4WY4B

Crystal structure of autophagic snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
ESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 8
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4B00
2HFED 1GL2A 3HTKB 3RK2C 3B5ND 4LGDE 3KYQA 3RL0D 2N1TC 2KOGA 5CCHC 1T3JA 1L4AB 1KILC 5CCGC 1L4AD 1URQC 1URQD 1GL2B 2WZ7A 4W7ZA 1NHLA 4W80A 3HD7B 1XTGB 2YMYA 2NPSB 1JTHB 1N7SA 3RL0C 3B5NC 1HVVA 2N1TA 3B5NA 1L4AC 2N1TB 2PP6A 3P8CE 3M0DC 2N1TD 3HD7D 1JTHA 1KILD 5CCGD 2NPSA 5KJ7D 5KJ7C 3HD7A 2HG5D 4N78E 3PP5A 1SFCA 2M8RA 3HD7C 1SFCC 1SFCD 1URQB 3TSIA 2XDJA 1N7SD 1L4AA 4OH8B 4W7YA 3RL0B 3RK2B 2H8PD 4JF7A 2NPSC 1URQA 1SFCB 4WY4B 5CCHA 1N7SC 1KILA 5CCGA 5CCHD 3RK2D 2NPSD 1KILB 3B5NB 1N7SB 3RK3D 4WY4D 4WY4C 5KJ7A 4WY4A 3RK3B 3VOPA 3RK3C 1GL2D 1GL2C
chains in the Genus database with same CATH superfamily
3HE4A 3TDKA 2BCCE 2WSEJ 2YXRB 3HTKB 3L72J 1NU1E 1ZN5A 4OWFA 3RK2C 2O01N 3L70E 3VMAA 2FFDA 1SQVD 4L73A 2HYNA 1NVOA 5BVZA 3TNUA 3SSUA 5CBNA 1T6AA 3H1IE 4Z1MH 2QEXP 2HR3A 2E42A 4JYCA 4RKUJ 2IYOA 1DD3A 3CX5E 4IFFA 2ZT9D 1LTGC 1PGPA 1EDIA 1EC5A 4HKZH 3SWYA 1NWQA 2QIWA 2R5BA 2YXQB 1W2EA 2L5GB 3AE5C 3M9QA 4L75A 1M1KQ 3H1JG 3L71G 3AE8C 2AXTH 3CWBD 3M06A 4D6TG 1PGJA 2O01H 2O1JA 1CI6A 2MKVA 1J1EC 1K73Q 5KLIC 3NMDA 2QJPC 1GL2B 3A3YB 1LTIC 4W80A 5KLIB 4ZKUA 1FZBA 1PPJG 3CWBG 4L74A 4ASWA 1XTGB 4D6TJ 4D6TD 3FX0A 4LLHA 4UB8E 3WU2H 3L75D 2A45I 2W6JH 1KN7A 1YTZI 3GHGC 5KAIH 1JTHB 2OYIB 5TISE 1HUCA 1NTKD 2R44A 3HE5A 2BCCJ 4PJ0E 3AE2C 1S1CX 2YIUC 3LIEA 3TGUJ 2M3BA 3CMAP 3CCEP 5DJTB 3AE1C 1NTKG 3H25A 1NTMD 3CCSP 1AVOA 3L72G 1N73A 1OW6A 2IZ1A 3USSA 2PP6A 1OVRA 3R4YA 4NPEA 3Q1MA 3Q2YA 3G6EP 1Q90D 1NTMG 2K9JB 5B5EE 3L72D 2M0BA 1BCCJ 1FDOA 2G8YA 2N1TD 2IZ0A 1KILD 3JSVC 1A02J 1Q2NA 2B87B 3N4XA 5APSA 1ZLLA 4TT3H 3W68A 1N73B 2HPCA 2IFNA 5KAFH 2CPSA 1JMMA 4N78E 3PHLA 5KLVG 3PP5A 4R4LA 3BVHA 3CC2P 2LXBA 3A0BE 3ZDMA 3GMAA 1GZLA 1P84H 2JDIH 2ZYAA 3HD7C 1NKNA 1PL5A 3WMM0 5GTHE 1SQQE 3MIWA 1GTWA 5AVYB 2GA1A 1KYOH 3IN6A 5APXA 3KZIH 2OYOA 4XA4A 3CCVP 2A06E 3L73D 2ZFCA 2K37A 2P10A 3L4FA 5AVQB 1NH4A 3L37A 1LNQA 1VF5D 2H89C 3EWKA 1PP9J 1KYOI 1MZ9A 2YIUB 3H1KJ 2BCCD 3L73G 2GUSA 4W7YA 1SQXE 3TGUD 2H8PD 5AVTB 2BEQD 4Y99B 1L0LK 4JF7A 2E74C 2E5YA 3E1IA 2VRSA 1EQ7A 1N2DC 3D70A 1FZGA 1NU1K 3K5BA 3KXDA 1ZMEC 2E76D 1BCCG 3AEDC 1SQVG 2AEFA 3V2RA 5B66H 1FAVA 2XKMA 2ITAA 2KP8A 4HH2A 2RMZA 4C7RA 1PGOA 4I2LC 4JPZB 4WVZA 1BE3E 5C39A 3H1HE 5TJHA 3RK3D 2Y0DA 3G3ZA 1KILA 4BRYA 1J1DB 1QLED 5CCHD 1PIXA 2ZAEB 2NPSD 3M9BA 2NZ2A 2IDBA 1KILB 2Z5IA 2ZJSE 5AW7B 1CZQA 1SQPG 2KSEA 3VTPC 1EZVI 4PD4E 3FXEA 3CL3D 3M0DA 3GF3A 1M1JC 5AW3B 3H1KD 2IFMA 1SQPD 1IK9A 1SQXJ 1PFIA 5AW4B 2FXPA 3V2NA 1P84I 1JY3N 1Z56A 3C9IA 5E79E 2FYNB 1OWAA 5AVXB 3VOPA 4ASVA 3Q5PA 3S1KA 3AEBC 4JQ0D 1RF1A 4K35A 1VQ7P 2KLUA 3RBXA 2QJPB 3H1LJ 1ZR4A 2KSJA 5B5EH 1IFDA 1RF1C 4EOTA 1EZVE 4PD4I 3CMEP 1CI6B 1Y9BA 1KILE 4LGDE 3VMYA 4H44B 3VN0A 1BE3J 2WPRA 3NFQA 1SS1A 2Y0CA 1KQGB 1LT9C 3AECC 3C8VA 3CWBJ 1T3JA 5CCHC 1YHQP 1KTMA 4XE5B 2C9LY 1FZCA 1JY3P 1IFPA 2IPPA 1L4AD 5CMZA 3Q5RA 1OVUA 1NTZG 2LKMA 1IFMA 2QG4A 1SVFA 2IBZE 1RF0C 1NAYA 2E43A 1WRGA 2JEEA 5BU5A 1SQBG 2ZT9B 3B71A 3L70G 5KLVD 1NYHA 1BGYG 1VQMP 1D7MA 1JO5A 2ZXXA 1URQD 1FZEA 1IC2A 3WUUA 1VQLP 1ZP0C 1NHLA 1S5LX 2HODA 1SQBD 3L70J 1JCCA 3L70D 3MZWB 4H13B 1RQUA 2YMYA 1LTAC 1YJWP 1M8OB 3A2AA 4NPDA 1VQKP 5AVRB 2K9JA 2ZYGA 3H1JE 3L71E 2ZYDA 3CX5D 1NJIQ 3GG2A 2Z4EA 3L74E 2J5UA 1X9VA 2KS1B 3RL0C 3CCRP 3KPEA 3CC4P 1AVYA 1JY2O 1R5LA 2YKQA 2O3JA 3B5NC 4GOFA 4LC1A 1HVVA 3CWBE 4N6JA 1E5WA 2YKOA 2FYZA 3A0HE 2WMMA 3B5NA 1T2KC 3VP8A 5B66E 1Y47A 3SFEC 2WSFJ 3BCCG 4U7JA 3AEAC 3NTNA 1QEXA 3SFDC 3ABVC 3HD7D 5CJ4A 3L75E 1JTHA 2P67A 1AJYA 2FYUD 1RE4C 4DOJA 1VQNP 3H1HD 3LIDA 1QL1A 2WSCJ 4DZOA 3Q3DA 1JUNA 3H32B 1DX7A 2QSIA 1SP4A 3MUDC 3CCJP 2QRXA 2D2CD 3CX5H 3S9OA 1YIJP 4JYBA 2CPBA 4H13C 1X0TA 3P7KA 1H88A 2P7JA 1JEKA 1KMIZ 2RKLA 1PZQA 4PD4H 