4WY4B

Crystal structure of autophagic snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
ESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 8
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4B00
2HG5D 2XDJA 3HD7C 5CCGD 4W7YA 1JTHB 5KJ7A 3HD7B 3HTKB 2NPSA 3RL0B 1GL2B 2H8PD 2N1TD 1URQD 3HD7D 3RK2C 3TSIA 1JTHA 4W7ZA 1SFCB 3B5NA 1T3JA 1L4AC 4WY4B 2PP6A 2WZ7A 3RK3C 3HD7A 2N1TC 1SFCC 1GL2D 3RL0D 3RK2B 4N78E 3RK3B 4JF7A 3B5ND 2NPSC 1N7SA 1L4AD 1L4AB 1URQA 3RK3D 2N1TA 2NPSB 1GL2C 1KILC 5CCGC 3P8CE 3KYQA 2NPSD 3VOPA 1SFCD 2YMYA 5CCHC 4WY4C 3PP5A 3B5NC 1XTGB 2N1TB 1L4AA 1N7SC 1URQC 1SFCA 1GL2A 4WY4D 5CCGA 4LGDE 5KJ7D 2KOGA 2M8RA 1HVVA 2HFED 1URQB 4W80A 1KILA 3RL0C 1KILD 1N7SD 5KJ7C 3M0DC 4OH8B 3B5NB 5CCHA 1N7SB 1KILB 4WY4A 1NHLA 5CCHD 3RK2D
chains in the Genus database with same CATH superfamily
1NH4A 2KI7B 1LTJB 4H44D 4JPZB 1S5LX 1EZVI 4U3FG 3VP8A 1EDIA 3HD7C 1Q7YQ 1NTMG 3CWBJ 1SQBJ 1JY2O 1NU1K 1NTKD 5APYA 3B71A 4U3FJ 1K05A 2R5BA 4R4MA 2E5YA 3AECC 5CCGD 1A02J 3E1RA 3CC7P 1IJDB 1LTAC 1R5LA 2RKLA 1KZUB 1QLED 1MV8A 3NFQA 2HYNA 1IC2A 4PV1D 4W7YA 2A45I 3S4RA 5KJ7A 1ZP0C 5APQA 1EZVE 2K1AA 3G71P 3BCCJ 3CX5H 1L2PA 1SQQK 3TF5A 1GL2B 1SQPG 2H8PD 1XTCC 3CCJP 1K8AQ 3H32A 1KYOD 4DCKA 4EDFA 3HD7D 1AFOA 1YJWP 1VQ6P 1LTIC 2FBWC 2WMMA 3MGNA 1X8YA 2IX7C 3PJSK 1X9VA 2WSSH 2AEJA 2KLVA 1J2JB 4W7ZA 2WWWA 3GHGA 3H1KD 4HKZH 1SQQG 4IFFA 5TISE 2BEQD 3CX5I 2NRGA 1KQGB 3BCCD 1SVFA 1KB9D 2K9JA 1L4AC 1CSBA 1OZHA 3L70D 4WB4A 2IFNA 2V7QH 4WY4B 3TGUG 3FXDA 1ZOYC 2FY8A 3GHGB 2FYUE 2VRSA 3RBXA 1PGQA 2SPZA 2C9LY 1JY2N 4BRYA 2N9YB 1S72P 1S5LE 2N1TC 1K04A 2Q7CA 1LTJA 1GL2D 2P58A 1OVVA 3FWNA 2QVAA 3L71J 3RK2B 5CJ4A 3AEFC 4PV1B 2W27A 1DX7A 2W6BA 3GLMA 2IYOA 1N7SA 2NZ2A 1RE4A 3CCQP 1JB0J 1NTMJ 3CWBG 1KMIZ 3U1AA 1PL5A 1GMJA 3L73G 3LIDA 4C7NA 2WVRA 1NU1D 1EXJA 1IK9A 2KB7P 3Q5RA 3EWKA 3BATA 1JCDA 2Y9YA 1DH3A 2KNCA 1RQUA 3NMDA 1USDA 2O1JA 2QM8A 1OW7A 2FKWB 5APXA 5CCGC 4GDOA 2QIWA 3P8CE 1NTZE 2OYOA 5L8RJ 3K5BA 2JO1A 3QWOC 4IL6E 1BE3G 5C39A 3H1IG 4OVNF 2R3SA 1PZQA 1OX3A 2KLUA 1BCCD 3CXHD 2DW3A 1NU1J 2YMYA 5AVXB 1FDMA 1DEEG 3VMXA 1EDKA 1OFCX 3AE9C 3H1LG 3L72D 4UB8H 1L4AA 4BRYB 5BU8B 3AE2C 1LTBC 1YYCA 1JY3N 2R44A 4MN4C 1BCCJ 2IBZG 3F89A 1FZFA 4EYYQ 3CCVP 1H8AA 2FYUJ 3A0BE 2KS1A 1NTMD 2H7HA 2QJYB 2V4HA 3BCCG 1AJYA 1SQPK 1KYOE 4NPEA 4OGQD 3L70G 2XKMA 4EOTA 1YIJP 1JOCA 2KXPB 3E7KA 1VQ5P 5CCGA 1J1DC 4N6JA 5AW3B 5KJ7D 1OIPA 1YTZI 1NGMB 3KXDA 1LJ2A 1RY3A 1QL1A 5KLVD 2Q3IA 1KTMA 1IK7A 2KOGA 2FYNC 4AUWA 1KB9E 2R3CA 1PIXA 1S5LH 1EDJA 1H0TB 5H2FE 1N73B 1SQVD 3CLQA 2G8YA 1YJNP 1J1DB 1QGKB 1QX8A 1URQB 2Y0DA 3L75E 4IL6X 2OTKE 4KJMA 3CC2P 1H0TA 4W80A 3L75D 2E75B 4GIFA 3D6ZA 1FZCC 1DEBA 3D71A 1N7LA 1WRGA 5B66E 1JY2P 3T97B 5AW1B 3M0DC 5KJ7C 1KILE 2BASA 3P32A 4K35A 1LTGC 3VP9A 1N73A 1SQXG 4N3YB 1E79H 2C9NY 4U3FD 2K9YA 1BE3E 3B5NB 5AW8B 2IBZI 2JWDA 5M1BA 1HJBA 4OGQC 5CCHA 1JM0A 1K9MQ 1Q90D 3IFMA 1NHLA 3N7NA 1Z56A 3WUTA 2ITAA 3MUDC 4D6TJ 3P8CD 3GHGC 2ZXXA 5AVZB 1VQLP 4ZMDA 1S9KD 3M9BA 2OYHB 3RL0g 1VQ4P 5CBNA 2FYZA 2QRXA 4JQ0D 1ZLLA 2BEZF 2XDJA 4PD4I 1L0ND 2KZIA 2FXMA 5CJ0A 3WUVA 2OYHA 5AW9B 2HODA 2Z4EA 2ZXEB 3H1KJ 4UB8E 1NVOA 3CXHE 2FXPA 3HUSB 1Q82Q 3TGUE 1PP9D 4B86A 1FZCA 1GTWA 1M90Q 2WPRA 3A5TA 1SP4A 1HBWA 5KLVK 5GTHE 3A0BH 3H1LJ 1IFDA 2O01J 2WSCH 3O6QB 4H44C 1NTME 5APUA 4TLFA 5AW7B 4KT0J 3MHVA 1NTKG 3T97A 3G4SP 1P84I 3CCLP 2CK3H 3KDPB 2YMKA 3KQGA 3VMZA 3AEBC 3RK2C 2W8ZA 3HE5B 1PP9J 4GOEA 5APVA 3VTPC 2KYVA 2E42A 1YQ4C 3SFEC 3AEAC 4I7ZC 5AW6B 3R2PA 2B88A 1SFCB 3B5NA 3L72G 4I1LA 1T3JA 4D6TD 4HB1A 4ZNCA 1L0NJ 1FJPA 4WBAA 1LT9B 2PP6A 2WZ7A 1T2KC 3RK3C 1N8RQ 3Q2YA 1NKNA 1SQPE 3AE5C 3H1IJ 3O8ZA 1SQVJ 4PD4E 1YQ3C 3VMYA 3CCMP 1JMBA 4TT3H 1YI2P 1EXIA 1AV1A 1NTZG 3M9HA 1KFNA 3MD0A 2ZFCA 3CL3D 2WPQA 1AQ5A 4CPGA 2OYIB 2QJYC 3B5ND 1P84E 4U7JA 1L0NK 1L4AD 1IZNB 1URQA 2J58A 2KNCB 2MJZA 3L36A 4Y28J 1SQVG 2AXCA 1PGPA 2CPBA 2K9JB 3RK3D 1RF1B 