4WY4B

Crystal structure of autophagic snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
ESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4B00
1KILD 3KYQA 1GL2B 4W7YA 3RK3B 2NPSA 4W80A 4WY4D 3PP5A 2WZ7A 3VOPA 5CCGA 1GL2C 4N78E 1SFCC 1L4AB 3HTKB 1GL2D 4OH8B 4LGDE 3HD7C 1N7SA 3RK3D 1L4AC 1T3JA 1JTHA 5KJ7A 2N1TD 1NHLA 1SFCB 3RK2C 4JF7A 1HVVA 2YMYA 5CCHA 1URQA 5CCGC 3HD7B 3B5NB 1KILA 1SFCD 2PP6A 3B5NC 4WY4A 3HD7D 3RK2B 2NPSB 1L4AD 3B5ND 4W7ZA 3P8CE 1GL2A 3RL0B 2NPSC 2M8RA 2HFED 1URQC 3RK2D 1N7SB 2NPSD 3RL0C 5CCGD 2N1TA 1JTHB 1N7SC 3RL0D 4WY4C 1N7SD 2KOGA 5KJ7C 1URQB 1SFCA 3TSIA 3RK3C 5CCHC 3M0DC 1KILB 5KJ7D 2XDJA 3HD7A 2N1TB 2HG5D 1L4AA 3B5NA 5CCHD 4WY4B 1KILC 1URQD 2N1TC 1XTGB 2H8PD
chains in the Genus database with same CATH superfamily
1L0ND 1AA0A 2WSEJ 1OW7A 1SQVJ 1T8ZA 2WSEH 4PD4I 2WTYA 5H2FE 2E75B 2A06E 2Z5HA 4DOJA 2UWJE 2QG4A 1U7MA 3AEGC 1GL2D 2JP3A 1K73Q 2ITAA 2WSSH 2RN0A 3SSUA 1KV4A 5AVTB 2N1TD 2RMZA 4N78D 1GU4A 1GDTA 1RQVA 1M57D 3N7NA 3PJSK 4OGQC 1KILA 2AXCA 3HUSA 2KSEA 2H88C 1Q82Q 1FZBA 4YXWH 1LTAC 4RO0A 2XU6A 1IFMA 1L4AD 3GG2A 2PRRA 4O9BA 3MP7B 5KAFH 2Q3EA 1J1DB 1IFPA 3L74G 4D6TD 1LT9C 1SQQK 1NTMD 1LWUA 2YKQA 2IFNA 2NRGA 2HR3A 3AE1C 1OXZA 4R4MA 1L0NE 2KS1A 2P67A 2AXTE 2Q1KA 3L71J 3GHGB 1BCCD 3AECC 3L70D 1ZR4A 3HD7A 1RF1A 3RL0g 1SQXD 2FKWB 3B5NA 3BCCJ 1URQD 1HGVA 2CPBA 2OYHC 2QVAA 4W7YA 2K9JB 3PP5A 5AVZB 1Y9BA 5CCGA 4N78E 5CHXA 2W6AA 4BRYA 2KXPB 5APUA 1LJ2A 5AW0B 2O1KA 1KYOI 1NOHA 3V2QA 1SQQD 1PP9J 5K5GB 1ZP0C 1HWTC 1IJDB 3M9QA 1PGOA 1ZW0A 2LXBA 2GA1A 4PV1B 3TNUA 3L35A 1NTZK 2LR2A 4D6TE 1P84I 2AEFA 1SQQG 1NTME 1BGYG 1FZEA 4C7NB 3TGUD 1X9VA 4K35A 3GHGC 4OVNF 3RK2D 1USDA 1JY3P 2OGUA 1BDDA 3L70E 3O6QB 3NFQA 2KSJA 1ZRTE 2D2CB 1SQXE 2K88A 4WWIA 3VP8A 3TGUG 3CCUP 2JKVA 3IAOA 1QX8A 4EOTA 4GIFA 1ZXGA 4AQRD 2XDJA 4C7RA 1LWUB 1IFJA 2HG5D 2ZAEB 3AE9C 3ZDMA 1M1JA 2OYIB 1G1JA 3RK3B 2WSFH 4WY4D 4K3AA 2JR8A 3AE5C 5APYA 3AE7C 3AE4C 1EXIA 1KQGB 3CCLP 1QVGO 4PV1C 4Y28J 4TT3H 3S1KA 5KLIB 1EZVD 1NTZG 2K37A 3NTNA 5CJ0A 4KHXA 5AVQB 1JY3O 2WPVB 1KB9H 3CC2P 1ZMEC 1M90Q 1BE3J 1JM0A 1HH0A 3OW2O 1R5LA 3H1KJ 1ZOYC 1S2EA 1SQPK 1QL2A 3M9BA 2B87A 2LXCB 1PGPA 1D7MA 2D2CC 3EQ2A 1DD4A 1GL2A 1OW6A 1AQTA 2NPSC 3TNUB 1HBWA 3RBZA 4JYBA 2FYNB 4GKGA 3AE3C 3A7OA 4XA4A 2HODB 2N1TA 1HF9A 4PD4H 3BATA 2E42A 4H44C 3SWYA 5KJ7C 3H1KE 2OYIC 3RK3C 4H0LD 1YI2P 1DIPA 1VQ8P 2Q6QA 1L4AA 3L72D 1EZVE 5KLIC 1N2DC 1WT6A 3B4SA 1SQPD 3FWNA 1FZCA 1FDMA 2E76D 3USSA 4KJMA 5CJ4A 2W27A 3SFEC 4WB4A 1FOSF 1S1CX 1NTKJ 1JTHA 2ZYAA 2E5YA 4LLHA 1SQPG 1LTBC 3F5HA 5APVA 1RE4C 2ZT9B 2MJZA 2QM8A 4JF7A 1VDFA 1URQA 1Q7YQ 2A45I 2YKOA 3V2NA 2FYNC 1NVOA 2WWWA 4UB8H 1NU1D 3VP9A 3P8CE 4IL6H 1FS0E 2NPSD 3T97A 4C46A 2GUVA 1GK6A 1ZN5A 2RKLA 4Y99B 2Y0EA 1YYCA 3L72E 1RF0C 3CMEP 2Q5UA 5E79H 5AW7B 2ZXXA 1Y47A 2M5AB 1A02F 3M0DC 5KJ7D 2N1TB 1PPJD 3W67A 3BRVB 2YMKA 1GU5A 4IFMA 1L0LK 2XNDH 1KILE 1KFNA 3M91A 3VOPA 3PHLA 2IYPA 5APQA 1FJPA 1PPJG 2V4HA 1L4AB 2YO2A 1OW8A 1VF5B 1KORA 4BXLA 4MN4C 3KXDA 1Y8AA 4U3FJ 1FZCB 5AVRB 1OWAA 1NU1E 2WPRA 2QEXP 1G1IA 1TU3F 2RH0A 1AVOA 2O01N 4L76A 1LNQA 4ZKUA 1JEKA 3AE8C 2OYHA 4H13C 1FDOA 2HPCA 1LT1A 1NYHA 4WY4A 3CWBG 2C0WA 4Y99C 1SQVK 2BCCG 3L4FA 3L73D 3CC4P 1PGJA 1USEA 3H1HG 3H1JJ 3CXHD 4EI2A 1L0LD 4N3YB 1NO4A 3HTKA 2PFXA 4RKUJ 4I2LC 4RESB 3H1ID 1N7SC 1H0TA 1SQBJ 4IFFA 1VQLP 5KLVJ 1EQ7A 1KD1Q 2Z4EA 2KI7B 1YQ4C 2FXMA 1JCCA 3L75D 5AW3B 1FJKA 5BU8B 2FYUJ 2WVRA 3Q5PA 1GD2E 3D6ZA 5H2FH 1QGKB 3D6YA 2QRXA 1S5LE 4R4LA 5BU5A 1LP1A 1LTJC 1YBKA 5AVXB 5KLVE 2QJKB 4I6MC 3LIDA 1IC2A 1HJBA 2FY8A 1EZVI 1H88A 3NXSA 1EDLA 2FYUE 2W6JH 1SQVG 2M3BA 3L73E 3CCVP 3JCUH 3AEAC 2KLVA 5TJHA 3NMDA 3FXDA 3AEBC 2FFDA 4DJGA 1S5LX 1S72P 1VQNP 4WBAA 1LTIC 2HFED 2OARA 4EIJA 1K05A 3RL0C 1L0NJ 4NPDA 3H6PA 4TLFA 2R5BA 1N7LA 3CX5D 3OA7A 5KTBA 2ZVNB 2AXTH 2KNCA 3FX0A 2G8YA 2R3CA 5TISE 3JCUE 3L74D 2C9LY 1N7SD 1YJWP 5EFWB 3H1LD 1PFIA 2E74B 