4PD4D 1SFCC 3AEGC 1EXJA 1KZUB 2E74B 1LT1A 2JWDA 1NTKK 3UIAA 1OW8A 4A7PA 3CX5I 1S5LH 1YITP 1G2CA 3Q5SA 1LTSC 2KIKA 3M9HA 1FZCC 1IZNB 1S3JA 3H1KG 4UB8H 1E79H 1XTCC 3H1HJ 4HYTB 1N7SD 1BDDA 4UB6H 1L4AA 4DJGA 1GU4A 1DH3A 3AEFC 4N78D 3HTKA 1VQ4P 3RL0B 3RK2B 3TNUB 2C0WA 1L0NE 1KD1Q 1BSHA 4GKGA 2IBZI 1MFTA 3G9RA 2NPSC 1S4XA 2K9YA 1URQA 3MTUE 1Q7YQ 4M3LA 2OYIC 4WY4D 1NO4A 2M5AA 1SQQD 3HE4B 2V4HA 2RH0A 1OX3A 4BWNA 2L91A 4EYYQ 5APTA 3CCQP 2YKPA 1L0NK 1K9MQ 3EQ2A 1EDKA 4WY4B 3G71P 2OYHB 1EDJA 2K88A 2A06D 3L73E 2H43A 2FFDC 2KLVA 2C9NY 3KQGA 4I7ZB 3II6A 1SQXG 1LJ2A 2FYUE 1FE6A 1WMKA 2ZT9C 4U3FD 3CXHD 4WBAA 5KLVJ 1VQ5P 1ZRTD 3FGAD 1YQ4C 3VMXA 4H0LC 2YNYA 3GW6A 1VQOP 2CK3H 5KAFE 2XV5A 1SQXD 4I6MC 3TGUE 3EFGA 3RGUA 1RF0A 3B5NB 1OMIA 1RY3A 1MV8A 1SQVE 1KQFB 1PP9G 3L73J 1LT9B 2Y9ZA 5GTHH 1L0LD 2R32A 3CXHI 4IL6E 3A5TA 1BE3G 3KHUA 1HTLC 1KYOE 2QM7A 3TYYA 3U59A 2OYHA 1K8AQ 1RE4A 2FY8A 3L74J 2PAJA 3H1IG 4PV1B 5KJ7A 1FJPA 1LTJA 1LWUC 2M5AB 3H1LG 4GODA 3A0HH 2OTJP 1BE3D 3NXSA 2UWJE 3B8EB 1GL2D 3O6QB 1KB9D 1KQLA 1DD4A 5AW0B 2D2CC 5BU8B 5GTIH 1BSNA 4AYCA 2J58A 3BRTB 1LP1A 3H1LD 4Y99C 1PGQA 4Y28J 1UIXA 2BASA 3KYQA 2KB7P 2KUBA 2C0XA 2KOGA 1YQ3C 1PPJE 3BCCD 3MGNA 1L4AB 1R8EA 1SQQK 1KILC 3OW2O 1FBMA 3C1LA 3JCUH 1FZCB 1GK6A 1HWTC 1IK7A 2XNXA 3P32A 1G2CB 2BCCG 4KT0J 4C46A 5KTBA 2XNDH 4I7ZC 3VP9A 3G4SP 3QWOC 4ZMDA 4U3FE 1JNMA 1VQ9P 3PH0A 4BXLA 1NTKJ 2JJLA 2POHA 1EDLA 4W7ZA 3QH9A 5AW5B 3HD7B 4AQRD 1NOHA 1EZVD 1CSBA 1LWUB 1R5SA 2I1KA 3R2PA 1OVVA 3CD6P 4PV1C 1K04A 1VF5C 2NPSB 4UB6E 1N73C 3BCCJ 4JBZA 1L0LE 1VQ8P 3CI9A 2A45G 1JY3O 3U1CA 1BGYE 2OARA 2Y0EA 2M3EA 1IFJA 1HGVA 1JB0J 3FWLA 5E79H 1AV1A 2N1TA 1KB9E 4H0LB 1L4AC 3CPWO 3P8CE 1LTBC 1SQBK 1FC2C 2FYUK 1HGZA 2KNCA 1X79B 4AUWA 5AW9B 1L2PA 1RE3C 1RHZB 1SQQG 1M1JA 2Q3EA 3N7NA 1JCDA 1OXZA 4NPFX 1KC8Q 3GHGB 1YTZT 1SQQJ 1NTKE 1PPJD 1ZRTE 1J2JB 2A06G 2WPSA 2XU6A 3BATA 3L36A 5KJ7D 2WITA 4IFDK 1SFCA 2H88C 1QGKB 3HUSC 4N3YB 3L74D 1S72P 1Q81Q 1P84D 2M8RA 2YO3A 1KV4A 1RH5B 2PGDA 2N9YB 1YJ9P 1NTME 2W90A 2RN0A 1J1EB 4WWIA 4ZNCA 1L0LJ 1TU3F 4IOIH 4H0LD 1FOSF 3IF4A 3LW5H 3TSIA 1H0TA 1ZR2A 4HJGH 3D6ZA 1VQ6P 2W27A 2WWWA 3OJAB 2KI7B 4C7NB 3TK1A 3PJSK 4TLFA 1FS0E 1GMJA 1IO4A 1NTMJ 5GTIE 1SQPJ 1PV3A 4OH8B 1AQTA 5KLVK 1KB9I 1SLQA 1YJNP 2WT7A 1QL2A 1SQPK 1Y8AA 1FOSE 2OTLP 1H0TB 2B88A 2KYVA 3V6IA 1RF1B 1AA0A 1QX8A 4EDFA 3H1KE 3P8CD 1SQPE 3V2PA 2E76C 3JCUE 1BDCA 1EXIA 1DEEG 2JR8A 3MD0A 1FDMA 2A45H 3MHVA 2QVAA 2E74D 4QMAA 2B87A 4YXDC 4DCKA 1N7SC 2KZJA 2WPVB 1M1JB 2H7HA 2JKVA 3H1JJ 3L71J 1T3UA 3GLMA 5H2FH 3RK2D 5CBOA 2XZRA 1L0ND 2WSFH 1NU1D 4EIJA 2Q9IA 4ZKPA 1VL2A 5AVZB 2IYPA 2WTYA 1MKMA 3CCMP 4H44C 2FXOA 3OAKA 5APUA 1MFZA 1N7SB 1NTZD 1RQVA 1SQVJ 4OGQC 5KAIE 3D6YA 4I1LA 3H1IJ 4BRYB 1NU1G 1G1JA 3I55P 1EZVG 1GU5A 4XFJA 1NTZK 1BGYD 1U57A 2E5TA 2W6BA 3AE7C 3H1HG 1S5LE 2FXMA 3HE5B 3F5HA 2BEZF 5EFWB 3WUTA 1OFCX 1VPCA 1VF5B 2HODB 2YMKA 2ZVOB 3FWNA 4HB1A 4IFMA 4U3FJ 3T97A 5DJUB 3CC7P 3RK3C 1GL2C 2B89A 5APVA 1HH0A 1T2KD 4K3AA 1USEA 4GT1A 2HFED 1GL2A 3B4SA 1H89A 1N8RQ 1SQBE 1QVFO 1GD2E 1OIPA 3B5ND 4D6TE 4IL6X 4YXWH 1KFNA 1U7JA 3RL0D 2WT7B 1YBKA 2N1TC 4OGQB 1JM0A 1K05A 2Z5HA 1T8ZA 3A7OA 4YPCA 4C7NA 2PFXA 1FU1A 2HLOA 1A02F 1U7MA 3LW5J 5CCGC 1KYOD 3A0BH 2I1JA 3OA7A 2DW3A 5APQA 1P84E 3FXDA 3ITKA 2V7QJ 2WPQA 3U1AA 3P8MC 2ZXEB 1YI2P 2N9BA 1DIPA 2R3CA 1KFMA 1M56D 1IFNA 2AEJA 3EFFK 3IAOA 4RESB 1URQC 3L74G 2OYHC 1LP1B 3T97B 3I56P 2WZ7A 2D2CB 2O1KA 2P1JA 4KHXA 5AW1B 5KKZB 1S9KE 3AEEC 3L72E 2KXPB 1HJBA 2Q3IA 3O8ZA 1G1IA 1BCCD 1N86A 1NTZE 2QJYB 5APWA 1ZV8A 4GDOA 1LTJB 2E75C 2E75D 2IBZG 4MN4C 3BCCE 2WSCH 1LGHB 4IL6H 1H8AA 2HPCB 2WQYC 3AE3C 1N7SA 4WB4A 2Y9YA 4U3FG 1HJ0A 3SWFA 5AW8B 2WVRA 1OZHA 2QM8A 1M57D 2LXCB 1OW7A 2B9BA 2NRGA 2QJKB 3RBZA 2FYUJ 2Q5UA 4GOEA 5KLVE 3PLNA 3VMZA 3CXHH 2N1TB 2P2UA 3V4QA 2AXCA 1FZAA 3IR9A 3E7KA 1L0LG 2Q1KA 3M0DC 4O9BA 3V4WA 3W67A 2OYIA 1N7LA 3V5BA 1GW4A 2NPSA 3AE4C 5CCGD 5K5GB 