4WY4B

Crystal structure of autophagic snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
b'ESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 8
molecule tags Membrane protein
source organism Homo sapiens
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4B00
2N1TD 1SFCA 1N7SC 4W7YA 5CCHD 2HG5D 1NHLA 3HTKB 3B5ND 2H8PD 4OH8B 1SFCB 3HD7A 4WY4B 1GL2C 4W7ZA 2NPSC 1N7SD 4JF7A 1URQB 2WZ7A 3RK2D 3RK2C 2N1TC 1T3JA 1GL2B 5KJ7D 1L4AC 5CCGC 3RL0D 1L4AD 5CCGD 1HVVA 1N7SA 2M8RA 1L4AA 5CCGA 3TSIA 3RK2B 2KOGA 2XDJA 3RK3C 4WY4C 4W80A 5KJ7A 3HD7C 1URQC 1KILC 3RL0C 1SFCC 1SFCD 3P8CE 2PP6A 5CCHA 3KYQA 1XTGB 1JTHB 3B5NB 3RL0B 2YMYA 3HD7D 3B5NA 5KJ7C 2N1TB 2N1TA 3PP5A 3VOPA 1KILA 3HD7B 1N7SB 2NPSD 1KILB 5CCHC 1GL2D 4LGDE 1JTHA 4WY4D 3RK3B 4WY4A 2NPSB 1KILD 1URQD 1URQA 1GL2A 2HFED 2NPSA 3M0DC 3B5NC 3RK3D 1L4AB 4N78E
chains in the Genus database with same CATH superfamily
1AQ5A 4YXDC 3HRNA 2HPCB 5APUA 2M5AA 2ZT9D 1ZRTD 1BGYJ 3F89A 1NYHA 3OJAB 2WSSH 1A02J 2B88A 2IYPA 1LTGC 4XE5B 2HYNA 5APXA 3G9RA 5E79E 3SWKA 1UIXA 3FWNA 1VF5B 1SQQK 1EDKA 2E75C 1NHLA 1IFNA 1QVGO 2RMZA 3KDPB 2GA1A 2WTYA 3PLNA 2H8PD 5CHXA 1FDMA 3VMXA 1KYOI 4JPZB 1FDOA 1JB0J 1KILE 2E75B 2P7JA 2RN0A 2WPSA 3A0BE 3L70J 1OX3A 1G2CA 2H88C 2Q6QA 3EQ2A 4B86A 1IO4A 1JY3P 3FXEA 1IFMA 3NTNA 2LKMA 1Z56A 5AVUB 1PPJD 5AVVB 5M1BA 3KQGA 1KYOH 2QM7A 1NU1K 1M90Q 1KB9D 3L70G 1BGYE 3G4SP 1L4AD 1KD1Q 2W6BA 1N7SA 4D6TJ 1SQVK 3Q2YA 5CCGA 5KTBA 4QMAA 3TSIA 3UIAA 2QEXP 1LTIC 1SQBK 2ZYDA 3Q5SA 4U7JA 1P84H 2FXPA 4UB8H 1AFOA 2O01H 1HBWA 3O6QA 2XDJA 5CJ0A 2E74D 3M9HA 5B5EE 2FY8A 2OYIA 2WSFJ 3RK3C 4KT0J 3BASA 1IFJA 2KZJA 5TISH 3U1CA 1K73Q 2HPCA 1X79B 1HJ0A 1SQVE 3G3ZA 2BEQD 3MUDC 4K3AA 5KJ7A 3H1JG 1SQXD 3HD7C 1SLQA 4OGQC 1K05A 3USSA 2JJLA 1URQC 3L37A 1LT9C 1QL1A 1W2EA 1NAFA 2W27A 5K5GB 1AA0A 4D6TD 1YJ9P 5AW3B 1CI6A 3TGUJ 1SFCD 2JWDA 1LTSC 1M1JB 1RF0C 1SQBE 2XKMA 1SQQE 1U57A 2K9JA 2B9BA 2ZT9B 5AW5B 5AW7B 3L70E 4ZMDA 3W67A 3IF4A 1T3UA 1FC2C 3CMAP 3NXSA 5BU5A 3Q5PA 5APWA 5CCHA 1JM0A 3AEGC 2OYHB 2E43A 3CWBG 1VQOP 1DX7A 2LXCB 3CX5I 4LC1A 1DD3A 1KB9H 3OAKA 1XTGB 1YBKA 3C9IA 3V4WA 1FAVA 1NTKD 2O01N 3VTPC 1SQXE 4PJ0H 3AE3C 1MKMA 5KAFH 3CCMP 3N7NA 1PGOA 3GHGC 2H43A 2YKOA 1CSBA 2AEMA 2E75D 1LTJC 2KZIA 2PGDA 2OGUA 3H1KG 4CPGA 2K9YA 1KYOE 3B5NA 5AVYB 3Q5RA 3JCUE 3V2PA 5KKZC 1N73B 1BCCD 3AEEC 3H1IJ 3VYIA 3H1JD 4H44B 4EIJA 2NZ2A 3A0HH 1OXZA 3PTZA 2W6JH 3NMDA 3PP5A 3PRJA 1OW8A 2RH0A 1QGKB 3M06A 4IOIH 1JY2P 5AW2B 1FZCA 1GDTA 2IZ1A 2I8DA 2O01J 1N7SB 3CX5H 2IDBA 3T97A 1HTLC 1YI2P 1H0TA 1BDDA 1BGYD 1P84E 2P67A 1IC2A 1S2EA 3H1KJ 3NFQA 3HTKA 4UB8E 1HGZA 1KILB 4BXLA 3I55P 4EOTA 1EZVG 1K8AQ 2KS1B 4MN4C 4LGDE 1TU3F 2OYIB 5AVTB 2KXPB 1S5LH 1YYCA 1NGMB 2H89C 1L0NE 4WWIA 1Q2NA 2KK7A 2W90A 1VQMP 1LWUB 1HGVA 3B71A 2R5BA 2YXQB 3WU2H 1KILD 1ZN5A 2C9NY 1URQD 1USDA 1LGHB 1T8ZA 1NKNA 1SQQG 1URQA 3LIEA 1VQPP 2HLOA 1YQ4C 2HFED 2XZRA 4LLHA 2FYZA 2JP3A 2AXCA 2I1JA 2OTLP 1X22A 2FYUE 2ZVNB 4N78E 1NTME 3CLQA 1VL2A 3RBZA 4C7RA 1X0TA 2I1KA 1Q81Q 2KI7B 1NTZE 2N1TD 1LT9B 1OVUA 1KQGB 2K3RA 2KYVA 1SQPJ 3AE9C 3L75J 4PJ0E 3MZWB 3AEAC 2E76C 1LP1A 3TDKA 3L75G 1YIJP 5CCHD 2J5UA 2QIWA 3P32A 1L0NG 3JCUH 3E1RA 3KHUA 3CXHE 4H13C 1AVOA 3GHGA 4ZKPA 3L73G 2HG5D 3A0HE 4EDFA 4UB6H 5CBOA 2WPVB 2FYUK 2QVAA 2R5DA 3CX5D 3HTKB 4C7NA 3H32B 1HUCA 1EQ7A 3CX5E 2K37A 4PV1C 4OH8B 3CPWO 3HUSA 1YJWP 2PFXA 3D6ZA 3M0DA 5H2FH 1FBMA 3E1IA 5CMZA 4H44D 5BU8B 4WB4A 1L0LG 1GL2C 1QLED 3L72G 1RQUA 2O3JA 4W7ZA 2XV5A 2KP8A 5AW4B 3WUTA 4PV1D 2WT7A 1N7SD 2O1KA 1RY3A 1S5LE 4JF7A 3SWYA 2WZ7A 1G2CB 2OQQA 4GDOA 3RK2D 2Q1KA 3B4SA 4A7PA 4DOJA 3KZIE 1KQLA 1NVOA 2P58A 3TK1A 1ZMEC 2XNXA 3QWOC 2FYNB 1NTZD 4I2LC 4L75A 1LWUA 1XTCC 1VQLP 5CCGD 2YXRB 2VRSA 2QJKC 4N78D 2FYUD 2M8RA 2JR8A 4GOEA 4GODA 4Y99C 3VMAA 3RK2B 4I6MC 3MP7B 2QJPB 2HR3A 3OW2O 1QX8A 1S72P 4NPFX 1VF5C 4C7NB 3BRTB 4IL6H 1GU5A 1E5WA 1J1DB 4H0LC 2P1JA 3VMZA 1KFNA 4WY4C 5AVSB 1U7JA 4R4LA 