4WY4B

Crystal structure of autophagic snare complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
b'ESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4B00
3RK2C 1L4AA 1N7SD 1N7SA 1NHLA 1KILB 4LGDE 4WY4D 5CCHA 1SFCD 2WZ7A 1SFCA 1KILA 3RK3D 4N78E 2NPSD 2YMYA 3RK2B 2M8RA 2HFED 5CCGD 3HTKB 1URQC 1L4AD 2H8PD 3B5NC 3KYQA 5CCHD 1KILD 1HVVA 5KJ7C 1URQB 3VOPA 3B5NB 1URQA 3RK2D 3HD7C 4W80A 1GL2C 2N1TC 3B5NA 2XDJA 2PP6A 2KOGA 3P8CE 4WY4C 3TSIA 3PP5A 5KJ7D 5KJ7A 3M0DC 3RK3C 2NPSC 3HD7B 1GL2B 1XTGB 2N1TB 3HD7D 3HD7A 3RL0C 1GL2A 1URQD 2N1TD 5CCGC 2N1TA 4WY4B 4W7ZA 1SFCB 3B5ND 1L4AC 1JTHB 4WY4A 3RK3B 2NPSB 1N7SC 1T3JA 2HG5D 4OH8B 1JTHA 5CCHC 2NPSA 4JF7A 1SFCC 3RL0B 4W7YA 1KILC 3RL0D 1L4AB 5CCGA 1N7SB 1GL2D
chains in the Genus database with same CATH superfamily
3TGUD 3LIDA 4ZKPA 4IFMA 1NTKJ 3N4XA 2WZ7A 1NAYA 1G1JA 4Y99B 4EI2A 4RKUJ 3A0BH 5CCGD 3NMDA 5GTHH 2YIUB 1GZLA 3K5BA 4UB6H 4YXDC 4XE5B 1KYOI 1FOSE 1P84E 3GMAA 3VOPA 1RE3C 1YITP 4OWFA 1LT9C 1JUNA 3VMAA 3OJAB 2ZYGA 2QRXA 2C9NY 3E1RA 2JEEA 4I7ZB 3HD7B 5B5EH 1NTZJ 3S1KA 3AE5C 1GU4A 1SP4A 3HD7A 1IFIA 2BCCD 5KLVE 1JTHB 3H1KD 1KYOD 3G4SP 2HG5D 4L75A 1FZCB 1JTHA 2ZYDA 3IF4A 1SQBK 3RL0B 2WPSA 4D6TG 1RF0A 1PGOA 1R5SA 2W83C 4OGQC 2V7QJ 3L73J 1A02J 3D71A 2J59M 3H1HG 3HUSB 3EFGA 3HUSA 5AW5B 3I56P 1DIPA 2KB7P 5CMZA 1BGYJ 1SQBD 3CX5E 2PAJA 1K8AQ 1KQFB 1N73B 1OXZA 2D2CC 1NOHA 1N73A 2E42A 3L71G 3GG2A 1DX7A 3CMAP 1J2JB 1OW7A 1NJIQ 4JBZA 1WRGA 3M9QA 5BU5A 3H1LG 4U3FE 1SQPD 3IAOA 4OVNF 2KZJA 3AE2C 3LW5J 1RHZB 3EFFK 2ZVOB 1M1KQ 1R8EA 3TSIA 5AW9B 1DEEG 3BVHA 3CCLP 5KLIB 2NPSC 2O01H 3BCCJ 2N1TB 1EQ7A 4TLFA 1USDA 3VMZA 3CXHH 1MFTA 4GIFA 2N1TA 1LTSC 1LT1A 1CSBA 4WY4B 4B86A 3WUUA 1EDIA 2GUSA 4IOIH 4WY4A 2Q3EA 3GLMA 3AE9C 5AVTB 1P84I 2CPBA 1MV8A 5CCHC 4GT1A 1BE3G 3P7KA 2L5GB 3CL3D 3KZIH 1L0NE 2IYOA 1YYCA 1L0LG 1NYHA 3RK2C 4LLHA 4H13C 1EZVG 1GK4A 3AE6C 2YNYA 4N78E 1M1JC 5KKZB 3F5HA 4R4LA 5E79E 1Q81Q 3HE5B 4WWIA 4EYYQ 2ZT9B 3HE5A 1S3JA 1VPCA 2MKVA 1BE3E 3O6QB 3L71J 2WTYA 2AXCA 3PH0A 