2O01J 2QJYC 2K3RA 3V2QA 3H1ID 4B86A 1LTJC 1LWUA 1ZOYC 2E75B 2I8DA 3H1JD 3L71D 5H2FE 5KJ7C 3TF5A 3HD7A 2HG5D 2AEMA 2G3AA 1NTMK 5M1BA 2LR2A 3IFMA 4H13D 3PRJA 3L75J 3BASA 1JOCA 1FDIA 1SFCD 2SPZA 1W2BO 1CW5A 1W5CE 1URQB 5AVVB 1QVGO 1SQVK 2AXTE 1GK4A 1L0NG 2KK7A 2R3SA 3L75G 2Q6QA 3CLQA 1KORA 5AW2B 3RK3E 3GF7A 5AVUB 2XDJA 1S9KD 4EI2A 3M91A 1GDTA 1L0NJ 1FJKA 1ZW0A 3MP7B 1HF9A 5L8RJ 2P58A 3WU2E 1BCCE 1LTTC 2OTKE 2QJKC 1J1DC 2JP3A 1PP9D 4L76A 4OGQD 2IX7C 3AE9C 3JC22 5TISH 4H44D 4PJ0H 5CJ0A 1Q86Q 2W6AA 1MUUA 2FYUG 4PV1D 2GM4A 1Q82Q 2OQQA 1JY2P 3O6QA 3L35A 4YTPC 2FFDB 2ZVNB 1SFCB 2PRRA 3H6PA 3CCUP 3WUVA 1S2EA 2FBWC 2GUVA 1USDA 2QA4P 3KDPB 3PTZA 3HUSB 1ZXGA 1KB9H 2FKWB 3GHGA 3D71A 5KKZC 1M90Q 2YO2A 4OVNF 3H32A 1NU1J 3BRVB 2OGUA 1YYCA 1UIIA 2KNCB 5AVSB 1LT9A 3TGUG 5CCHA 1HBWA 2Q7CA 1JMBA 3RL0g 1FZFA 3HRNA 1JY2N 5CCGA 3CCLP 2K1AA 2QE7H 1SQBJ 3AE6C 3E1RA 2MJZA 1BGYJ 4DT0A 3H1LE 4KJMA 1KQSO 2WSEH 1AFOA 1NAFA 2JWAA 1AQ5A 2WSSH 2W83C 2V7QH 5APYA 1X8YA 4RO0A 1NTZJ 1NKZB 1VQPP 3M0AA 1M7LA 4R4MA 2KS1A 5CHXA 1RE3A 3VYIA 2W8ZA 1DEBA 4RJTA 5AW6B 4GIFA 1IFIA 4WY4C 2E76B 3KZIE 4CPGA 2KZIA 3MUDA 2FYNC 2IBZD 2JO1A 1SQXK 1X22A 4WY4A 3F89A 5AVWB 3RK3B 3S4RA 1WT6A 3SWKA 1IJDB 2R5DA 3CXHE 1VDFA 2J59M 1GW3A 3HUSA 3I5CA 1PP9E 1NGMB
chains in the Genus database with same CATH topology
3HE4A 3HTKB 3RK2C 2FFDA 1ZN5A 2HYNA 5BVZA 3TNUA 2E42A 4JYCA 4IFFA 1LTGC 3SWYA 1NWQA 3M9QA 2R5BA 1W2EA 2L5GB 3M06A 2O01H 2O1JA 1CI6A 1J1EC 3NMDA 3A3YB 1GL2B 1LTIC 4W80A 4ZKUA 1FZBA 1XTGB 4LLHA 2A45I 1YTZI 3GHGC 1JTHB 2OYIB 1HUCA 3HE5A 3LIEA 2M3BA 2PP6A 2N1TD 1A02J 1KILD 3N4XA 5APSA 1ZLLA 2HPCA 2IFNA 2CPSA 1JMMA 4N78E 3BVHA 3PP5A 1GZLA 3HD7C 1NKNA 3WMM0 3MIWA 1GTWA 5AVYB 5APXA 4XA4A 2ZFCA 3L4FA 5AVQB 1NH4A 3L37A 1MZ9A 4W7YA 2GUSA 2H8PD 5AVTB 4Y99B 1L0LK 4JF7A 3E1IA 2VRSA 1EQ7A 1N2DC 1FZGA 1NU1K 3V2RA 1FAVA 2XKMA 2KP8A 4HH2A 4C7RA 4I2LC 3G3ZA 1KILA 1J1DB 5CCHD 3M9BA 2NPSD 1KILB 2Z5IA 5AW7B 1CZQA 3VTPC 3CL3D 3M0DA 1M1JC 5AW3B 2IFMA 1IK9A 1PFIA 5AW4B 3V2NA 1JY3N 1Z56A 3C9IA 1OWAA 5AVXB 3VOPA 1RF1A 1ZR4A 2KSJA 1IFDA 1RF1C 4EOTA 1CI6B 4LGDE 3VN0A 2WPRA 3NFQA 1LT9C 5CCHC 1T3JA 4XE5B 1FZCA 1JY3P 2IPPA 1L4AD 5CMZA 2LKMA 1IFMA 1SVFA 1RF0C 2E43A 1WRGA 2JEEA 5BU5A 1JO5A 1URQD 1FZEA 1IC2A 1NHLA 2HODA 1JCCA 2YMYA 1LTAC 3A2AA 5AVRB 2Z4EA 3RL0C 1X9VA 3KPEA 1JY2O 2YKQA 3B5NC 4LC1A 1HVVA 4N6JA 1E5WA 2YKOA 2FYZA 1T2KC 3B5NA 3VP8A 3NTNA 3HD7D 5CJ4A 1JTHA 2P67A 1RE4C 4DOJA 3LIDA 4DZOA 1QL1A 1JUNA 3H32B 1DX7A 1SP4A 4JYBA 2CPBA 1H88A 3P7KA 2P7JA 1SFCC 1KZUB 3UIAA 1NTKK 1G2CA 1LTSC 3M9HA 1FZCC 1XTCC 4HYTB 1N7SD 1L4AA 1GU4A 1DH3A 4N78D 3HTKA 3RL0B 3RK2B 3TNUB 2C0WA 4GKGA 2NPSC 1N73B 4IFDK 1URQA 3MTUE 2C9LY 4M3LA 2OYIC 1NO4A 3HE4B 5APTA 2YKPA 1L0NK 3EQ2A 4WY4B 2OYHB 2H43A 2C9NY 2FFDC 2KLVA 3KQGA 3II6A 1AQ5A 4WBAA 3VMXA 2YNYA 2XV5A 4I6MC 3EFGA 1RF0A 3B5NB 1RY3A 1MV8A 1LT9B 2R32A 3A5TA 3U59A 2OYHA 1HTLC 2QM7A 3TYYA 1FJPA 1RE4A 5KJ7A 2PAJA 1LTJA 1LWUC 3NXSA 3B8EB 1GL2D 1KQLA 5AW0B 5BU8B 4AYCA 2J58A 3BRTB 4Y99C 2BASA 3KYQA 2KB7P 2C0XA 2KOGA 3MGNA 1L4AB 1SQQK 1KILC 1FBMA 1FZCB 1GK6A 1HWTC 3P32A 2XNXA 5KTBA 1G2CB 4C46A 3VP9A 1JNMA 2JJLA 2POHA 4W7ZA 5AW5B 4AQRD 3HD7B 1NOHA 1CSBA 1LWUB 2I1KA 3R2PA 2NPSB 1N73C 3CI9A 2A45G 1JY3O 3U1CA 2OARA 1IFJA 1HGVA 2N1TA 1L4AC 3P8CE 1LTBC 1SQBK 2FYUK 1HGZA 1X79B 4AUWA 5AW9B 1RE3C 3N7NA 1M1JA 1JCDA 1OXZA 3GHGB 1YTZT 3BATA 5KJ7D 1J2JB 2WPSA 3L36A 2XU6A 2WITA 1SFCA 3HUSC 4N3YB 2YO3A 2M8RA 1J1EB 1FOSF 3LW5H 3TSIA 1ZR2A 2W27A 2WWWA 3OJAB 4C7NB 3TK1A 1IO4A 4OH8B 5KLVK 1SLQA 2WT7A 1QL2A 1SQPK 1RF1B 2KYVA 3P8CD 3V2PA 3MD0A 2A45H 1N7SC 1M1JB 2H7HA 1T3UA 3RK2D 2XZRA 2WSFH 4EIJA 2Q9IA 2WTYA 5AVZB 3OAKA 5APUA 1MFZA 1N7SB 4I1LA 1G1JA 1GU5A 1NTZK 2W6BA 4WY4D 3RK3D 3HE5B 2FXMA 1VPCA 2HODB 4IFMA 4ZKPA 3T97A 3RK3C 1GL2C 5APVA 1HH0A 1T2KD 1H89A 4GT1A 2HFED 1GL2A 1GD2E 3B5ND 1KFNA 3RL0D 2WT7B 2N1TC 4C7NA 2Z5HA 1FDMA 1T8ZA 3A7OA 1FU1A 2HLOA 