3RL0D 2QJPC 1PP9D 1GZLA 4RESB 4NPDA 1G1IA 1SQPE 3KXDA 3BCCE 3CWBD 4PD4I 1JMMA 2D2CB 3T97B 1NU1D 4RKUJ 3U59A 4H0LD 4DZOA 1KILC 3L74D 4JQ0D 2Y0DA 2C9LY 4TT3H 2BASA 1MV8A 3L71G 1IFDA 3G6EP 3P8CE 1FOSE 2IBZG 1NO4A 4L73A 1LTTC 4TLFA 2XNDH 1N8RQ 2A06E 3P8CD 3PHLA 2PP6A 2Q3EA 1OVRA 2AEFA 3CCUP 3KYQA 2KLUA 1G1JA 2YO3A 3A0BH 3H1JE 3IFMA 3TGUD 2Y9YA 1FZCC 2E5YA 2P10A 3L35A 3MTUE 1KYOD 1JTHB 3CWBE 2A45I 2WT7B 1SQPD 2B87A 1SQXK 2K9JB 3A3YB 4ASVA 1SQBJ 3HD7D 1VQ6P 1X8YA 1NTKK 2AXTH 2YKPA 5AVZB 1PZQA 1QVFO 1PP9G 4GIFA 3AE7C 1ZR2A 3SWFA 1LTJA 2WSCJ 1SVFA 2WWWA 3VOPA 3CL3D 3AE4C 1S9KE 2RKLA 3L73D 3HD7B 2M3EA 3VP8A 1Q86Q 4NPEA 1EXJA 2IYOA 4XA4A 3VP9A 2SPZA 5B5EH 1GTWA 4OVNF 1DD4A 1OW7A 1J1EB 3FWLA 5TISE 5L8RJ 3Q3DA 2Q9IA 1Y8AA 2WMMA 3V2RA 1FZFA 1VQ4P 2IBZI 2K88A 4AQRD 1OZHA 2QJKB 4WY4D 3CCQP 4DT0A 4EI2A 1SQVD 3CC4P 2Z5IA 4WY4A 2R3SA 2JO1A 2N9YB 1JOCA 2KLVA 1LTBC 5CJ4A 2R44A 4H13D 1L0NK 1IZNB 1MFZA 2A45G 1RE4A 1SQPK 4GOFA 1EDLA 4OGQB 2D2CD 3CC2P 3I56P 1FZAA 2WPQA 3M0DC 2G3AA 1RF1C 4DCKA 3CXHD 2GUVA 3S4RA 4PD4D 3C8VA 1S1CX 3N4XA 3AE8C 1KB9E 1SQQJ 2Q5UA 3ITKA 1YITP 2QSIA 1GU4A 3H1LD 1VQ8P 4O9BA 3TF5A 1SFCA 2YIUB 1GMJA 1N7SC 3IN6A 1PPJE 5KAFE 4W7YA 4ASWA 3CCLP 3CCVP 3AEFC 1FJPA 3L72D 1ZP0C 1H0TB 1JCDA 1NTMD 5APSA 1KTMA 2E74B 1CZQA 1LP1B 2IFNA 1OIPA 1DEBA 2XU6A 3L72J 3R2PA 5AVWB 3RL0g 3G71P 2ZAEB 2WITA 4AUWA 2W8ZA 1HH0A 1M57D 1NTZG 2QE7H 1IJDB 3FGAD 4HYTB 1ZR4A 1YJNP 2R32A 1IK9A 3L74J 3HD7A 1GW4A 4H44C 1NU1J 1HWTC 4BRYB 1LT9A 3H1IE 2E76B 2NPSC 2W6AA 2ZXXA 2BEZF 3HUSC 3MD0A 3OA7A 1R8EA 1M1KQ 1VQ9P 1R5SA 3L72E 1URQB 1PV3A 2FYUJ 3CCJP 1RF0A 2GUSA 2WSEJ 3V2NA 1ZOYC 4I7ZC 2WSCH 5KLIB 1M1JC 1T3JA 3ABVC 3H32A 1L4AC 5B66H 4M3LA 2R3CA 4HB1A 1P84D 1JY2N 1SQBG 2CK3H 1LNQA 1HVVA 5AW8B 1OW6A 2E76D 2V4HA 4IFMA 1H89A 3BVHA 1NU1G 2OTKE 4JYCA 1LWUC 3V4QA 2QJYB 5EFWB 2MKVA 2KOGA 3WUUA 1OWAA 2B89A 3P7KA 1Q7YQ 1VQKP 5APVA 1IFIA 5KLVJ 1VF5D 1JY3N 2ZJSE 4H13B 2IBZD 1N2DC 2QG4A 1JY3O 4U3FE 3V2QA 1AQTA 2J58A 1RF1A 3GHGB 5KLVD 1IK7A 1JEKA 3M9QA 1E79H 2C0WA 3L73J 1KMIZ 1OVVA 1NTKE 1YQ3C 1GK6A 2BCCG 1DEEG 2FFDA 1WRGA 1EDIA 3RL0C 3FXDA 2Z4EA 2AEJA 1SFCC 2FBWC 1JO5A 1JUNA 3A5TA 1DIPA 3L70D 1NH4A 4YPCA 1AV1A 1SQQD 4JYBA 1CW5A 1SQBD 2HODB 1BCCG 1CI6B 2KSEA 4HJGH 1S9KD 1RHZB 4RJTA 3GF7A 3PH0A 5H2FE 4D6TE 3H25A 1Q90D 1MUUA 1KQFB 2V7QH 3R4YA 3SSUA 2POHA 3H1IG 2J59M 3AE5C 5GTHH 3PJSK 4YXWH 2IFMA 3E7KA 2OYHA 2YO2A 3M9BA 4U3FG 2Y0EA 4ZNCA 5KLVE 3H1LG 4KHXA 2H7HA 1RE3C 3HE4B 3RGUA 2IBZE 1S3JA 2B87B 4PD4H 2LXBA 1RE4C 2JDIH 3C1LA 3L36A 3MGNA 5B66E 1PGQA 3CMEP 2FFDB 2KSJA 1W5CE 5KJ7C 2N1TB 2A45H 1LJ2A 2PAJA 2YIUC 3CWBJ 4KJMA 2L5GB 1L2PA 2A06D 1EZVE 1ZXGA 2KNCB 3L71D 1WMKA 2CPBA 3BCCG 4HKZH 4JBZA 1HF9A 5GTIE 3SFEC 3W68A 3H6PA 4N6JA 4AYCA 1N73C 2Q3IA 2NPSD 1JMBA 2DW3A 3H1KD 5AVQB 1GL2D 1NAYA 3A7OA 3M91A 1H8AA 1T6AA 3H1HD 1PGPA 4L76A 1PP9J 1KFMA 5KLIC 3O8ZA 1N86A 1NU1E 3D6YA 2CPSA 2WPRA 3AEDC 1NTKG 3EFFK 3B8EB 1BCCJ 3EWKA 3H1ID 3TNUA 5KLVK 1FOSF 1SS1A 1DH3A 2KIKA 2OARA 2NPSB 3Q1MA 2ZVOB 3CC7P 3MHVA 1A02F 2QM8A 1KORA 5KKZB 1M7LA 1GL2A 2NRGA 3O6QB 4I1LA 2D2CC 4K35A 4PV1B 3CCRP 1NTKJ 3B5NC 1SP4A 1Y47A 2BCCE 1L4AB 3L71J 1J1EC 4WBAA 3H1HJ 3CCEP 1EZVI 1FZBA 1NTMK 1NWQA 1JNMA 5GTHE 2M5AB 1ZRTE 1VQ7P 2ZYAA 3LW5H 1KZUB 3H1LE 2KB7P 2E5TA 1S5LX 2AXTE 3HE5B 3JSVC 3H1HG 5AW9B 4PD4E 2QA4P 1T2KC 3AECC 1NOHA 1PFIA 2K1AA 5APQA 2W83C 2ZFCA 2OYHC 4Y28J 3RK3E 2WSEH 1RF1B 3IAOA 1SQVG 2QRXA 3WUVA 3VMYA 1JCCA 1L0LE 2P2UA 3F5HA 5APTA 5C39A 3VN0A 3B5ND 3GLMA 1YHQP 1BE3G 2V7QJ 1H88A 1HJBA 1RH5B 3HE4A 5AW1B 3D70A 1J1DC 1SFCB 1X9VA 4H0LB 5GTIH 1VDFA 5KAIH 3CI9A 2FYUG 4WY4B 3K5BA 3II6A 2LR2A 4BWNA 3WMM0 2WQYC 1FS0E 1PGJA 3I5CA 2WSFH 4DJGA 1ZLLA 5DJUB 3EFGA 1FU1A 1BE3J 3A2AA 4WVZA 4Y99B 5AW0B 2G8YA 3AEBC 5BVZA 3RK2C 1EC5A 2N1TC 3D71A 1W2BO 1NTZJ 2FKWB 3L75E 4IFDK 4ZKUA 1GL2B 5KJ7D 5AVXB 5CCGC 1T2KD 1EXIA 1BSNA 3AE6C 2YMKA 3JC22 3GF3A 1QEXA 1FZEA 1OFCX 1YTZI 2Y9ZA 3MIWA 1M1JA 