3O6QA 2FYUG 5CJ0A 3L37A 3L74J 4H0LB 3QWOC 1FC2C 5APUA 3D6YA 4NPDA 3CX5I 1PPJG 1T2KC 2Q9IA 5TJHA 5KLVD 3R2PA 1GL2B 2O1JA 1GL2A 5AVWB 2QSIA 1S5LH 2FYZA 3A0BE 1L4AC 5GTHE 2QJYB 1NO4A 4K3AA 4UB6E 1OZHA 2OTJP 3L72J 3TDKA 3RBXA 2DW3A 3AEFC 1CI6B 5AVVB 5B66E 3CX5D 1SQQG 4ZMDA 1CI6A 2IDBA 1PPJE 3W68A 1CZQA 2IYPA 1OW8A 3M06A 3OW2O 5APYA 4WY4D 1DD4A 1PZQA 3Q5RA 1MUUA 2I8DA 3ITKA 3HTKB 3U59A 1KQSO 5B5EE 1JMBA 1VF5B 3HTKA 1VQ5P 4L74A 4U3FD 2Y9YA 2QIWA 1AA0A 2BASA 3CCUP 3TNUA 3H1JJ 1NTMG 2KI7B 1YHQP 1SQQE 1YJ9P 4RESB 4ZKUA 1MKMA 2QJPB 2XKMA 1VQ6P 1Q86Q 2POHA 1L0NK 3LW5H 2K9JB 2ZT9D 2FYUJ 4C46A 2KOGA 4AUWA 1NU1J 3FWNA 3L70J 3T97B 2K9JA 2M3EA 2XU6A 2IBZG 4JQ0D 3T97A 4AYCA 2P2UA 1J1EC 1PP9G 5CCGC 1SFCB 1L0ND 4UB8E 4H0LD 5H2FH 4H44D 2P58A 3JCUE 3IFMA 1GW4A 3GHGB 2QG4A 2WITA 2HPCB 3CI9A 1ZW0A 3GHGA 3AECC 2HPCA 3CWBE 3VYIA 4N78D 1GL2D 1QVGO 3E1IA 1KN7A 3UIAA 1X9VA 3ABVC 2HODB 1HTLC 3MD0A 2ZYAA 4LGDE 2R3CA 1GD2E 1FE6A 2E75B 4YTPC 1HJ0A 2E76C 4GOFA 2K88A 1PP9E 1FZGA 2QJKB 2WPVB 1LTJC 1BE3D 1NTKG 1JNMA 3TGUJ 3CXHE 3HE4B 3CCMP 4KT0J 2J5UA 3HE4A 1SQVE 4K35A 1WT6A 1KFMA 1ZLLA 5KJ7C 4I6MC 2B87B 1AJYA 2Q1KA 2YO3A 3KXDA 4HB1A 2B87A 3AE1C 1VQ4P 3I5CA 2Y0CA 1X79B 1RQVA 5GTIE 1VF5D 1FZBA 1Q2NA 4PD4H 3O8ZA 3M0DC 2WT7B 1KD1Q 2FFDB 4JYBA 4YPCA 3M9HA 2WT7A 2FFDA 5M1BA 1QL1A 1FJPA 3V4WA 2G8YA 4W7YA 2OQQA 2QVAA 2MJZA 4C7RA 3BRTB 1LTGC 4Y99C 2HR3A 4L76A 2P1JA 2B89A 2BCCJ 2M3BA 3H1KJ 3L73G 1FU1A 1SFCD 2Q6QA 2XNDH 2YIUC 2IFMA 5AW1B 5KAIH 2NRGA 5C39A 3A3YB 3A0HH 2FXOA 1SQXE 4BRYB 4BWNA 5APQA 4BRYA 1NTZE 2XZRA 3N7NA 1LTIC 1HWTC 1S5LE 1QX8A 1SQBJ 2E75D 1QLED 2N9YB 3V4QA 4I7ZC 3HD7C 3E7KA 2OYIB 1FDOA 3L73E 1HGZA 2CK3H 2OYIA 3P32A 1IFPA 1UIIA 1RF0C 1AV1A 1OVVA 1BGYE 1ZV8A 3CXHI 3RL0C 1ZMEC 5EFWB 3KHUA 4O9BA 3C1LA 3H1IJ 5AW8B 3HUSC 3VP8A 1LTBC 3BCCG 1VQLP 3CWBD 1T3JA 1LP1B 4WB4A 5CJ4A 1H8AA 3LIEA 1K9MQ 2W6AA 1JO5A 1LP1A 2Y0DA 2W6JH 1RF1B 1PP9D 1SQVK 1N73C 2BEZF 1DH3A 1N7SD 4GDOA 1RF1A 1NHLA 2C0XA 3WUTA 2H88C 1Q7YQ 1KB9H 2KSJA 4LC1A 4R4MA 1RE4A 