3CCEP 2IPPA 3C9IA 1MFTA 2HR3A 1HGZA 1Y8AA 2E75D 1GL2C 2N9BA 3HE4A 1SQBK 3PHLA 1LWUC 1NTZD 3BVHA 3CCRP 3L72J 3R4YA 1RQVA 1HGVA 1L0NE 1SQQJ 3L73E 1EDLA 1RF1A 1GD2E 4YPCA 3CC4P 1FU1A 1PPJE 5GTIH 3CCUP 3A7OA 5TJHA 3PH0A 2H88C 3Q1MA 1GK4A 2C0XA 2QG4A 1BGYG 1PP9E 3AE7C 4WY4C 1FC2C 2IFMA 2KP8A 3MIWA 4D6TG 3OW2O 2OYIA 1SQQD 3I56P 1NOHA 5KAFE 3B5NC 4HJGH 3H1HG 2N1TB 1GDTA 2E76D 4H13D 2Y0CA 5KKZB 1N73C 1AVYA 1URQC 1S3JA 2BCCD 3H1HJ 1L0LG 1HF9A 1Y47A 4IOIH 5APSA 3RBZA 3H1KE 4ASVA 1GL2A 3GG2A 2FFDB 3KPEA 1KQFB 3TGUJ 4IFMA 2P1JA 1YJ9P 5B5EH 4LC1A 1G1IA 2PGDA 3BCCE 5KLVE 1ZMEC 1M1JA 4IFDK 1S4XA 4LLHA 3FXEA 4BWNA 2IBZE 3M91A 3VN0A 1SQBE 2WTYA 1NYHA 1X22A 4Y99C 2Y9ZA 3WU2E 2E74C 4KHXA 1SQBD 3AE1C 4C7RA 3KZIE 1FZBA 1LWUA 2B87B 3G6EP 3OA7A 1ZN5A 1NTZK 3IN6A 5H2FH 1KQSO 3CD6P 1X0TA 4JYCA 4BXLA 1OMIA 2GUVA 1S2EA 1PPJG 3WMM0 4ZKPA 1RF0C 2FYNB 2Q1KA 1ZRTE 1N7SB 1KILB 1NU1E 2OARA 5B66H 1YBKA 3V2NA 4XE5B 3CI9A 3RK2D 2E75C 2MKVA 3V2RA 1RE3A 3SSUA 3KZIH 4L76A 3IAOA 1LT1A 3MP7B 3V4WA 4XFJA 1FJKA 2E76C 2ZT9D 1KYOI 1NAYA 1U7JA 1G2CB 2KIKA 4I2LC 4OWFA 2QSIA 3L70J 2QJKB 3OJAB 3PTZA 2Z5HA 1T2KD 1N2DC 3Q5PA 3CWBD 2JP3A 1JY3P 3HTKA 2FYUK 3JC22 5AVQB 3CX5D 2P67A 1KV4A 1R5SA 4RESB 1OVUA 3LW5H 2UWJE 2XNDH 3HD7B 1DD3A 3KHUA 1NTMK 1G2CA 2W83C 3HTKB 3G9RA 1LTSC 2NPSA 2KZJA 3M0DA 1RE4C 3RL0B 4RJTA 1EZVD 2B89A 1NKZB 1RF0A 2QEXP 1LWUB 1URQD 2LKMA 1R8EA 2HPCB 2PAJA 4L73A 3H25A 2OGUA 3H1JE 1EC5A 3TSIA 1ZW0A 2YKOA 3M9QA 3USSA 4H0LD 1FOSF 3TYYA 2YIUB 2WSEH 1FDOA 2Z5IA 3P8MC 2QJPB 5B5EE 1M56D 4QMAA 2D2CC 3HRNA 2YKPA 4WVZA 1RE3C 3IF4A 3A3YB 2ZYGA 1S1CX 3A0HE 1PFIA 1FZGA 1SQPD 3L70E 4GOFA 4JBZA 1VQMP 4H44B 3V6IA 2BCCG 4K3AA 4ZKUA 1RF1C 2OYHC 2ZAEB 1MUUA 2FYUD 2FFDA 1FAVA 3CPWO 3SWYA 2W90A 2RH0A 3RL0D 1AVOA 4N78E 2E74B 1OW6A 2V7QJ 2YNYA 3CMEP 4JF7A 3VMAA 2IYPA 1VL2A 1J1EC 3L35A 1Y9BA 3L74D 3I55P 1VQKP 2QE7H 3D70A 1P84D 3A2AA 1FDIA 5DJTB 1BDDA 2E74D 4U3FE 3H1JJ 5BVZA 2JJLA 2WITA 2YKQA 2I1JA 1LP1A 2B87A 2ZT9B 5AVYB 3RK3E 3PRJA 1GK6A 1KILC 1QEXA 1H88A 3VYIA 2M5AA 1IFNA 5KKZC 3Q5SA 3TNUA 3L37A 4A7PA 1LP1B 3AEEC 1OVRA 2C0WA 4EI2A 5DJUB 4YXWH 1KC8Q 1UIXA 2G3AA 3VOPA 2POHA 2ZT9C 1QVFO 1QL2A 3H1JG 1MFZA 4DJGA 1ZR2A 5KAFH 1HUCA 5AVUB 1SQXE 1M8OB 5CCHC 3TGUD 2GA1A 2A45G 2FFDC 4H0LB 4PJ0H 4DT0A 2YXQB 1M1KQ 5KLVG 1XTGB 4GODA 2FYUG 1N7SC 1T8ZA 1JNMA 1T6AA 2PRRA 2K37A 2AEMA 1VQOP 2JDIH 1LTTC 3H1JD 2JR8A 2HPCA 1GZLA 1RH5B 1VF5C 3AE3C 1LTJC 2B9BA 2BCCE 3ITKA 1NWQA 1CI6A 1U57A 1MZ9A 3CXHI 4GT1A 3JSVC 2A45H 4WY4D 4D6TE 4LGDE 3BRVB 1OWAA 4PJ0E 1VQ8P 3A0HH 3C1LA 2QJKC 1FE6A 3HE4B 3H1LD 1HTLC 2D2CD 2I8DA 1L0LD 3MZWB 2GM4A 1ZV8A 3V2PA 4H13C 1DIPA 2IBZD 1Q81Q 1AA0A 1L0LE 2R5DA 2AEFA 3JCUE 1HVVA 4ASWA 1M57D 1WT6A 1VQ7P 1JO5A 4L75A 1T3UA 3AE6C 4N78D 2ZVOB 1PV3A 1SS1A 4IL6H 5GTHH 3L74G 3ZDMA 1IFJA 1KILA 1KQLA 2M3BA 2OQQA 3RL0C 3TK1A 4H13B 1FZCB 1EQ7A 1KILD 1N7SD 5CMZA 2RN0A 2YO2A 3V2QA 3U1CA 1Q2NA 2O1KA 3U59A 1GU4A 2E5TA 1BCCG 3C8VA 4OH8B 2Q5UA 2XZRA 2A06D 1N86A 1X79B 3L74J 2QA4P 4NPDA 2LXCB 3NXSA 1FZAA 3FGAD 1KFMA 2KSEA 3JCUH 1ZR4A 3H32B 3L71G 1FBMA 5E79H 2P2UA 5CCHD 2IZ1A 1NAFA 2WPVB 3N4XA 1YHQP 2YXRB 1G1JA 1M1JB 5EFWB 2HG5D 1TU3F 2M3EA 1KB9I 2FXOA 4EIJA 1PGOA 3LW5J 3M06A 1LNQA 1BCCE 5AVWB 3L73D 4I6MC 3CWBE 1SQXD 3MTUE 1JUNA 1QVGO 1VDFA 1EZVG 2P10A 3CX5E 5BU5A 1RHZB 1FOSE 1VF5D 1W5CE 1J1EB 1P84H 2QJPC 4JYBA 2Y0EA 5CBOA 3QH9A 5KLIC 1JTHB 1FS0E 2Q3EA 4Z1MH 1M7LA 3H1KG 5K5GB 2J5UA 1SQQE 1IFIA 3L73J 3L72E 5CHXA 5KLVJ 3EQ2A 3H6PA 5KTBA 3II6A 2LR2A 1D7MA 2RMZA 2XU6A 3AE4C 2ZJSE 3B8EB 2E76B 2IDBA 3L4FA 2N1TD 1IO4A 2KK7A 1H89A 3TDKA 2K88A 2Q6QA 1USEA 1BSNA 1NO4A 1JTHA 5AW5B 1W2BO 1VF5B 3S1KA 4AQRD 1E5WA 1JMMA 1U7MA 2H89C 1PP9G 2IZ0A 4RKUJ 2K3RA 2JEEA 4O9BA 3H1HE 2XV5A 3HD7A 4M3LA 2W6AA 3SWKA 3H1HD 4WWIA 1GW4A 1SFCC 1SQVE 5KAIH 3MUDA 3WUUA 1SLQA 1AQTA 3L71E 1IFPA 2KS1B 2W6JH 4XA4A 1UIIA 4YTPC 1NJIQ 3RK3B 3V5BA 2OYIC 2NPSC 2M5AB 3CXHH 2O01N 1DD4A 1SQBG 