1A02F 5CCGC 2I1JA 3OA7A 5APQA 2WPQA 3U1AA 3P8MC 2ZXEB 2N9BA 2R3CA 1KFMA 1IFNA 4RESB 1URQC 2OYHC 2WZ7A 2O1KA 2P1JA 4KHXA 5AW1B 1S9KE 1HJBA 2Q3IA 3O8ZA 1G1IA 5APWA 1N86A 3VMYA 1ZV8A 1LTJB 2HPCB 2WSCH 1LGHB 1H8AA 1N7SA 4WB4A 3SWFA 5AW8B 2QM8A 2Q5UA 3VMZA 2N1TB 2P2UA 3V4QA 1FZAA 3IR9A 3M0DC 4O9BA 3V4WA 2OYIA 1N7LA 3V5BA 1GW4A 2NPSA 5CCGD 1FOSE 3V2QA 4B86A 1LTJC 1LWUA 5KJ7C 3HD7A 2HG5D 1NTMK 3IFMA 3BASA 1JOCA 1SFCD 1CW5A 1URQB 5AVVB 1N73A 1SQVK 1GK4A 5AW2B 3CLQA 5AVUB 2XDJA 1S9KD 3M91A 1GDTA 1FJKA 1LTTC 1J1DC 2IX7C 5CJ0A 2W6AA 1MUUA 2GM4A 1JY2P 3L35A 2FFDB 1SFCB 3H6PA 2GUVA 3KDPB 3HUSB 2FKWB 3GHGA 2YO2A 3H32A 3BRVB 1YYCA 5AVSB 1LT9A 5CCHA 1HBWA 2Q7CA 1FZFA 3HRNA 1JY2N 5CCGA 2MJZA 2WSEH 1AFOA 1NAFA 5APYA 1X8YA 1NKZB 3M0AA 1M7LA 5CHXA 3VYIA 1RE3A 1DEBA 5AW6B 4GIFA 1IFIA 4WY4C 3MUDA 5AVWB 1SQXK 4WY4A 3RK3B 1WT6A 3I5CA 1IJDB 2R5DA 1VDFA 2J59M 1GW3A 3HUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFE D;  1GL2 A;  3HTK B;  3RK2 C;  3B5N D;  4LGD E;  3KYQ A;  3RL0 D;  2N1T C;  2KOG A;  5CCH C;  1T3J A;  1L4A B;  1KIL C;  5CCG C;  1L4A D;  1URQ C;  1URQ D;  1GL2 B;  2WZ7 A;  4W7Z A;  1NHL A;  4W80 A;  3HD7 B;  1XTG B;  2YMY A;  2NPS B;  1JTH B;  1N7S A;  3RL0 C;  3B5N C;  1HVV A;  2N1T A;  3B5N A;  1L4A C;  2N1T B;  2PP6 A;  3P8C E;  3M0D C;  2N1T D;  3HD7 D;  1JTH A;  1KIL D;  5CCG D;  2NPS A;  5KJ7 D;  5KJ7 C;  3HD7 A;  2HG5 D;  4N78 E;  3PP5 A;  1SFC A;  2M8R A;  3HD7 C;  1SFC C;  1SFC D;  1URQ B;  3TSI A;  2XDJ A;  1N7S D;  1L4A A;  4OH8 B;  4W7Y A;  3RL0 B;  3RK2 B;  2H8P D;  4JF7 A;  2NPS C;  1URQ A;  1SFC B;  4WY4 B;  5CCH A;  1N7S C;  1KIL A;  5CCG A;  5CCH D;  3RK2 D;  2NPS D;  1KIL B;  3B5N B;  1N7S B;  3RK3 D;  4WY4 D;  4WY4 C;  5KJ7 A;  4WY4 A;  3RK3 B;  3VOP A;  3RK3 C;  1GL2 D;  1GL2 C; 
#chains in the Genus database with same CATH topology
 3HE4 A;  3TDK A;  2BCC E;  2WSE J;  2YXR B;  3HTK B;  3L72 J;  1NU1 E;  1ZN5 A;  4OWF A;  3RK2 C;  2O01 N;  3L70 E;  3VMA A;  2FFD A;  1SQV D;  4L73 A;  2HYN A;  1NVO A;  5BVZ A;  3TNU A;  3SSU A;  5CBN A;  1T6A A;  3H1I E;  4Z1M H;  2QEX P;  2HR3 A;  2E42 A;  4JYC A;  4RKU J;  2IYO A;  1DD3 A;  3CX5 E;  4IFF A;  2ZT9 D;  1LTG C;  1PGP A;  1EDI A;  1EC5 A;  4HKZ H;  3SWY A;  1NWQ A;  2QIW A;  2R5B A;  2YXQ B;  1W2E A;  2L5G B;  3AE5 C;  3M9Q A;  4L75 A;  1M1K Q;  3H1J G;  3L71 G;  3AE8 C;  2AXT H;  3CWB D;  3M06 A;  4D6T G;  1PGJ A;  2O01 H;  2O1J A;  1CI6 A;  2MKV A;  1J1E C;  1K73 Q;  5KLI C;  3NMD A;  2QJP C;  1GL2 B;  3A3Y B;  1LTI C;  4W80 A;  5KLI B;  4ZKU A;  1FZB A;  1PPJ G;  3CWB G;  4L74 A;  4ASW A;  1XTG B;  4D6T J;  4D6T D;  3FX0 A;  4LLH A;  4UB8 E;  3WU2 H;  3L75 D;  2A45 I;  2W6J H;  1KN7 A;  1YTZ I;  3GHG C;  5KAI H;  1JTH B;  2OYI B;  5TIS E;  1HUC A;  1NTK D;  2R44 A;  3HE5 A;  2BCC J;  4PJ0 E;  3AE2 C;  1S1C X;  2YIU C;  3LIE A;  3TGU J;  2M3B A;  3CMA P;  3CCE P;  5DJT B;  3AE1 C;  1NTK G;  3H25 A;  1NTM D;  3CCS P;  1AVO A;  3L72 G;  1N73 A;  1OW6 A;  2IZ1 A;  3USS A;  2PP6 A;  1OVR A;  3R4Y A;  4NPE A;  3Q1M A;  3Q2Y A;  3G6E P;  1Q90 D;  1NTM G;  2K9J B;  5B5E E;  3L72 D;  2M0B A;  1BCC J;  1FDO A;  2G8Y A;  2N1T D;  2IZ0 A;  1KIL D;  3JSV C;  1A02 J;  1Q2N A;  2B87 B;  3N4X A;  5APS A;  1ZLL A;  4TT3 H;  3W68 A;  1N73 B;  2HPC A;  2IFN A;  5KAF H;  2CPS A;  1JMM A;  4N78 E;  3PHL A;  5KLV G;  3PP5 A;  4R4L A;  3BVH A;  3CC2 P;  2LXB A;  3A0B E;  3ZDM A;  3GMA A;  1GZL A;  1P84 H;  2JDI H;  2ZYA A;  3HD7 C;  1NKN A;  1PL5 A;  3WMM 0;  5GTH E;  1SQQ E;  3MIW A;  1GTW A;  5AVY B;  2GA1 A;  1KYO H;  3IN6 A;  5APX A;  3KZI H;  2OYO A;  4XA4 A;  3CCV P;  2A06 E;  3L73 D;  2ZFC A;  2K37 A;  2P10 A;  3L4F A;  5AVQ B;  1NH4 A;  3L37 A;  1LNQ A;  1VF5 D;  2H89 C;  3EWK A;  1PP9 J;  1KYO I;  1MZ9 A;  2YIU B;  3H1K J;  2BCC D;  3L73 G;  2GUS A;  4W7Y A;  1SQX E;  3TGU D;  2H8P D;  5AVT B;  2BEQ D;  4Y99 B;  1L0L