2GUVA 1KQLA 1FZCA 2R44A 1IFNA 1IJDB 1M57D 1RH5B 1SQVD 3BCCE 3JSVC 1S5LX 2Z5HA 3WU2E 1NKNA 2JJLA 3KYQA 1PGQA 1PGPA 2I1KA 3TK1A 4RO0A 1SQPK 3OA7A 5KLIC 3KQGA 5KAFH 1L2PA 1S4XA 3FWLA 2N1TC 2WSCJ 2ZFCA 4HH2A 3P8CE 4WY4C 4D6TE 3L74G 2A06D 3H1HE 1EDKA 3A5TA 2B88A 2YKOA 3PRJA 4ASWA 1S2EA 3CC2P 3WMM0 1LWUB 1DD3A 1N7LA 1SQXK 2NZ2A 1LWUA 1VQOP 1IO4A 1IK7A 3AEBC 3SWYA 1NTZK 2JP3A 1LJ2A 1ZRTE 2IX7C 5BVZA 3L71E 2OTLP 2Z4EA 5KKZC 2LXBA 4A7PA 2ZXEB 1SQXD 1N86A 2V4HA 3L72G 4N3YB 3I55P 3L74E 1IC2A 3EWKA 2HLOA 1AQ5A 1NTZD 3H1LE 2O01N 3FXDA 4CPGA 1KTMA 3A2AA 2KK7A 1K05A 1OWAA 3B4SA 3SSUA 4JPZB 2KXPB 1EC5A 4H0LC 2I1JA 2J58A 2KS1B 4GKGA 3CCQP 2KS1A 3B5NB 1PGJA 2N9BA 3IR9A 1GL2C 3H1JG 1BSNA 2ZVNB 3B5NA 4HYTB 1P84D 1BGYD 1JY2N 3PHLA 3P8MC 3II6A 4JYCA 3PP5A 2KLUA 5AVXB 3NFQA 5CBNA 2OYHB 5KLVK 1L0LE 2FBWC 2QJYC 4IL6H 2OYHA 1NU1G 3A0HE 3L70G 3KDPB 3S4RA 2YXRB 1WMKA 3AE4C 4H44B 3QH9A 1EZVE 4EIJA 1ZP0C 2QM7A 2AEJA 1A02F 1N2DC 1NWQA 2W8ZA 3AEDC 5AVZB 2XNXA 1UIXA 1EXIA 3PLNA 3AEAC 1L0NJ 1VF5C 3SWKA 2WMMA 5APSA 1JY3N 2WQYC 2FYUE 3AE7C 1NU1E 2HFED 3L70E 1NGMB 2Y0EA 2Q5UA 3RK3E 2OYOA 4DOJA 2QJPC 2H7HA 1AVOA 4NPFX 3P8CD 3TGUG 4D6TD 5DJTB 3H25A 3FXEA 1KILE 2RKLA 3Q1MA 3H1HD 3CCEP 1J1DB 2WSCH 3L75J 4L73A 1JCDA 3L36A 1NVOA 1LTAC 4XA4A 3GHGC 2FKWB 1E5WA 3CCVP 2G3AA 2LKMA 1ZRTD 4I1LA 4YXWH 1G2CB 3CMEP 3B5ND 3D70A 3RK3B 3L71D 1G2CA 1FS0E 4DCKA 1BCCJ 1FDIA 2E75C 1YIJP 1PL5A 1VL2A 3L74D 1OX3A 1FZAA 3H1LD 2IFNA 2QJKC 1KILB 3ZDMA 5KAFE 1SFCA 1NTME 1KILA 2M0BA 1NH4A 2BCCG 1GDTA 3EQ2A 2LXCB 2AXTH 2JO1A 1BSHA 3H1KG 1EZVI 2P7JA 3MUDA 1JOCA 1AFOA 2H8PD 1L0LK 3BATA 2IBZE 3C8VA 2HODA 1YQ3C 2H43A 5TISH 3HRNA 3BASA 4DT0A 2KSEA 1X0TA 5AVUB 1U7JA 1YI2P 1IK9A 2FFDC 1L0LD 1SQBG 3M0AA 2PP6A 3FX0A 3H32B 2KNCB 2E74B 2O1KA 3H32A 2KNCA 1EZVD 3Q3DA 4TT3H 1H88A 1YJNP 1OIPA 3KZIE 3BRVB 1OFCX 4Z1MH 4IFDK 3M9BA 4DJGA 1N8RQ 2P10A 2JKVA 1SQPG 1VQPP 4JF7A 1G1IA 5APXA 3H1IG 1NTKE 4HKZH 1QEXA 2B9BA 1N7SB 1SQBE 3G9RA 2VRSA 2FYUD 1N7SA 1NU1D 1ZN5A 3L70D 3CWBJ 4C7NB 1YJWP 3RK3D 