2WSFJ 5AW4B 2L91A 1L4AB 1YTZT 3F5HA 1GU5A 1BGYE 1L0LJ 1BGYJ 3BRTB 1VPCA 1ZXGA 5E79E 5APTA 3D6YA 1SQXK 2XNXA 1BE3D 2LXBA 1GW3A 2BCCJ 2N1TA 1BDCA 3FWLA 3RGUA 2NPSB 4C7NB 1BSHA 4GKGA 2ZYAA 1VQ9P 1YITP 1HJ0A 2O3JA 3AEGC 3EFGA 1NTZJ 3W68A 3BASA 3KYQA 5AVVB 3GF3A 4PV1C 1VQPP 3LIEA 1S9KE 3WU2H 2NPSD 1NU1G 2WSEJ 5AVTB 1M1JC 1JCCA 2A06G 3B4SA 3GMAA 4AYCA 2D2CB 2P7JA 2WSFH 2H43A 1HWTC 2OTJP 1SFCD 3E1IA 1PPJD 3L75J 3CCSP 3PLNA 2OTLP 1KORA 3AEDC 1NTKE 3PP5A 4DOJA 2YO3A 4YXDC 1KD1Q 1L0LK 3OAKA 4L74A 1Q86Q 2GUSA 3AE8C 1KYOH 2QM7A 4PD4H 1LGHB 1W2EA 2WQYC 3HUSC 1PGJA 3P7KA 2HLOA 5AVRB 2WT7A 5APWA 2AXTH 3GF7A 1CI6B 3V4QA 3I5CA 2J59M 3EFFK 1BE3J 2ZYDA 1LT9A 1OW8A 2YIUC 1SFCA 4C46A 1KB9H 2O01H 1NTKK 2WSCJ 4RO0A 1JY3O 2WPSA 2I1KA 3L75G 4H0LC 2JWAA 4R4LA 4DZOA 4Y99B 1MKMA 2ZVNB 2M8RA 3H1LE 4I7ZB 5TISH 2E43A 2CPSA 2L5GB 3NTNA 4OGQB 1CW5A 2AXTE 4PD4D 5KAIE 1K73Q 5KLIB 2HFED 1KN7A 1FZEA 1A02F 1LT9C 1VQNP 3S9OA 3SFDC 3TNUB 1WMKA 1NTKJ 1JEKA 4UB6H 3W67A 1OXZA 5AW2B 3L71D 3HUSA 3HE5A 2HODB 1BGYD 3CMAP 3SWFA 5AVSB 4HH2A 2JKVA 1ZRTD 2KUBA 3H1ID 3M0AA 3UIAA 2KSJA 3ABVC 3L74E 3Q3DA 1SQPJ 3H1IE 1L0NG 2A06E 2Q9IA 1SQXJ 2M0BA 2PFXA 2R32A 1HH0A 3IR9A 4HYTB 3GW6A 4WY4A 5GTIE 1IFMA 5AW0B 1SQVK 2WT7B 1CZQA 3G3ZA 3O6QA 3FX0A 4UB6E 4NPFX
chains in the Genus database with same CATH topology
1NH4A 1LTJB 3VP8A 3HD7C 1JY2O 1NU1K 5APYA 2R5BA 5CCGD 1A02J 1IJDB 1LTAC 3NFQA 1KZUB 1MV8A 4W7YA 2HYNA 1IC2A 5KJ7A 2A45I 5APQA 1SQQK 1FZCB 1GL2B 2H8PD 1XTCC 3H32A 1AFOA 3HD7D 1LTIC 3MGNA 1X8YA 2IX7C 1X9VA 4W7ZA 2KLVA 1J2JB 2WWWA 3GHGA 4IFFA 1SVFA 4WB4A 1L4AC 1CSBA 2IFNA 4WY4B 3GHGB 2VRSA 2C9LY 1JY2N 2N1TC 2Q7CA 1LTJA 1GL2D 5CJ4A 3RK2B 2W27A 1DX7A 2W6BA 1N7SA 1RE4A 3U1AA 3LIDA 4C7NA 1IK9A 2KB7P 3BATA 1JCDA 3NMDA 2O1JA 2QM8A 2FKWB 5APXA 5CCGC 3P8CE 2YMYA 5AVXB 1FDMA 3VMXA 1L4AA 5BU8B 1LTBC 1YYCA 1JY3N 1FZFA 1H8AA 2H7HA 1SQPK 2XKMA 4EOTA 1JOCA 5CCGA 1J1DC 4N6JA 5AW3B 5KJ7D 1YTZI 1RY3A 1QL1A 2Q3IA 2KOGA 4AUWA 2R3CA 1N73B 3CLQA 1J1DB 1URQB 4W80A 4GIFA 1FZCC 1DEBA 1N7LA 1WRGA 1JY2P 5KJ7C 5AW1B 3M0DC 2BASA 3P32A 3VP9A 1LTGC 1N73A 4N3YB 2C9NY 3B5NB 5AW8B 1HJBA 5CCHA 3N7NA 3IFMA 1NHLA 1Z56A 3P8CD 3GHGC 5AVZB 1S9KD 2OYHB 3M9BA 2E43A 2FYZA 1ZLLA 2XDJA 2OYHA 2FXMA 5CJ0A 5AW9B 2HODA 2Z4EA 2ZXEB 3HUSB 4B86A 1FZCA 1GTWA 2WPRA 3A5TA 1SP4A 1HBWA 5KLVK 5APUA 1A02F 1IFDA 2WSCH 5AW7B 3VMYA 3T97A 3KDPB 3KQGA 3VMZA 3RK2C 3HE5B 5APVA 3VTPC 2E42A 2KYVA 5AW6B 3R2PA 4I1LA 1SFCB 3B5NA 1T3JA 1FJPA 4WBAA 1LT9B 2PP6A 2WZ7A 1T2KC 3RK3C 1NKNA 3O8ZA 3M9HA 1KFNA 3MD0A 2ZFCA 3CL3D 2WPQA 1AQ5A 2OYIB 3B5ND 1L0NK 1L4AD 1URQA 2J58A 3L36A 2MJZA 3RK3D 2CPBA 1RF1B 2IPPA 3C9IA 1HGZA 1GL2C 2N9BA 3HE4A 1SQBK 1LWUC 3BVHA 1HGVA 1RF1A 1GD2E 1FU1A 3A7OA 1GK4A 2C0XA 4WY4C 2IFMA 2KP8A 3MIWA 2OYIA 1NOHA 3B5NC 2N1TB 1GDTA 1N73C 1URQC 5APSA 1GL2A 2FFDB 3KPEA 4IFMA 2P1JA 4LC1A 1G1IA 1M1JA 4IFDK 4LLHA 3M91A 3VN0A 2WTYA 4Y99C 4KHXA 4C7RA 1FZBA 1LWUA 3OA7A 1ZN5A 1NTZK 4JYCA 2GUVA 3WMM0 4ZKPA 1RF0C 1N7SB 1KILB 2OARA 3V2NA 4XE5B 3CI9A 3RK2D 3V2RA 1RE3A 3V4WA 1FJKA 4I2LC 1G2CB 3OJAB 2Z5HA 1T2KD 1N2DC 1JY3P 3HTKA 2FYUK 5AVQB 2P67A 4RESB 3LW5H 3HD7B 1NTMK 1G2CA 3HTKB 3M0DA 1LTSC 2NPSA 1RE4C 3RL0B 1NKZB 1RF0A 1LWUB 1URQD 2LKMA 2PAJA 3TSIA 2YKOA 3M9QA 1FOSF 3TYYA 2WSEH 2Z5IA 3P8MC 2OYIC 3HRNA 2YKPA 1RE3C 3A3YB 1PFIA 1FZGA 1RF1C 2OYHC 4ZKUA 1MUUA 2FFDA 1FAVA 3SWYA 3RL0D 4N78E 2YNYA 4JF7A 1J1EC 3L35A 3A2AA 5BVZA 2JJLA 2WITA 2YKQA 2I1JA 5AVYB 1GK6A 1KILC 1H88A 3VYIA 1IFNA 3TNUA 3L37A 2C0WA 3VOPA 2POHA 1QL2A 1MFZA 1ZR2A 1HUCA 5AVUB 5CCHC 2FFDC 2A45G 1XTGB 1N7SC 1T8ZA 1JNMA 1LTTC 2HPCA 1GZLA 1LTJC 1NWQA 1CI6A 1MZ9A 4GT1A 2A45H 4WY4D 4LGDE 3BRVB 1OWAA 3HE4B 1HTLC 2GM4A 1ZV8A 3V2PA 2R5DA 1HVVA 1JO5A 1WT6A 1T3UA 4N78D 1IFJA 1KILA 1KQLA 2M3BA 3RL0C 3TK1A 1EQ7A 1KILD 1N7SD 5CMZA 2YO2A 3V2QA 3U1CA 2O1KA 3U59A 1GU4A 4OH8B 2Q5UA 2XZRA 1N86A 1X79B 3NXSA 1FZAA 1KFMA 1ZR4A 3H32B 1FBMA 5CCHD 2P2UA 1NAFA 