3L73E 1L0LJ 2BCCD 1L4AA 1PIXA 1IFPA 2L91A 3GW6A 2IX7C 4BRYA 1Q82Q 2OYIC 1R5LA 2KS1A 2MJZA 1NTZK 3FX0A 1N7LA 3LW5J 4IFFA 3HUSB 2FXOA 4Z1MH 1FDIA 2Z5HA 2C0XA 3TYYA 2E74C 3KPEA 3MUDA 1KC8Q 1AJYA 1M56D 2M3BA 3GG2A 4N3YB 2FFDC 1BE3D 3L4FA 1Y9BA 3CXHI 3P8MC 4I7ZB 2IPPA 1J2JB 1QL2A 4W80A 1UIIA 1ZV8A 1L0ND 3IR9A 4GT1A 4R4MA 5TJHA 1ZW0A 1PL5A 3TGUE 3SFDC 1BDCA 3H1HE 4HH2A 2JEEA 3WU2E 1K9MQ 3ZDMA 1GW3A 1OMIA 1SQPG 3BRVB 3H1JJ 1WT6A 1LTJB 4YTPC 3H1KE 2FYNC 2JWAA 2GM4A 1BSHA 2N9BA 1VQ5P 4IL6X 1YTZT 1MZ9A 2M0BA 3S9OA 1EZVD 3AE1C 3L71E 1U7MA 2ZXEB 3TNUB 1M8OB 1LT1A 1GK4A 1SQXG 3M0AA 5KAIE 1EDJA 5CBNA 2Q7CA 2ZYGA 3L74E 1BCCE 2PRRA 4GKGA 2A06G 1FE6A 1L0LK 1LTAC 4D6TG 3BCCD 3B5NB 3RL0B 1MFTA 1PP9E 2KUBA 2ITAA 2O1JA 2UWJE 2YMYA 3BCCJ 4OGQD 5APYA 5AW6B 3V5BA 4OWFA 1FZGA 1BE3E 1KV4A 3AE2C 1S4XA 5E79H 5KLVG 3CXHH 1FZCB 1FJKA 1RE3A 2WVRA 2OYOA 4UB6E 1SQXJ 2N1TA 1GD2E 1NTMJ 1KILA 1KB9I 2HODA 2YNYA 4U3FJ 1P84I 2YKQA 3HE5A 1NJIQ 1VQNP 1K04A 2E42A 2IZ0A 2KNCA 3H1LJ 3L75D 4XFJA 3RBXA 5CCHC 1L0NJ 1JTHA 4L74A 2QJYC 1RQVA 1N73A 5AVRB 1JY2O 1NTMG 3L74G 1SQVJ 3KZIH 3RK3B 1KN7A 1VPCA 4RO0A 3LIDA 2OTJP 1NKZB 4U3FD 1BGYG 1AVYA 1D7MA 4C46A 3CCSP 2FXMA 1L0LD 2BCCJ 2Y0CA 3CD6P 2NPSA 1USEA 3S1KA 3U1AA 4EYYQ 2JKVA 3RK3D 2ZT9C 3V6IA 1KQSO 3TGUG 3QH9A 4IL6E 3BATA 1PPJG 5DJTB 3GMAA
chains in the Genus database with same CATH topology
1AQ5A 3HRNA 2HPCB 5APUA 3OJAB 1A02J 1LTGC 4XE5B 2HYNA 5APXA 1SQQK 1NHLA 1IFNA 3KDPB 2WTYA 2H8PD 5CHXA 1FDMA 3VMXA 2P7JA 2FFDC 2WPSA 4B86A 1IO4A 1G2CA 3EQ2A 1JY3P 1IFMA 3NTNA 2LKMA 1Z56A 5AVUB 5AVVB 3KQGA 2QM7A 1NU1K 1L4AD 2W6BA 1N7SA 1SQVK 5CCGA 5KTBA 3TSIA 3UIAA 1LTIC 1SQBK 1AFOA 2O01H 1HBWA 2XDJA 5CJ0A 3M9HA 2OYIA 3RK3C 2HPCA 3BASA 1IFJA 3U1CA 1X79B 3G3ZA 5KJ7A 3HD7C 1SLQA 3A5TA 2JJLA 1URQC 3L37A 1LT9C 1QL1A 1W2EA 1NAFA 2W27A 5AW3B 1CI6A 1SFCD 3LW5H 1LTSC 1M1JB 1RF0C 2XKMA 5AW7B 5AW5B 1T3UA 3NXSA 5BU5A 5APWA 5CCHA 2OYHB 2E43A 1DX7A 4LC1A 3V4WA 2C9LY 3OAKA 1XTGB 3C9IA 1FAVA 3VTPC 3N7NA 3GHGC 2H43A 2YKOA 1CSBA 1LTJC 3B5NA 5AVYB 1JUNA 3V2PA 3VYIA 1OXZA 3NMDA 3PP5A 5AW2B 3M06A 1GDTA 1JY2P 1N7SB 3T97A 1HTLC 3NFQA 2P67A 1IC2A 3HTKA 4EOTA 1HGZA 1KILB 4LGDE 2OYIB 5AVTB 1YYCA 1LWUB 1HGVA 2R5BA 1KILD 1ZN5A 2C9NY 1URQD 1LGHB 1T8ZA 1NKNA 1URQA 3LIEA 2HLOA 2HFED 2XZRA 4LLHA 2FYZA 2I1JA 4N78E 3CLQA 4C7RA 2I1KA 2N1TD 1LT9B 2KYVA 1N73B 5CCHD 3P32A 3GHGA 4ZKPA 2HG5D 2FYUK 2R5DA 4C7NA 1FZCA 3HTKB 3H32B 1HUCA 1EQ7A 4OH8B 3HUSA 3M0DA 5BU8B 1FBMA 3E1IA 5CMZA 4WB4A 1GL2C 4W7ZA 2XV5A 2KP8A 5AW4B 2WT7A 1N7SD 2O1KA 1RY3A 4JF7A 3SWYA 2WZ7A 1G2CB 3RK2D 4DOJA 1KQLA 3TK1A 2XNXA 4I2LC 1LWUA 1XTCC 5CCGD 2VRSA 4N78D 2M8RA 4Y99C 3RK2B 4I6MC 4C7NB 3BRTB 1GU5A 1E5WA 1J1DB 3VMZA 2P1JA 1KFNA 4WY4C 5AVSB 1GZLA 4RESB 1G1IA 4DZOA 1JMMA 3U59A 1KILC 2BASA 1MV8A 1IFDA 3P8CE 1FOSE 1NO4A 1LTTC 3P8CD 2PP6A 3KYQA 1G1JA 2YO3A 3IFMA 1FZCC 1A02F 3L35A 3MTUE 2WT7B 1JTHB 2A45I 1SQXK 3A3YB 3HD7D 1X8YA 1NTKK 2YKPA 5AVZB 4GIFA 1ZR2A 3SWFA 1LTJA 1SVFA 2WWWA 3VOPA 3CL3D 1S9KE 3VP8A 3HD7B 4XA4A 3VP9A 1GTWA 1J1EB 2Q9IA 3V2RA 1FZFA 4AQRD 4WY4D 2Z5IA 4WY4A 1JOCA 2KLVA 1LTBC 5CJ4A 1L0NK 1MFZA 2A45G 1RE4A 1SQPK 1FZAA 2WPQA 3M0DC 1RF1C 2GUVA 3N4XA 1GU4A 2Q5UA 4O9BA 1SFCA 1N7SC 4W7YA 1FJPA 1JCDA 5APSA 1CZQA 2IFNA 5AVWB 1DEBA 2XU6A 3R2PA 2WITA 4AUWA 4HYTB 1HH0A 1IJDB 1ZR4A 2R32A 1IK9A 3HD7A 1GW4A 1LT9A 3HUSC 2NPSC 2W6AA 3OA7A 3MD0A 1URQB 1RF0A 2GUSA 3V2NA 2WSCH 1M1JC 1T3JA 3H32A 1L4AC 4M3LA 2R3CA 5AW8B 3RL0D 1JY2N 4EIJA 1H89A 1HVVA 4IFMA 3BVHA 4JYCA 1LWUC 3V4QA 2KOGA 1OWAA 3P7KA 5APVA 1IFIA 1JY3N 1N2DC 1JY3O 3V2QA 2J58A 1RF1A 3GHGB 3M9QA 2C0WA 2FFDA 1GK6A 1WRGA 3RL0C 2Z4EA 1SFCC 1JO5A 1NH4A 1CW5A 4JYBA 2HODB 1CI6B 1S9KD 1MUUA 2POHA 2J59M 2IFMA 2OYHA 2YO2A 3M9BA 4KHXA 2H7HA 1RE3C 3HE4B 1RE4C 3L36A 3MGNA 2FFDB 2KSJA 5KJ7C 2N1TB 2A45H 2PAJA 2L5GB 2CPBA 3H6PA 4N6JA 4AYCA 1N73C 2Q3IA 2NPSD 5AVQB 1GL2D 3A7OA 3M91A 1H8AA 1KFMA 3O8ZA 1N86A 2CPSA 2WPRA 5KLVK 