2J5UA 3V6IA 3I55P 5APTA 2R32A 1VQPP 2IBZG 3GF3A 2H8PD 2KLUA 3PTZA 3H1LG 2NPSA 2A45H 3IN6A 1IFNA 1PZQA 2IZ0A 3L71G 1S9KD 1K04A 1DD3A 2E75C 1T3UA 2WITA 2P2UA 3BCCG 3FGAD 3M06A 4I7ZB 5KJ7A 1SFCB 4D6TJ 1NTMJ 4DZOA 3E7KA 3H32A 3CX5E 1MUUA 4HJGH 1BCCJ 1EC5A 3L70J 3L74E 1WMKA 2V7QJ 1BGYD 1SQXJ 1PP9G 2B88A 2ZJSE 2V7QH 3QH9A 1AV1A 3WU2E 1J1DC 1IFDA 3RL0D 3A0HE 4OGQD 5APSA 3CCSP 2MKVA 2H43A 1ZLLA 5KKZB 1YJNP 1VQ7P 1KILB 3HUSB 1BCCE 1S9KE 3OJAB 1SQQJ 3BASA 3MIWA 3G71P 3SWFA 3A3YB 1S3JA 1SLQA 4I7ZC 1DX7A 1SFCC 2FBWC 5C39A 4JYCA 2E75D 3TGUJ 1RF0A 1JY3N 1NTZD 2KS1B 1OVVA 2Q3IA 3GF7A 3CCJP 1SQQE 1BDCA 1BGYE 3HD7B 1RF1B 3B5NB 3A2AA 1NJIQ 1KQLA 1DH3A 2K3RA 1JCDA 3KQGA 3CCRP 1Q2NA 4BRYB 2OTLP 1JOCA 1FDIA 3VMAA 1NKZB 2IYOA 3TGUE 1FBMA 1M1KQ 5KAIE 1BE3G 5BVZA 2WT7A 2YXQB 1NTKK 1CI6A 3ABVC 5B66E 2GM4A 5CCHC 5AW6B 3SFDC 1QL1A 2W83C 3MGNA 3HE4A 3EFFK 3FXEA 1LWUC 3VMZA 3K5BA 1VQ6P 1YITP 1NTZE 2WZ7A 4HH2A 3V5BA 1MFZA 4KT0J 1YJ9P 3HD7C 1N7SA 3G3ZA 1Q86Q 1T2KC 3IR9A 1AJYA 3MHVA 1W5CE 2XKMA 3D70A 3EFGA 2B89A 5CCGC 1MV8A 1Q81Q 2OQQA 4QMAA 2G3AA 1M1JB 4PV1D 1NTKG 3KZIE 2KZJA 2P1JA 4PJ0E 3L72J 1LTJA 1N73A 3S4RA 1PV3A 1RH5B 3E1RA 1M7LA 5AW1B 4N6JA 5AVSB 1SQPJ 1VQ4P 3CX5I 2O01J 3M0AA 4YPCA 2QJYB 3B71A 3HE5A 2D2CD 4UB6H 2Y0CA 2W8ZA 3U59A 1G2CA 3TF5A 2XV5A 2H7HA 3RGUA 5CCHD 1NAFA 1KYOD 2B87B 2WQYC 3GLMA 2YIUB 1K9MQ 1R8EA 4ASWA 1GL2B 2YKPA 2IDBA 1E79H 1SQPE 2KK7A 4H44D 3WMM0 1NU1J 3RK3D 1P84D 4UB6E 5DJTB 1EDIA 1SQBK 2OTJP 1W2EA 3BVHA 2O1JA 1CZQA 3CD6P 2POHA 2C0XA 2OYOA 1M1JC 5GTHE 1RHZB 1JMBA 2YMYA 1PL5A 2ZT9C 2FXPA 3I5CA 5B5EE 1LT9A 2DW3A 1KMIZ 3V4WA 1OFCX 1LTTC 3GMAA 3AE6C 1R5SA 3WUUA 3CWBD 4U3FG 3CL3D 3VMXA 2QJYC 3QWOC 2BCCD 1VPCA 1IZNB 3H1HD 2WPSA 3IFMA 3VMYA 1JTHB 1KYOE 2KOGA 1FZAA 3AEDC 1HUCA 2ZYGA 1URQB 3MTUE 3H1JG 1KQFB 1FC2C 1YQ3C 3CWBJ 3G4SP 2ZYDA 2N1TC 1S5LH 3RK3E 1PPJE 1AFOA 1IK9A 1SQBG 1NGMB 5APXA 2I1JA 2QSIA 4U7JA 2ZFCA 3AE2C 3KPEA 1NAYA 1VL2A 3T97B 4DT0A 2B9BA 2IZ1A 1L0NK 4OH8B 2IPPA 1JY2P 3C9IA 1L4AC 1VF5C 3L73J 4NPFX 2A06G 1L0LJ 2WSCJ 3GW6A 1VQOP 1ZV8A 3CXHH 1JB0J 1NHLA 1CW5A 1FZCC 3CWBE 4OGQB 2O3JA 3H1IJ 3V2RA 3GHGA 1SQVD 2P58A 3EWKA 2BCCE 2ZT9D 1LGHB 3H1HE 3TK1A 5GTIE 2PP6A 1IO4A 3L75J 3RK2B 5CMZA 1U57A 1H8AA 2K9JA 4M3LA 1VQ9P 1FU1A 2BEZF 1URQC 3CMAP 5TISH 2HLOA 3CXHE 1L0LE 2M0BA 1W2BO 2L91A 2QIWA 3P8MC 3H1IE 2P7JA 4H13D 3SWKA 1KC8Q 1J2JB 1VQ5P 4ZMDA 1JY2O 1NTMK 3S9OA 2H89C 4NPEA 1RY3A 3L75E 2BEQD 3CCMP 2OYHB 2HPCB 2CK3H 4WY4B 1L0NG 2QE7H 1DEBA 1EDJA 4Z1MH 2IBZD 1X79B 1SP4A 1Z56A 2K1AA 1SQXK 1M56D 4C7NA 2N9BA 2R5DA 3TYYA 3MD0A 3HTKB 1E5WA 1UIXA 3L71D 4LGDE 1FE6A 1SQVE 1H0TB 2PAJA 3PLNA 3O6QA 4GDOA 4HYTB 5AVUB 1FZFA 2QJKC 1VF5D 3BCCD 1NKNA 2A45G 3ITKA 3RK2C 5CCHA 1HGZA 4ZNCA 3AEEC 3L74J 3CX5H 1KFMA 2W90A 3V4QA 5AW2B 5AW5B 3H1LJ 2QJPB 3WU2H 2CPSA 4LC1A 2OYIA 2NZ2A 1LP1B 2JO1A 4D6TG 3A0HH 1PP9D 1BSNA 1NTMG 4AYCA 1ZRTD 1FAVA 1FZGA 1HTLC 1WRGA 1BSHA 5KAFE 4WY4C 4H0LB 1BCCG 2IBZE 2GUSA 3L70G 3TSIA 1SQXG 1MFTA 2OTKE 1OIPA 3H1LE 2E74C 3L71E 2E76B 3MUDC 2FFDB 3VYIA 1RE4A 2VRSA 1K8AQ 3BCCE 1RE3C 5AVWB 1LTSC 4JBZA 1SS1A 1NWQA 1YTZT 2KNCB 3OAKA 1T3JA 2HODA 1BGYJ 3Q1MA 2ZVOB 3LW5J 4CPGA 1QLED 3LW5H 4B86A 4ZKPA 2Q7CA 1HVVA 4YTPC 2QJPC 1FOSE 2WPQA 1YTZI 1PP9E 1N8RQ 1X0TA 4XFJA 2KB7P 2NPSB 2ZXEB 4H0LC 1OMIA 5KAIH 1MZ9A 1KB9D 1A02J 3M0DA 4L75A 1KZUB 1OVRA 2JWDA 2I8DA 1S4XA 5CBOA 3PRJA 5B66H 3AEFC 1BE3D 3HRNA 2WSFJ 4H44B 3LIEA 3CI9A 2E76C 2FFDC 3H1KD 3II6A 3P32A 5AW4B 2XZRA 2JEEA 2FXOA 2LKMA 3CXHI 5KKZC 5AVVB 2L5GB 1NTZJ 3BRTB 3R4YA 3O8ZA 1DEEG 1KILC 3HUSC 3H32B 2E74D 3H1KG 4PD4D 1LTGC 3TDKA 2AEJA 4JQ0D 1CSBA 1Q90D 1EZVG 3H25A 2I1KA 1GTWA 2QM7A 3A0BH 4I1LA 1GK4A 3D71A 3Q3DA 3CPWO 3R2PA 1KTMA 3CCQP 4GOFA 5AW8B 1OX3A 1M8OB 2M5AA 1KB9E 2C9NY 2SPZA 1MKMA 1VQKP 1GW3A 1RF1C 1SFCD 3KZIH 4L74A 1JUNA 3B5NC 3CC7P 3I56P 2N9YB 4PJ0H 3P8CD 3A0BE 1BE3E 1NTKD 5AVYB 3Q5SA 1KQSO 1YHQP 4IOIH 1NU1K 5CBNA 2AEMA 2R3SA 