3N4XA 1G1JA 1M1JB 2HPCB 2HG5D 4EIJA 3M06A 5AVWB 4I6MC 3MTUE 1JUNA 1VDFA 5BU5A 1FOSE 1J1EB 4JYBA 1JTHB 1M7LA 1IFIA 5CHXA 3EQ2A 3H6PA 5KTBA 3II6A 2XU6A 3L4FA 3B8EB 2N1TD 1IO4A 1H89A 5AW5B 1NO4A 1JTHA 4AQRD 1E5WA 1JMMA 2JEEA 4O9BA 2XV5A 3HD7A 4M3LA 2W6AA 1GW4A 1SFCC 3MUDA 1SLQA 4XA4A 3RK3B 3V5BA 2NPSC 5AW4B 1L4AB 1YTZT 1GU5A 3BRTB 1VPCA 5APTA 1SQXK 2XNXA 1GW3A 2N1TA 4C7NB 2NPSB 4GKGA 3EFGA 3BASA 3KYQA 5AVVB 1S9KE 3LIEA 2NPSD 5AVTB 1M1JC 1JCCA 4AYCA 2H43A 1DH3A 2P7JA 2WSFH 1HWTC 1SFCD 3E1IA 3PP5A 4DOJA 2YO3A 1L0LK 3OAKA 2GUSA 2QM7A 1LGHB 1W2EA 3HUSC 3P7KA 5AVRB 2HLOA 2WT7A 5APWA 3V4QA 1CI6B 3I5CA 2J59M 1LT9A 1SFCA 4C46A 2O01H 1NTKK 1JY3O 2WPSA 2I1KA 4DZOA 4Y99B 2M8RA 2CPSA 2L5GB 3NTNA 1CW5A 2HFED 1FZEA 1LT9C 3TNUB 1OXZA 5AW2B 3HUSA 3HE5A 2HODB 3SWFA 5AVSB 4HH2A 3M0AA 3UIAA 2KSJA 2Q9IA 3IR9A 4HYTB 2R32A 1HH0A 4WY4A 1IFMA 5AW0B 1SQVK 2WT7B 1CZQA 3G3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HG5 D;  2XDJ A;  3HD7 C;  5CCG D;  4W7Y A;  1JTH B;  5KJ7 A;  3HD7 B;  3HTK B;  2NPS A;  3RL0 B;  1GL2 B;  2H8P D;  2N1T D;  1URQ D;  3HD7 D;  3RK2 C;  3TSI A;  1JTH A;  4W7Z A;  1SFC B;  3B5N A;  1T3J A;  1L4A C;  4WY4 B;  2PP6 A;  2WZ7 A;  3RK3 C;  3HD7 A;  2N1T C;  1SFC C;  1GL2 D;  3RL0 D;  3RK2 B;  4N78 E;  3RK3 B;  4JF7 A;  3B5N D;  2NPS C;  1N7S A;  1L4A D;  1L4A B;  1URQ A;  3RK3 D;  2N1T A;  2NPS B;  1GL2 C;  1KIL C;  5CCG C;  3P8C E;  3KYQ A;  2NPS D;  3VOP A;  1SFC D;  2YMY A;  5CCH C;  4WY4 C;  3PP5 A;  3B5N C;  1XTG B;  2N1T B;  1L4A A;  1N7S C;  1URQ C;  1SFC A;  1GL2 A;  4WY4 D;  5CCG A;  4LGD E;  5KJ7 D;  2KOG A;  2M8R A;  1HVV A;  2HFE D;  1URQ B;  4W80 A;  1KIL A;  3RL0 C;  1KIL D;  1N7S D;  5KJ7 C;  3M0D C;  4OH8 B;  3B5N B;  5CCH A;  1N7S B;  1KIL B;  4WY4 A;  1NHL A;  5CCH D;  3RK2 D; 
#chains in the Genus database with same CATH topology
 1NH4 A;  2KI7 B;  1LTJ B;  4H44 D;  4JPZ B;  1S5L X;  1EZV I;  4U3F G;  3VP8 A;  1EDI A;  3HD7 C;  1Q7Y Q;  1NTM G;  3CWB J;  1SQB J;  1JY2 O;  1NU1 K;  1NTK D;  5APY A;  3B71 A;  4U3F J;  1K05 A;  2R5B A;  4R4M A;  2E5Y A;  3AEC C;  5CCG D;  1A02 J;  3E1R A;  3CC7 P;  1IJD B;  1LTA C;  1R5L A;  2RKL A;  1KZU B;  1QLE D;  1MV8 A;  3NFQ A;  2HYN A;  1IC2 A;  4PV1 D;  4W7Y A;  2A45 I;  3S4R A;  5KJ7 A;  1ZP0 C;  5APQ A;  1EZV E;  2K1A A;  3G71 P;  3BCC J;  3CX5 H;  1L2P A;  1SQQ K;  3TF5 A;  1GL2 B;  1SQP G;  2H8P D;  1XTC C;  3CCJ P;  1K8A Q;  3H32 A;  1KYO D;  4DCK A;  4EDF A;  3HD7 D;  1AFO A;  1YJW P;  1VQ6 P;  1LTI C;  2FBW C;  2WMM A;  3MGN A;  1X8Y A;  2IX7 C;  3PJS K;  1X9V A;  2WSS H;  2AEJ A;  2KLV A;  1J2J B;  4W7Z A;  2WWW A;  3GHG A;  3H1K D;  4HKZ H;  1SQQ G;  4IFF A;  5TIS E;  2BEQ D;  3CX5 I;  2NRG A;  1KQG B;  3BCC D;  1SVF A;  1KB9 D;  2K9J A;  1L4A C;  1CSB A;  1OZH A;  3L70 D;  4WB4 A;  2IFN A;  2V7Q H;  4WY4 B;  3TGU G;  3FXD A;  1ZOY C;  2FY8 A;  3GHG B;  2FYU E;  2VRS A;  3RBX A;  1PGQ A;  2SPZ A;  2C9L Y;  1JY2 N;  4BRY A;  2N9Y B;  1S72 P;  1S5L E;  2N1T C;  1K04 A;  2Q7C A;  1LTJ A;  1GL2 D;  2P58 A;  1OVV A;  3FWN A;  2QVA A;  3L71 J;  3RK2 B;  5CJ4 A;  3AEF C;  4PV1 B;  2W27 A;  1DX7 A;  2W6B A;  3GLM A;  2IYO A;  1N7S A;  2NZ2 A;  1RE4 A;  3CCQ P;  1JB0 J;  1NTM J;  3CWB G;  1KMI Z;  3U1A A;  1PL5 A;  1GMJ A;  3L73 G;  3LID A;  4C7N A;  2WVR A;  1NU1 D;  1EXJ A;  1IK9 A;  2KB7 P;  3Q5R A;  3EWK A;  3BAT A;  1JCD A;  2Y9Y A;  1DH3 A;  2KNC A;  1RQU A;  3NMD A;  1USD A;  2O1J A;  2QM8 A;  1OW7 A;  2FKW B;  5APX A;  5CCG C;  4GDO A;  2QIW A;  3P8C E;  1NTZ E;  2OYO A;  5L8R J;  3K5B A;  2JO1 A;  3QWO C;  4IL6 E;  1BE3 G;  5C39 A;  3H1I G;  4OVN F;  2R3S A;  1PZQ A;  1OX3 A;  2KLU A;  1BCC D;  3CXH D;  2DW3 A;  1NU1 J;  2YMY A;  5AVX B;  1FDM A;  1DEE G;  3VMX A;  1EDK A;  1OFC X;  3AE9 C;  3H1L G;  3L72 D;  4UB8 H;  1L4A A;  4BRY B;  5BU8 B;  3AE2 C;  1LTB C;  1YYC A;  1JY3 N;  2R44 A;  4MN4 C;  1BCC