3B8EB 3TNUA 1FOSF 1DH3A 2OARA 2NPSB 2QM8A 1M7LA 1GL2A 4I1LA 3B5NC 1SP4A 1L4AB 1J1EC 4WBAA 1FZBA 1NTMK 1NWQA 1JNMA 1KZUB 2KB7P 3HE5B 5AW9B 1PFIA 1T2KC 1NOHA 5APQA 2ZFCA 2OYHC 2WSEH 1RF1B 3VMYA 1JCCA 2P2UA 5APTA 3VN0A 3B5ND 1HJBA 1H88A 3HE4A 5AW1B 1J1DC 1SFCB 1X9VA 1VDFA 3CI9A 4WY4B 3II6A 3WMM0 3I5CA 2WSFH 1ZLLA 3EFGA 1FU1A 4Y99B 3A2AA 5AW0B 5BVZA 3RK2C 2N1TC 2FKWB 4IFDK 4ZKUA 1GL2B 5KJ7D 5AVXB 5CCGC 1T2KD 1FZEA 1YTZI 3MIWA 1M1JA 1L4AA 2IX7C 2OYIC 1HWTC 2MJZA 1NTZK 1N7LA 4IFFA 3HUSB 3TYYA 2Z5HA 2C0XA 3KPEA 3MUDA 2M3BA 4N3YB 3L4FA 3P8MC 4W80A 2IPPA 1J2JB 1QL2A 1ZV8A 4GT1A 3IR9A 4HH2A 2JEEA 1GW3A 3BRVB 2GM4A 1WT6A 1LTJB 2N9BA 1YTZT 1MZ9A 2ZXEB 3TNUB 1GK4A 3M0AA 2Q7CA 4GKGA 1L0LK 1LTAC 3B5NB 3RL0B 2O1JA 2YMYA 5APYA 1FZGA 5AW6B 3V5BA 1FZCB 1FJKA 1RE3A 2N1TA 1GD2E 1KILA 2HODA 2YNYA 2YKQA 3HE5A 2E42A 5CCHC 1JTHA 1N73A 5AVRB 1JY2O 3RK3B 1VPCA 3LIDA 1NKZB 4C46A 2FXMA 2NPSA 3U1AA 3RK3D 3BATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1T D;  1SFC A;  1N7S C;  4W7Y A;  5CCH D;  2HG5 D;  1NHL A;  3HTK B;  3B5N D;  2H8P D;  4OH8 B;  1SFC B;  3HD7 A;  4WY4 B;  1GL2 C;  4W7Z A;  2NPS C;  1N7S D;  4JF7 A;  1URQ B;  2WZ7 A;  3RK2 D;  3RK2 C;  2N1T C;  1T3J A;  1GL2 B;  5KJ7 D;  1L4A C;  5CCG C;  3RL0 D;  1L4A D;  5CCG D;  1HVV A;  1N7S A;  2M8R A;  1L4A A;  5CCG A;  3TSI A;  3RK2 B;  2KOG A;  2XDJ A;  3RK3 C;  4WY4 C;  4W80 A;  5KJ7 A;  3HD7 C;  1URQ C;  1KIL C;  3RL0 C;  1SFC C;  1SFC D;  3P8C E;  2PP6 A;  5CCH A;  3KYQ A;  1XTG B;  1JTH B;  3B5N B;  3RL0 B;  2YMY A;  3HD7 D;  3B5N A;  5KJ7 C;  2N1T B;  2N1T A;  3PP5 A;  3VOP A;  1KIL A;  3HD7 B;  1N7S B;  2NPS D;  1KIL B;  5CCH C;  1GL2 D;  4LGD E;  1JTH A;  4WY4 D;  3RK3 B;  4WY4 A;  2NPS B;  1KIL D;  1URQ D;  1URQ A;  1GL2 A;  2HFE D;  2NPS A;  3M0D C;  3B5N C;  3RK3 D;  1L4A B;  4N78 E; 
#chains in the Genus database with same CATH topology
 1AQ5 A;  4YXD C;  3HRN A;  2HPC B;  5APU A;  2M5A A;  2ZT9 D;  1ZRT D;  1BGY J;  3F89 A;  1NYH A;  3OJA B;  2WSS H;  1A02 J;  2B88 A;  2IYP A;  1LTG C;  4XE5 B;  2HYN A;  5APX A;  3G9R A;  5E79 E;  3SWK A;  1UIX A;  3FWN A;  1VF5 B;  1SQQ K;  1EDK A;  2E75 C;  1NHL A;  1IFN A;  1QVG O;  2RMZ A;  3KDP B;  2GA1 A;  2WTY A;  3PLN A;  2H8P D;  5CHX A;  1FDM A;  3VMX A;  1KYO I;  4JPZ B;  1FDO A;  1JB0 J;  1KIL E;  2E75 B;  2P7J A;  2RN0 A;  2WPS A;  3A0B E;  3L70 J;  1OX3 A;  1G2C A;  2H88 C;  2Q6Q A;  3EQ2 A;  4B86 A;  1IO4 A;  1JY3 P;  3FXE A;  1IFM A;  3NTN A;  2LKM A;  1Z56 A;  5AVU B;  1PPJ D;  5AVV B;  5M1B A;  3KQG A;  1KYO H;  2QM7 A;  1NU1 K;  1M90 Q;  1KB9 D;  3L70 G;  1BGY E;  3G4S P;  1L4A D;  1KD1 Q;  2W6B A;  1N7S A;  4D6T J;  1SQV K;  3Q2Y A;  5CCG A;  5KTB A;  4QMA A;  3TSI A;  3UIA A;  2QEX P;  1LTI C;  1SQB K;  2ZYD A;  3Q5S A;  4U7J A;  1P84 H;  2FXP A;  4UB8 H;  1AFO A;  2O01 H;  1HBW A;  3O6Q A;  2XDJ A;  5CJ0 A;  2E74 D;  3M9H A;  5B5E E;  2FY8 A;  2OYI A;  2WSF J;  3RK3 C;  4KT0 J;  3BAS A;  1IFJ A;  2KZJ A;  5TIS H;  3U1C A;  1K73 Q;  2HPC A;  1X79 B;  1HJ0 A;  1SQV E;  3G3Z A;  2BEQ D;  3MUD C;  4K3A A;  5KJ7 A;  3H1J G;  1SQX D;  3HD7 C;  1SLQ A;  4OGQ C;  1K05 A;  3USS A;  2JJL A;  1URQ C;  3L37 A;  1LT9 C;  1QL1 A;  1W2E A;  1NAF A;  2W27 A;  5K5G B;  1AA0 A;  4D6T D;  1YJ9 P;  5AW3 B;  1CI6 A;  3TGU J;  1SFC D;  2JWD A;  1LTS C;  1M1J B;  1RF0 C;  1SQB E;  2XKM A;  1SQQ E;  1U57 A;  2K9J A;  2B9B A;  2ZT9 B;  5AW5 B;  5AW7 B;  3L70 E;  4ZMD A;  3W67 A;  3IF4 A;  1T3U A;  1FC2 C;  3CMA P;  3NXS A;  5BU5 A;  3Q5P A;  5APW A;  5CCH A;  1JM0 A;  3AEG C;  2OYH B;  2E43 A;  3CWB G;  1VQO P;  1DX7 A;  2LXC B;  3CX5 I;  4LC1 A;  1DD3 A;  1KB9 H;  3OAK A;  1XTG B;  1YBK A;  3C9I A;  3V4W A;  1FAV A;  1NTK D;  2O01 N;  3VTP C;  1SQX E;  4PJ0 H;  3AE3 C;  1MKM A;  5KAF H;  3CCM P;  3N7N A;  1PGO A;  3GHG C;  2H43 A;  2YKO A;  1CSB A;  2AEM A;  2E75 D;  1LTJ C;  2KZI A;  2PGD A;  