K;  4JF7 A;  2E74 C;  2E5Y A;  3E1I A;  2VRS A;  1EQ7 A;  1N2D C;  3D70 A;  1FZG A;  1NU1 K;  3K5B A;  3KXD A;  1ZME C;  2E76 D;  1BCC G;  3AED C;  1SQV G;  2AEF A;  3V2R A;  5B66 H;  1FAV A;  2XKM A;  2ITA A;  2KP8 A;  4HH2 A;  2RMZ A;  4C7R A;  1PGO A;  4I2L C;  4JPZ B;  4WVZ A;  1BE3 E;  5C39 A;  3H1H E;  5TJH A;  3RK3 D;  2Y0D A;  3G3Z A;  1KIL A;  4BRY A;  1J1D B;  1QLE D;  5CCH D;  1PIX A;  2ZAE B;  2NPS D;  3M9B A;  2NZ2 A;  2IDB A;  1KIL B;  2Z5I A;  2ZJS E;  5AW7 B;  1CZQ A;  1SQP G;  2KSE A;  3VTP C;  1EZV I;  4PD4 E;  3FXE A;  3CL3 D;  3M0D A;  3GF3 A;  1M1J C;  5AW3 B;  3H1K D;  2IFM A;  1SQP D;  1IK9 A;  1SQX J;  1PFI A;  5AW4 B;  2FXP A;  3V2N A;  1P84 I;  1JY3 N;  1Z56 A;  3C9I A;  5E79 E;  2FYN B;  1OWA A;  5AVX B;  3VOP A;  4ASV A;  3Q5P A;  3S1K A;  3AEB C;  4JQ0 D;  1RF1 A;  4K35 A;  1VQ7 P;  2KLU A;  3RBX A;  2QJP B;  3H1L J;  1ZR4 A;  2KSJ A;  5B5E H;  1IFD A;  1RF1 C;  4EOT A;  1EZV E;  4PD4 I;  3CME P;  1CI6 B;  1Y9B A;  1KIL E;  4LGD E;  3VMY A;  4H44 B;  3VN0 A;  1BE3 J;  2WPR A;  3NFQ A;  1SS1 A;  2Y0C A;  1KQG B;  1LT9 C;  3AEC C;  3C8V A;  3CWB J;  1T3J A;  5CCH C;  1YHQ P;  1KTM A;  4XE5 B;  2C9L Y;  1FZC A;  1JY3 P;  1IFP A;  2IPP A;  1L4A D;  5CMZ A;  3Q5R A;  1OVU A;  1NTZ G;  2LKM A;  1IFM A;  2QG4 A;  1SVF A;  2IBZ E;  1RF0 C;  1NAY A;  2E43 A;  1WRG A;  2JEE A;  5BU5 A;  1SQB G;  2ZT9 B;  3B71 A;  3L70 G;  5KLV D;  1NYH A;  1BGY G;  1VQM P;  1D7M A;  1JO5 A;  2ZXX A;  1URQ D;  1FZE A;  1IC2 A;  3WUU A;  1VQL P;  1ZP0 C;  1NHL A;  1S5L X;  2HOD A;  1SQB D;  3L70 J;  1JCC A;  3L70 D;  3MZW B;  4H13 B;  1RQU A;  2YMY A;  1LTA C;  1YJW P;  1M8O B;  3A2A A;  4NPD A;  1VQK P;  5AVR B;  2K9J A;  2ZYG A;  3H1J E;  3L71 E;  2ZYD A;  3CX5 D;  1NJI Q;  3GG2 A;  2Z4E A;  3L74 E;  2J5U A;  1X9V A;  2KS1 B;  3RL0 C;  3CCR P;  3KPE A;  3CC4 P;  1AVY A;  1JY2 O;  1R5L A;  2YKQ A;  2O3J A;  3B5N C;  4GOF A;  4LC1 A;  1HVV A;  3CWB E;  4N6J A;  1E5W A;  2YKO A;  2FYZ A;  3A0H E;  2WMM A;  3B5N A;  1T2K C;  3VP8 A;  5B66 E;  1Y47 A;  3SFE C;  2WSF J;  3BCC G;  4U7J A;  3AEA C;  3NTN A;  1QEX A;  3SFD C;  3ABV C;  3HD7 D;  5CJ4 A;  3L75 E;  1JTH A;  2P67 A;  1AJY A;  2FYU D;  1RE4 C;  4DOJ A;  1VQN P;  3H1H D;  3LID A;  1QL1 A;  2WSC J;  4DZO A;  3Q3D A;  1JUN A;  3H32 B;  1DX7 A;  2QSI A;  1SP4 A;  3MUD C;  3CCJ P;  2QRX A;  2D2C D;  3CX5 H;  3S9O A;  1YIJ P;  4JYB A;  2CPB A;  4H13 C;  1X0T A;  3P7K A;  1H88 A;  2P7J A;  1JEK A;  1KMI Z;  2RKL A;  1PZQ A;  4PD4 H;  4PD4 D;  1SFC C;  3AEG C;  1EXJ A;  1KZU B;  2E74 B;  1LT1 A;  2JWD A;  1NTK K;  3UIA A;  1OW8 A;  4A7P A;  3CX5 I;  1S5L H;  1YIT P;  1G2C A;  3Q5S A;  1LTS C;  2KIK A;  3M9H A;  1FZC C;  1IZN B;  1S3J A;  3H1K G;  4UB8 H;  1E79 H;  1XTC C;  3H1H J;  4HYT B;  1N7S D;  1BDD A;  4UB6 H;  1L4A A;  4DJG A;  1GU4 A;  1DH3 A;  3AEF C;  4N78 D;  3HTK A;  1VQ4 P;  3RL0 B;  3RK2 B;  3TNU B;  2C0W A;  1L0N E;  1KD1 Q;  1BSH A;  4GKG A;  2IBZ I;  1MFT A;  3G9R A;  2NPS C;  1S4X A;  2K9Y A;  1URQ A;  3MTU E;  1Q7Y Q;  4M3L A;  2OYI C;  4WY4 D;  1NO4 A;  2M5A A;  1SQQ D;  3HE4 B;  2V4H A;  2RH0 A;  1OX3 A;  4BWN A;  2L91 A;  4EYY Q;  5APT A;  3CCQ P;  2YKP A;  1L0N K;  1K9M Q;  3EQ2 A;  1EDK A;  4WY4 B;  3G71 P;  2OYH B;  1EDJ A;  2K88 A;  2A06 D;  3L73 E;  2H43 A;  2FFD C;  2KLV A;  2C9N Y;  3KQG A;  4I7Z B;  3II6 A;  1SQX G;  1LJ2 A;  2FYU E;  1FE6 A;  1WMK A;  2ZT9 C;  4U3F D;  3CXH D;  4WBA A;  5KLV J;  1VQ5 P;  1ZRT D;  3FGA D;  1YQ4 C;  3VMX A;  4H0L C;  2YNY A;  3GW6 A;  1VQO P;  2CK3 H;  5KAF E;  2XV5 A;  1SQX D;  4I6M C;  3TGU E;  3EFG A;  3RGU A;  1RF0 A;  3B5N B;  1OMI A;  1RY3 A;  1MV8 A;  1SQV E;  1KQF B;  1PP9 G;  3L73 J;  1LT9 B;  2Y9Z A;  5GTH H;  1L0L D;  2R32 A;  3CXH I;  4IL6 E;  3A5T A;  1BE3 G;  3KHU A;  1HTL C;  1KYO E;  2QM7 A;  3TYY A;  3U59 A;  2OYH A;  1K8A Q;  1RE4 A;  2FY8 A;  