3W67A 1PPJD 2XV5A 4C7NA 1Q82Q 1T6AA 4IL6E 1M8OB 4AQRD 1DEBA 1SQQK 1KC8Q 1X22A 2OYIC 2WSEJ 1KILD 5E79H 1W2BO 2WPRA 4HJGH 3H1IE 2A45H 1JEKA 3VP9A 1HVVA 3V2PA 1URQB 1JB0J 4EDFA 1IFJA 1URQA 1KV4A 1SQVJ 3B8EB 1SQQD 2K1AA 2FYNB 4N6JA 4EOTA 3G6EP 2OGUA 1SS1A 2FXPA 1SLQA 1CW5A 3CC4P 1VQKP 1NTMK 2QEXP 1VQ7P 5AW7B 2IBZI 2WSFJ 1RF1C 3NTNA 2E74D 1RE4C 3RL0g 1FZCC 4KHXA 1NTMD 1HGVA 1SQPJ 1KQGB 3KPEA 3CLQA 4PV1B 3Q5SA 5APWA 3VMYA 5KLVG 1W2EA 5AVQB 5B66H 1AQTA 2YMYA 2OTKE 2IBZD 3VMXA 1AVYA 3GF3A 4IL6X 1FZFA 1HJBA 2E76D 1SQXJ 3G71P 3PTZA 3MTUE 3V2NA 1JCCA 3U1CA 2W90A 3CXHD 2ZJSE 1D7MA 4W80A 2Y9ZA 1ZXGA 1ZR4A 1NTKK 3SWFA 1LWUC 2AEMA 5H2FE 5KJ7D 3H6PA 1RE3A 1LT9B 5AW2B 3CCSP 2FXMA 3PJSK 4U3FG 1LT9A 3TF5A 1URQD 1MZ9A 4W7ZA 2AXTE 5AVRB 2Q3IA 1NTKD 1SVFA 3FGAD 1IZNB 2Q7CA 2R32A 3MHVA 1GTWA 3MP7B 5AVYB 5TISE 4UB8H 4KJMA 1OW6A 3JCUH 3AE8C 3U1AA 1U57A 4Y28J 1BDDA 2WPQA 4OGQB 1H0TB 4WVZA 1EDJA 1H0TA 5KLVJ 1S9KE 1L0NG 1HH0A 1VQMP 3H1ID 3CC7P 1YQ4C 2ITAA 1PV3A 2W6BA 1TU3F 2JWDA 3B5NC 1Y9BA 4PV1D 2ZT9C 2D2CB 2WSEH 1KYOH 1KORA 4PD4E 1HF9A 3VN0A 3C9IA 2A45G 3AEEC 2OYHC 3AE3C 2OARA 3CD6P 3V2RA 4H44C 1YBKA 3L73D 3TYYA 3V6IA 1S72P 3HD7D 4MN4C 3L75G 5GTIH 4D6TJ 2R3SA 3L72E 1VDFA 1OVRA 1XTCC 3RGUA 3H1HJ 2GM4A 2NPSB 2YMKA 2WSFH 4U3FJ 1MFZA 4PJ0H 1EXJA 1FBMA 1JY2O 2NPSA 1ZOYC 1OMIA 2KZIA 1KZUB 3RL0D 1M90Q 5DJUB 1H89A 2YKQA 5KAIE 2WWWA 2R5BA 2KYVA 1BCCG 1GW3A 3G3ZA 1KMIZ 3NXSA 4QMAA 5CCHA 2C9LY 3F89A 4GOEA 3RBZA 2E5YA 3RK2B 3V5BA 3L75E 2P67A 4H13B 3H1JE 3JC22 1LTTC 1JY2P 3H1LJ 1IFDA 5AW0B 1M1JB 1K04A 2KP8A 2KIKA 1M1JA 3BCCD 1J1DC 4OGQD 1JY3O 3MZWB 1FOSF 1Y8AA 1BCCE 1YTZT 2SPZA 2XDJA 1QGKB 2K37A 1LGHB 5AW6B 5L8RJ 1FDMA 1T3UA 2UWJE 2L91A 3D6ZA 3RK3C 2D2CD 3VTPC 1XTGB 1E79H 5CBOA 3Q5PA 2V7QH 2IZ0A 1JMMA 2N1TD 4GODA 1BE3J 3B71A 2QM8A 1HUCA 1OVUA 1BDCA 1L0LJ 2AEFA 1JY3P 1FAVA 1P84H 1SFCC 4PD4I 1KILC 3WUVA 1KB9E 1L4AB 2QA4P 2WSSH 2PGDA 1FJKA 1L4AA 4U7JA 2W27A 3MUDC 3TNUB 1S9KD 1IFMA 5K5GB 2CPSA 1Y47A 2QE7H 3AEGC 2NPSD 1QVFO 2C0WA 2RN0A 3TGUE 