A 1FJPA 2HODA 3FWLA 2WPRA 2C0XA 2WSCH 3M9QA 2KXPB 4PV1B 2OYOA 4NPEA 1VQ5P 5CCHA 2NZ2A 3BRVB 1M57D 1RF0C 2E75D 3N7NA 2C9LY 2IBZI 4WBAA 1JUNA 5AW0B 1IJDB 1EQ7A 2O01H 4TLFA 3RBZA 1BCCE 3P8MC 4RESB 1EDKA 1BGYG 2CPSA 2FYUE 5DJTB 2E43A 3D6ZA 4Z1MH 2OYHA 1VQ6P 4L74A 3KZIE 1R8EA 5B66H 3CX5I 5KAIE 5APQA 3L75D 1SQXG 1PGPA 3GHGA 2E74B 5KJ7A 1P84E 2QA4P 2M0BA 3H32B 2QJYC 1L0ND 1NTMD 1YJ9P 4IL6E 1BDDA 5E79E 1U7JA 3USSA 1RE3C 3S9OA 3OJAB 1AVYA 2CK3H 1KYOD 3PHLA 1FZAA 1VPCA 1RF1A 4WY4C 1IZNB 3L71G 4JF7A 2GUVA 2A45H 1FZGA 3CC4P 5CCHD 1SQXJ 2N9BA 2QVAA 1H89A 3HUSB 1AVOA 3ITKA 3H1LE 1SQVK 1NH4A 2LR2A 2WT7A 4D6TD 1T6AA 2KSJA 3BATA 3M91A 4ASWA 2L5GB 1A02J 4AQRD 3AE3C 4W80A 1BCCD 1GD2E 2Y0DA 3H1IG 2IX7C 2YNYA 3CWBE 2FYUD 1RY3A 2OARA 3RL0B 1ZRTD 3AE1C 3VMYA 3WMM0 3L73J 3S1KA 5CJ0A 2D2CB 3H1JE 3T97A 4CPGA 1OWAA 2YO2A 1N7SA 2WPVB 2LXCB 3L70E 3HRNA 1FE6A 1URQA 1VDFA 3TNUA 1RQVA 1ZN5A 3H1KJ 4K35A 2KNCB 1LT1A 1P84D 3HD7A 3WUTA 2Z4EA 3AE5C 1T8ZA 1NKZB 5CHXA 2M3BA 3AE7C 2ZAEB 1QL1A 3SFDC 4HYTB 5CBOA 4I7ZB 3L74J 1LWUB 2K37A 3I5CA 4Y99B 1X9VA 3AEEC 1KTMA 3O6QA 3TYYA 3L72D 1EXJA 3CC2P 2H88C 1NTZD 2JWAA 5APTA 1KC8Q 1OVUA 3D6YA 1BE3G 1S72P 3H1HJ 1L4AB 4B86A 1L0LE 3B5NC 3AE8C 2IFMA 3E1IA 1EDJA 4PD4E 1YHQP 3C9IA 3HE4B 5B5EH 1EZVI 2OYIB 1RE4A 2XZRA 1OFCX 2ZFCA 1M1JA 3AECC 1KB9I 5CCGA 3AE4C 2V7QJ 1KYOH 2ZXEB 3CWBD 1BE3J 5AVSB 1URQD 2E74D 2R3SA 1GL2C 3GW6A 2R44A 5TISE 3H1JD 2LXBA 2H7HA 2KK7A 2BCCE 4AUWA 1SFCA 2M5AA 3UIAA 2RN0A 2PP6A 3GF7A 5AW5B 1HJ0A 3LW5H 1NTKG 1QVFO 2WMMA 1SQVJ 1DH3A 3MZWB 5KLVK 3L75G 1FZCB 1KQLA 1QX8A 2ZJSE 1YITP 2B87A 2YIUB 2FY8A 1L2PA 3H1KE 2QJKB 1JTHB 2MJZA 4I7ZC 3TGUE 3SWKA 1OW8A 4UB6E 1ZR4A 3KZIH 1LTGC 2I8DA 5C39A 5KAIH 2N1TC 3V2PA 3L74E 2E75B 1NTKJ 2JEEA 1FJKA 4OVNF 3O8ZA 1SQPE 1Q81Q 1LTIC 1YJWP 1WRGA 3BASA 1X8YA 5CCGD 1GU4A 1P84H 1IFMA 1W2EA 3L37A 2QE7H 1H0TB 1T2KD 4IL6H 3P32A 3V2NA 4KT0J 5E79H 1BSNA 4HJGH 2VRSA 1NJIQ 2W6JH 1SFCD 1FDOA 1ZOYC 2QRXA 1K05A 4KHXA 2XNDH 4TT3H 2BCCD 4H44C 3A0BE 4PJ0E 1AV1A 1NGMB 3GG2A 2O1JA 2ITAA 2WITA 1LTJA 1PP9E 1LT9B 1SQBK 4MN4C 3L73D 2Z5IA 1UIXA 1KILC 2HODB 3K5BA 1ZW0A 1L4AD 1JCDA 1DEBA 1JMBA 1IO4A 2IBZE 3H1KD 4BRYA 1M90Q 3RK3B 1FZCC 5KLVG 1X22A 3JSVC 1SQVE 4H13C 5AVXB 1PGQA 1JEKA 2YIUC 4LC1A 3VMZA 1AQ5A 1ZP0C 3L74D 2IDBA 3M06A 2G3AA 2WSEH 2JJLA 2HYNA 2C9NY 4L73A 2KOGA 2OYHB 3CX5E 1PZQA 3BVHA 3ZDMA 1VQ4P 2E75C 1Y47A 3H1LG 3H1HD 2NPSA 3CD6P 3GHGB 5KLVJ 1Q2NA 1L0NE 4A7PA 3A0HE 3KYQA 1NTME 2FKWB 4IL6X 2ZVNB 1N73A 1PPJG 1HF9A 2GM4A 3CMEP 1DX7A 1IFNA 3F5HA 1VQ7P 2Q9IA 5GTIE 3VMAA 1USEA 3VOPA 1JY2O 3S4RA 1EC5A 5GTHE 1RF1B 4C7NA 1ZV8A 4PD4H 2K9JA 3RK3E 2C0WA 1YTZT 1FS0E 1KQGB 3CCMP 3MP7B 1AJYA 3L70G 3W68A 3V2QA 1NAYA 2A06E 2FXPA 3IR9A 2ZYDA 1RF0A 2IBZD 4D6TE 2WT7B 1QVGO 3LIEA 2FBWC 4IFDK 2RMZA 1SQBG 2JDIH 3CCJP 2WPQA 1SQVD 1FDMA 5TISH 2Q3IA 5KKZC 1NU1G 5CCHC 2R3CA 1DD4A 2PGDA 2XU6A 1JY3P 3SSUA 3H25A 1ZRTE 3WUVA 3CX5D 3A2AA 5CMZA 2IFNA 1L0LG 3T97B 1N7SB 1GU5A 1LNQA 1FC2C 1URQB 3TNUB 1SQQG 1FZFA 2QM8A 2P58A 1R5SA 1SQBJ 3PP5A 2YMKA 2YO3A 1YQ3C 3EFGA 1XTGB 3HD7B 2I1JA 1JNMA 1OIPA 2AEMA 1J1DB 5CJ4A 1NU1J 1RE3A 1S3JA 4UB6H 1S5LE 3Q1MA 1LTAC 1J1EC 2ZT9D 1BGYJ 3CPWO 2KS1A 4OGQD 5CBNA 3E7KA 2W8ZA 3L72E 4WY4A 2WSFH 5AVVB 1FBMA 2P67A 3O6QB 3CC7P 3L35A 1U57A 1NTZE 1JY2P 3RL0g 3RK3D 1HJBA 4JYCA 3RGUA 1G2CA 