2QA4P 3CCEP 1JMMA 1X8YA 3FWLA 3G6EP 1QEXA 4PD4E 2R44A 3A5TA 3L72G 2JDIH 1AQ5A 1UIIA 1GMJA 1JNMA 2W6BA 4L73A 1XTGB 4IFDK 1KILD 3KYQA 1ZR2A 2IBZI 1RQUA 4W80A 4HKZH 3E1IA 2O01H 4EYYQ 4RJTA 3MZWB 1L2PA 4HB1A 3VTPC 5DJUB 1PIXA 2WT7B 2IFMA 4EDFA 1H89A 5GTHH 2Y0DA 1SVFA 3M9HA 1YIJP 1CI6B 3P7KA 5B5EH 3UIAA 1GZLA 1OZHA 2WMMA 4JPZB 4H13B 1NTKE 3HE4B 2Q9IA 2YXRB 2IX7C 1NU1G 2FYZA 2E5TA 3WUTA 3HD7D 2KUBA 2Z5IA 5KLVK 1QVFO 3B5ND 1T2KD 3V2PA 4W7ZA 1NH4A 2KIKA 2M8RA 2JWAA 4UB8E 4U3FD 4DCKA 1N7SB 2FYUK 1KYOH 2Y9YA 3Q2YA 3W68A 4IL6E 3U1CA 5AW9B 5CCGD 1JO5A 2JJLA 1GW4A 3Q5RA 4OWFA 2Y9ZA 3L36A 2XNXA 2YO3A 1P84H 5E79E 4AUWA 1J1EB 3H1JD 2KZIA 3JSVC 4A7PA 5M1BA 3JC22 2PGDA 2YIUC 1LTJB 4XE5B 1SQBD 2HYNA 4GODA 1GL2C 1N73B 5APWA 5KLVD 1IFIA 4IL6X 3G9RA 3KDPB 2FYUD 1P84E 3HE5B 2BCCJ 3H1HJ 2A06D 3RBXA 5KLVG 2E43A 1G2CB 1IK7A 2P10A 2KYVA 5GTIH 3PH0A 3F89A 1KN7A 1U7JA 4U3FE 2YNYA 3CLQA 2M3EA 3MUDA 1PGQA 2FYUG 1OVUA 1EDKA 4YXDC 1N86A 5L8RJ 3L73G 3VN0A 1L0LG 1HJ0A 3L37A 3IF4A 2J58A 1RE3A 2WSCH 1T6AA 3RL0B 3B8EB 4WVZA 1KB9I 1XTCC 4GOEA 3H1IG 3C8VA 2KP8A 3C1LA 4BWNA 3H1JE 1J1EC 2J59M 2K9YA 1AVYA 1JY2N 3L75G 3U1AA 3KHUA 1VQMP 1SFCA 4ASVA 1EXJA 1SQBE 2BASA 1LT9B 1N73C 1X22A 4GT1A 3N4XA 3WUVA
chains in the Genus database with same CATH topology
3VYIA 1L0LK 1RE4A 2VRSA 1T8ZA 2WSEH 1KFNA 2WZ7A 3M91A 3VOPA 2WTYA 4HH2A 1FJPA 1RE3C 5APQA 2Z5HA 3V5BA 4DOJA 5AVWB 1LTSC 1L4AB 2YO2A 1MFZA 1GL2D 3HD7C 1NWQA 1N7SA 1YTZT 3G3ZA 1T2KC 3OAKA 1T3JA 2HODA 3IR9A 1FZCB 5AVRB 5AVTB 2N1TD 4N78D 3LW5H 1OWAA 2XKMA 4B86A 2WPRA 4ZKPA 2Q7CA 1GU4A 1G1IA 1HVVA 1GDTA 1FOSE 3EFGA 5CCGC 1MV8A 3N7NA 4ZKUA 2WPQA 1KILA 1YTZI 3HUSA 2OYHA 1FZBA 2HPCA 1LTAC 2XU6A 4WY4A 1M1JB 2C0WA 4Y99C 2KB7P 1IFMA 2NPSB 1L4AD 1SQVK 2ZXEB 3L4FA 1MZ9A 2P1JA 1LTJA 4O9BA 1A02J 3M0DA 4N3YB 1KZUB 1J1DB 1NO4A 1N73A 3HTKA 1M7LA 1LT9C 4I2LC 1SQQK 4RESB 5AW1B 1LWUA 1N7SC 4N6JA 5AVSB 4IFFA 2YKQA 3HRNA 3LIEA 2IFNA 3CI9A 1EQ7A 3M0AA 2FFDC 2Z4EA 1OXZA 3II6A 3HE5A 2P67A 3P32A 3GHGB 5AW4B 2FXMA 1JCCA 3U59A 1G2CA 2XZRA 5AW3B 1FJKA 2JEEA 2XV5A 5BU8B 2LKMA 1ZR4A 3HD7A 2H7HA 1RF1A 5AVVB 2FKWB 2L5GB 3BRTB 3B5NA 5CCHD 3O8ZA 1NAFA 1KILC 3HUSC 1URQD 1HGVA 2CPBA 3H32B 1GD2E 2OYHC 1GL2B 4W7YA 1LTGC 3PP5A 2YKPA 5AVZB 5CCGA 4N78E 5CHXA 2W6AA 5BU5A 1LTJC 3WMM0 1CSBA 2I1KA 1GTWA 2QM7A 5AVXB 4I1LA 3RK3D 1GK4A 4I6MC 5APUA 1SQBK 3LIDA 5AW0B 1IC2A 2O1KA 3R2PA 1HJBA 1W2EA 3BVHA 1NOHA 2O1JA 1H88A 3V2QA 3NXSA 1CZQA 2POHA 2C0XA 1M1JC 1HWTC 1IJDB 3M9QA 2YMYA 2M3BA 5AW8B 3I5CA 2C9NY 2KLVA 3TNUA 3L35A 1NTZK 1LT9A 1GW3A 3NMDA 1RF1C 1SFCD 3V4WA 1JUNA 3B5NC 1LTTC 3P8CD 2FFDA 1FZEA 4C7NB 3CL3D 1X9VA 4WBAA 1LTIC 3VMXA 2HFED 5AVYB 2OARA 4EIJA 1VPCA 3GHGC 3RK2D 3RL0C 1JY3P 1NU1K 3H6PA 2R5BA 2WPSA 3IFMA 1N7LA 2KSJA 3NFQA 3OA7A 5KTBA 3VMYA 1JTHB 2R3CA 1JMMA 3VP8A 1X8YA 2C9LY 1N7SD 2KOGA 1FZAA 1HUCA 4EOTA 1URQB 1PFIA 3MTUE 3A5TA 4GIFA 4AQRD 2XDJA 5APTA 4C7RA 1AQ5A 1LWUB 1IFJA 2HG5D 2R32A 1JNMA 2W6BA 2N1TC 1XTGB 1AFOA 2H8PD 4IFDK 1IK9A 1KILD 3KYQA 1M1JA 5APXA 1ZR2A 2I1JA 2OYIB 1G1JA 3RK3B 2NPSA 2A45H 2WSFH 2ZFCA 4W80A 4WY4D 3E1IA 2O01H 1IFNA 3KPEA 5APYA 1S9KD 3VTPC 1L0NK 2WT7B 4OH8B 1T3UA 2IFMA 2IPPA 2WITA 1H89A 1JY2P 3C9IA 2P2UA 1L4AC 1SVFA 3M9HA 1CI6B 3NTNA 5CJ0A 3M06A 4KHXA 5AVQB 1JY3O 5KJ7A 1ZV8A 3P7KA 1NHLA 1SFCB 1CW5A 3UIAA 1GZLA 1FZCC 3V2RA 3GHGA 3HE4B 4DZOA 1HH0A 2Q9IA 1LGHB 2IX7C 3TK1A 2PP6A 1SQPK 2FYZA 1QL2A 3M9BA 1IO4A 3H32A 1MUUA 3HD7D 2Z5IA 3RK2B 3EQ2A 5KLVK 3B5ND 5CMZA 3V2PA 4W7ZA 1T2KD 1H8AA 1NH4A 1GL2A 2NPSC 2M8RA 3TNUB 4M3LA 1FU1A 1HBWA 1URQC 4JYBA 1N7SB 2FYUK 4GKGA 2HLOA 3A7OA 4XA4A 3U1CA 2HODB 5AW9B 5CCGD 1J1DC 2N1TA 1IFDA 3RL0D 1JO5A 2JJLA 1GW4A 3P8MC 3BATA 2E42A 2P7JA 5APSA 1J2JB 1JY2O 3SWYA 5KJ7C 3L36A 2H43A 1ZLLA 1NTMK 2OYIC 2XNXA 2YO3A 3RK3C 1KILB 3HUSB 1RY3A 2OYHB 1S9KE 3OJAB 2HPCB 4AUWA 1J1EB 1L4AA 3BASA 3MIWA 4WY4B 3SWFA 3A3YB 1DEBA 1N2DC 1WT6A 1X79B 1SP4A 1Z56A 1LTJB 1SQXK 