3L74 J;  2PAJ A;  3H1I G;  4PV1 B;  5KJ7 A;  1FJP A;  1LTJ A;  1LWU C;  2M5A B;  3H1L G;  4GOD A;  3A0H H;  2OTJ P;  1BE3 D;  3NXS A;  2UWJ E;  3B8E B;  1GL2 D;  3O6Q B;  1KB9 D;  1KQL A;  1DD4 A;  5AW0 B;  2D2C C;  5BU8 B;  5GTI H;  1BSN A;  4AYC A;  2J58 A;  3BRT B;  1LP1 A;  3H1L D;  4Y99 C;  1PGQ A;  4Y28 J;  1UIX A;  2BAS A;  3KYQ A;  2KB7 P;  2KUB A;  2C0X A;  2KOG A;  1YQ3 C;  1PPJ E;  3BCC D;  3MGN A;  1L4A B;  1R8E A;  1SQQ K;  1KIL C;  3OW2 O;  1FBM A;  3C1L A;  3JCU H;  1FZC B;  1GK6 A;  1HWT C;  1IK7 A;  2XNX A;  3P32 A;  1G2C B;  2BCC G;  4KT0 J;  4C46 A;  5KTB A;  2XND H;  4I7Z C;  3VP9 A;  3G4S P;  3QWO C;  4ZMD A;  4U3F E;  1JNM A;  1VQ9 P;  3PH0 A;  4BXL A;  1NTK J;  2JJL A;  2POH A;  1EDL A;  4W7Z A;  3QH9 A;  5AW5 B;  3HD7 B;  4AQR D;  1NOH A;  1EZV D;  1CSB A;  1LWU B;  1R5S A;  2I1K A;  3R2P A;  1OVV A;  3CD6 P;  4PV1 C;  1K04 A;  1VF5 C;  2NPS B;  4UB6 E;  1N73 C;  3BCC J;  4JBZ A;  1L0L E;  1VQ8 P;  3CI9 A;  2A45 G;  1JY3 O;  3U1C A;  1BGY E;  2OAR A;  2Y0E A;  2M3E A;  1IFJ A;  1HGV A;  1JB0 J;  3FWL A;  5E79 H;  1AV1 A;  2N1T A;  1KB9 E;  4H0L B;  1L4A C;  3CPW O;  3P8C E;  1LTB C;  1SQB K;  1FC2 C;  2FYU K;  1HGZ A;  2KNC A;  1X79 B;  4AUW A;  5AW9 B;  1L2P A;  1RE3 C;  1RHZ B;  1SQQ G;  1M1J A;  2Q3E A;  3N7N A;  1JCD A;  1OXZ A;  4NPF X;  1KC8 Q;  3GHG B;  1YTZ T;  1SQQ J;  1NTK E;  1PPJ D;  1ZRT E;  1J2J B;  2A06 G;  2WPS A;  2XU6 A;  3BAT A;  3L36 A;  5KJ7 D;  2WIT A;  4IFD K;  1SFC A;  2H88 C;  1QGK B;  3HUS C;  4N3Y B;  3L74 D;  1S72 P;  1Q81 Q;  1P84 D;  2M8R A;  2YO3 A;  1KV4 A;  1RH5 B;  2PGD A;  2N9Y B;  1YJ9 P;  1NTM E;  2W90 A;  2RN0 A;  1J1E B;  4WWI A;  4ZNC A;  1L0L J;  1TU3 F;  4IOI H;  4H0L D;  1FOS F;  3IF4 A;  3LW5 H;  3TSI A;  1H0T A;  1ZR2 A;  4HJG H;  3D6Z A;  1VQ6 P;  2W27 A;  2WWW A;  3OJA B;  2KI7 B;  4C7N B;  3TK1 A;  3PJS K;  4TLF A;  1FS0 E;  1GMJ A;  1IO4 A;  1NTM J;  5GTI E;  1SQP J;  1PV3 A;  4OH8 B;  1AQT A;  5KLV K;  1KB9 I;  1SLQ A;  1YJN P;  2WT7 A;  1QL2 A;  1SQP K;  1Y8A A;  1FOS E;  2OTL P;  1H0T B;  2B88 A;  2KYV A;  3V6I A;  1RF1 B;  1AA0 A;  1QX8 A;  4EDF A;  3H1K E;  3P8C D;  1SQP E;  3V2P A;  2E76 C;  3JCU E;  1BDC A;  1EXI A;  1DEE G;  2JR8 A;  3MD0 A;  1FDM A;  2A45 H;  3MHV A;  2QVA A;  2E74 D;  4QMA A;  2B87 A;  4YXD C;  4DCK A;  1N7S C;  2KZJ A;  2WPV B;  1M1J B;  2H7H A;  2JKV A;  3H1J J;  3L71 J;  1T3U A;  3GLM A;  5H2F H;  3RK2 D;  5CBO A;  2XZR A;  1L0N D;  2WSF H;  1NU1 D;  4EIJ A;  2Q9I A;  4ZKP A;  1VL2 A;  5AVZ B;  2IYP A;  2WTY A;  1MKM A;  3CCM P;  4H44 C;  2FXO A;  3OAK A;  5APU A;  1MFZ A;  1N7S B;  1NTZ D;  1RQV A;  1SQV J;  4OGQ C;  5KAI E;  3D6Y A;  4I1L A;  3H1I J;  4BRY B;  1NU1 G;  1G1J A;  3I55 P;  1EZV G;  1GU5 A;  4XFJ A;  1NTZ K;  1BGY D;  1U57 A;  2E5T A;  2W6B A;  3AE7 C;  3H1H G;  1S5L E;  2FXM A;  3HE5 B;  3F5H A;  2BEZ F;  5EFW B;  3WUT A;  1OFC X;  1VPC A;  1VF5 B;  2HOD B;  2YMK A;  2ZVO B;  3FWN A;  4HB1 A;  4IFM A;  4U3F J;  3T97 A;  5DJU B;  3CC7 P;  3RK3 C;  1GL2 C;  2B89 A;  5APV A;  1HH0 A;  1T2K D;  4K3A A;  1USE A;  4GT1 A;  2HFE D;  1GL2 A;  3B4S A;  1H89 A;  1N8R Q;  1SQB E;  1QVF O;  1GD2 E;  1OIP A;  3B5N D;  4D6T E;  4IL6 X;  4YXW H;  1KFN A;  1U7J A;  3RL0 D;  2WT7 B;  1YBK A;  2N1T C;  4OGQ B;  1JM0 A;  1K05 A;  2Z5H A;  1T8Z A;  3A7O A;  4YPC A;  4C7N A;  2PFX A;  1FU1 A;  2HLO A;  1A02 F;  1U7M A;  3LW5 J;  5CCG C;  1KYO D;  3A0B H;  2I1J A;  3OA7 A;  2DW3 A;  5APQ A;  1P84 E;  3FXD A;  3ITK A;  2V7Q J;  2WPQ A;  3U1A A;  3P8M C;  2ZXE B;  1YI2 P;  2N9B A;  1DIP A;  2R3C A;  1KFM A;  1M56 D;  1IFN A;  2AEJ A;  3EFF K;  3IAO A;  4RES B;  1URQ C;  3L74 G;  2OYH C;  1LP1 B;  3T97 B;  3I56 P;  2WZ7 A;  2D2C B;  2O1K A;  2P1J A;  4KHX A;  5AW1 B;  5KKZ B;  1S9K E;  3AEE C;  3L72 E;  2KXP B;  1HJB A;  2Q3I A;  3O8Z A;  1G1I A;  1BCC D;  1N86 A;  1NTZ E;  