3V5BA 4H0LD 2P2UA 2H43A 2KZJA 5AVTB 2Y0CA 2JP3A 3EQ2A 4GDOA 2JKVA 2A06D 4DZOA 3CCLP 3BCCG 2WSCJ 1EZVE 4R4MA 2HPCA 3FXEA 3G71P 1HH0A 4PV1C 1KB9E 4GKGA 2JO1A 1M1JB 2QG4A 3L71J 1GW4A 2FFDA 2WTYA 1E79H 2POHA 3A0BH 3WU2E 4UB8E 4PJ0H 1VF5D 2ZXXA 3TGUG 3WUUA 2V7QH 2OQQA 5KJ7D 1H88A 1NYHA 1NTKK 1KQFB 2FXMA 3PJSK 4WB4A 5AVYB 2XDJA 3L4FA 2A45G 1SQPG 3F89A 1SFCB 2M5AB 3VN0A 3V2RA 4WY4D 5AVUB 3IAOA 1URQC 2E74C 4ASVA 3H1IJ 1M8OB 3HTKB 4U3FG 2B87B 4I1LA 3VYIA 1JMMA 1GW3A 2OTJP 3NXSA 3CL3D 4IOIH 1MKMA 3CX5H 3NFQA 3P8CE 2R5DA 3VP8A 4NPDA 3B5NA 3U1CA 3R4YA 2J59M 3QH9A 2H89C 3U59A 3HUSC 2E42A 1EZVD 3OA7A 1PP9G 1LTSC 3MUDC 4BXLA 3A0HH 1N2DC 1SQXE 2ZYGA 4U3FJ 1KB9D 3FGAD 1IK7A 3A7OA 1ZLLA 3FWNA 3MIWA 1DIPA 1N7SD 2YKOA 3G9RA 1GDTA 1K73Q 4EIJA 1ZXGA 3G6EP 1EXIA 5GTIH 1GL2A 2KP8A 2NRGA 4LGDE 5GTHH 3HD7D 3QWOC 1M1JC 2CPBA 3CCQP 4GIFA 2KYVA 2K88A 3V6IA 1EDIA 2YXQB 3RL0C 1T2KC 2D2CC 1OMIA 3D71A 1ZR2A 1A02F 4K3AA 3GF3A 1LTJB 1N7LA 3L73E 1SFCC 1JO5A 5KTBA 3KXDA 1CI6A 4DOJA 1L0NG
chains in the Genus database with same CATH topology
4LC1A 2OYHA 1HGVA 3G3ZA 1FZBA 3B5ND 1JY3N 3A3YB 3VMZA 1AQ5A 3H32A 1NHLA 3M06A 3MTUE 1QL2A 3HD7C 1LWUC 5APQA 1NKNA 3KPEA 2WSEH 4Y99C 2JJLA 1CI6B 2Q5UA 2Z5HA 1J1DC 3P8CD 2HYNA 3M0DA 3V4QA 2C9NY 2KOGA 3GHGA 4N3YB 2OYHB 2N1TA 2J58A 2WWWA 3BVHA 5KJ7A 4N6JA 1JCCA 1NAFA 3H32B 1Z56A 5AVRB 1L4AC 2NPSA 3TK1A 1LTTC 1G1IA 1RE3C 3GHGB 2N1TB 3OJAB 1HBWA 3MGNA 3U1AA 1FZAA 3HUSA 3KYQA 1CZQA 1VPCA 3V4WA 2GUSA 1GZLA 2FKWB 3MUDA 5APYA 1RF1A 1N73A 4WY4C 1HWTC 2OYIC 2NPSB 2GM4A 2P1JA 4JF7A 2GUVA 2A45H 4JYBA 1YYCA 1FZGA 3R2PA 3RK2B 5CCHD 1DX7A 1IFNA 1JY2N 2N9BA 3CI9A 1J2JB 2Q9IA 1IFJA 1H89A 3HUSB 3VOPA 3A5TA 1NWQA 1JY2O 1RF1B 1N73B 4C7NA 1ZV8A 1SQVK 2IPPA 1SP4A 2FYUK 1KZUB 1RE4C 3IFMA 1FU1A 1NH4A 2C0WA 2WPSA 4GT1A 1YTZT 2WT7A 5AW7B 1KFMA 2KSJA 5APUA 3BATA 3M91A 2XV5A 2L5GB 1YTZI 2HG5D 5CCGC 5APWA 3M0AA 1MUUA 3V2QA 5AW8B 1CW5A 1A02J 1NOHA 4AQRD 4C7NB 3IR9A 4XA4A 1RF0A 4W80A 2WT7B 3LIEA 2WZ7A 1KILA 4IFDK 1GD2E 3CLQA 1GK4A 2IX7C 2YNYA 2WPQA 3MD0A 2R5BA 5APXA 2XKMA 2W27A 1HTLC 1NU1K 1RY3A 1JOCA 1FDMA 4EOTA 2OARA 4M3LA 2Q3IA 1LTBC 2N1TD 3RL0B 5CCHC 3VMYA 3WMM0 1SVFA 1KILB 5CJ0A 2R3CA 3T97A 1OWAA 1G1JA 1N7SA 2YO2A 4I2LC 5AW9B 4W7YA 3HRNA 2XU6A 1N86A 3LIDA 5APSA 1JY3P 1URQA 1VDFA 3TNUA 1ZN5A 1L0LK 5AW3B 1NTZK 3A2AA 3HD7A 1LWUA 5CMZA 2IFNA 1HGZA 3TSIA 3HTKA 1IFIA 2Z4EA 1SQQK 1N7SB 1T8ZA 1NKZB 1FZEA 5CHXA 2M3BA 1GU5A 1LGHB 1QL1A 1URQB 3TNUB 4HYTB 1FZFA 2QM8A 3PP5A 2YO3A 3VMXA 3EFGA 1XTGB 3HD7B 1SLQA 1LWUB 2I1JA 2YMYA 1JNMA 3I5CA 4Y99B 1L4AA 1X9VA 2A45I 1J1DB 3TYYA 5CJ4A 1HVVA 3M0DC 1RE3A 1E5WA 2YKPA 1GL2D 1LTAC 1J1EC 4I6MC 5APTA 2HFED 2P7JA 1WT6A 3B8EB 3H6PA 3HE4A 4WY4A 1L4AB 3M9HA 2WSFH 3BRTB 5AVVB 1FBMA 2P67A 4B86A 2OYIA 3L35A 4O9BA 3P7KA 3B5NC 3NMDA 1JY2P 2IFMA 2O1KA 3RK3D 1HJBA 3E1IA 3RL0D 1MFZA 4JYCA 2W6AA 1G2CA 3V5BA 3C9IA 1H8AA 2P2UA 2H43A 3HE4B 3OAKA 5AVTB 4AYCA 4ZKUA 4LLHA 4WY4B 2H8PD 2OYIB 3EQ2A 1RE4A 2XZRA 4DZOA 2ZFCA 2I1KA 1M1JA 1IK9A 1G2CB 5CCGA 2Q7CA 1IFDA 1XTCC 2HPCA 1MZ9A 4N78D 2ZXEB 4HH2A 1HH0A 5AVSB 1URQD 1GL2C 4W7ZA 1LT9C 4GKGA 1M1JB 1GW4A 4OH8B 4XE5B 2FFDA 2WTYA 4N78E 1OXZA 2POHA 5AVZB 1FOSE 2H7HA 1FAVA 3KQGA 3N4XA 2HPCB 1MV8A 1GTWA 4AUWA 1LTJC 1SFCA 3UIAA 1FZCA 3RK3C 3VTPC 2PP6A 5KJ7D 1H88A 1NTKK 3NTNA 3VP9A 2FXMA 2XNXA 