2OGU A;  3H1K G;  4CPG A;  2K9Y A;  1KYO E;  3B5N A;  5AVY B;  3Q5R A;  3JCU E;  3V2P A;  5KKZ C;  1N73 B;  1BCC D;  3AEE C;  3H1I J;  3VYI A;  3H1J D;  4H44 B;  4EIJ A;  2NZ2 A;  3A0H H;  1OXZ A;  3PTZ A;  2W6J H;  3NMD A;  3PP5 A;  3PRJ A;  1OW8 A;  2RH0 A;  1QGK B;  3M06 A;  4IOI H;  1JY2 P;  5AW2 B;  1FZC A;  1GDT A;  2IZ1 A;  2I8D A;  2O01 J;  1N7S B;  3CX5 H;  2IDB A;  3T97 A;  1HTL C;  1YI2 P;  1H0T A;  1BDD A;  1BGY D;  1P84 E;  2P67 A;  1IC2 A;  1S2E A;  3H1K J;  3NFQ A;  3HTK A;  4UB8 E;  1HGZ A;  1KIL B;  4BXL A;  3I55 P;  4EOT A;  1EZV G;  1K8A Q;  2KS1 B;  4MN4 C;  4LGD E;  1TU3 F;  2OYI B;  5AVT B;  2KXP B;  1S5L H;  1YYC A;  1NGM B;  2H89 C;  1L0N E;  4WWI A;  1Q2N A;  2KK7 A;  2W90 A;  1VQM P;  1LWU B;  1HGV A;  3B71 A;  2R5B A;  2YXQ B;  3WU2 H;  1KIL D;  1ZN5 A;  2C9N Y;  1URQ D;  1USD A;  1LGH B;  1T8Z A;  1NKN A;  1SQQ G;  1URQ A;  3LIE A;  1VQP P;  2HLO A;  1YQ4 C;  2HFE D;  2XZR A;  4LLH A;  2FYZ A;  2JP3 A;  2AXC A;  2I1J A;  2OTL P;  1X22 A;  2FYU E;  2ZVN B;  4N78 E;  1NTM E;  3CLQ A;  1VL2 A;  3RBZ A;  4C7R A;  1X0T A;  2I1K A;  1Q81 Q;  2KI7 B;  1NTZ E;  2N1T D;  1LT9 B;  1OVU A;  1KQG B;  2K3R A;  2KYV A;  1SQP J;  3AE9 C;  3L75 J;  4PJ0 E;  3MZW B;  3AEA C;  2E76 C;  1LP1 A;  3TDK A;  3L75 G;  1YIJ P;  5CCH D;  2J5U A;  2QIW A;  3P32 A;  1L0N G;  3JCU H;  3E1R A;  3KHU A;  3CXH E;  4H13 C;  1AVO A;  3GHG A;  4ZKP A;  3L73 G;  2HG5 D;  3A0H E;  4EDF A;  4UB6 H;  5CBO A;  2WPV B;  2FYU K;  2QVA A;  2R5D A;  3CX5 D;  3HTK B;  4C7N A;  3H32 B;  1HUC A;  1EQ7 A;  3CX5 E;  2K37 A;  4PV1 C;  4OH8 B;  3CPW O;  3HUS A;  1YJW P;  2PFX A;  3D6Z A;  3M0D A;  5H2F H;  1FBM A;  3E1I A;  5CMZ A;  4H44 D;  5BU8 B;  4WB4 A;  1L0L G;  1GL2 C;  1QLE D;  3L72 G;  1RQU A;  2O3J A;  4W7Z A;  2XV5 A;  2KP8 A;  5AW4 B;  3WUT A;  4PV1 D;  2WT7 A;  1N7S D;  2O1K A;  1RY3 A;  1S5L E;  4JF7 A;  3SWY A;  2WZ7 A;  1G2C B;  2OQQ A;  4GDO A;  3RK2 D;  2Q1K A;  3B4S A;  4A7P A;  4DOJ A;  3KZI E;  1KQL A;  1NVO A;  2P58 A;  3TK1 A;  1ZME C;  2XNX A;  3QWO C;  2FYN B;  1NTZ D;  4I2L C;  4L75 A;  1LWU A;  1XTC C;  1VQL P;  5CCG D;  2YXR B;  2VRS A;  2QJK C;  4N78 D;  2FYU D;  2M8R A;  2JR8 A;  4GOE A;  4GOD A;  4Y99 C;  3VMA A;  3RK2 B;  4I6M C;  3MP7 B;  2QJP B;  2HR3 A;  3OW2 O;  1QX8 A;  1S72 P;  4NPF X;  1VF5 C;  4C7N B;  3BRT B;  4IL6 H;  1GU5 A;  1E5W A;  1J1D B;  4H0L C;  2P1J A;  3VMZ A;  1KFN A;  4WY4 C;  5AVS B;  1U7J A;  4R4L A;  3RL0 D;  2QJP C;  1PP9 D;  1GZL A;  4RES B;  4NPD A;  1G1I A;  1SQP E;  3KXD A;  3BCC E;  3CWB D;  4PD4 I;  1JMM A;  2D2C B;  3T97 B;  1NU1 D;  4RKU J;  3U59 A;  4H0L D;  4DZO A;  1KIL C;  3L74 D;  4JQ0 D;  2Y0D A;  2C9L Y;  4TT3 H;  2BAS A;  1MV8 A;  3L71 G;  1IFD A;  3G6E P;  3P8C E;  1FOS E;  2IBZ G;  1NO4 A;  4L73 A;  1LTT C;  4TLF A;  2XND H;  1N8R Q;  2A06 E;  3P8C D;  3PHL A;  2PP6 A;  2Q3E A;  1OVR A;  2AEF A;  3CCU P;  3KYQ A;  2KLU A;  1G1J A;  2YO3 A;  3A0B H;  3H1J E;  3IFM A;  3TGU D;  2Y9Y A;  1FZC C;  2E5Y A;  2P10 A;  3L35 A;  3MTU E;  1KYO D;  1JTH B;  3CWB E;  2A45 I;  2WT7 B;  1SQP D;  2B87 A;  1SQX K;  2K9J B;  3A3Y B;  4ASV A;  1SQB J;  3HD7 D;  1VQ6 P;  1X8Y A;  1NTK K;  2AXT H;  2YKP A;  5AVZ B;  1PZQ A;  1QVF O;  1PP9 G;  4GIF A;  3AE7 C;  1ZR2 A;  3SWF A;  1LTJ A;  2WSC J;  1SVF A;  2WWW A;  3VOP A;  3CL3 D;  3AE4 C;  1S9K E;  2RKL A;  3L73 D;  3HD7 B;  2M3E A;  3VP8 A;  1Q86 Q;  4NPE A;  1EXJ A;  2IYO A;  4XA4 A;  3VP9 A;  2SPZ A;  5B5E H;  1GTW A;  4OVN F;  1DD4 A;  1OW7 A;  1J1E B;  3FWL A;  5TIS E;  5L8R J;  3Q3D A;  2Q9I A;  1Y8A A;  2WMM A;  3V2R A;  1FZF A;  1VQ4 P;  2IBZ I;  2K88 A;  4AQR D;  1OZH A;  2QJK B;  4WY4 D;  3CCQ P;  4DT0 A;  4EI2 A;  1SQV D;  3CC4 P;  2Z5I A;  4WY4 A;  2R3S A;  2JO1 A;  2N9Y B;  1JOC A;  2KLV A;  1LTB C;  5CJ4 A;  2R44 A;  4H13 D;  1L0N K;  1IZN B;  1MFZ A;  2A45 G;  1RE4 A;  1SQP K;  4GOF