J;  2IBZ G;  3F89 A;  1FZF A;  4EYY Q;  3CCV P;  1H8A A;  2FYU J;  3A0B E;  2KS1 A;  1NTM D;  2H7H A;  2QJY B;  2V4H A;  3BCC G;  1AJY A;  1SQP K;  1KYO E;  4NPE A;  4OGQ D;  3L70 G;  2XKM A;  4EOT A;  1YIJ P;  1JOC A;  2KXP B;  3E7K A;  1VQ5 P;  5CCG A;  1J1D C;  4N6J A;  5AW3 B;  5KJ7 D;  1OIP A;  1YTZ I;  1NGM B;  3KXD A;  1LJ2 A;  1RY3 A;  1QL1 A;  5KLV D;  2Q3I A;  1KTM A;  1IK7 A;  2KOG A;  2FYN C;  4AUW A;  1KB9 E;  2R3C A;  1PIX A;  1S5L H;  1EDJ A;  1H0T B;  5H2F E;  1N73 B;  1SQV D;  3CLQ A;  2G8Y A;  1YJN P;  1J1D B;  1QGK B;  1QX8 A;  1URQ B;  2Y0D A;  3L75 E;  4IL6 X;  2OTK E;  4KJM A;  3CC2 P;  1H0T A;  4W80 A;  3L75 D;  2E75 B;  4GIF A;  3D6Z A;  1FZC C;  1DEB A;  3D71 A;  1N7L A;  1WRG A;  5B66 E;  1JY2 P;  3T97 B;  5AW1 B;  3M0D C;  5KJ7 C;  1KIL E;  2BAS A;  3P32 A;  4K35 A;  1LTG C;  3VP9 A;  1N73 A;  1SQX G;  4N3Y B;  1E79 H;  2C9N Y;  4U3F D;  2K9Y A;  1BE3 E;  3B5N B;  5AW8 B;  2IBZ I;  2JWD A;  5M1B A;  1HJB A;  4OGQ C;  5CCH A;  1JM0 A;  1K9M Q;  1Q90 D;  3IFM A;  1NHL A;  3N7N A;  1Z56 A;  3WUT A;  2ITA A;  3MUD C;  4D6T J;  3P8C D;  3GHG C;  2ZXX A;  5AVZ B;  1VQL P;  4ZMD A;  1S9K D;  3M9B A;  2OYH B;  3RL0 g;  1VQ4 P;  5CBN A;  2FYZ A;  2QRX A;  4JQ0 D;  1ZLL A;  2BEZ F;  2XDJ A;  4PD4 I;  1L0N D;  2KZI A;  2FXM A;  5CJ0 A;  3WUV A;  2OYH A;  5AW9 B;  2HOD A;  2Z4E A;  2ZXE B;  3H1K J;  4UB8 E;  1NVO A;  3CXH E;  2FXP A;  3HUS B;  1Q82 Q;  3TGU E;  1PP9 D;  4B86 A;  1FZC A;  1GTW A;  1M90 Q;  2WPR A;  3A5T A;  1SP4 A;  1HBW A;  5KLV K;  5GTH E;  3A0B H;  3H1L J;  1IFD A;  2O01 J;  2WSC H;  3O6Q B;  4H44 C;  1NTM E;  5APU A;  4TLF A;  5AW7 B;  4KT0 J;  3MHV A;  1NTK G;  3T97 A;  3G4S P;  1P84 I;  3CCL P;  2CK3 H;  3KDP B;  2YMK A;  3KQG A;  3VMZ A;  3AEB C;  3RK2 C;  2W8Z A;  3HE5 B;  1PP9 J;  4GOE A;  5APV A;  3VTP C;  2KYV A;  2E42 A;  1YQ4 C;  3SFE C;  3AEA C;  4I7Z C;  5AW6 B;  3R2P A;  2B88 A;  1SFC B;  3B5N A;  3L72 G;  4I1L A;  1T3J A;  4D6T D;  4HB1 A;  4ZNC A;  1L0N J;  1FJP A;  4WBA A;  1LT9 B;  2PP6 A;  2WZ7 A;  1T2K C;  3RK3 C;  1N8R Q;  3Q2Y A;  1NKN A;  1SQP E;  3AE5 C;  3H1I J;  3O8Z A;  1SQV J;  4PD4 E;  1YQ3 C;  3VMY A;  3CCM P;  1JMB A;  4TT3 H;  1YI2 P;  1EXI A;  1AV1 A;  1NTZ G;  3M9H A;  1KFN A;  3MD0 A;  2ZFC A;  3CL3 D;  2WPQ A;  1AQ5 A;  4CPG A;  2OYI B;  2QJY C;  3B5N D;  1P84 E;  4U7J A;  1L0N K;  1L4A D;  1IZN B;  1URQ A;  2J58 A;  2KNC B;  2MJZ A;  3L36 A;  4Y28 J;  1SQV G;  2AXC A;  1PGP A;  2CPB A;  2K9J B;  3RK3 D;  1RF1 B;  3CCE P;  2IPP A;  3C9I A;  1MFT A;  2HR3 A;  1HGZ A;  1Y8A A;  2E75 D;  1GL2 C;  2N9B A;  3HE4 A;  1SQB K;  3PHL A;  1LWU C;  1NTZ D;  3BVH A;  3CCR P;  3L72 J;  3R4Y A;  1RQV A;  1HGV A;  1L0N E;  1SQQ J;  3L73 E;  1EDL A;  1RF1 A;  1GD2 E;  4YPC A;  3CC4 P;  1FU1 A;  1PPJ E;  5GTI H;  3CCU P;  3A7O A;  5TJH A;  3PH0 A;  2H88 C;  3Q1M A;  1GK4 A;  2C0X A;  2QG4 A;  1BGY G;  1PP9 E;  3AE7 C;  4WY4 C;  1FC2 C;  2IFM A;  2KP8 A;  3MIW A;  4D6T G;  3OW2 O;  2OYI A;  1SQQ D;  3I56 P;  1NOH A;  5KAF E;  3B5N C;  4HJG H;  3H1H G;  2N1T B;  1GDT A;  2E76 D;  4H13 D;  2Y0C A;  5KKZ B;  1N73 C;  1AVY A;  1URQ C;  1S3J A;  2BCC D;  3H1H J;  1L0L G;  1HF9 A;  1Y47 A;  4IOI H;  5APS A;  3RBZ A;  3H1K E;  4ASV A;  1GL2 A;  3GG2 A;  2FFD B;  3KPE A;  1KQF B;  3TGU J;  4IFM A;  2P1J A;  1YJ9 P;  5B5E H;  4LC1 A;  1G1I A;  2PGD A;  3BCC E;  5KLV E;  1ZME C;  1M1J A;  4IFD K;  1S4X A;  4LLH A;  3FXE A;  4BWN A;  2IBZ E;  3M91 A;  3VN0 A;  1SQB E;  2WTY A;  1NYH A;  1X22 A;  4Y99 C;  2Y9Z A;  3WU2 E;  2E74 C;  4KHX A;  1SQB D;  3AE1 C;  4C7R A;  3KZI E;  1FZB A;  1LWU A;  2B87 B;  3G6E P;  3OA7 A;  1ZN5 A;  1NTZ K;  3IN6 A;  5H2F H;  1KQS O;  3CD6 P;  1X0T A;  4JYC A;  4BXL A;  1OMI A;  2GUV A;  1S2E A;  1PPJ G;  3WMM 0;  4ZKP A;  1RF0 C;  2FYN B;  2Q1K A;  1ZRT E;  1N7S B;  1KIL B;  1NU1 E;  2OAR A;  5B66 H;  