5AW5B 3LW5H 4WB4A 2FFDB 5AVYB 1SQPK 2XDJA 1M7LA 1FOSF 3L4FA 3SWYA 2W6BA 2NPSD 1DH3A 1IC2A 2A45G 3M9BA 1JTHA 1SFCB 3RK2D 3L36A 5KLVK 3HE5A 5BU8B 1FZCB 1GK6A 1KQLA 1T3UA 1S9KE 3VN0A 3V2RA 5BVZA 4WY4D 1NO4A 5AVUB 5APVA 2OYHC 1JTHB 1URQC 2MJZA 2KLVA 4C46A 3HE5B 1SQXK 2M8RA 1AFOA 1JY3O 3HTKB 1ZR4A 2QM7A 1LTGC 4I1LA 3VYIA 1PFIA 3GHGC 1JMMA 2N1TC 3V2PA 1GW3A 2JEEA 5KJ7C 1FJKA 3O8ZA 4C7RA 1LTIC 3NXSA 1X79B 3CL3D 5AVQB 1WRGA 3BASA 1X8YA 5CCGD 3NFQA 3P8CE 2R5DA 1GU4A 2NPSC 3VP8A 5AW4B 1IFMA 3B5NA 3U1CA 3RK2C 1W2EA 3L37A 1J1EB 4ZKPA 2J59M 1T2KD 3P32A 1KILD 3U59A 3V2NA 3HUSC 2E42A 5AW6B 5AW2B 3OA7A 2VRSA 1LTSC 1RF1C 5AVWB 1N73C 1N2DC 3B5NB 3KDPB 1SFCD 1T3JA 3II6A 1CSBA 2BASA 3A7OA 5BU5A 1ZLLA 4KHXA 2YKQA 3MIWA 2LKMA 1N7SD 2YKOA 1GDTA 1HUCA 4EIJA 4IFFA 3SWFA 5AW1B 1GL2A 2HLOA 2R32A 1LT9A 2KP8A 4LGDE 1FJPA 3HD7D 2HODA 1M1JC 2O1JA 2C0XA 2WPRA 2CPBA 2FYZA 2WSCH 3M9QA 4GIFA 2KYVA 2WITA 1LTJA 5CCHA 1GL2B 3BRVB 1RF0C 1LT9B 3RL0C 1SQBK 3N7NA 2C9LY 2Z5IA 1T2KC 4WBAA 1KFNA 1JUNA 2KB7P 2PAJA 5AW0B 1KILC 2HODB 1IJDB 1ZR2A 4IFMA 2FFDC 1EQ7A 1S9KD 1A02F 1L4AD 1JCDA 1DEBA 1IO4A 2O01H 1LTJB 1N7LA 1SFCC 3RK3B 1JO5A 5KTBA 1FZCC 3P8MC 1L0NK 4RESB 1CI6A 2CPSA 5AVXB 1NTMK 1N7SC 2E43A 4DOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N D;  5CCG D;  3P8C E;  1NHL A;  2NPS C;  3HD7 C;  3B5N A;  5CCG A;  2N1T D;  3RK2 C;  3RL0 B;  5CCH C;  1KIL D;  1KIL B;  2KOG A;  1URQ D;  2N1T A;  1GL2 C;  1N7S A;  4W7Z A;  5KJ7 A;  4W7Y A;  1URQ A;  4OH8 B;  3B5N B;  4N78 E;  1SFC D;  1L4A C;  1T3J A;  2NPS A;  3HD7 A;  3TSI A;  1SFC A;  2N1T B;  3RK3 C;  1N7S B;  1N7S D;  2PP6 A;  5KJ7 D;  3KYQ A;  1URQ B;  1GL2 A;  2XDJ A;  3PP5 A;  4WY4 C;  4LGD E;  2NPS D;  2NPS B;  4JF7 A;  1XTG B;  3HD7 D;  3HD7 B;  2YMY A;  1JTH A;  1SFC B;  3RK2 B;  3RK2 D;  1L4A A;  5CCH D;  1HVV A;  3M0D C;  3VOP A;  5CCH A;  1GL2 B;  1GL2 D;  3RL0 C;  2HFE D;  4WY4 D;  1KIL C;  1JTH B;  1URQ C;  4WY4 A;  1L4A B;  1L4A D;  2M8R A;  3HTK B;  3B5N C;  2HG5 D;  5CCG C;  1SFC C;  3RK3 B;  3RK3 D;  3RL0 D;  2N1T C;  4W80 A;  1N7S C;  4WY4 B;  5KJ7 C;  2H8P D;  2WZ7 A;  1KIL A; 
#chains in the Genus database with same CATH topology
 3G3Z A;  1FZB A;  1NTM G;  3B5N D;  1JY3 N;  4BRY B;  3A3Y B;  2DW3 A;  1NHL A;  3FXD A;  4EYY Q;  1LWU C;  4YXD C;  1NKN A;  3KPE A;  4Y99 C;  3RBX A;  1D7M A;  2Y9Y A;  3P8C D;  3M0D A;  3V4Q A;  4N3Y B;  2N1T A;  2J58 A;  2WWW A;  1BGY D;  1NAF A;  2IYO A;  1Z56 A;  5AVR B;  3CXH D;  3CXH I;  1L4A C;  3L75 J;  3TK1 A;  1LTT C;  1G1I A;  3AEB C;  1N8R Q;  5K5G B;  1HBW A;  3U1A A;  1SQX D;  2QIW A;  3H1H E;  1CZQ A;  3V4W A;  1S5L H;  5APY A;  4D6T G;  1Y8A A;  2OYI C;  2NPS B;  2P1J A;  4L75 A;  2KLU A;  1KN7 A;  2OGU A;  3R2P A;  3RK2 B;  1PIX A;  1JY2 N;  1IFJ A;  2ZVO B;  3PRJ A;  1BCC G;  1N73 B;  3C8V A;  2IPP A;  3IFM A;  4GT1 A;  2FYU G;  4OWF A;  1KFM A;  2E5Y A;  3AE6 C;  1YTZ I;  3M0A A;  1BE3 E;  4C7N B;  1RHZ B;  2K9J B;  2ZT9 B;  2BEQ D;  2RKL A;  4OGQ B;  1KIL A;  1USD A;  3CLQ A;  3E1R A;  3MD0 A;  2R5B A;  1KB9 H;  5APX A;  2W27 A;  1NU1 K;  1JOC A;  1M56 D;  2FXO A;  1OW7 A;  2JR8 A;  1K04 A;  2N1T D;  4RKU J;  4XFJ A;  3WU2 H;  1S4X A;  4UB8 H;  1SVF A;  3I55 P;  1VQM P;  2QEX P;  1BCC J;  4H0L B;  1G1J A;  1PGO A;  1N86 A;  3LID A;  