2BEQD 1RY3A 2M8RA 4DZOA 3USSA 2E43A 5APTA 3CWBG 1VQ9P 2K3RA 4PD4D 1GK6A 5CCHD 1U7MA 2A45I 4I2LC 2R5DA 2E74C 3MIWA 4XFJA 3RK2D 1PIXA 3WU2H 1JM0A 1GU5A 1FZEA 4H13D 1S1CX 2Z5IA 3CX5H 2YO2A 2JDIH 1NKZB 2KUBA 1RQUA 2KLVA 2E5TA 1Z56A 3L72D 1T8ZA 1SQVG 4ASVA 2IZ1A 4RJTA 1W5CE 4ZNCA 3CCRP 4BXLA 1N7SC 1SQQJ 1J1EB 2JWAA 2BCCE 1VQNP 1K73Q 3MGNA 3H1KE 2RH0A 1KYOE 5CCGA 3A7OA 5AW4B 1LNQA 3CCJP 1HBWA 2FYUK 3IN6A 1T2KD 2A06G 3L75D 2PFXA 1NU1K 4M3LA 4NPEA 1YTZI 3H1JD 5BU8B 2HYNA 1GMJA 2FY8A 1ZR2A 3V2QA 1PFIA 1X8YA 1NTMJ 4IFFA 3S9OA 2E76B 1URQC 2JR8A 1L4AD 2YXQB 2IPPA 2RMZA 2YKPA 1BCCD 1LTJB 1KB9I 1QL2A 5AW3B 4PJ0E 1LTJA 3Q2YA 2K9YA 2FYNC 1Q90D 3GF7A 3R4YA 1SQXG 3M91A 2GA1A 2A06E 1KFNA 1PP9J 1NTZG 5CHXA 1VQ8P 5AVSB 1SQPE 3SFEC 5APVA 3SFDC 1NAFA 2O01J 2H89C 5KJ7A 3L4FA 1M56D 3GW6A 3CPWO 2ZXXA 1KB9D 1M7LA 1EDLA 4PV1C 4OH8B 2O3JA 3M0DA 2LR2A 2ZAEB 3L35A 2M5AB 4WBAA 3OAKA 5KTBA 1USEA 2WVRA 2M5AA 1BGYG 2PRRA 1R5LA
chains in the Genus database with same CATH topology
3E1IA 3LIDA 4ZKPA 3UIAA 1X9VA 3U1AA 1GL2D 2HODB 1HTLC 3MD0A 4LGDE 2R3CA 1GD2E 4IFMA 3N4XA 2WPQA 2WZ7A 1G1JA 5APSA 4Y99B 1JY3N 1FZGA 1LTJC 2HFED 1S9KE 5CCGD 1HH0A 3NMDA 2Q5UA 1JNMA 4DOJA 1GZLA 3HE4B 2W6BA 3B5NC 4XE5B 2H7HA 3HE4A 2WSEH 1FOSE 1WT6A 1KFMA 1ZLLA 5KJ7C 3P8CD 3VOPA 1RE3C 4I6MC 3VN0A 2YO3A 2A45G 3C9IA 2OYHC 1LT9C 1JUNA 2OARA 3I5CA 3OJAB 1X79B 1J1DB 2WSCH 2C9NY 1FZBA 3V2RA 2JEEA 1JCDA 3L36A 3O8ZA 3M0DC 3HD7B 3TYYA 2WT7B 2FFDB 1LTAC 4JYBA 4XA4A 1GU4A 1SP4A 3GHGC 3HD7D 3M9HA 3HD7A 2WT7A 2FKWB 1IFIA 1E5WA 2FFDA 2LKMA 4I1LA 1VDFA 1G2CB 1XTCC 3B5ND 1JTHB 1QL1A 3RK3B 2NPSB 2GM4A 1FJPA 1G2CA 2HG5D 2WSFH 1MFZA 3V4WA 1FBMA 1FZCB 1JTHA 1JY2O 1SQBK 2NPSA 3RL0B 4W7YA 2WPSA 1RF0A 1KZUB 2MJZA 3RL0D 4C7RA 3BRTB 1A02J 2J59M 3HUSB 3EFGA 1H89A 1FZAA 1LTGC 2YKQA 4Y99C 2WWWA 2R5BA 2P1JA 2IFNA 3HUSA 2KYVA 5AW5B 2M3BA 1GW3A 3G3ZA 1KILB 2KB7P 3NXSA 5CMZA 5CCHA 1FU1A 1SFCD 2C9LY 1SFCA 1KILA 2IFMA 2PAJA 5AW1B 3A3YB 1NH4A 1N73B 1GDTA 3RK2B 3V5BA 1OXZA 1NOHA 3EQ2A 2P67A 5APQA 1N73A 