1YBK A;  3V2N A;  4XE5 B;  3CI9 A;  3RK2 D;  2E75 C;  2MKV A;  3V2R A;  1RE3 A;  3SSU A;  3KZI H;  4L76 A;  3IAO A;  1LT1 A;  3MP7 B;  3V4W A;  4XFJ A;  1FJK A;  2E76 C;  2ZT9 D;  1KYO I;  1NAY A;  1U7J A;  1G2C B;  2KIK A;  4I2L C;  4OWF A;  2QSI A;  3L70 J;  2QJK B;  3OJA B;  3PTZ A;  2Z5H A;  1T2K D;  1N2D C;  3Q5P A;  3CWB D;  2JP3 A;  1JY3 P;  3HTK A;  2FYU K;  3JC2 2;  5AVQ B;  3CX5 D;  2P67 A;  1KV4 A;  1R5S A;  4RES B;  1OVU A;  3LW5 H;  2UWJ E;  2XND H;  3HD7 B;  1DD3 A;  3KHU A;  1NTM K;  1G2C A;  2W83 C;  3HTK B;  3G9R A;  1LTS C;  2NPS A;  2KZJ A;  3M0D A;  1RE4 C;  3RL0 B;  4RJT A;  1EZV D;  2B89 A;  1NKZ B;  1RF0 A;  2QEX P;  1LWU B;  1URQ D;  2LKM A;  1R8E A;  2HPC B;  2PAJ A;  4L73 A;  3H25 A;  2OGU A;  3H1J E;  1EC5 A;  3TSI A;  1ZW0 A;  2YKO A;  3M9Q A;  3USS A;  4H0L D;  1FOS F;  3TYY A;  2YIU B;  2WSE H;  1FDO A;  2Z5I A;  3P8M C;  2QJP B;  5B5E E;  1M56 D;  4QMA A;  2D2C C;  3HRN A;  2YKP A;  4WVZ A;  1RE3 C;  3IF4 A;  3A3Y B;  2ZYG A;  1S1C X;  3A0H E;  1PFI A;  1FZG A;  1SQP D;  3L70 E;  4GOF A;  4JBZ A;  1VQM P;  4H44 B;  3V6I A;  2BCC G;  4K3A A;  4ZKU A;  1RF1 C;  2OYH C;  2ZAE B;  1MUU A;  2FYU D;  2FFD A;  1FAV A;  3CPW O;  3SWY A;  2W90 A;  2RH0 A;  3RL0 D;  1AVO A;  4N78 E;  2E74 B;  1OW6 A;  2V7Q J;  2YNY A;  3CME P;  4JF7 A;  3VMA A;  2IYP A;  1VL2 A;  1J1E C;  3L35 A;  1Y9B A;  3L74 D;  3I55 P;  1VQK P;  2QE7 H;  3D70 A;  1P84 D;  3A2A A;  1FDI A;  5DJT B;  1BDD A;  2E74 D;  4U3F E;  3H1J J;  5BVZ A;  2JJL A;  2WIT A;  2YKQ A;  2I1J A;  1LP1 A;  2B87 A;  2ZT9 B;  5AVY B;  3RK3 E;  3PRJ A;  1GK6 A;  1KIL C;  1QEX A;  1H88 A;  3VYI A;  2M5A A;  1IFN A;  5KKZ C;  3Q5S A;  3TNU A;  3L37 A;  4A7P A;  1LP1 B;  3AEE C;  1OVR A;  2C0W A;  4EI2 A;  5DJU B;  4YXW H;  1KC8 Q;  1UIX A;  2G3A A;  3VOP A;  2POH A;  2ZT9 C;  1QVF O;  1QL2 A;  3H1J G;  1MFZ A;  4DJG A;  1ZR2 A;  5KAF H;  1HUC A;  5AVU B;  1SQX E;  1M8O B;  5CCH C;  3TGU D;  2GA1 A;  2A45 G;  2FFD C;  4H0L B;  4PJ0 H;  4DT0 A;  2YXQ B;  1M1K Q;  5KLV G;  1XTG B;  4GOD A;  2FYU G;  1N7S C;  1T8Z A;  1JNM A;  1T6A A;  2PRR A;  2K37 A;  2AEM A;  1VQO P;  2JDI H;  1LTT C;  3H1J D;  2JR8 A;  2HPC A;  1GZL A;  1RH5 B;  1VF5 C;  3AE3 C;  1LTJ C;  2B9B A;  2BCC E;  3ITK A;  1NWQ A;  1CI6 A;  1U57 A;  1MZ9 A;  3CXH I;  4GT1 A;  3JSV C;  2A45 H;  4WY4 D;  4D6T E;  4LGD E;  3BRV B;  1OWA A;  4PJ0 E;  1VQ8 P;  3A0H H;  3C1L A;  2QJK C;  1FE6 A;  3HE4 B;  3H1L D;  1HTL C;  2D2C D;  2I8D A;  1L0L D;  3MZW B;  2GM4 A;  1ZV8 A;  3V2P A;  4H13 C;  1DIP A;  2IBZ D;  1Q81 Q;  1AA0 A;  1L0L E;  2R5D A;  2AEF A;  3JCU E;  1HVV A;  4ASW A;  1M57 D;  1WT6 A;  1VQ7 P;  1JO5 A;  4L75 A;  1T3U A;  3AE6 C;  4N78 D;  2ZVO B;  1PV3 A;  1SS1 A;  4IL6 H;  5GTH H;  3L74 G;  3ZDM A;  1IFJ A;  1KIL A;  1KQL A;  2M3B A;  2OQQ A;  3RL0 C;  3TK1 A;  4H13 B;  1FZC B;  1EQ7 A;  1KIL D;  1N7S D;  5CMZ A;  2RN0 A;  2YO2 A;  3V2Q A;  3U1C A;  1Q2N A;  2O1K A;  3U59 A;  1GU4 A;  2E5T A;  1BCC G;  3C8V A;  4OH8 B;  2Q5U A;  2XZR A;  2A06 D;  1N86 A;  1X79 B;  3L74 J;  2QA4 P;  4NPD A;  2LXC B;  3NXS A;  1FZA A;  3FGA D;  1KFM A;  2KSE A;  3JCU H;  1ZR4 A;  3H32 B;  3L71 G;  1FBM A;  5E79 H;  2P2U A;  5CCH D;  2IZ1 A;  1NAF A;  2WPV B;  3N4X A;  1YHQ P;  2YXR B;  1G1J A;  1M1J B;  5EFW B;  2HG5 D;  1TU3 F;  2M3E A;  1KB9 I;  2FXO A;  4EIJ A;  1PGO A;  3LW5 J;  3M06 A;  1LNQ A;  1BCC E;  5AVW B;  3L73 D;  4I6M C;  3CWB E;  1SQX D;  3MTU E;  1JUN A;  1QVG O;  1VDF A;  1EZV G;  2P10 A;  3CX5 E;  5BU5 A;  1RHZ B;  1FOS E;  1VF5 D;  1W5C E;  1J1E B;  1P84 H;  2QJP C;  4JYB A;  2Y0E A;  5CBO A;  3QH9 A;  5KLI C;  1JTH B;  1FS0 E;  2Q3E A;  4Z1M H;  1M7L A;  3H1K G;  5K5G B;  2J5U A;  1SQQ E;  1IFI A;  3L73 J;  3L72 E;  5CHX A;  5KLV J;  3EQ2 A;  3H6P A;  5KTB A;  3II6 A;  2LR2 A;  1D7M A;  2RMZ A;  2XU6 A;  3AE4 C;  2ZJS E;  3B8E B;  