5APS A;  2QJP B;  2QJK C;  2FYU J;  3H1I D;  1L0L K;  3ABV C;  5AW3 B;  1WMK A;  3L72 G;  5TJH A;  1NTZ G;  4Y28 J;  1IFI A;  1SQQ K;  1K9M Q;  1LGH B;  3CCV P;  2ZYA A;  1VQ9 P;  2A45 I;  1LP1 A;  5KAF E;  1VF5 B;  1HVV A;  1NTK E;  1RQU A;  2HFE D;  3H6P A;  3B8E B;  4HB1 A;  2QJY B;  1QLE D;  2FYN B;  1JM0 A;  3M9H A;  3BRT B;  3JCU E;  3P7K A;  1S5L X;  1W5C E;  1Y9B A;  3CWB G;  2KS1 B;  1H8A A;  3C1L A;  1U7M A;  4AYC A;  4EI2 A;  4ZKU A;  4WY4 B;  1BE3 D;  4HKZ H;  3TF5 A;  3H1J G;  3H1L J;  2I1K A;  1PV3 A;  1G2C B;  2AXT E;  2Q7C A;  1IFD A;  1XTC C;  4H13 D;  1MZ9 A;  4N78 D;  4HH2 A;  1RH5 B;  4W7Z A;  1LT9 C;  3Q3D A;  4OGQ C;  5AVZ B;  2HPC B;  1FDI A;  2WVR A;  2E76 D;  3CWB J;  3RK3 C;  3VTP C;  2AEF A;  3EFF K;  2XNX A;  4H0L C;  2FFD B;  4YXW H;  1SQP K;  3H1J J;  2OTL P;  1M7L A;  3SWY A;  2UWJ E;  2NPS D;  3I56 P;  1IC2 A;  4DCK A;  2QJP C;  3L70 J;  2QSI A;  3RK2 D;  1QEX A;  3HE5 A;  5BU8 B;  1GK6 A;  2WSE J;  1VQN P;  1S9K E;  4JBZ A;  1VQK P;  5BVZ A;  1NO4 A;  1DD3 A;  5APV A;  2OYH C;  2KLV A;  1NTK D;  4ZNC A;  4C46 A;  1X0T A;  2M8R A;  1AFO A;  2P10 A;  2QM7 A;  3AEA C;  2K9Y A;  1VF5 C;  1PFI A;  3OW2 O;  3GHG C;  4GOF A;  2B89 A;  5KJ7 C;  4C7R A;  4QMA A;  4YPC A;  1X79 B;  5AVQ B;  5H2F E;  2FYN C;  1QGK B;  5KLV E;  2Q1K A;  1L0L J;  2KZI A;  4ZKP A;  1KYO I;  2BCC G;  5AW6 B;  5AW2 B;  1SQQ J;  1ZME C;  4YTP C;  1RF1 C;  3B5N B;  1Q86 Q;  2BAS A;  5BU5 A;  3Q5R A;  2KUB A;  2LKM A;  3AE2 C;  3L73 G;  1HUC A;  3PLN A;  4IFF A;  3SWF A;  3PH0 A;  2KI7 B;  4NPF X;  3H1K G;  2O01 J;  2IYP A;  2E5T A;  2FYZ A;  3TDK A;  2K1A A;  4DJG A;  1BSH A;  1GL2 B;  4R4L A;  2BCC J;  3KHU A;  1PPJ E;  2JWD A;  1KFN A;  2KB7 P;  2PAJ A;  4IFM A;  2FFD C;  3G4S P;  1S9K D;  3BCC J;  3L74 G;  1OW6 A;  2W90 A;  3GMA A;  2Q3E A;  2G8Y A;  2HR3 A;  4JPZ B;  3MHV A;  1L0N K;  1M1K Q;  1NVO A;  1NTM K;  1N7S C;  1HGV A;  3H1H G;  3CCR P;  5KLI B;  4WVZ A;  3H32 A;  3MTU E;  1QL2 A;  3HD7 C;  1P84 I;  3TGU J;  1CI6 B;  2Q5U A;  2Z5H A;  1J1D C;  1SS1 A;  1SQB E;  5KLV D;  2YXR B;  4WWI A;  4KJM A;  1S2E A;  4U7J A;  4N6J A;  1JCC A;  2WSF J;  1SQP J;  1NU1 E;  1GMJ A;  1BGY E;  4PV1 D;  2N1T B;  3MGN A;  4DT0 A;  1OZH A;  5KAF H;  3CXH E;  3HUS A;  2GUS A;  1GZL A;  3D70 A;  3W67 A;  3B71 A;  3MUD A;  2IZ1 A;  1HWT C;  2N9Y B;  3AEG C;  4JYB A;  1YYC A;  3H1L D;  2V4H A;  2AEJ A;  1R5L A;  1PL5 A;  5L8R J;  3CMA P;  2Q6Q A;  3CI9 A;  4EDF A;  1J2J B;  1SQQ E;  3JCU H;  3A5T A;  1OVR A;  2IBZ G;  4RO0 A;  1NWQ A;  5DJU B;  1SP4 A;  2FYU K;  1KZU B;  1RE4 C;  1FU1 A;  2WPS A;  3Q5S A;  5AW7 B;  3CCS P;  1SQV G;  2M3E A;  3AED C;  1PPJ D;  4BWN A;  5APU A;  2O3J A;  2XV5 A;  2HG5 D;  5CCG C;  5APW A;  1S1C X;  1MUU A;  5AW8 B;  1CW5 A;  1NOH A;  1UII A;  4XA4 A;  4H44 B;  2AXT H;  2O01 N;  1W2B O;  3GLM A;  3L71 E;  1PP9 J;  2WZ7 A;  1GK4 A;  2XKM A;  1HTL C;  4EOT A;  4M3L A;  3L70 D;  1LJ2 A;  1LTB C;  2KNC A;  1KIL B;  3BCC E;  5M1B A;  5B66 E;  4I2L C;  5AW9 B;  4W7Y A;  4JQ0 D;  1YBK A;  1AA0 A;  1SQB D;  1YIJ P;  5KLI C;  1NTZ K;  1LWU A;  3TSI A;  1HGZ A;  3HTK A;  1TU3 F;  4H13 B;  1NU1 D;  1FZE A;  3H1I E;  1VQL P;  4RJT A;  3IF4 A;  1VL2 A;  3VMX A;  3Q2Y A;  1SLQ A;  2YMY A;  1L4A A;  1K8A Q;  