2E42A 2P7JA 1LTTC 3MUDA 1JY2P 1JOCA 1DX7A 1AFOA 2H8PD 1L0LK 1J2JB 2XZRA 1IFDA 3N7NA 1LTIC 5AW0B 1HWTC 1M1JB 2KP8A 3BATA 2HODA 2H43A 1M1JA 1J1DC 1WRGA 3HRNA 3M9QA 5BU5A 3BASA 3V4QA 1JY3O 1FOSF 5AVUB 3HD7C 2OYIB 1YTZT 1IK9A 2FFDC 3M0AA 2XDJA 1HGZA 2PP6A 2OYIA 3H32B 1LGHB 5AW6B 3TSIA 5AW9B 3BVHA 3P32A 1FDMA 2O1KA 1T3UA 3H32A 3RK3C 2NPSC 2O01H 3VTPC 1RF0C 1XTGB 2N1TB 1EQ7A 1ZV8A 3RL0C 3VMZA 1H88A 1JMMA 2N1TD 4GIFA 2N1TA 1LTSC 4O9BA 3BRVB 1CSBA 2QM8A 4WY4B 1HUCA 4B86A 5AW8B 3HUSC 3VP8A 4IFDK 1LTBC 2GUSA 3M9BA 4WY4A 1T3JA 1JY3P 4WB4A 5AVTB 5CJ4A 3LIEA 1H8AA 1FAVA 2CPBA 1MV8A 5CCHC 4GT1A 4JF7A 1SFCC 2W6AA 3P7KA 1KILC 1G1IA 2L5GB 1JO5A 3CL3D 5APXA 1YYCA 1L4AB 1RF1B 1N7SB 2VRSA 1SQVK 1FJKA 1N73C 3RK2C 1L4AA 1DH3A 2W27A 1N7SD 1RF1A 1N7SA 1ZN5A 1NHLA 2C0XA 4LLHA 3TNUB 1S9KD 1IFMA 1GK4A 2CPSA 4C7NB 2KSJA 2YNYA 4LC1A 2NPSD 4N78E 3RK3D 1RE4A 2XV5A 4C7NA 2C0WA 1M1JC 1KQLA 1RY3A 2GUVA 1FZCA 2M8RA 1IFNA 4DZOA 1IJDB 3HE5B 2E43A 5APTA 3HE5A 1VPCA 4AQRD 1DEBA 1GK6A 1SQQK 2Z5HA 1NKNA 2JJLA 3KYQA 5CCHD 2OYIC 1KILD 2A45I 2WPRA 4I2LC 2WTYA 2A45H 2I1KA 3VP9A 1HVVA 2R5DA 3TK1A 1URQB 3V2PA 5CJ0A 3L37A 1IFJA 1SQPK 3MIWA 3OA7A 1URQA 3RK2D 3KQGA 5APUA 1GU5A 1FZEA 2N1TC 2ZFCA 3B8EB 2Z5IA 2YO2A 4HH2A 1T2KC 3P8CE 2Q9IA 1NKZB 4WY4C 2KLVA 4N6JA 1Z56A 1T8ZA 4EOTA 3R2PA 1GL2B 1SLQA 1CW5A 3A5TA 2O1JA 2YKOA 1NTMK 1GL2A 5AVWB 3WMM0 2FYZA 1LWUB 5AW7B 1L4AC 1N7LA 1SQXK 1RF1C 1N7SC 1LWUA 1J1EB 1NO4A 3NTNA 1IO4A 3SWYA 1NTZK 2IX7C 1RE4C 1CI6B 5AVVB 3MGNA 5BVZA 1FZCC 4KHXA 5CCGA 3A7OA 1HGVA 5AW4B 2Z4EA 1HBWA 1CI6A 3KPEA 3CLQA 1CZQA 3M06A 5APWA 2FYUK 2ZXEB 1T2KD 1N86A 3VMYA 5APYA 1NU1K 4N3YB 4WY4D 1W2EA 4M3LA 5AVQB 1YTZI 5BU8B 1IC2A 2HYNA 2HLOA 1AQ5A 1ZR2A 2YMYA 3V2QA 1MUUA 1PFIA 3VMXA 3A2AA 1X8YA 3HTKB 3U59A 1OWAA 4IFFA 1URQC 1L4AD 3HTKA 1FZFA 1HJBA 2IPPA 2YKPA 2I1JA 2BASA 2J58A 1LTJB 3MTUE 3TNUA 1QL2A 3V2NA 1JCCA 5AW3B 3U1CA 4GKGA 1LTJA 4RESB 4ZKUA 3B5NB 3M91A 2N9BA 3IR9A 4W80A 2XKMA 1GL2C 3B5NA 1KFNA 2POHA 4HYTB 1L0NK 3LW5H 1ZR4A 1NTKK 1JY2N 5CHXA 