A;  1EDL A;  4OGQ B;  2D2C D;  3CC2 P;  3I56 P;  1FZA A;  2WPQ A;  3M0D C;  2G3A A;  1RF1 C;  4DCK A;  3CXH D;  2GUV A;  3S4R A;  4PD4 D;  3C8V A;  1S1C X;  3N4X A;  3AE8 C;  1KB9 E;  1SQQ J;  2Q5U A;  3ITK A;  1YIT P;  2QSI A;  1GU4 A;  3H1L D;  1VQ8 P;  4O9B A;  3TF5 A;  1SFC A;  2YIU B;  1GMJ A;  1N7S C;  3IN6 A;  1PPJ E;  5KAF E;  4W7Y A;  4ASW A;  3CCL P;  3CCV P;  3AEF C;  1FJP A;  3L72 D;  1ZP0 C;  1H0T B;  1JCD A;  1NTM D;  5APS A;  1KTM A;  2E74 B;  1CZQ A;  1LP1 B;  2IFN A;  1OIP A;  1DEB A;  2XU6 A;  3L72 J;  3R2P A;  5AVW B;  3RL0 g;  3G71 P;  2ZAE B;  2WIT A;  4AUW A;  2W8Z A;  1HH0 A;  1M57 D;  1NTZ G;  2QE7 H;  1IJD B;  3FGA D;  4HYT B;  1ZR4 A;  1YJN P;  2R32 A;  1IK9 A;  3L74 J;  3HD7 A;  1GW4 A;  4H44 C;  1NU1 J;  1HWT C;  4BRY B;  1LT9 A;  3H1I E;  2E76 B;  2NPS C;  2W6A A;  2ZXX A;  2BEZ F;  3HUS C;  3MD0 A;  3OA7 A;  1R8E A;  1M1K Q;  1VQ9 P;  1R5S A;  3L72 E;  1URQ B;  1PV3 A;  2FYU J;  3CCJ P;  1RF0 A;  2GUS A;  2WSE J;  3V2N A;  1ZOY C;  4I7Z C;  2WSC H;  5KLI B;  1M1J C;  1T3J A;  3ABV C;  3H32 A;  1L4A C;  5B66 H;  4M3L A;  2R3C A;  4HB1 A;  1P84 D;  1JY2 N;  1SQB G;  2CK3 H;  1LNQ A;  1HVV A;  5AW8 B;  1OW6 A;  2E76 D;  2V4H A;  4IFM A;  1H89 A;  3BVH A;  1NU1 G;  2OTK E;  4JYC A;  1LWU C;  3V4Q A;  2QJY B;  5EFW B;  2MKV A;  2KOG A;  3WUU A;  1OWA A;  2B89 A;  3P7K A;  1Q7Y Q;  1VQK P;  5APV A;  1IFI A;  5KLV J;  1VF5 D;  1JY3 N;  2ZJS E;  4H13 B;  2IBZ D;  1N2D C;  2QG4 A;  1JY3 O;  4U3F E;  3V2Q A;  1AQT A;  2J58 A;  1RF1 A;  3GHG B;  5KLV D;  1IK7 A;  1JEK A;  3M9Q A;  1E79 H;  2C0W A;  3L73 J;  1KMI Z;  1OVV A;  1NTK E;  1YQ3 C;  1GK6 A;  2BCC G;  1DEE G;  2FFD A;  1WRG A;  1EDI A;  3RL0 C;  3FXD A;  2Z4E A;  2AEJ A;  1SFC C;  2FBW C;  1JO5 A;  1JUN A;  3A5T A;  1DIP A;  3L70 D;  1NH4 A;  4YPC A;  1AV1 A;  1SQQ D;  4JYB A;  1CW5 A;  1SQB D;  2HOD B;  1BCC G;  1CI6 B;  2KSE A;  4HJG H;  1S9K D;  1RHZ B;  4RJT A;  3GF7 A;  3PH0 A;  5H2F E;  4D6T E;  3H25 A;  1Q90 D;  1MUU A;  1KQF B;  2V7Q H;  3R4Y A;  3SSU A;  2POH A;  3H1I G;  2J59 M;  3AE5 C;  5GTH H;  3PJS K;  4YXW H;  2IFM A;  3E7K A;  2OYH A;  2YO2 A;  3M9B A;  4U3F G;  2Y0E A;  4ZNC A;  5KLV E;  3H1L G;  4KHX A;  2H7H A;  1RE3 C;  3HE4 B;  3RGU A;  2IBZ E;  1S3J A;  2B87 B;  4PD4 H;  2LXB A;  1RE4 C;  2JDI H;  3C1L A;  3L36 A;  3MGN A;  5B66 E;  1PGQ A;  3CME P;  2FFD B;  2KSJ A;  1W5C E;  5KJ7 C;  2N1T B;  2A45 H;  1LJ2 A;  2PAJ A;  2YIU C;  3CWB J;  4KJM A;  2L5G B;  1L2P A;  2A06 D;  1EZV E;  1ZXG A;  2KNC B;  3L71 D;  1WMK A;  2CPB A;  3BCC G;  4HKZ H;  4JBZ A;  1HF9 A;  5GTI E;  3SFE C;  3W68 A;  3H6P A;  4N6J A;  4AYC A;  1N73 C;  2Q3I A;  2NPS D;  1JMB A;  2DW3 A;  3H1K D;  5AVQ B;  1GL2 D;  1NAY A;  3A7O A;  3M91 A;  1H8A A;  1T6A A;  3H1H D;  1PGP A;  4L76 A;  1PP9 J;  1KFM A;  5KLI C;  3O8Z A;  1N86 A;  1NU1 E;  3D6Y A;  2CPS A;  2WPR A;  3AED C;  1NTK G;  3EFF K;  3B8E B;  1BCC J;  3EWK A;  3H1I D;  3TNU A;  5KLV K;  1FOS F;  1SS1 A;  1DH3 A;  2KIK A;  2OAR A;  2NPS B;  3Q1M A;  2ZVO B;  3CC7 P;  3MHV A;  1A02 F;  2QM8 A;  1KOR A;  5KKZ B;  1M7L A;  1GL2 A;  2NRG A;  3O6Q B;  4I1L A;  2D2C C;  4K35 A;  4PV1 B;  3CCR P;  1NTK J;  3B5N C;  1SP4 A;  1Y47 A;  2BCC E;  1L4A B;  3L71 J;  1J1E C;  4WBA A;  3H1H J;  3CCE P;  1EZV I;  1FZB A;  1NTM K;  1NWQ A;  1JNM A;  5GTH E;  2M5A B;  1ZRT E;  1VQ7 P;  2ZYA A;  3LW5 H;  1KZU B;  3H1L E;  2KB7 P;  2E5T A;  1S5L X;  2AXT E;  3HE5 B;  3JSV C;  3H1H G;  5AW9 B;  4PD4 E;  2QA4 P;  1T2K C;  3AEC C;  1NOH A;  1PFI A;  2K1A A;  5APQ A;  2W83 C;  2ZFC A;  2OYH C;  4Y28 J;  3RK3 E;  2WSE H;  1RF1 B;  3IAO A;  1SQV G;  2QRX A;  3WUV A;  3VMY A;  1JCC A;  1L0L E;  2P2U A;  3F5H A;  5APT A;  5C39 A;  3VN0 A;  3B5N D;  3GLM A;  1YHQ P;  1BE3 G;  2V7Q J;  1H88 A;  1HJB A;  1RH5 B;  3HE4 A;  5AW1 B;  3D70 A;  1J1D C;  1SFC B;  1X9V A;  4H0L B;  5GTI