2QJY B;  5APW A;  1ZV8 A;  4GDO A;  1LTJ B;  2E75 C;  2E75 D;  2IBZ G;  4MN4 C;  3BCC E;  2WSC H;  1LGH B;  4IL6 H;  1H8A A;  2HPC B;  2WQY C;  3AE3 C;  1N7S A;  4WB4 A;  2Y9Y A;  4U3F G;  1HJ0 A;  3SWF A;  5AW8 B;  2WVR A;  1OZH A;  2QM8 A;  1M57 D;  2LXC B;  1OW7 A;  2B9B A;  2NRG A;  2QJK B;  3RBZ A;  2FYU J;  2Q5U A;  4GOE A;  5KLV E;  3PLN A;  3VMZ A;  3CXH H;  2N1T B;  2P2U A;  3V4Q A;  2AXC A;  1FZA A;  3IR9 A;  3E7K A;  1L0L G;  2Q1K A;  3M0D C;  4O9B A;  3V4W A;  3W67 A;  2OYI A;  1N7L A;  3V5B A;  1GW4 A;  2NPS A;  3AE4 C;  5CCG D;  5K5G B;  2O01 J;  2QJY C;  2K3R A;  3V2Q A;  3H1I D;  4B86 A;  1LTJ C;  1LWU A;  1ZOY C;  2E75 B;  2I8D A;  3H1J D;  3L71 D;  5H2F E;  5KJ7 C;  3TF5 A;  3HD7 A;  2HG5 D;  2AEM A;  2G3A A;  1NTM K;  5M1B A;  2LR2 A;  3IFM A;  4H13 D;  3PRJ A;  3L75 J;  3BAS A;  1JOC A;  1FDI A;  1SFC D;  2SPZ A;  1W2B O;  1CW5 A;  1W5C E;  1URQ B;  5AVV B;  1QVG O;  1SQV K;  2AXT E;  1GK4 A;  1L0N G;  2KK7 A;  2R3S A;  3L75 G;  2Q6Q A;  3CLQ A;  1KOR A;  5AW2 B;  3RK3 E;  3GF7 A;  5AVU B;  2XDJ A;  1S9K D;  4EI2 A;  3M91 A;  1GDT A;  1L0N J;  1FJK A;  1ZW0 A;  3MP7 B;  1HF9 A;  5L8R J;  2P58 A;  3WU2 E;  1BCC E;  1LTT C;  2OTK E;  2QJK C;  1J1D C;  2JP3 A;  1PP9 D;  4L76 A;  4OGQ D;  2IX7 C;  3AE9 C;  3JC2 2;  5TIS H;  4H44 D;  4PJ0 H;  5CJ0 A;  1Q86 Q;  2W6A A;  1MUU A;  2FYU G;  4PV1 D;  2GM4 A;  1Q82 Q;  2OQQ A;  1JY2 P;  3O6Q A;  3L35 A;  4YTP C;  2FFD B;  2ZVN B;  1SFC B;  2PRR A;  3H6P A;  3CCU P;  3WUV A;  1S2E A;  2FBW C;  2GUV A;  1USD A;  2QA4 P;  3KDP B;  3PTZ A;  3HUS B;  1ZXG A;  1KB9 H;  2FKW B;  3GHG A;  3D71 A;  5KKZ C;  1M90 Q;  2YO2 A;  4OVN F;  3H32 A;  1NU1 J;  3BRV B;  2OGU A;  1YYC A;  1UII A;  2KNC B;  5AVS B;  1LT9 A;  3TGU G;  5CCH A;  1HBW A;  2Q7C A;  1JMB A;  3RL0 g;  1FZF A;  3HRN A;  1JY2 N;  5CCG A;  3CCL P;  2K1A A;  2QE7 H;  1SQB J;  3AE6 C;  3E1R A;  2MJZ A;  1BGY J;  4DT0 A;  3H1L E;  4KJM A;  1KQS O;  2WSE H;  1AFO A;  1NAF A;  2JWA A;  1AQ5 A;  2WSS H;  2W83 C;  2V7Q H;  5APY A;  1X8Y A;  4RO0 A;  1NTZ J;  1NKZ B;  1VQP P;  3M0A A;  1M7L A;  4R4M A;  2KS1 A;  5CHX A;  1RE3 A;  3VYI A;  2W8Z A;  1DEB A;  4RJT A;  5AW6 B;  4GIF A;  1IFI A;  4WY4 C;  2E76 B;  3KZI E;  4CPG A;  2KZI A;  3MUD A;  2FYN C;  2IBZ D;  2JO1 A;  1SQX K;  1X22 A;  4WY4 A;  3F89 A;  5AVW B;  3RK3 B;  3S4R A;  1WT6 A;  3SWK A;  1IJD B;  2R5D A;  3CXH E;  1VDF A;  2J59 M;  1GW3 A;  3HUS A;  3I5C A;  1PP9 E;  1NGM B; 
#chains in the Genus database with same CATH homology
 3HE4 A;  3HTK B;  3RK2 C;  2FFD A;  1ZN5 A;  2HYN A;  5BVZ A;  3TNU A;  2E42 A;  4JYC A;  4IFF A;  1LTG C;  3SWY A;  1NWQ A;  3M9Q A;  2R5B A;  1W2E A;  2L5G B;  3M06 A;  2O01 H;  2O1J A;  1CI6 A;  1J1E C;  3NMD A;  3A3Y B;  1GL2 B;  1LTI C;  4W80 A;  4ZKU A;  1FZB A;  1XTG B;  4LLH A;  2A45 I;  1YTZ I;  3GHG C;  1JTH B;  2OYI B;  1HUC A;  3HE5 A;  3LIE A;  2M3B A;  2PP6 A;  2N1T D;  1A02 J;  1KIL D;  3N4X A;  5APS A;  1ZLL A;  2HPC A;  2IFN A;  2CPS A;  1JMM A;  4N78 E;  3BVH A;  3PP5 A;  1GZL A;  3HD7 C;  1NKN A;  3WMM 0;  3MIW A;  1GTW A;  5AVY B;  5APX A;  4XA4 A;  2ZFC A;  3L4F A;  5AVQ B;  1NH4 A;  3L37 A;  1MZ9 A;  4W7Y A;  2GUS A;  2H8P D;  5AVT B;  4Y99 B;  1L0L K;  4JF7 A;  3E1I A;  2VRS A;  1EQ7 A;  1N2D C;  1FZG A;  1NU1 K;  3V2R A;  1FAV A;  2XKM A;  2KP8 A;  4HH2 A;  4C7R A;  4I2L C;  3G3Z A;  1KIL A;  1J1D B;  5CCH D;  3M9B A;  2NPS D;  1KIL B;  2Z5I A;  5AW7 B;  1CZQ A;  3VTP C;  3CL3 D;  3M0D A;  1M1J C;  5AW3 B;  2IFM A;  1IK9 A;  1PFI A;  5AW4 B;  3V2N A;  1JY3 N;  1Z56 A;  3C9I A;  1OWA A;  5AVX B;  3VOP A;  1RF1 A;  1ZR4 A;  2KSJ A;  1IFD A;  1RF1 C;  4EOT A;  1CI6 B;  4LGD E;  3VN0 A;  2WPR A;  3NFQ A;  1LT9 C;  5CCH C;  1T3J A;  4XE5 B;  1FZC A;  1JY3 P;  2IPP A;  1L4A D;  5CMZ A;  2LKM A;  1IFM A;  1SVF A;  1RF0 C;  2E43 A;  1WRG A;  2JEE A;  5BU5 A;  1JO5 