4XE5B 1SLQA 2HYNA 1FZCA 4C7NA 2N9BA 2R5DA 1FDMA 3TYYA 1GL2C 1DX7A 1N73B 5APWA 1SFCC 5CJ4A 3MD0A 2W27A 3HTKB 1E5WA 1IFIA 4LGDE 4WB4A 2PAJA 4JYCA 1FOSF 3KDPB 1RF0A 1JY3N 4HYTB 5AVUB 1JTHA 1FZFA 4LLHA 3HE5B 1LTBC 1NKNA 5APVA 1RE4C 2A45G 2Q3IA 3RK2C 2MJZA 2E43A 1G2CB 2QM8A 4JF7A 5CCHA 1VDFA 2KYVA 1URQA 1HGZA 3HD7B 1RF1B 2A45I 3B5NB 2YNYA 1KFMA 3V4QA 2YKOA 3CLQA 5AW2B 3V2NA 3MUDA 5AW5B 3A2AA 1KQLA 2WWWA 1DH3A 1N86A 1JCDA 3KQGA 3VN0A 3L37A 3VP9A 2J58A 3P8CE 1RE3A 2CPSA 4LC1A 1JOCA 2WSCH 2OYIA 3RL0B 3B8EB 1NKZB 1XTCC 1FBMA 4AYCA 2NPSD 3T97A 4C46A 1FAVA 1FZGA 2GUVA 5BVZA 1GK6A 2KP8A 2WT7A 1HTLC 1WRGA 1ZN5A 4Y99B 1J1EC 1NTKK 1YYCA 2J59M 4WY4C 1CI6A 1RF0C 1JY2N 3U1AA 2Q5UA 5AW7B 2GUSA 1SFCA 3TSIA 2GM4A 2BASA 5CCHC 1A02F 3M0DC 5KJ7D 1LT9B 5AW6B 1N73C 2N1TB 1QL1A 3MGNA 3HE4A 4GT1A 3N4XA 3BRVB 1GU5A 1LWUC 3VMZA 2FFDB 4IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIL D;  3KYQ A;  1GL2 B;  4W7Y A;  3RK3 B;  2NPS A;  4W80 A;  4WY4 D;  3PP5 A;  2WZ7 A;  3VOP A;  5CCG A;  1GL2 C;  4N78 E;  1SFC C;  1L4A B;  3HTK B;  1GL2 D;  4OH8 B;  4LGD E;  3HD7 C;  1N7S A;  3RK3 D;  1L4A C;  1T3J A;  1JTH A;  5KJ7 A;  2N1T D;  1NHL A;  1SFC B;  3RK2 C;  4JF7 A;  1HVV A;  2YMY A;  5CCH A;  1URQ A;  5CCG C;  3HD7 B;  3B5N B;  1KIL A;  1SFC D;  2PP6 A;  3B5N C;  4WY4 A;  3HD7 D;  3RK2 B;  2NPS B;  1L4A D;  3B5N D;  4W7Z A;  3P8C E;  1GL2 A;  3RL0 B;  2NPS C;  2M8R A;  2HFE D;  1URQ C;  3RK2 D;  1N7S B;  2NPS D;  3RL0 C;  5CCG D;  2N1T A;  1JTH B;  1N7S C;  3RL0 D;  4WY4 C;  1N7S D;  2KOG A;  5KJ7 C;  1URQ B;  1SFC A;  3TSI A;  3RK3 C;  5CCH C;  3M0D C;  1KIL B;  5KJ7 D;  2XDJ A;  3HD7 A;  2N1T B;  2HG5 D;  1L4A A;  3B5N A;  5CCH D;  4WY4 B;  1KIL C;  1URQ D;  2N1T C;  1XTG B;  2H8P D; 
#chains in the Genus database with same CATH topology
 1L0N D;  1AA0 A;  2WSE J;  1OW7 A;  1SQV J;  1T8Z A;  2WSE H;  4PD4 I;  2WTY A;  5H2F E;  2E75 B;  2A06 E;  2Z5H A;  4DOJ A;  2UWJ E;  2QG4 A;  1U7M A;  3AEG C;  1GL2 D;  2JP3 A;  1K73 Q;  2ITA A;  2WSS H;  2RN0 A;  3SSU A;  1KV4 A;  5AVT B;  2N1T D;  2RMZ A;  4N78 D;  1GU4 A;  1GDT A;  1RQV A;  1M57 D;  3N7N A;  3PJS K;  4OGQ C;  1KIL A;  2AXC A;  3HUS A;  2KSE A;  2H88 C;  1Q82 Q;  1FZB A;  4YXW H;  1LTA C;  4RO0 A;  2XU6 A;  1IFM A;  1L4A D;  3GG2 A;  2PRR A;  4O9B A;  3MP7 B;  5KAF H;  2Q3E A;  1J1D B;  1IFP A;  3L74 G;  4D6T D;  1LT9 C;  1SQQ K;  1NTM D;  1LWU A;  2YKQ A;  2IFN A;  2NRG A;  2HR3 A;  3AE1 C;  1OXZ A;  4R4M A;  1L0N E;  2KS1 A;  2P67 A;  2AXT E;  2Q1K A;  3L71 J;  3GHG B;  1BCC D;  3AEC C;  3L70 D;  1ZR4 A;  3HD7 A;  1RF1 A;  3RL0 g;  1SQX D;  2FKW B;  3B5N A;  3BCC J;  1URQ D;  1HGV A;  2CPB A;  2OYH C;  2QVA A;  4W7Y A;  2K9J B;  3PP5 A;  5AVZ B;  1Y9B A;  5CCG A;  4N78 E;  5CHX A;  2W6A A;  4BRY A;  2KXP B;  5APU A;  1LJ2 A;  5AW0 B;  2O1K A;  1KYO I;  1NOH A;  3V2Q A;  1SQQ D;  1PP9 J;  5K5G B;  1ZP0 C;  1HWT C;  1IJD B;  3M9Q A;  1PGO A;  1ZW0 A;  2LXB A;  2GA1 A;  4PV1 B;  3TNU A;  3L35 A;  1NTZ K;  2LR2 A;  4D6T E;  1P84 I;  2AEF A;  1SQQ G;  1NTM E;  1BGY G;  1FZE A;  4C7N B;  3TGU D;  1X9V A;  4K35 A;  3GHG C;  4OVN F;  3RK2 D;  1USD A;  1JY3 P;  2OGU A;  1BDD A;  3L70 E;  3O6Q B;  3NFQ A;  2KSJ A;  1ZRT E;  2D2C B;  1SQX E;  2K88 A;  4WWI A;  3VP8 A;  3TGU G;  3CCU P;  2JKV A;  3IAO A;  1QX8 A;  4EOT A;  4GIF A;  1ZXG A;  4AQR D;  2XDJ A;  4C7R A;  1LWU B;  1IFJ A;  2HG5 D;  2ZAE B;  3AE9 C;  3ZDM A;  1M1J A;  2OYI B;  1G1J A;  3RK3 B;  2WSF H;  4WY4 D;  4K3A A;  2JR8 A;  3AE5 C;  5APY A;  3AE7 C;  3AE4 C;  1EXI A;  1KQG B;  3CCL P;  1QVG O;  4PV1 C;  4Y28 J;  4TT3 H;  3S1K A;  5KLI B;  1EZV D;  1NTZ G;  2K37 A;  3NTN A;  5CJ0 A;  4KHX A;  5AVQ B;  1JY3 O;  2WPV B;  1KB9 H;  3CC2 P;  1ZME C;  1M90 Q;  1BE3 J;  1JM0 A;  1HH0 A;  3OW2 O;  1R5L A;  3H1K J;  1ZOY C;  1S2E A;  1SQP K;  1QL2 A;  3M9B A;  2B87 A;  2LXC B;  1PGP