H;  1VDF A;  5KAI H;  3CI9 A;  2FYU G;  4WY4 B;  3K5B A;  3II6 A;  2LR2 A;  4BWN A;  3WMM 0;  2WQY C;  1FS0 E;  1PGJ A;  3I5C A;  2WSF H;  4DJG A;  1ZLL A;  5DJU B;  3EFG A;  1FU1 A;  1BE3 J;  3A2A A;  4WVZ A;  4Y99 B;  5AW0 B;  2G8Y A;  3AEB C;  5BVZ A;  3RK2 C;  1EC5 A;  2N1T C;  3D71 A;  1W2B O;  1NTZ J;  2FKW B;  3L75 E;  4IFD K;  4ZKU A;  1GL2 B;  5KJ7 D;  5AVX B;  5CCG C;  1T2K D;  1EXI A;  1BSN A;  3AE6 C;  2YMK A;  3JC2 2;  3GF3 A;  1QEX A;  1FZE A;  1OFC X;  1YTZ I;  2Y9Z A;  3MIW A;  1M1J A;  3L73 E;  1L0L J;  2BCC D;  1L4A A;  1PIX A;  1IFP A;  2L91 A;  3GW6 A;  2IX7 C;  4BRY A;  1Q82 Q;  2OYI C;  1R5L A;  2KS1 A;  2MJZ A;  1NTZ K;  3FX0 A;  1N7L A;  3LW5 J;  4IFF A;  3HUS B;  2FXO A;  4Z1M H;  1FDI A;  2Z5H A;  2C0X A;  3TYY A;  2E74 C;  3KPE A;  3MUD A;  1KC8 Q;  1AJY A;  1M56 D;  2M3B A;  3GG2 A;  4N3Y B;  2FFD C;  1BE3 D;  3L4F A;  1Y9B A;  3CXH I;  3P8M C;  4I7Z B;  2IPP A;  1J2J B;  1QL2 A;  4W80 A;  1UII A;  1ZV8 A;  1L0N D;  3IR9 A;  4GT1 A;  4R4M A;  5TJH A;  1ZW0 A;  1PL5 A;  3TGU E;  3SFD C;  1BDC A;  3H1H E;  4HH2 A;  2JEE A;  3WU2 E;  1K9M Q;  3ZDM A;  1GW3 A;  1OMI A;  1SQP G;  3BRV B;  3H1J J;  1WT6 A;  1LTJ B;  4YTP C;  3H1K E;  2FYN C;  2JWA A;  2GM4 A;  1BSH A;  2N9B A;  1VQ5 P;  4IL6 X;  1YTZ T;  1MZ9 A;  2M0B A;  3S9O A;  1EZV D;  3AE1 C;  3L71 E;  1U7M A;  2ZXE B;  3TNU B;  1M8O B;  1LT1 A;  1GK4 A;  1SQX G;  3M0A A;  5KAI E;  1EDJ A;  5CBN A;  2Q7C A;  2ZYG A;  3L74 E;  1BCC E;  2PRR A;  4GKG A;  2A06 G;  1FE6 A;  1L0L K;  1LTA C;  4D6T G;  3BCC D;  3B5N B;  3RL0 B;  1MFT A;  1PP9 E;  2KUB A;  2ITA A;  2O1J A;  2UWJ E;  2YMY A;  3BCC J;  4OGQ D;  5APY A;  5AW6 B;  3V5B A;  4OWF A;  1FZG A;  1BE3 E;  1KV4 A;  3AE2 C;  1S4X A;  5E79 H;  5KLV G;  3CXH H;  1FZC B;  1FJK A;  1RE3 A;  2WVR A;  2OYO A;  4UB6 E;  1SQX J;  2N1T A;  1GD2 E;  1NTM J;  1KIL A;  1KB9 I;  2HOD A;  2YNY A;  4U3F J;  1P84 I;  2YKQ A;  3HE5 A;  1NJI Q;  1VQN P;  1K04 A;  2E42 A;  2IZ0 A;  2KNC A;  3H1L J;  3L75 D;  4XFJ A;  3RBX A;  5CCH C;  1L0N J;  1JTH A;  4L74 A;  2QJY C;  1RQV A;  1N73 A;  5AVR B;  1JY2 O;  1NTM G;  3L74 G;  1SQV J;  3KZI H;  3RK3 B;  1KN7 A;  1VPC A;  4RO0 A;  3LID A;  2OTJ P;  1NKZ B;  4U3F D;  1BGY G;  1AVY A;  1D7M A;  4C46 A;  3CCS P;  2FXM A;  1L0L D;  2BCC J;  2Y0C A;  3CD6 P;  2NPS A;  1USE A;  3S1K A;  3U1A A;  4EYY Q;  2JKV A;  3RK3 D;  2ZT9 C;  3V6I A;  1KQS O;  3TGU G;  3QH9 A;  4IL6 E;  3BAT A;  1PPJ G;  5DJT B;  3GMA A; 
#chains in the Genus database with same CATH homology
 1AQ5 A;  3HRN A;  2HPC B;  5APU A;  3OJA B;  1A02 J;  1LTG C;  4XE5 B;  2HYN A;  5APX A;  1SQQ K;  1NHL A;  1IFN A;  3KDP B;  2WTY A;  2H8P D;  5CHX A;  1FDM A;  3VMX A;  2P7J A;  2FFD C;  2WPS A;  4B86 A;  1IO4 A;  1G2C A;  3EQ2 A;  1JY3 P;  1IFM A;  3NTN A;  2LKM A;  1Z56 A;  5AVU B;  5AVV B;  3KQG A;  2QM7 A;  1NU1 K;  1L4A D;  2W6B A;  1N7S A;  1SQV K;  5CCG A;  5KTB A;  3TSI A;  3UIA A;  1LTI C;  1SQB K;  1AFO A;  2O01 H;  1HBW A;  2XDJ A;  5CJ0 A;  3M9H A;  2OYI A;  3RK3 C;  2HPC A;  3BAS A;  1IFJ A;  3U1C A;  1X79 B;  3G3Z A;  5KJ7 A;  3HD7 C;  1SLQ A;  3A5T A;  2JJL A;  1URQ C;  3L37 A;  1LT9 C;  1QL1 A;  1W2E A;  1NAF A;  2W27 A;  5AW3 B;  1CI6 A;  1SFC D;  3LW5 H;  1LTS C;  1M1J B;  1RF0 C;  2XKM A;  5AW7 B;  5AW5 B;  1T3U A;  3NXS A;  5BU5 A;  5APW A;  5CCH A;  2OYH B;  2E43 A;  1DX7 A;  4LC1 A;  3V4W A;  2C9L Y;  3OAK A;  1XTG B;  3C9I A;  1FAV A;  3VTP C;  3N7N A;  3GHG C;  2H43 A;  2YKO A;  1CSB A;  1LTJ C;  3B5N A;  5AVY B;  1JUN A;  3V2P A;  3VYI A;  1OXZ A;  3NMD A;  3PP5 A;  5AW2 B;  3M06 A;  1GDT A;  1JY2 P;  1N7S B;  3T97 A;  1HTL C;  3NFQ A;  2P67 A;  1IC2 A;  3HTK A;  4EOT A;  1HGZ A;  1KIL B;  4LGD E;  2OYI B;  5AVT B;  1YYC A;  1LWU B;  1HGV A;  2R5B A;  1KIL D;  1ZN5 A;  2C9N Y;  1URQ D;  1LGH B;  1T8Z A;  1NKN A;  1URQ A;  3LIE A;  2HLO A;  2HFE