3EWK A;  1KOR A;  2E76 B;  3M0D C;  1E5W A;  1L0L D;  2YKP A;  1YQ4 C;  1GL2 D;  3PTZ A;  4I6M C;  2P7J A;  1WT6 A;  2A06 G;  1L0N J;  3HE4 A;  4PD4 D;  1SQQ D;  1NTM J;  3CCE P;  1EDL A;  4PD4 I;  1LP1 B;  2OYI A;  4O9B A;  3NMD A;  3JC2 2;  5H2F H;  2O1K A;  3RL0 D;  1MFZ A;  2W6A A;  2D2C D;  1KD1 Q;  3OAK A;  2IZ0 A;  1KMI Z;  4LLH A;  2H8P D;  2B9B A;  4U3F E;  1KIL E;  4GOE A;  3AEF C;  3L71 D;  1IK9 A;  2WQY C;  2Y0E A;  2BEZ F;  1YI2 P;  1KQS O;  1Q7Y Q;  3LW5 J;  1VQ8 P;  1VQP P;  1JB0 J;  4D6T J;  1Q90 D;  3AE9 C;  3SFE C;  1YJN P;  2Y9Z A;  4OH8 B;  4XE5 B;  4N78 E;  1OXZ A;  3BCC D;  1FOS E;  1FAV A;  3KQG A;  3N4X A;  1MV8 A;  1MFT A;  1VQO P;  2B88 A;  1GTW A;  1LTJ C;  1BDC A;  3Q5P A;  1Q82 Q;  1FZC A;  3NTN A;  3VP9 A;  3FX0 A;  2L91 A;  1FOS F;  2W6B A;  3M9B A;  1JTH A;  1OX3 A;  5KKZ B;  2KIK A;  2PFX A;  3L36 A;  1T3U A;  3CCU P;  1KV4 A;  3TGU D;  2WSS H;  2PRR A;  3HE5 B;  1SQX K;  2OTK E;  1JY3 O;  1SQP D;  3B4S A;  2E76 C;  1DEE G;  1EZV G;  4H44 D;  1H0T A;  1AQT A;  3L75 E;  1PGJ A;  2MKV A;  3IN6 A;  2NPS C;  5AW4 B;  3L72 J;  4U3F D;  3RK2 C;  5B5E E;  1NTZ J;  1J1E B;  2AXC A;  2KSE A;  1KIL D;  5EFW B;  2W83 C;  1N73 C;  5AVW B;  3CXH H;  3KDP B;  4ZMD A;  1KYO E;  2J5U A;  1T3J A;  1OVV A;  3II6 A;  4L76 A;  1CSB A;  2GA1 A;  2K3R A;  2YKQ A;  2SPZ A;  5AW1 B;  2HLO A;  2R32 A;  1LT9 A;  1IFP A;  2ZT9 C;  1PP9 D;  4GOD A;  2RH0 A;  1FJP A;  2HOD A;  3FWL A;  2WPR A;  2C0X A;  2WSC H;  3M9Q A;  2KXP B;  4PV1 B;  2OYO A;  4NPE A;  1VQ5 P;  5CCH A;  2NZ2 A;  3BRV B;  1M57 D;  1RF0 C;  2E75 D;  3N7N A;  2C9L Y;  2IBZ I;  4WBA A;  1JUN A;  5AW0 B;  1IJD B;  1EQ7 A;  2O01 H;  4TLF A;  3RBZ A;  1BCC E;  3P8M C;  4RES B;  1EDK A;  1BGY G;  2CPS A;  2FYU E;  5DJT B;  2E43 A;  3D6Z A;  4Z1M H;  2OYH A;  1VQ6 P;  4L74 A;  3KZI E;  1R8E A;  5B66 H;  3CX5 I;  5KAI E;  5APQ A;  3L75 D;  1SQX G;  1PGP A;  3GHG A;  2E74 B;  5KJ7 A;  1P84 E;  2QA4 P;  2M0B A;  3H32 B;  2QJY C;  1L0N D;  1NTM D;  1YJ9 P;  4IL6 E;  1BDD A;  5E79 E;  1U7J A;  3USS A;  1RE3 C;  3S9O A;  3OJA B;  1AVY A;  2CK3 H;  1KYO D;  3PHL A;  1FZA A;  1VPC A;  1RF1 A;  4WY4 C;  1IZN B;  3L71 G;  4JF7 A;  2GUV A;  2A45 H;  1FZG A;  3CC4 P;  5CCH D;  1SQX J;  2N9B A;  2QVA A;  1H89 A;  3HUS B;  1AVO A;  3ITK A;  3H1L E;  1SQV K;  1NH4 A;  2LR2 A;  2WT7 A;  4D6T D;  1T6A A;  2KSJ A;  3BAT A;  3M91 A;  4ASW A;  2L5G B;  1A02 J;  4AQR D;  3AE3 C;  4W80 A;  1BCC D;  1GD2 E;  2Y0D A;  3H1I G;  2IX7 C;  2YNY A;  3CWB E;  2FYU D;  1RY3 A;  2OAR A;  3RL0 B;  1ZRT D;  3AE1 C;  3VMY A;  3WMM 0;  3L73 J;  3S1K A;  5CJ0 A;  2D2C B;  3H1J E;  3T97 A;  4CPG A;  1OWA A;  2YO2 A;  1N7S A;  2WPV B;  2LXC B;  3L70 E;  3HRN A;  1FE6 A;  1URQ A;  1VDF A;  3TNU A;  1RQV A;  1ZN5 A;  3H1K J;  4K35 A;  2KNC B;  1LT1 A;  1P84 D;  3HD7 A;  3WUT A;  2Z4E A;  3AE5 C;  1T8Z A;  1NKZ B;  5CHX A;  2M3B A;  3AE7 C;  2ZAE B;  1QL1 A;  3SFD C;  4HYT B;  5CBO A;  4I7Z B;  3L74 J;  1LWU B;  2K37 A;  3I5C A;  4Y99 B;  1X9V A;  3AEE C;  1KTM A;  3O6Q A;  3TYY A;  3L72 D;  1EXJ A;  3CC2 P;  2H88 C;  1NTZ D;  2JWA A;  5APT A;  1KC8 Q;  1OVU A;  3D6Y A;  1BE3 G;  1S72 P;  3H1H J;  1L4A B;  4B86 A;  1L0L E;  3B5N C;  3AE8 C;  2IFM A;  3E1I A;  1EDJ A;  4PD4 E;  1YHQ P;  3C9I A;  3HE4 B;  5B5E H;  1EZV I;  2OYI B;  1RE4 A;  2XZR A;  1OFC X;  2ZFC A;  1M1J A;  3AEC C;  1KB9 I;  5CCG A;  3AE4 C;  2V7Q J;  1KYO H;  2ZXE B;  3CWB D;  1BE3 J;  5AVS B;  1URQ D;  2E74 D;  2R3S A;  1GL2 C;  3GW6 A;  2R44 A;  5TIS E;  3H1J D;  2LXB A;  2H7H A;  2KK7 A;  2BCC E;  4AUW A;  1SFC A;  2M5A A;  3UIA A;  2RN0 A;  2PP6 A;  3GF7 A;  5AW5 B;  1HJ0 A;  3LW5 H;  1NTK G;  1QVF O;  2WMM A;  1SQV J;  1DH3 A;  3MZW B;  5KLV K;  3L75 G;  1FZC B;  1KQL A;  1QX8 A;  2ZJS E;  1YIT P;  2B87 A;  2YIU B;  2FY8 A;  1L2P A;  3H1K E;  2QJK B;  1JTH B;  2MJZ A;  4I7Z C;  3TGU E;  3SWK A;  1OW8 A;  4UB6 E;  1ZR4 A;  3KZI H;  1LTG C;  2I8D A;  5C39 A;  5KAI H;  2N1T C;  3V2P A;  3L74 E;  2E75 B;  1NTK J;  2JEE A;  1FJK A;  4OVN F;  3O8Z A;  1SQP E;  1Q81 Q;  1LTI C;  1YJW P;  1WRG A;  3BAS A;  1X8Y A;  5CCG D;  1GU4 A;  1P84 H;  1IFM A;  1W2E A;  3L37 A;  2QE7 H;  1H0T B;  1T2K D;  4IL6 H;  3P32 A;  3V2N A;  4KT0 J;  5E79 H;  1BSN A;  4HJG H;  2VRS A;  1NJI Q;  2W6J H;  1SFC D;  1FDO A;  1ZOY C;  2QRX A;  1K05 A;  4KHX A;  2XND H;  4TT3 H;  2BCC D;  4H44 C;  3A0B E;  4PJ0 E;  1AV1 A;  1NGM B;  3GG2 A;  2O1J A;  2ITA A;  2WIT A;  1LTJ A;  1PP9 E;  1LT9 B;  1SQB K;  4MN4 C;  3L73 D;  2Z5I A;  1UIX A;  1KIL C;  2HOD B;  3K5B A;  1ZW0 A;  1L4A D;  1JCD A;  1DEB A;  1JMB A;  1IO4 A;  2IBZ E;  3H1K D;  4BRY A;  1M90 Q;  3RK3 B;  1FZC C;  5KLV G;  1X22 A;  3JSV C;  1SQV E;  4H13 C;  5AVX B;  1PGQ A;  1JEK A;  2YIU C;  4LC1 A;  3VMZ A;  1AQ5 A;  1ZP0 C;  3L74 D;  2IDB A;  3M06 A;  2G3A A;  2WSE H;  2JJL A;  2HYN A;  2C9N Y;  4L73 A;  2KOG A;  2OYH B;  3CX5 E;  1PZQ A;  3BVH A;  3ZDM A;  1VQ4 P;  2E75 C;  1Y47 A;  3H1L G;  3H1H D;  2NPS A;  3CD6 P;  3GHG B;  5KLV J;  1Q2N A;  1L0N E;  4A7P A;  3A0H E;  3KYQ A;  1NTM E;  2FKW B;  4IL6 X;  2ZVN B;  1N73 A;  1PPJ G;  1HF9 A;  2GM4 A;  3CME P;  1DX7 A;  1IFN A;  3F5H A;  1VQ7 P;  2Q9I A;  5GTI E;  3VMA A;  1USE A;  3VOP A;  1JY2 O;  3S4R A;  1EC5 A;  5GTH E;  1RF1 B;  4C7N A;  1ZV8 A;  4PD4 H;  2K9J A;  3RK3 E;  2C0W A;  1YTZ T;  1FS0 E;  1KQG B;  3CCM P;  3MP7 B;  1AJY A;  3L70 G;  3W68 A;  3V2Q A;  1NAY A;  2A06 E;  2FXP A;  3IR9 A;  2ZYD A;  1RF0 A;  2IBZ D;  4D6T E;  2WT7 B;  1QVG O;  3LIE A;  2FBW C;  4IFD K;  2RMZ A;  1SQB G;  2JDI H;  3CCJ P;  2WPQ A;  1SQV D;  1FDM A;  5TIS H;  2Q3I A;  5KKZ C;  1NU1 G;  5CCH C;  2R3C A;  1DD4 A;  2PGD A;  2XU6 A;  1JY3 P;  3SSU A;  3H25 A;  1ZRT E;  3WUV A;  3CX5 D;  3A2A A;  5CMZ A;  2IFN A;  1L0L G;  3T97 B;  1N7S B;  1GU5 A;  1LNQ A;  1FC2 C;  1URQ B;  3TNU B;  1SQQ G;  1FZF A;  2QM8 A;  2P58 A;  1R5S A;  1SQB J;  3PP5 A;  2YMK A;  2YO3 A;  1YQ3 C;  3EFG A;  1XTG B;  3HD7 B;  2I1J A;  1JNM A;  1OIP A;  2AEM A;  1J1D B;  5CJ4 A;  1NU1 J;  1RE3 A;  1S3J A;  4UB6 H;  1S5L E;  3Q1M A;  1LTA C;  1J1E C;  2ZT9 D;  1BGY J;  3CPW O;  2KS1 A;  4OGQ D;  5CBN A;  3E7K A;  2W8Z A;  3L72 E;  4WY4 A;  2WSF H;  5AVV B;  1FBM A;  2P67 A;  3O6Q B;  3CC7 P;  3L35 A;  1U57 A;  1NTZ E;  1JY2 P;  3RL0 g;  3RK3 D;  1HJB A;  4JYC A;  3RGU A;  1G2C A;  3V5B A;  4H0L D;  2P2U A;  2H43 A;  2KZJ A;  5AVT B;  2Y0C A;  2JP3 A;  3EQ2 A;  4GDO A;  2JKV A;  2A06 D;  4DZO A;  3CCL P;  3BCC G;  2WSC J;  1EZV E;  4R4M A;  2HPC A;  3FXE A;  3G71 P;  1HH0 A;  4PV1 C;  