A;  1D7M A;  2D2C C;  3EQ2 A;  1DD4 A;  1GL2 A;  1OW6 A;  1AQT A;  2NPS C;  3TNU B;  1HBW A;  3RBZ A;  4JYB A;  2FYN B;  4GKG A;  3AE3 C;  3A7O A;  4XA4 A;  2HOD B;  2N1T A;  1HF9 A;  4PD4 H;  3BAT A;  2E42 A;  4H44 C;  3SWY A;  5KJ7 C;  3H1K E;  2OYI C;  3RK3 C;  4H0L D;  1YI2 P;  1DIP A;  1VQ8 P;  2Q6Q A;  1L4A A;  3L72 D;  1EZV E;  5KLI C;  1N2D C;  1WT6 A;  3B4S A;  1SQP D;  3FWN A;  1FZC A;  1FDM A;  2E76 D;  3USS A;  4KJM A;  5CJ4 A;  2W27 A;  3SFE C;  4WB4 A;  1FOS F;  1S1C X;  1NTK J;  1JTH A;  2ZYA A;  2E5Y A;  4LLH A;  1SQP G;  1LTB C;  3F5H A;  5APV A;  1RE4 C;  2ZT9 B;  2MJZ A;  2QM8 A;  4JF7 A;  1VDF A;  1URQ A;  1Q7Y Q;  2A45 I;  2YKO A;  3V2N A;  2FYN C;  1NVO A;  2WWW A;  4UB8 H;  1NU1 D;  3VP9 A;  3P8C E;  4IL6 H;  1FS0 E;  2NPS D;  3T97 A;  4C46 A;  2GUV A;  1GK6 A;  1ZN5 A;  2RKL A;  4Y99 B;  2Y0E A;  1YYC A;  3L72 E;  1RF0 C;  3CME P;  2Q5U A;  5E79 H;  5AW7 B;  2ZXX A;  1Y47 A;  2M5A B;  1A02 F;  3M0D C;  5KJ7 D;  2N1T B;  1PPJ D;  3W67 A;  3BRV B;  2YMK A;  1GU5 A;  4IFM A;  1L0L K;  2XND H;  1KIL E;  1KFN A;  3M91 A;  3VOP A;  3PHL A;  2IYP A;  5APQ A;  1FJP A;  1PPJ G;  2V4H A;  1L4A B;  2YO2 A;  1OW8 A;  1VF5 B;  1KOR A;  4BXL A;  4MN4 C;  3KXD A;  1Y8A A;  4U3F J;  1FZC B;  5AVR B;  1OWA A;  1NU1 E;  2WPR A;  2QEX P;  1G1I A;  1TU3 F;  2RH0 A;  1AVO A;  2O01 N;  4L76 A;  1LNQ A;  4ZKU A;  1JEK A;  3AE8 C;  2OYH A;  4H13 C;  1FDO A;  2HPC A;  1LT1 A;  1NYH A;  4WY4 A;  3CWB G;  2C0W A;  4Y99 C;  1SQV K;  2BCC G;  3L4F A;  3L73 D;  3CC4 P;  1PGJ A;  1USE A;  3H1H G;  3H1J J;  3CXH D;  4EI2 A;  1L0L D;  4N3Y B;  1NO4 A;  3HTK A;  2PFX A;  4RKU J;  4I2L C;  4RES B;  3H1I D;  1N7S C;  1H0T A;  1SQB J;  4IFF A;  1VQL P;  5KLV J;  1EQ7 A;  1KD1 Q;  2Z4E A;  2KI7 B;  1YQ4 C;  2FXM A;  1JCC A;  3L75 D;  5AW3 B;  1FJK A;  5BU8 B;  2FYU J;  2WVR A;  3Q5P A;  1GD2 E;  3D6Z A;  5H2F H;  1QGK B;  3D6Y A;  2QRX A;  1S5L E;  4R4L A;  5BU5 A;  1LP1 A;  1LTJ C;  1YBK A;  5AVX B;  5KLV E;  2QJK B;  4I6M C;  3LID A;  1IC2 A;  1HJB A;  2FY8 A;  1EZV I;  1H88 A;  3NXS A;  1EDL A;  2FYU E;  2W6J H;  1SQV G;  2M3B A;  3L73 E;  3CCV P;  3JCU H;  3AEA C;  2KLV A;  5TJH A;  3NMD A;  3FXD A;  3AEB C;  2FFD A;  4DJG A;  1S5L X;  1S72 P;  1VQN P;  4WBA A;  1LTI C;  2HFE D;  2OAR A;  4EIJ A;  1K05 A;  3RL0 C;  1L0N J;  4NPD A;  3H6P A;  4TLF A;  2R5B A;  1N7L A;  3CX5 D;  3OA7 A;  5KTB A;  2ZVN B;  2AXT H;  2KNC A;  3FX0 A;  2G8Y A;  2R3C A;  5TIS E;  3JCU E;  3L74 D;  2C9L Y;  1N7S D;  1YJW P;  5EFW B;  3H1L D;  1PFI A;  2E74 B;  2J5U A;  3V6I A;  3I55 P;  5APT A;  2R32 A;  1VQP P;  2IBZ G;  3GF3 A;  2H8P D;  2KLU A;  3PTZ A;  3H1L G;  2NPS A;  2A45 H;  3IN6 A;  1IFN A;  1PZQ A;  2IZ0 A;  3L71 G;  1S9K D;  1K04 A;  1DD3 A;  2E75 C;  1T3U A;  2WIT A;  2P2U A;  3BCC G;  3FGA D;  3M06 A;  4I7Z B;  5KJ7 A;  1SFC B;  4D6T J;  1NTM J;  4DZO A;  3E7K A;  3H32 A;  3CX5 E;  1MUU A;  4HJG H;  1BCC J;  1EC5 A;  3L70 J;  3L74 E;  1WMK A;  2V7Q J;  1BGY D;  1SQX J;  1PP9 G;  2B88 A;  2ZJS E;  2V7Q H;  3QH9 A;  1AV1 A;  3WU2 E;  1J1D C;  1IFD A;  3RL0 D;  3A0H E;  4OGQ D;  5APS A;  3CCS P;  2MKV A;  2H43 A;  1ZLL A;  5KKZ B;  1YJN P;  1VQ7 P;  1KIL B;  3HUS B;  1BCC E;  1S9K E;  3OJA B;  1SQQ J;  3BAS A;  3MIW A;  3G71 P;  3SWF A;  3A3Y B;  1S3J A;  1SLQ A;  4I7Z C;  1DX7 A;  1SFC C;  2FBW C;  5C39 A;  4JYC A;  2E75 D;  3TGU J;  1RF0 A;  1JY3 N;  1NTZ D;  2KS1 B;  1OVV A;  2Q3I A;  3GF7 A;  3CCJ P;  1SQQ E;  1BDC A;  1BGY E;  3HD7 B;  1RF1 B;  3B5N B;  3A2A A;  1NJI Q;  1KQL A;  1DH3 A;  2K3R A;  1JCD A;  3KQG A;  3CCR P;  1Q2N A;  4BRY B;  2OTL P;  1JOC A;  1FDI A;  3VMA A;  1NKZ B;  2IYO A;  3TGU E;  1FBM A;  1M1K Q;  5KAI E;  1BE3 G;  5BVZ A;  2WT7 A;  2YXQ B;  1NTK K;  1CI6 A;  3ABV C;  5B66 E;  2GM4 A;  5CCH C;  5AW6 B;  3SFD C;  1QL1 A;  2W83 C;  3MGN A;  3HE4 A;  3EFF K;  