2E76 B;  2IDB A;  3L4F A;  2N1T D;  1IO4 A;  2KK7 A;  1H89 A;  3TDK A;  2K88 A;  2Q6Q A;  1USE A;  1BSN A;  1NO4 A;  1JTH A;  5AW5 B;  1W2B O;  1VF5 B;  3S1K A;  4AQR D;  1E5W A;  1JMM A;  1U7M A;  2H89 C;  1PP9 G;  2IZ0 A;  4RKU J;  2K3R A;  2JEE A;  4O9B A;  3H1H E;  2XV5 A;  3HD7 A;  4M3L A;  2W6A A;  3SWK A;  3H1H D;  4WWI A;  1GW4 A;  1SFC C;  1SQV E;  5KAI H;  3MUD A;  3WUU A;  1SLQ A;  1AQT A;  3L71 E;  1IFP A;  2KS1 B;  2W6J H;  4XA4 A;  1UII A;  4YTP C;  1NJI Q;  3RK3 B;  3V5B A;  2OYI C;  2NPS C;  2M5A B;  3CXH H;  2O01 N;  1DD4 A;  1SQB G;  2WSF J;  5AW4 B;  2L91 A;  1L4A B;  1YTZ T;  3F5H A;  1GU5 A;  1BGY E;  1L0L J;  1BGY J;  3BRT B;  1VPC A;  1ZXG A;  5E79 E;  5APT A;  3D6Y A;  1SQX K;  2XNX A;  1BE3 D;  2LXB A;  1GW3 A;  2BCC J;  2N1T A;  1BDC A;  3FWL A;  3RGU A;  2NPS B;  4C7N B;  1BSH A;  4GKG A;  2ZYA A;  1VQ9 P;  1YIT P;  1HJ0 A;  2O3J A;  3AEG C;  3EFG A;  1NTZ J;  3W68 A;  3BAS A;  3KYQ A;  5AVV B;  3GF3 A;  4PV1 C;  1VQP P;  3LIE A;  1S9K E;  3WU2 H;  2NPS D;  1NU1 G;  2WSE J;  5AVT B;  1M1J C;  1JCC A;  2A06 G;  3B4S A;  3GMA A;  4AYC A;  2D2C B;  2P7J A;  2WSF H;  2H43 A;  1HWT C;  2OTJ P;  1SFC D;  3E1I A;  1PPJ D;  3L75 J;  3CCS P;  3PLN A;  2OTL P;  1KOR A;  3AED C;  1NTK E;  3PP5 A;  4DOJ A;  2YO3 A;  4YXD C;  1KD1 Q;  1L0L K;  3OAK A;  4L74 A;  1Q86 Q;  2GUS A;  3AE8 C;  1KYO H;  2QM7 A;  4PD4 H;  1LGH B;  1W2E A;  2WQY C;  3HUS C;  1PGJ A;  3P7K A;  2HLO A;  5AVR B;  2WT7 A;  5APW A;  2AXT H;  3GF7 A;  1CI6 B;  3V4Q A;  3I5C A;  2J59 M;  3EFF K;  1BE3 J;  2ZYD A;  1LT9 A;  1OW8 A;  2YIU C;  1SFC A;  4C46 A;  1KB9 H;  2O01 H;  1NTK K;  2WSC J;  4RO0 A;  1JY3 O;  2WPS A;  2I1K A;  3L75 G;  4H0L C;  2JWA A;  4R4L A;  4DZO A;  4Y99 B;  1MKM A;  2ZVN B;  2M8R A;  3H1L E;  4I7Z B;  5TIS H;  2E43 A;  2CPS A;  2L5G B;  3NTN A;  4OGQ B;  1CW5 A;  2AXT E;  4PD4 D;  5KAI E;  1K73 Q;  5KLI B;  2HFE D;  1KN7 A;  1FZE A;  1A02 F;  1LT9 C;  1VQN P;  3S9O A;  3SFD C;  3TNU B;  1WMK A;  1NTK J;  1JEK A;  4UB6 H;  3W67 A;  1OXZ A;  5AW2 B;  3L71 D;  3HUS A;  3HE5 A;  2HOD B;  1BGY D;  3CMA P;  3SWF A;  5AVS B;  4HH2 A;  2JKV A;  1ZRT D;  2KUB A;  3H1I D;  3M0A A;  3UIA A;  2KSJ A;  3ABV C;  3L74 E;  3Q3D A;  1SQP J;  3H1I E;  1L0N G;  2A06 E;  2Q9I A;  1SQX J;  2M0B A;  2PFX A;  2R32 A;  1HH0 A;  3IR9 A;  4HYT B;  3GW6 A;  4WY4 A;  5GTI E;  1IFM A;  5AW0 B;  1SQV K;  2WT7 B;  1CZQ A;  3G3Z A;  3O6Q A;  3FX0 A;  4UB6 E;  4NPF X; 
#chains in the Genus database with same CATH homology
 1NH4 A;  1LTJ B;  3VP8 A;  3HD7 C;  1JY2 O;  1NU1 K;  5APY A;  2R5B A;  5CCG D;  1A02 J;  1IJD B;  1LTA C;  3NFQ A;  1KZU B;  1MV8 A;  4W7Y A;  2HYN A;  1IC2 A;  5KJ7 A;  2A45 I;  5APQ A;  1SQQ K;  1FZC B;  1GL2 B;  2H8P D;  1XTC C;  3H32 A;  1AFO A;  3HD7 D;  1LTI C;  3MGN A;  1X8Y A;  2IX7 C;  1X9V A;  4W7Z A;  2KLV A;  1J2J B;  2WWW A;  3GHG A;  4IFF A;  1SVF A;  4WB4 A;  1L4A C;  1CSB A;  2IFN A;  4WY4 B;  3GHG B;  2VRS A;  2C9L Y;  1JY2 N;  2N1T C;  2Q7C A;  1LTJ A;  1GL2 D;  5CJ4 A;  3RK2 B;  2W27 A;  1DX7 A;  2W6B A;  1N7S A;  1RE4 A;  3U1A A;  3LID A;  4C7N A;  1IK9 A;  2KB7 P;  3BAT A;  1JCD A;  3NMD A;  2O1J A;  2QM8 A;  2FKW B;  5APX A;  5CCG C;  3P8C E;  2YMY A;  5AVX B;  1FDM A;  3VMX A;  1L4A A;  5BU8 B;  1LTB C;  1YYC A;  1JY3 N;  1FZF A;  1H8A A;  2H7H A;  1SQP K;  2XKM A;  4EOT A;  1JOC A;  5CCG A;  1J1D C;  4N6J A;  5AW3 B;  5KJ7 D;  1YTZ I;  1RY3 A;  1QL1 A;  2Q3I A;  2KOG A;  4AUW A;  2R3C A;  1N73 B;  3CLQ A;  1J1D B;  1URQ B;  4W80 A;  4GIF A;  1FZC C;  1DEB A;  1N7L A;  1WRG A;  1JY2 P;  5KJ7 C;  5AW1 B;  3M0D C;  2BAS A;  3P32 A;  3VP9 A;  1LTG C;  1N73 A;  4N3Y B;  2C9N Y;  3B5N B;  5AW8 B;  1HJB A;  5CCH A;  3N7N A;  3IFM A;  1NHL A;  1Z56 A;  3P8C D;  3GHG C;  5AVZ B;  1S9K D;  2OYH B;  3M9B A;  2E43 A;  2FYZ A;  1ZLL A;  2XDJ A;  2OYH A;  2FXM A;  5CJ0 