D;  2XZR A;  4LLH A;  2FYZ A;  2I1J A;  4N78 E;  3CLQ A;  4C7R A;  2I1K A;  2N1T D;  1LT9 B;  2KYV A;  1N73 B;  5CCH D;  3P32 A;  3GHG A;  4ZKP A;  2HG5 D;  2FYU K;  2R5D A;  4C7N A;  1FZC A;  3HTK B;  3H32 B;  1HUC A;  1EQ7 A;  4OH8 B;  3HUS A;  3M0D A;  5BU8 B;  1FBM A;  3E1I A;  5CMZ A;  4WB4 A;  1GL2 C;  4W7Z A;  2XV5 A;  2KP8 A;  5AW4 B;  2WT7 A;  1N7S D;  2O1K A;  1RY3 A;  4JF7 A;  3SWY A;  2WZ7 A;  1G2C B;  3RK2 D;  4DOJ A;  1KQL A;  3TK1 A;  2XNX A;  4I2L C;  1LWU A;  1XTC C;  5CCG D;  2VRS A;  4N78 D;  2M8R A;  4Y99 C;  3RK2 B;  4I6M C;  4C7N B;  3BRT B;  1GU5 A;  1E5W A;  1J1D B;  3VMZ A;  2P1J A;  1KFN A;  4WY4 C;  5AVS B;  1GZL A;  4RES B;  1G1I A;  4DZO A;  1JMM A;  3U59 A;  1KIL C;  2BAS A;  1MV8 A;  1IFD A;  3P8C E;  1FOS E;  1NO4 A;  1LTT C;  3P8C D;  2PP6 A;  3KYQ A;  1G1J A;  2YO3 A;  3IFM A;  1FZC C;  1A02 F;  3L35 A;  3MTU E;  2WT7 B;  1JTH B;  2A45 I;  1SQX K;  3A3Y B;  3HD7 D;  1X8Y A;  1NTK K;  2YKP A;  5AVZ B;  4GIF A;  1ZR2 A;  3SWF A;  1LTJ A;  1SVF A;  2WWW A;  3VOP A;  3CL3 D;  1S9K E;  3VP8 A;  3HD7 B;  4XA4 A;  3VP9 A;  1GTW A;  1J1E B;  2Q9I A;  3V2R A;  1FZF A;  4AQR D;  4WY4 D;  2Z5I A;  4WY4 A;  1JOC A;  2KLV A;  1LTB C;  5CJ4 A;  1L0N K;  1MFZ A;  2A45 G;  1RE4 A;  1SQP K;  1FZA A;  2WPQ A;  3M0D C;  1RF1 C;  2GUV A;  3N4X A;  1GU4 A;  2Q5U A;  4O9B A;  1SFC A;  1N7S C;  4W7Y A;  1FJP A;  1JCD A;  5APS A;  1CZQ A;  2IFN A;  5AVW B;  1DEB A;  2XU6 A;  3R2P A;  2WIT A;  4AUW A;  4HYT B;  1HH0 A;  1IJD B;  1ZR4 A;  2R32 A;  1IK9 A;  3HD7 A;  1GW4 A;  1LT9 A;  3HUS C;  2NPS C;  2W6A A;  3OA7 A;  3MD0 A;  1URQ B;  1RF0 A;  2GUS A;  3V2N A;  2WSC H;  1M1J C;  1T3J A;  3H32 A;  1L4A C;  4M3L A;  2R3C A;  5AW8 B;  3RL0 D;  1JY2 N;  4EIJ A;  1H89 A;  1HVV A;  4IFM A;  3BVH A;  4JYC A;  1LWU C;  3V4Q A;  2KOG A;  1OWA A;  3P7K A;  5APV A;  1IFI A;  1JY3 N;  1N2D C;  1JY3 O;  3V2Q A;  2J58 A;  1RF1 A;  3GHG B;  3M9Q A;  2C0W A;  2FFD A;  1GK6 A;  1WRG A;  3RL0 C;  2Z4E A;  1SFC C;  1JO5 A;  1NH4 A;  1CW5 A;  4JYB A;  2HOD B;  1CI6 B;  1S9K D;  1MUU A;  2POH A;  2J59 M;  2IFM A;  2OYH A;  2YO2 A;  3M9B A;  4KHX A;  2H7H A;  1RE3 C;  3HE4 B;  1RE4 C;  3L36 A;  3MGN A;  2FFD B;  2KSJ A;  5KJ7 C;  2N1T B;  2A45 H;  2PAJ A;  2L5G B;  2CPB A;  3H6P A;  4N6J A;  4AYC A;  1N73 C;  2Q3I A;  2NPS D;  5AVQ B;  1GL2 D;  3A7O A;  3M91 A;  1H8A A;  1KFM A;  3O8Z A;  1N86 A;  2CPS A;  2WPR A;  5KLV K;  3B8E B;  3TNU A;  1FOS F;  1DH3 A;  2OAR A;  2NPS B;  2QM8 A;  1M7L A;  1GL2 A;  4I1L A;  3B5N C;  1SP4 A;  1L4A B;  1J1E C;  4WBA A;  1FZB A;  1NTM K;  1NWQ A;  1JNM A;  1KZU B;  2KB7 P;  3HE5 B;  5AW9 B;  1PFI A;  1T2K C;  1NOH A;  5APQ A;  2ZFC A;  2OYH C;  2WSE H;  1RF1 B;  3VMY A;  1JCC A;  2P2U A;  5APT A;  3VN0 A;  3B5N D;  1HJB A;  1H88 A;  3HE4 A;  5AW1 B;  1J1D C;  1SFC B;  1X9V A;  1VDF A;  3CI9 A;  4WY4 B;  3II6 A;  3WMM 0;  3I5C A;  2WSF H;  1ZLL A;  3EFG A;  1FU1 A;  4Y99 B;  3A2A A;  5AW0 B;  5BVZ A;  3RK2 C;  2N1T C;  2FKW B;  4IFD K;  4ZKU A;  1GL2 B;  5KJ7 D;  5AVX B;  5CCG C;  1T2K D;  1FZE A;  1YTZ I;  3MIW A;  1M1J A;  1L4A A;  2IX7 C;  2OYI C;  1HWT C;  2MJZ A;  1NTZ K;  1N7L A;  4IFF A;  3HUS B;  3TYY A;  2Z5H A;  2C0X A;  3KPE A;  3MUD A;  2M3B A;  4N3Y B;  3L4F A;  3P8M C;  4W80 A;  2IPP A;  1J2J B;  1QL2 A;  1ZV8 A;  4GT1 A;  3IR9 A;  4HH2 A;  2JEE A;  1GW3 A;  3BRV B;  2GM4 A;  1WT6 A;  1LTJ B;  2N9B A;  1YTZ T;  1MZ9 A;  2ZXE B;  3TNU B;  1GK4 A;  3M0A A;  2Q7C A;  4GKG A;  1L0L K;  1LTA C;  3B5N B;  3RL0 B;  2O1J A;  2YMY A;  5APY A;  1FZG A;  5AW6 B;  3V5B A;  1FZC B;  1FJK A;  1RE3 A;  2N1T A;  1GD2 E;  1KIL A;  2HOD A;  2YNY A;  2YKQ A;  3HE5 A;  2E42 A;  5CCH C;  1JTH A;  1N73 A;  5AVR B;  1JY2 O;  3RK3 B;  1VPC A;  3LID A;  1NKZ B;  4C46 A;  2FXM A;  2NPS A;  3U1A A;  3RK3 D;  3BAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...