3P8MC 2KOGA 4C46A 3SWFA 4AUWA 5AVSB 3II6A 4JYCA 3PP5A 5APVA 1LWUC 1NAFA 5AVXB 3NFQA 5KJ7D 2XU6A 3H6PA 5KJ7A 3L4FA 2OYHB 3T97A 1RE3A 1LT9B 2P2UA 4AYCA 1J1EC 5KLVK 5AW2B 2FXMA 2OYHA 1LT9A 1URQD 3KDPB 5CCGC 1MZ9A 4W7ZA 5AVRB 1SFCB 1M7LA 2Q3IA 1SVFA 4EIJA 4OH8B 3IFMA 2QM7A 1GW4A 3M0DA 3GHGB 2WITA 1A02F 2HPCB 3CI9A 1N2DC 3L35A 4WBAA 2Q7CA 2R32A 3OAKA 5KTBA 1NWQA 1GTWA 5AVYB 3GHGA 2HPCA 5AVZB 3VYIA 4N78D 2XNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK2 C;  1L4A A;  1N7S D;  1N7S A;  1NHL A;  1KIL B;  4LGD E;  4WY4 D;  5CCH A;  1SFC D;  2WZ7 A;  1SFC A;  1KIL A;  3RK3 D;  4N78 E;  2NPS D;  2YMY A;  3RK2 B;  2M8R A;  2HFE D;  5CCG D;  3HTK B;  1URQ C;  1L4A D;  2H8P D;  3B5N C;  3KYQ A;  5CCH D;  1KIL D;  1HVV A;  5KJ7 C;  1URQ B;  3VOP A;  3B5N B;  1URQ A;  3RK2 D;  3HD7 C;  4W80 A;  1GL2 C;  2N1T C;  3B5N A;  2XDJ A;  2PP6 A;  2KOG A;  3P8C E;  4WY4 C;  3TSI A;  3PP5 A;  5KJ7 D;  5KJ7 A;  3M0D C;  3RK3 C;  2NPS C;  3HD7 B;  1GL2 B;  1XTG B;  2N1T B;  3HD7 D;  3HD7 A;  3RL0 C;  1GL2 A;  1URQ D;  2N1T D;  5CCG C;  2N1T A;  4WY4 B;  4W7Z A;  1SFC B;  3B5N D;  1L4A C;  1JTH B;  4WY4 A;  3RK3 B;  2NPS B;  1N7S C;  1T3J A;  2HG5 D;  4OH8 B;  1JTH A;  5CCH C;  2NPS A;  4JF7 A;  1SFC C;  3RL0 B;  4W7Y A;  1KIL C;  3RL0 D;  1L4A B;  5CCG A;  1N7S B;  1GL2 D; 
#chains in the Genus database with same CATH topology
 3TGU D;  3LID A;  4ZKP A;  4IFM A;  1NTK J;  3N4X A;  2WZ7 A;  1NAY A;  1G1J A;  4Y99 B;  4EI2 A;  4RKU J;  3A0B H;  5CCG D;  3NMD A;  5GTH H;  2YIU B;  1GZL A;  3K5B A;  4UB6 H;  4YXD C;  4XE5 B;  1KYO I;  1FOS E;  1P84 E;  3GMA A;  3VOP A;  1RE3 C;  1YIT P;  4OWF A;  1LT9 C;  1JUN A;  3VMA A;  3OJA B;  2ZYG A;  2QRX A;  2C9N Y;  3E1R A;  2JEE A;  4I7Z B;  3HD7 B;  5B5E H;  1NTZ J;  3S1K A;  3AE5 C;  1GU4 A;  1SP4 A;  3HD7 A;  1IFI A;  2BCC D;  5KLV E;  1JTH B;  3H1K D;  1KYO D;  3G4S P;  2HG5 D;  4L75 A;  1FZC B;  1JTH A;  2ZYD A;  3IF4 A;  1SQB K;  3RL0 B;  2WPS A;  4D6T G;  1RF0 A;  1PGO A;  