A;  5AW9 B;  2HOD A;  2Z4E A;  2ZXE B;  3HUS B;  4B86 A;  1FZC A;  1GTW A;  2WPR A;  3A5T A;  1SP4 A;  1HBW A;  5KLV K;  5APU A;  1A02 F;  1IFD A;  2WSC H;  5AW7 B;  3VMY A;  3T97 A;  3KDP B;  3KQG A;  3VMZ A;  3RK2 C;  3HE5 B;  5APV A;  3VTP C;  2E42 A;  2KYV A;  5AW6 B;  3R2P A;  4I1L A;  1SFC B;  3B5N A;  1T3J A;  1FJP A;  4WBA A;  1LT9 B;  2PP6 A;  2WZ7 A;  1T2K C;  3RK3 C;  1NKN A;  3O8Z A;  3M9H A;  1KFN A;  3MD0 A;  2ZFC A;  3CL3 D;  2WPQ A;  1AQ5 A;  2OYI B;  3B5N D;  1L0N K;  1L4A D;  1URQ A;  2J58 A;  3L36 A;  2MJZ A;  3RK3 D;  2CPB A;  1RF1 B;  2IPP A;  3C9I A;  1HGZ A;  1GL2 C;  2N9B A;  3HE4 A;  1SQB K;  1LWU C;  3BVH A;  1HGV A;  1RF1 A;  1GD2 E;  1FU1 A;  3A7O A;  1GK4 A;  2C0X A;  4WY4 C;  2IFM A;  2KP8 A;  3MIW A;  2OYI A;  1NOH A;  3B5N C;  2N1T B;  1GDT A;  1N73 C;  1URQ C;  5APS A;  1GL2 A;  2FFD B;  3KPE A;  4IFM A;  2P1J A;  4LC1 A;  1G1I A;  1M1J A;  4IFD K;  4LLH A;  3M91 A;  3VN0 A;  2WTY A;  4Y99 C;  4KHX A;  4C7R A;  1FZB A;  1LWU A;  3OA7 A;  1ZN5 A;  1NTZ K;  4JYC A;  2GUV A;  3WMM 0;  4ZKP A;  1RF0 C;  1N7S B;  1KIL B;  2OAR A;  3V2N A;  4XE5 B;  3CI9 A;  3RK2 D;  3V2R A;  1RE3 A;  3V4W A;  1FJK A;  4I2L C;  1G2C B;  3OJA B;  2Z5H A;  1T2K D;  1N2D C;  1JY3 P;  3HTK A;  2FYU K;  5AVQ B;  2P67 A;  4RES B;  3LW5 H;  3HD7 B;  1NTM K;  1G2C A;  3HTK B;  3M0D A;  1LTS C;  2NPS A;  1RE4 C;  3RL0 B;  1NKZ B;  1RF0 A;  1LWU B;  1URQ D;  2LKM A;  2PAJ A;  3TSI A;  2YKO A;  3M9Q A;  1FOS F;  3TYY A;  2WSE H;  2Z5I A;  3P8M C;  2OYI C;  3HRN A;  2YKP A;  1RE3 C;  3A3Y B;  1PFI A;  1FZG A;  1RF1 C;  2OYH C;  4ZKU A;  1MUU A;  2FFD A;  1FAV A;  3SWY A;  3RL0 D;  4N78 E;  2YNY A;  4JF7 A;  1J1E C;  3L35 A;  3A2A A;  5BVZ A;  2JJL A;  2WIT A;  2YKQ A;  2I1J A;  5AVY B;  1GK6 A;  1KIL C;  1H88 A;  3VYI A;  1IFN A;  3TNU A;  3L37 A;  2C0W A;  3VOP A;  2POH A;  1QL2 A;  1MFZ A;  1ZR2 A;  1HUC A;  5AVU B;  5CCH C;  2FFD C;  2A45 G;  1XTG B;  1N7S C;  1T8Z A;  1JNM A;  1LTT C;  2HPC A;  1GZL A;  1LTJ C;  1NWQ A;  1CI6 A;  1MZ9 A;  4GT1 A;  2A45 H;  4WY4 D;  4LGD E;  3BRV B;  1OWA A;  3HE4 B;  1HTL C;  2GM4 A;  1ZV8 A;  3V2P A;  2R5D A;  1HVV A;  1JO5 A;  1WT6 A;  1T3U A;  4N78 D;  1IFJ A;  1KIL A;  1KQL A;  2M3B A;  3RL0 C;  3TK1 A;  1EQ7 A;  1KIL D;  1N7S D;  5CMZ A;  2YO2 A;  3V2Q A;  3U1C A;  2O1K A;  3U59 A;  1GU4 A;  4OH8 B;  2Q5U A;  2XZR A;  1N86 A;  1X79 B;  3NXS A;  1FZA A;  1KFM A;  1ZR4 A;  3H32 B;  1FBM A;  5CCH D;  2P2U A;  1NAF A;  3N4X A;  1G1J A;  1M1J B;  2HPC B;  2HG5 D;  4EIJ A;  3M06 A;  5AVW B;  4I6M C;  3MTU E;  1JUN A;  1VDF A;  5BU5 A;  1FOS E;  1J1E B;  4JYB A;  1JTH B;  1M7L A;  1IFI A;  5CHX A;  3EQ2 A;  3H6P A;  5KTB A;  3II6 A;  2XU6 A;  3L4F A;  3B8E B;  2N1T D;  1IO4 A;  1H89 A;  5AW5 B;  1NO4 A;  1JTH A;  4AQR D;  1E5W A;  1JMM A;  2JEE A;  4O9B A;  2XV5 A;  3HD7 A;  4M3L A;  2W6A A;  1GW4 A;  1SFC C;  3MUD A;  1SLQ A;  4XA4 A;  3RK3 B;  3V5B A;  2NPS C;  5AW4 B;  1L4A B;  1YTZ T;  1GU5 A;  3BRT B;  1VPC A;  5APT A;  1SQX K;  2XNX A;  1GW3 A;  2N1T A;  4C7N B;  2NPS B;  4GKG A;  3EFG A;  3BAS A;  3KYQ A;  5AVV B;  1S9K E;  3LIE A;  2NPS D;  5AVT B;  1M1J C;  1JCC A;  4AYC A;  2H43 A;  1DH3 A;  2P7J A;  2WSF H;  1HWT C;  1SFC D;  3E1I A;  3PP5 A;  4DOJ A;  2YO3 A;  1L0L K;  3OAK A;  2GUS A;  2QM7 A;  1LGH B;  1W2E A;  3HUS C;  3P7K A;  5AVR B;  2HLO A;  2WT7 A;  5APW A;  3V4Q A;  1CI6 B;  3I5C A;  2J59 M;  1LT9 A;  1SFC A;  4C46 A;  2O01 H;  1NTK K;  1JY3 O;  2WPS A;  2I1K A;  4DZO A;  4Y99 B;  2M8R A;  2CPS A;  2L5G B;  3NTN A;  1CW5 A;  2HFE D;  1FZE A;  1LT9 C;  3TNU B;  1OXZ A;  5AW2 B;  3HUS A;  3HE5 A;  2HOD B;  3SWF A;  5AVS B;  4HH2 A;  3M0A A;  3UIA A;  2KSJ A;  2Q9I A;  3IR9 A;  4HYT B;  2R32 A;  1HH0 A;  4WY4 A;  1IFM A;  5AW0 B;  1SQV K;  2WT7 B;  1CZQ A;  3G3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...