1KB9 E;  4GKG A;  2JO1 A;  1M1J B;  2QG4 A;  3L71 J;  1GW4 A;  2FFD A;  2WTY A;  1E79 H;  2POH A;  3A0B H;  3WU2 E;  4UB8 E;  4PJ0 H;  1VF5 D;  2ZXX A;  3TGU G;  3WUU A;  2V7Q H;  2OQQ A;  5KJ7 D;  1H88 A;  1NYH A;  1NTK K;  1KQF B;  2FXM A;  3PJS K;  4WB4 A;  5AVY B;  2XDJ A;  3L4F A;  2A45 G;  1SQP G;  3F89 A;  1SFC B;  2M5A B;  3VN0 A;  3V2R A;  4WY4 D;  5AVU B;  3IAO A;  1URQ C;  2E74 C;  4ASV A;  3H1I J;  1M8O B;  3HTK B;  4U3F G;  2B87 B;  4I1L A;  3VYI A;  1JMM A;  1GW3 A;  2OTJ P;  3NXS A;  3CL3 D;  4IOI H;  1MKM A;  3CX5 H;  3NFQ A;  3P8C E;  2R5D A;  3VP8 A;  4NPD A;  3B5N A;  3U1C A;  3R4Y A;  2J59 M;  3QH9 A;  2H89 C;  3U59 A;  3HUS C;  2E42 A;  1EZV D;  3OA7 A;  1PP9 G;  1LTS C;  3MUD C;  4BXL A;  3A0H H;  1N2D C;  1SQX E;  2ZYG A;  4U3F J;  1KB9 D;  3FGA D;  1IK7 A;  3A7O A;  1ZLL A;  3FWN A;  3MIW A;  1DIP A;  1N7S D;  2YKO A;  3G9R A;  1GDT A;  1K73 Q;  4EIJ A;  1ZXG A;  3G6E P;  1EXI A;  5GTI H;  1GL2 A;  2KP8 A;  2NRG A;  4LGD E;  5GTH H;  3HD7 D;  3QWO C;  1M1J C;  2CPB A;  3CCQ P;  4GIF A;  2KYV A;  2K88 A;  3V6I A;  1EDI A;  2YXQ B;  3RL0 C;  1T2K C;  2D2C C;  1OMI A;  3D71 A;  1ZR2 A;  1A02 F;  4K3A A;  3GF3 A;  1LTJ B;  1N7L A;  3L73 E;  1SFC C;  1JO5 A;  5KTB A;  3KXD A;  1CI6 A;  4DOJ A;  1L0N G; 
#chains in the Genus database with same CATH homology
 4LC1 A;  2OYH A;  1HGV A;  3G3Z A;  1FZB A;  3B5N D;  1JY3 N;  3A3Y B;  3VMZ A;  1AQ5 A;  3H32 A;  1NHL A;  3M06 A;  3MTU E;  1QL2 A;  3HD7 C;  1LWU C;  5APQ A;  1NKN A;  3KPE A;  2WSE H;  4Y99 C;  2JJL A;  1CI6 B;  2Q5U A;  2Z5H A;  1J1D C;  3P8C D;  2HYN A;  3M0D A;  3V4Q A;  2C9N Y;  2KOG A;  3GHG A;  4N3Y B;  2OYH B;  2N1T A;  2J58 A;  2WWW A;  3BVH A;  5KJ7 A;  4N6J A;  1JCC A;  1NAF A;  3H32 B;  1Z56 A;  5AVR B;  1L4A C;  2NPS A;  3TK1 A;  1LTT C;  1G1I A;  1RE3 C;  3GHG B;  2N1T B;  3OJA B;  1HBW A;  3MGN A;  3U1A A;  1FZA A;  3HUS A;  3KYQ A;  1CZQ A;  1VPC A;  3V4W A;  2GUS A;  1GZL A;  2FKW B;  3MUD A;  5APY A;  1RF1 A;  1N73 A;  4WY4 C;  1HWT C;  2OYI C;  2NPS B;  2GM4 A;  2P1J A;  4JF7 A;  2GUV A;  2A45 H;  4JYB A;  1YYC A;  1FZG A;  3R2P A;  3RK2 B;  5CCH D;  1DX7 A;  1IFN A;  1JY2 N;  2N9B A;  3CI9 A;  1J2J B;  2Q9I A;  1IFJ A;  1H89 A;  3HUS B;  3VOP A;  3A5T A;  1NWQ A;  1JY2 O;  1RF1 B;  1N73 B;  4C7N A;  1ZV8 A;  1SQV K;  2IPP A;  1SP4 A;  2FYU K;  1KZU B;  1RE4 C;  3IFM A;  1FU1 A;  1NH4 A;  2C0W A;  2WPS A;  4GT1 A;  1YTZ T;  2WT7 A;  5AW7 B;  1KFM A;  2KSJ A;  5APU A;  3BAT A;  3M91 A;  2XV5 A;  2L5G B;  1YTZ I;  2HG5 D;  5CCG C;  5APW A;  3M0A A;  1MUU A;  3V2Q A;  5AW8 B;  1CW5 A;  1A02 J;  1NOH A;  4AQR D;  4C7N B;  3IR9 A;  4XA4 A;  1RF0 A;  4W80 A;  2WT7 B;  3LIE A;  2WZ7 A;  1KIL A;  4IFD K;  1GD2 E;  3CLQ A;  1GK4 A;  2IX7 C;  2YNY A;  2WPQ A;  3MD0 A;  2R5B A;  5APX A;  2XKM A;  2W27 A;  1HTL C;  1NU1 K;  1RY3 A;  1JOC A;  1FDM A;  4EOT A;  2OAR A;  4M3L A;  2Q3I A;  1LTB C;  2N1T D;  3RL0 B;  5CCH C;  3VMY A;  3WMM 0;  1SVF A;  1KIL B;  5CJ0 A;  2R3C A;  3T97 A;  1OWA A;  1G1J A;  1N7S A;  2YO2 A;  4I2L C;  5AW9 B;  4W7Y A;  3HRN A;  2XU6 A;  1N86 A;  3LID A;  5APS A;  1JY3 P;  1URQ A;  1VDF A;  3TNU A;  1ZN5 A;  1L0L K;  5AW3 B;  1NTZ K;  3A2A A;  3HD7 A;  1LWU A;  5CMZ A;  2IFN A;  1HGZ A;  3TSI A;  3HTK