3FXE A;  1LWU C;  3VMZ A;  3K5B A;  1VQ6 P;  1YIT P;  1NTZ E;  2WZ7 A;  4HH2 A;  3V5B A;  1MFZ A;  4KT0 J;  1YJ9 P;  3HD7 C;  1N7S A;  3G3Z A;  1Q86 Q;  1T2K C;  3IR9 A;  1AJY A;  3MHV A;  1W5C E;  2XKM A;  3D70 A;  3EFG A;  2B89 A;  5CCG C;  1MV8 A;  1Q81 Q;  2OQQ A;  4QMA A;  2G3A A;  1M1J B;  4PV1 D;  1NTK G;  3KZI E;  2KZJ A;  2P1J A;  4PJ0 E;  3L72 J;  1LTJ A;  1N73 A;  3S4R A;  1PV3 A;  1RH5 B;  3E1R A;  1M7L A;  5AW1 B;  4N6J A;  5AVS B;  1SQP J;  1VQ4 P;  3CX5 I;  2O01 J;  3M0A A;  4YPC A;  2QJY B;  3B71 A;  3HE5 A;  2D2C D;  4UB6 H;  2Y0C A;  2W8Z A;  3U59 A;  1G2C A;  3TF5 A;  2XV5 A;  2H7H A;  3RGU A;  5CCH D;  1NAF A;  1KYO D;  2B87 B;  2WQY C;  3GLM A;  2YIU B;  1K9M Q;  1R8E A;  4ASW A;  1GL2 B;  2YKP A;  2IDB A;  1E79 H;  1SQP E;  2KK7 A;  4H44 D;  3WMM 0;  1NU1 J;  3RK3 D;  1P84 D;  4UB6 E;  5DJT B;  1EDI A;  1SQB K;  2OTJ P;  1W2E A;  3BVH A;  2O1J A;  1CZQ A;  3CD6 P;  2POH A;  2C0X A;  2OYO A;  1M1J C;  5GTH E;  1RHZ B;  1JMB A;  2YMY A;  1PL5 A;  2ZT9 C;  2FXP A;  3I5C A;  5B5E E;  1LT9 A;  2DW3 A;  1KMI Z;  3V4W A;  1OFC X;  1LTT C;  3GMA A;  3AE6 C;  1R5S A;  3WUU A;  3CWB D;  4U3F G;  3CL3 D;  3VMX A;  2QJY C;  3QWO C;  2BCC D;  1VPC A;  1IZN B;  3H1H D;  2WPS A;  3IFM A;  3VMY A;  1JTH B;  1KYO E;  2KOG A;  1FZA A;  3AED C;  1HUC A;  2ZYG A;  1URQ B;  3MTU E;  3H1J G;  1KQF B;  1FC2 C;  1YQ3 C;  3CWB J;  3G4S P;  2ZYD A;  2N1T C;  1S5L H;  3RK3 E;  1PPJ E;  1AFO A;  1IK9 A;  1SQB G;  1NGM B;  5APX A;  2I1J A;  2QSI A;  4U7J A;  2ZFC A;  3AE2 C;  3KPE A;  1NAY A;  1VL2 A;  3T97 B;  4DT0 A;  2B9B A;  2IZ1 A;  1L0N K;  4OH8 B;  2IPP A;  1JY2 P;  3C9I A;  1L4A C;  1VF5 C;  3L73 J;  4NPF X;  2A06 G;  1L0L J;  2WSC J;  3GW6 A;  1VQO P;  1ZV8 A;  3CXH H;  1JB0 J;  1NHL A;  1CW5 A;  1FZC C;  3CWB E;  4OGQ B;  2O3J A;  3H1I J;  3V2R A;  3GHG A;  1SQV D;  2P58 A;  3EWK A;  2BCC E;  2ZT9 D;  1LGH B;  3H1H E;  3TK1 A;  5GTI E;  2PP6 A;  1IO4 A;  3L75 J;  3RK2 B;  5CMZ A;  1U57 A;  1H8A A;  2K9J A;  4M3L A;  1VQ9 P;  1FU1 A;  2BEZ F;  1URQ C;  3CMA P;  5TIS H;  2HLO A;  3CXH E;  1L0L E;  2M0B A;  1W2B O;  2L91 A;  2QIW A;  3P8M C;  3H1I E;  2P7J A;  4H13 D;  3SWK A;  1KC8 Q;  1J2J B;  1VQ5 P;  4ZMD A;  1JY2 O;  1NTM K;  3S9O A;  2H89 C;  4NPE A;  1RY3 A;  3L75 E;  2BEQ D;  3CCM P;  2OYH B;  2HPC B;  2CK3 H;  4WY4 B;  1L0N G;  2QE7 H;  1DEB A;  1EDJ A;  4Z1M H;  2IBZ D;  1X79 B;  1SP4 A;  1Z56 A;  2K1A A;  1SQX K;  1M56 D;  4C7N A;  2N9B A;  2R5D A;  3TYY A;  3MD0 A;  3HTK B;  1E5W A;  1UIX A;  3L71 D;  4LGD E;  1FE6 A;  1SQV E;  1H0T B;  2PAJ A;  3PLN A;  3O6Q A;  4GDO A;  4HYT B;  5AVU B;  1FZF A;  2QJK C;  1VF5 D;  3BCC D;  1NKN A;  2A45 G;  3ITK A;  3RK2 C;  5CCH A;  1HGZ A;  4ZNC A;  3AEE C;  3L74 J;  3CX5 H;  1KFM A;  2W90 A;  3V4Q A;  5AW2 B;  5AW5 B;  3H1L J;  2QJP B;  3WU2 H;  2CPS A;  4LC1 A;  2OYI A;  2NZ2 A;  1LP1 B;  2JO1 A;  4D6T G;  3A0H H;  1PP9 D;  1BSN A;  1NTM G;  4AYC A;  1ZRT D;  1FAV A;  1FZG A;  1HTL C;  1WRG A;  1BSH A;  5KAF E;  4WY4 C;  4H0L B;  1BCC G;  2IBZ E;  2GUS A;  3L70 G;  3TSI A;  1SQX G;  1MFT A;  2OTK E;  1OIP A;  3H1L E;  2E74 C;  3L71 E;  2E76 B;  3MUD C;  2FFD B;  3VYI A;  1RE4 A;  2VRS A;  1K8A Q;  3BCC E;  1RE3 C;  5AVW B;  1LTS C;  4JBZ A;  1SS1 A;  1NWQ A;  1YTZ T;  2KNC B;  3OAK A;  1T3J A;  2HOD A;  1BGY J;  3Q1M A;  2ZVO B;  3LW5 J;  4CPG A;  1QLE D;  3LW5 H;  4B86 A;  4ZKP A;  2Q7C A;  1HVV A;  4YTP C;  2QJP C;  1FOS E;  2WPQ A;  1YTZ I;  1PP9 E;  1N8R Q;  1X0T A;  4XFJ A;  2KB7 P;  2NPS B;  2ZXE B;  4H0L C;  1OMI A;  5KAI H;  1MZ9 A;  1KB9 D;  1A02 J;  3M0D A;  4L75 A;  1KZU B;  1OVR A;  2JWD A;  2I8D A;  1S4X A;  5CBO A;  3PRJ A;  5B66 H;  3AEF C;  1BE3 D;  3HRN A;  2WSF J;  4H44 B;  3LIE A;  3CI9 A;  2E76 C;  2FFD C;  3H1K D;  3II6 A;  3P32 A;  5AW4 B;  2XZR A;  2JEE A;  2FXO A;  2LKM A;  3CXH I;  5KKZ C;  5AVV B;  2L5G B;  1NTZ J;  3BRT B;  3R4Y A;  3O8Z A;  1DEE G;  1KIL C;  3HUS C;  3H32 B;  2E74 D;  3H1K G;  4PD4 D;  1LTG C;  3TDK A;  2AEJ A;  4JQ0 D;  1CSB A;  1Q90 D;  1EZV G;  3H25 A;  2I1K A;  1GTW A;  2QM7 A;  3A0B H;  4I1L A;  1GK4 A;  3D71 A;  3Q3D A;  3CPW O;  3R2P A;  1KTM A;  3CCQ P;  4GOF A;  5AW8 B;  1OX3 A;  1M8O B;  2M5A A;  1KB9 E;  2C9N Y;  2SPZ A;  1MKM A;  1VQK P;  1GW3 A;  1RF1 C;  1SFC D;  3KZI H;  4L74 A;  1JUN A;  3B5N C;  3CC7 P;  3I56 P;  2N9Y B;  4PJ0 H;  3P8C D;  3A0B E;  1BE3 E;  1NTK D;  5AVY B;  3Q5S A;  1KQS O;  1YHQ P;  4IOI H;  1NU1 K;  5CBN A;  2AEM A;  2R3S A;  2QA4 P;  3CCE P;  1JMM A;  1X8Y A;  3FWL A;  3G6E P;  1QEX A;  4PD4 E;  2R44 A;  3A5T A;  3L72 G;  2JDI H;  1AQ5 A;  1UII A;  1GMJ A;  1JNM A;  2W6B A;  4L73 A;  1XTG B;  4IFD K;  1KIL D;  3KYQ A;  1ZR2 A;  2IBZ I;  1RQU A;  4W80 A;  4HKZ H;  3E1I A;  2O01 H;  4EYY Q;  4RJT A;  3MZW B;  1L2P A;  4HB1 A;  3VTP C;  5DJU B;  1PIX A;  2WT7 B;  2IFM A;  4EDF A;  1H89 A;  5GTH H;  2Y0D A;  1SVF A;  3M9H A;  1YIJ P;  1CI6 B;  3P7K A;  5B5E H;  3UIA A;  1GZL A;  1OZH A;  2WMM A;  4JPZ B;  4H13 B;  1NTK E;  3HE4 B;  2Q9I A;  2YXR B;  2IX7 C;  1NU1 G;  2FYZ A;  2E5T A;  3WUT A;  3HD7 D;  2KUB A;  2Z5I A;  5KLV K;  1QVF O;  3B5N D;  1T2K D;  3V2P A;  4W7Z A;  1NH4 A;  2KIK A;  2M8R A;  2JWA A;  4UB8 E;  4U3F D;  4DCK A;  1N7S B;  2FYU K;  1KYO H;  2Y9Y A;  3Q2Y A;  3W68 A;  4IL6 E;  3U1C A;  5AW9 B;  5CCG D;  1JO5 A;  2JJL A;  1GW4 A;  3Q5R A;  4OWF A;  2Y9Z A;  3L36 A;  2XNX A;  2YO3 A;  1P84 H;  5E79 E;  4AUW A;  1J1E B;  3H1J D;  2KZI A;  3JSV C;  4A7P A;  5M1B A;  3JC2 2;  2PGD A;  2YIU C;  1LTJ B;  4XE5 B;  1SQB D;  2HYN A;  4GOD A;  1GL2 C;  1N73 B;  5APW A;  5KLV D;  1IFI A;  4IL6 X;  3G9R A;  3KDP B;  2FYU D;  1P84 E;  3HE5 B;  2BCC J;  3H1H J;  2A06 D;  3RBX A;  5KLV G;  2E43 A;  1G2C B;  1IK7 A;  2P10 A;  2KYV A;  5GTI H;  3PH0 A;  3F89 A;  1KN7 A;  1U7J A;  4U3F E;  2YNY A;  3CLQ A;  2M3E A;  3MUD A;  1PGQ A;  2FYU G;  1OVU A;  1EDK A;  4YXD C;  1N86 A;  5L8R J;  3L73 G;  3VN0 A;  1L0L G;  1HJ0 A;  3L37 A;  3IF4 A;  2J58 A;  1RE3 A;  2WSC H;  1T6A A;  3RL0 B;  3B8E B;  4WVZ A;  1KB9 I;  1XTC C;  4GOE A;  3H1I G;  3C8V A;  2KP8 A;  3C1L A;  4BWN A;  3H1J E;  1J1E C;  2J59 M;  2K9Y A;  1AVY A;  1JY2 N;  3L75 G;  3U1A A;  3KHU A;  1VQM P;  1SFC A;  4ASV A;  1EXJ A;  1SQB E;  2BAS A;  1LT9 B;  1N73 C;  1X22 A;  4GT1 A;  3N4X A;  3WUV A; 
#chains in the Genus database with same CATH homology
 3VYI A;  1L0L K;  1RE4 A;  2VRS A;  1T8Z A;  2WSE H;  1KFN A;  2WZ7 A;  3M91 A;  3VOP A;  2WTY A;  4HH2 A;  1FJP A;  1RE3 C;  5APQ A;  2Z5H A;  3V5B A;  4DOJ A;  5AVW B;  1LTS C;  1L4A B;  2YO2 A;  1MFZ A;  1GL2 D;  3HD7 C;  1NWQ A;  1N7S A;  1YTZ T;  3G3Z A;  1T2K C;  3OAK A;  1T3J A;  2HOD A;  3IR9 A;  1FZC B;  5AVR B;  5AVT B;  2N1T D;  4N78 D;  3LW5 H;  1OWA A;  2XKM A;  4B86 A;  2WPR A;  4ZKP A;  2Q7C A;  1GU4 A;  1G1I A;  1HVV A;  1GDT A;  1FOS E;  3EFG A;  5CCG C;  1MV8 A;  3N7N A;  4ZKU A;  2WPQ A;  1KIL A;  1YTZ I;  3HUS A;  2OYH A;  1FZB A;  2HPC A;  1LTA C;  2XU6 A;  4WY4 A;  1M1J B;  2C0W A;  4Y99 C;  2KB7 P;  1IFM A;  2NPS B;  1L4A D;  1SQV K;  2ZXE B;  3L4F A;  1MZ9 A;  2P1J A;  1LTJ A;  4O9B A;  1A02 J;  3M0D A;  4N3Y B;  1KZU B;  1J1D B;  1NO4 A;  1N73 A;  3HTK A;  1M7L A;  1LT9 C;  4I2L C;  1SQQ K;  4RES B;  5AW1 B;  1LWU A;  1N7S C;  4N6J A;  5AVS B;  4IFF A;  2YKQ A;  3HRN A;  3LIE A;  2IFN A;  3CI9 A;  1EQ7 A;  3M0A A;  2FFD C;  2Z4E A;  1OXZ A;  3II6 A;  3HE5 A;  2P67 A;  3P32 A;  3GHG B;  5AW4 B;  2FXM A;  1JCC A;  3U59 A;  1G2C A;  2XZR A;  5AW3 B;  1FJK A;  2JEE A;  2XV5 A;  5BU8 B;  2LKM A;  1ZR4 A;  3HD7 A;  2H7H A;  1RF1 A;  5AVV B;  2FKW B;  2L5G B;  3BRT B;  3B5N A;  5CCH D;  3O8Z A;  1NAF A;  1KIL C;  3HUS C;  1URQ D;  1HGV A;  2CPB A;  3H32 B;  1GD2 E;  