A;  1URQ D;  1FZE A;  1IC2 A;  1NHL A;  2HOD A;  1JCC A;  2YMY A;  1LTA C;  3A2A A;  5AVR B;  2Z4E A;  3RL0 C;  1X9V A;  3KPE A;  1JY2 O;  2YKQ A;  3B5N C;  4LC1 A;  1HVV A;  4N6J A;  1E5W A;  2YKO A;  2FYZ A;  1T2K C;  3B5N A;  3VP8 A;  3NTN A;  3HD7 D;  5CJ4 A;  1JTH A;  2P67 A;  1RE4 C;  4DOJ A;  3LID A;  4DZO A;  1QL1 A;  1JUN A;  3H32 B;  1DX7 A;  1SP4 A;  4JYB A;  2CPB A;  1H88 A;  3P7K A;  2P7J A;  1SFC C;  1KZU B;  3UIA A;  1NTK K;  1G2C A;  1LTS C;  3M9H A;  1FZC C;  1XTC C;  4HYT B;  1N7S D;  1L4A A;  1GU4 A;  1DH3 A;  4N78 D;  3HTK A;  3RL0 B;  3RK2 B;  3TNU B;  2C0W A;  4GKG A;  2NPS C;  1N73 B;  4IFD K;  1URQ A;  3MTU E;  2C9L Y;  4M3L A;  2OYI C;  1NO4 A;  3HE4 B;  5APT A;  2YKP A;  1L0N K;  3EQ2 A;  4WY4 B;  2OYH B;  2H43 A;  2C9N Y;  2FFD C;  2KLV A;  3KQG A;  3II6 A;  1AQ5 A;  4WBA A;  3VMX A;  2YNY A;  2XV5 A;  4I6M C;  3EFG A;  1RF0 A;  3B5N B;  1RY3 A;  1MV8 A;  1LT9 B;  2R32 A;  3A5T A;  3U59 A;  2OYH A;  1HTL C;  2QM7 A;  3TYY A;  1FJP A;  1RE4 A;  5KJ7 A;  2PAJ A;  1LTJ A;  1LWU C;  3NXS A;  3B8E B;  1GL2 D;  1KQL A;  5AW0 B;  5BU8 B;  4AYC A;  2J58 A;  3BRT B;  4Y99 C;  2BAS A;  3KYQ A;  2KB7 P;  2C0X A;  2KOG A;  3MGN A;  1L4A B;  1SQQ K;  1KIL C;  1FBM A;  1FZC B;  1GK6 A;  1HWT C;  3P32 A;  2XNX A;  5KTB A;  1G2C B;  4C46 A;  3VP9 A;  1JNM A;  2JJL A;  2POH A;  4W7Z A;  5AW5 B;  4AQR D;  3HD7 B;  1NOH A;  1CSB A;  1LWU B;  2I1K A;  3R2P A;  2NPS B;  1N73 C;  3CI9 A;  2A45 G;  1JY3 O;  3U1C A;  2OAR A;  1IFJ A;  1HGV A;  2N1T A;  1L4A C;  3P8C E;  1LTB C;  1SQB K;  2FYU K;  1HGZ A;  1X79 B;  4AUW A;  5AW9 B;  1RE3 C;  3N7N A;  1M1J A;  1JCD A;  1OXZ A;  3GHG B;  1YTZ T;  3BAT A;  5KJ7 D;  1J2J B;  2WPS A;  3L36 A;  2XU6 A;  2WIT A;  1SFC A;  3HUS C;  4N3Y B;  2YO3 A;  2M8R A;  1J1E B;  1FOS F;  3LW5 H;  3TSI A;  1ZR2 A;  2W27 A;  2WWW A;  3OJA B;  4C7N B;  3TK1 A;  1IO4 A;  4OH8 B;  5KLV K;  1SLQ A;  2WT7 A;  1QL2 A;  1SQP K;  1RF1 B;  2KYV A;  3P8C D;  3V2P A;  3MD0 A;  2A45 H;  1N7S C;  1M1J B;  2H7H A;  1T3U A;  3RK2 D;  2XZR A;  2WSF H;  4EIJ A;  2Q9I A;  2WTY A;  5AVZ B;  3OAK A;  5APU A;  1MFZ A;  1N7S B;  4I1L A;  1G1J A;  1GU5 A;  1NTZ K;  2W6B A;  4WY4 D;  3RK3 D;  3HE5 B;  2FXM A;  1VPC A;  2HOD B;  4IFM A;  4ZKP A;  3T97 A;  3RK3 C;  1GL2 C;  5APV A;  1HH0 A;  1T2K D;  1H89 A;  4GT1 A;  2HFE D;  1GL2 A;  1GD2 E;  3B5N D;  1KFN A;  3RL0 D;  2WT7 B;  2N1T C;  4C7N A;  2Z5H A;  1FDM A;  1T8Z A;  3A7O A;  1FU1 A;  2HLO A;  1A02 F;  5CCG C;  2I1J A;  3OA7 A;  5APQ A;  2WPQ A;  3U1A A;  3P8M C;  2ZXE B;  2N9B A;  2R3C A;  1KFM A;  1IFN A;  4RES B;  1URQ C;  2OYH C;  2WZ7 A;  2O1K A;  2P1J A;  4KHX A;  5AW1 B;  1S9K E;  1HJB A;  2Q3I A;  3O8Z A;  1G1I A;  5APW A;  1N86 A;  3VMY A;  1ZV8 A;  1LTJ B;  2HPC B;  2WSC H;  1LGH B;  1H8A A;  1N7S A;  4WB4 A;  3SWF A;  5AW8 B;  2QM8 A;  2Q5U A;  3VMZ A;  2N1T B;  2P2U A;  3V4Q A;  1FZA A;  3IR9 A;  3M0D C;  4O9B A;  3V4W A;  2OYI A;  1N7L A;  3V5B A;  1GW4 A;  2NPS A;  5CCG D;  1FOS E;  3V2Q A;  4B86 A;  1LTJ C;  1LWU A;  5KJ7 C;  3HD7 A;  2HG5 D;  1NTM K;  3IFM A;  3BAS A;  1JOC A;  1SFC D;  1CW5 A;  1URQ B;  5AVV B;  1N73 A;  1SQV K;  1GK4 A;  5AW2 B;  3CLQ A;  5AVU B;  2XDJ A;  1S9K D;  3M91 A;  1GDT A;  1FJK A;  1LTT C;  1J1D C;  2IX7 C;  5CJ0 A;  2W6A A;  1MUU A;  2GM4 A;  1JY2 P;  3L35 A;  2FFD B;  1SFC B;  3H6P A;  2GUV A;  3KDP B;  3HUS B;  2FKW B;  3GHG A;  2YO2 A;  3H32 A;  3BRV B;  1YYC A;  5AVS B;  1LT9 A;  5CCH A;  1HBW A;  2Q7C A;  1FZF A;  3HRN A;  1JY2 N;  5CCG A;  2MJZ A;  2WSE H;  1AFO A;  1NAF A;  5APY A;  1X8Y A;  1NKZ B;  3M0A A;  1M7L A;  5CHX A;  3VYI A;  1RE3 A;  1DEB A;  5AW6 B;  4GIF A;  1IFI A;  4WY4 C;  3MUD A;  5AVW B;  1SQX K;  4WY4 A;  3RK3 B;  1WT6 A;  3I5C A;  1IJD B;  2R5D A;  1VDF A;  2J59 M;  1GW3 A;  3HUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...