A;  1IFI A;  2Z4E A;  1SQQ K;  1N7S B;  1T8Z A;  1NKZ B;  1FZE A;  5CHX A;  2M3B A;  1GU5 A;  1LGH B;  1QL1 A;  1URQ B;  3TNU B;  4HYT B;  1FZF A;  2QM8 A;  3PP5 A;  2YO3 A;  3VMX A;  3EFG A;  1XTG B;  3HD7 B;  1SLQ A;  1LWU B;  2I1J A;  2YMY A;  1JNM A;  3I5C A;  4Y99 B;  1L4A A;  1X9V A;  2A45 I;  1J1D B;  3TYY A;  5CJ4 A;  1HVV A;  3M0D C;  1RE3 A;  1E5W A;  2YKP A;  1GL2 D;  1LTA C;  1J1E C;  4I6M C;  5APT A;  2HFE D;  2P7J A;  1WT6 A;  3B8E B;  3H6P A;  3HE4 A;  4WY4 A;  1L4A B;  3M9H A;  2WSF H;  3BRT B;  5AVV B;  1FBM A;  2P67 A;  4B86 A;  2OYI A;  3L35 A;  4O9B A;  3P7K A;  3B5N C;  3NMD A;  1JY2 P;  2IFM A;  2O1K A;  3RK3 D;  1HJB A;  3E1I A;  3RL0 D;  1MFZ A;  4JYC A;  2W6A A;  1G2C A;  3V5B A;  3C9I A;  1H8A A;  2P2U A;  2H43 A;  3HE4 B;  3OAK A;  5AVT B;  4AYC A;  4ZKU A;  4LLH A;  4WY4 B;  2H8P D;  2OYI B;  3EQ2 A;  1RE4 A;  2XZR A;  4DZO A;  2ZFC A;  2I1K A;  1M1J A;  1IK9 A;  1G2C B;  5CCG A;  2Q7C A;  1IFD A;  1XTC C;  2HPC A;  1MZ9 A;  4N78 D;  2ZXE B;  4HH2 A;  1HH0 A;  5AVS B;  1URQ D;  1GL2 C;  4W7Z A;  1LT9 C;  4GKG A;  1M1J B;  1GW4 A;  4OH8 B;  4XE5 B;  2FFD A;  2WTY A;  4N78 E;  1OXZ A;  2POH A;  5AVZ B;  1FOS E;  2H7H A;  1FAV A;  3KQG A;  3N4X A;  2HPC B;  1MV8 A;  1GTW A;  4AUW A;  1LTJ C;  1SFC A;  3UIA A;  1FZC A;  3RK3 C;  3VTP C;  2PP6 A;  5KJ7 D;  1H88 A;  1NTK K;  3NTN A;  3VP9 A;  2FXM A;  2XNX A;  5AW5 B;  3LW5 H;  4WB4 A;  2FFD B;  5AVY B;  1SQP K;  2XDJ A;  1M7L A;  1FOS F;  3L4F A;  3SWY A;  2W6B A;  2NPS D;  1DH3 A;  1IC2 A;  2A45 G;  3M9B A;  1JTH A;  1SFC B;  3RK2 D;  3L36 A;  5KLV K;  3HE5 A;  5BU8 B;  1FZC B;  1GK6 A;  1KQL A;  1T3U A;  1S9K E;  3VN0 A;  3V2R A;  5BVZ A;  4WY4 D;  1NO4 A;  5AVU B;  5APV A;  2OYH C;  1JTH B;  1URQ C;  2MJZ A;  2KLV A;  4C46 A;  3HE5 B;  1SQX K;  2M8R A;  1AFO A;  1JY3 O;  3HTK B;  1ZR4 A;  2QM7 A;  1LTG C;  4I1L A;  3VYI A;  1PFI A;  3GHG C;  1JMM A;  2N1T C;  3V2P A;  1GW3 A;  2JEE A;  5KJ7 C;  1FJK A;  3O8Z A;  4C7R A;  1LTI C;  3NXS A;  1X79 B;  3CL3 D;  5AVQ B;  1WRG A;  3BAS A;  1X8Y A;  5CCG D;  3NFQ A;  3P8C E;  2R5D A;  1GU4 A;  2NPS C;  3VP8 A;  5AW4 B;  1IFM A;  3B5N A;  3U1C A;  3RK2 C;  1W2E A;  3L37 A;  1J1E B;  4ZKP A;  2J59 M;  1T2K D;  3P32 A;  1KIL D;  3U59 A;  3V2N A;  3HUS C;  2E42 A;  5AW6 B;  5AW2 B;  3OA7 A;  2VRS A;  1LTS C;  1RF1 C;  5AVW B;  1N73 C;  1N2D C;  3B5N B;  3KDP B;  1SFC D;  1T3J A;  3II6 A;  1CSB A;  2BAS A;  3A7O A;  5BU5 A;  1ZLL A;  4KHX A;  2YKQ A;  3MIW A;  2LKM A;  1N7S D;  2YKO A;  1GDT A;  1HUC A;  4EIJ A;  4IFF A;  3SWF A;  5AW1 B;  1GL2 A;  2HLO A;  2R32 A;  1LT9 A;  2KP8 A;  4LGD E;  1FJP A;  3HD7 D;  2HOD A;  1M1J C;  2O1J A;  2C0X A;  2WPR A;  2CPB A;  2FYZ A;  2WSC H;  3M9Q A;  4GIF A;  2KYV A;  2WIT A;  1LTJ A;  5CCH A;  1GL2 B;  3BRV B;  1RF0 C;  1LT9 B;  3RL0 C;  1SQB K;  3N7N A;  2C9L Y;  2Z5I A;  1T2K C;  4WBA A;  1KFN A;  1JUN A;  2KB7 P;  2PAJ A;  5AW0 B;  1KIL C;  2HOD B;  1IJD B;  1ZR2 A;  4IFM A;  2FFD C;  1EQ7 A;  1S9K D;  1A02 F;  1L4A D;  1JCD A;  1DEB A;  1IO4 A;  2O01 H;  1LTJ B;  1N7L A;  1SFC C;  3RK3 B;  1JO5 A;  5KTB A;  1FZC C;  3P8M C;  1L0N K;  4RES B;  1CI6 A;  2CPS A;  5AVX B;  1NTM K;  1N7S C;  2E43 A;  4DOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...