2OYH C;  1GL2 B;  4W7Y A;  1LTG C;  3PP5 A;  2YKP A;  5AVZ B;  5CCG A;  4N78 E;  5CHX A;  2W6A A;  5BU5 A;  1LTJ C;  3WMM 0;  1CSB A;  2I1K A;  1GTW A;  2QM7 A;  5AVX B;  4I1L A;  3RK3 D;  1GK4 A;  4I6M C;  5APU A;  1SQB K;  3LID A;  5AW0 B;  1IC2 A;  2O1K A;  3R2P A;  1HJB A;  1W2E A;  3BVH A;  1NOH A;  2O1J A;  1H88 A;  3V2Q A;  3NXS A;  1CZQ A;  2POH A;  2C0X A;  1M1J C;  1HWT C;  1IJD B;  3M9Q A;  2YMY A;  2M3B A;  5AW8 B;  3I5C A;  2C9N Y;  2KLV A;  3TNU A;  3L35 A;  1NTZ K;  1LT9 A;  1GW3 A;  3NMD A;  1RF1 C;  1SFC D;  3V4W A;  1JUN A;  3B5N C;  1LTT C;  3P8C D;  2FFD A;  1FZE A;  4C7N B;  3CL3 D;  1X9V A;  4WBA A;  1LTI C;  3VMX A;  2HFE D;  5AVY B;  2OAR A;  4EIJ A;  1VPC A;  3GHG C;  3RK2 D;  3RL0 C;  1JY3 P;  1NU1 K;  3H6P A;  2R5B A;  2WPS A;  3IFM A;  1N7L A;  2KSJ A;  3NFQ A;  3OA7 A;  5KTB A;  3VMY A;  1JTH B;  2R3C A;  1JMM A;  3VP8 A;  1X8Y A;  2C9L Y;  1N7S D;  2KOG A;  1FZA A;  1HUC A;  4EOT A;  1URQ B;  1PFI A;  3MTU E;  3A5T A;  4GIF A;  4AQR D;  2XDJ A;  5APT A;  4C7R A;  1AQ5 A;  1LWU B;  1IFJ A;  2HG5 D;  2R32 A;  1JNM A;  2W6B A;  2N1T C;  1XTG B;  1AFO A;  2H8P D;  4IFD K;  1IK9 A;  1KIL D;  3KYQ A;  1M1J A;  5APX A;  1ZR2 A;  2I1J A;  2OYI B;  1G1J A;  3RK3 B;  2NPS A;  2A45 H;  2WSF H;  2ZFC A;  4W80 A;  4WY4 D;  3E1I A;  2O01 H;  1IFN A;  3KPE A;  5APY A;  1S9K D;  3VTP C;  1L0N K;  2WT7 B;  4OH8 B;  1T3U A;  2IFM A;  2IPP A;  2WIT A;  1H89 A;  1JY2 P;  3C9I A;  2P2U A;  1L4A C;  1SVF A;  3M9H A;  1CI6 B;  3NTN A;  5CJ0 A;  3M06 A;  4KHX A;  5AVQ B;  1JY3 O;  5KJ7 A;  1ZV8 A;  3P7K A;  1NHL A;  1SFC B;  1CW5 A;  3UIA A;  1GZL A;  1FZC C;  3V2R A;  3GHG A;  3HE4 B;  4DZO A;  1HH0 A;  2Q9I A;  1LGH B;  2IX7 C;  3TK1 A;  2PP6 A;  1SQP K;  2FYZ A;  1QL2 A;  3M9B A;  1IO4 A;  3H32 A;  1MUU A;  3HD7 D;  2Z5I A;  3RK2 B;  3EQ2 A;  5KLV K;  3B5N D;  5CMZ A;  3V2P A;  4W7Z A;  1T2K D;  1H8A A;  1NH4 A;  1GL2 A;  2NPS C;  2M8R A;  3TNU B;  4M3L A;  1FU1 A;  1HBW A;  1URQ C;  4JYB A;  1N7S B;  2FYU K;  4GKG A;  2HLO A;  3A7O A;  4XA4 A;  3U1C A;  2HOD B;  5AW9 B;  5CCG D;  1J1D C;  2N1T A;  1IFD A;  3RL0 D;  1JO5 A;  2JJL A;  1GW4 A;  3P8M C;  3BAT A;  2E42 A;  2P7J A;  5APS A;  1J2J B;  1JY2 O;  3SWY A;  5KJ7 C;  3L36 A;  2H43 A;  1ZLL A;  1NTM K;  2OYI C;  2XNX A;  2YO3 A;  3RK3 C;  1KIL B;  3HUS B;  1RY3 A;  2OYH B;  1S9K E;  3OJA B;  2HPC B;  4AUW A;  1J1E B;  1L4A A;  3BAS A;  3MIW A;  4WY4 B;  3SWF A;  3A3Y B;  1DEB A;  1N2D C;  1WT6 A;  1X79 B;  1SP4 A;  1Z56 A;  1LTJ B;  1SQX K;  4XE5 B;  1SLQ A;  2HYN A;  1FZC A;  4C7N A;  2N9B A;  2R5D A;  1FDM A;  3TYY A;  1GL2 C;  1DX7 A;  1N73 B;  5APW A;  1SFC C;  5CJ4 A;  3MD0 A;  2W27 A;  3HTK B;  1E5W A;  1IFI A;  4LGD E;  4WB4 A;  2PAJ A;  4JYC A;  1FOS F;  3KDP B;  1RF0 A;  1JY3 N;  4HYT B;  5AVU B;  1JTH A;  1FZF A;  4LLH A;  3HE5 B;  1LTB C;  1NKN A;  5APV A;  1RE4 C;  2A45 G;  2Q3I A;  3RK2 C;  2MJZ A;  2E43 A;  1G2C B;  2QM8 A;  4JF7 A;  5CCH A;  1VDF A;  2KYV A;  1URQ A;  1HGZ A;  3HD7 B;  1RF1 B;  2A45 I;  3B5N B;  2YNY A;  1KFM A;  3V4Q A;  2YKO A;  3CLQ A;  5AW2 B;  3V2N A;  3MUD A;  5AW5 B;  3A2A A;  1KQL A;  2WWW A;  1DH3 A;  1N86 A;  1JCD A;  3KQG A;  3VN0 A;  3L37 A;  3VP9 A;  2J58 A;  3P8C E;  1RE3 A;  2CPS A;  4LC1 A;  1JOC A;  2WSC H;  2OYI A;  3RL0 B;  3B8E B;  1NKZ B;  1XTC C;  1FBM A;  4AYC A;  2NPS D;  3T97 A;  4C46 A;  1FAV A;  1FZG A;  2GUV A;  5BVZ A;  1GK6 A;  2KP8 A;  2WT7 A;  1HTL C;  1WRG A;  1ZN5 A;  4Y99 B;  1J1E C;  1NTK K;  1YYC A;  2J59 M;  4WY4 C;  1CI6 A;  1RF0 C;  1JY2 N;  3U1A A;  2Q5U A;  5AW7 B;  2GUS A;  1SFC A;  3TSI A;  2GM4 A;  2BAS A;  5CCH C;  1A02 F;  3M0D C;  5KJ7 D;  1LT9 B;  5AW6 B;  1N73 C;  2N1T B;  1QL1 A;  3MGN A;  3HE4 A;  4GT1 A;  3N4X A;  3BRV B;  1GU5 A;  1LWU C;  3VMZ A;  2FFD B;  4IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...