1R5S A;  2W83 C;  4OGQ C;  2V7Q J;  3L73 J;  1A02 J;  3D71 A;  2J59 M;  3H1H G;  3HUS B;  3EFG A;  3HUS A;  5AW5 B;  3I56 P;  1DIP A;  2KB7 P;  5CMZ A;  1BGY J;  1SQB D;  3CX5 E;  2PAJ A;  1K8A Q;  1KQF B;  1N73 B;  1OXZ A;  2D2C C;  1NOH A;  1N73 A;  2E42 A;  3L71 G;  3GG2 A;  1DX7 A;  3CMA P;  1J2J B;  1OW7 A;  1NJI Q;  4JBZ A;  1WRG A;  3M9Q A;  5BU5 A;  3H1L G;  4U3F E;  1SQP D;  3IAO A;  4OVN F;  2KZJ A;  3AE2 C;  3LW5 J;  1RHZ B;  3EFF K;  2ZVO B;  1M1K Q;  1R8E A;  3TSI A;  5AW9 B;  1DEE G;  3BVH A;  3CCL P;  5KLI B;  2NPS C;  2O01 H;  3BCC J;  2N1T B;  1EQ7 A;  4TLF A;  1USD A;  3VMZ A;  3CXH H;  1MFT A;  4GIF A;  2N1T A;  1LTS C;  1LT1 A;  1CSB A;  4WY4 B;  4B86 A;  3WUU A;  1EDI A;  2GUS A;  4IOI H;  4WY4 A;  2Q3E A;  3GLM A;  3AE9 C;  5AVT B;  1P84 I;  2CPB A;  1MV8 A;  5CCH C;  4GT1 A;  1BE3 G;  3P7K A;  2L5G B;  3CL3 D;  3KZI H;  1L0N E;  2IYO A;  1YYC A;  1L0L G;  1NYH A;  3RK2 C;  4LLH A;  4H13 C;  1EZV G;  1GK4 A;  3AE6 C;  2YNY A;  4N78 E;  1M1J C;  5KKZ B;  3F5H A;  4R4L A;  5E79 E;  1Q81 Q;  3HE5 B;  4WWI A;  4EYY Q;  2ZT9 B;  3HE5 A;  1S3J A;  1VPC A;  2MKV A;  1BE3 E;  3O6Q B;  3L71 J;  2WTY A;  2AXC A;  3PH0 A;  3O6Q A;  2FYU G;  5CJ0 A;  3L37 A;  3L74 J;  4H0L B;  3QWO C;  1FC2 C;  5APU A;  3D6Y A;  4NPD A;  3CX5 I;  1PPJ G;  1T2K C;  2Q9I A;  5TJH A;  5KLV D;  3R2P A;  1GL2 B;  2O1J A;  1GL2 A;  5AVW B;  2QSI A;  1S5L H;  2FYZ A;  3A0B E;  1L4A C;  5GTH E;  2QJY B;  1NO4 A;  4K3A A;  4UB6 E;  1OZH A;  2OTJ P;  3L72 J;  3TDK A;  3RBX A;  2DW3 A;  3AEF C;  1CI6 B;  5AVV B;  5B66 E;  3CX5 D;  1SQQ G;  4ZMD A;  1CI6 A;  2IDB A;  1PPJ E;  3W68 A;  1CZQ A;  2IYP A;  1OW8 A;  3M06 A;  3OW2 O;  5APY A;  4WY4 D;  1DD4 A;  1PZQ A;  3Q5R A;  1MUU A;  2I8D A;  3ITK A;  3HTK B;  3U59 A;  1KQS O;  5B5E E;  1JMB A;  1VF5 B;  3HTK A;  1VQ5 P;  4L74 A;  4U3F D;  2Y9Y A;  2QIW A;  1AA0 A;  2BAS A;  3CCU P;  3TNU A;  3H1J J;  1NTM G;  2KI7 B;  1YHQ P;  1SQQ E;  1YJ9 P;  4RES B;  4ZKU A;  1MKM A;  2QJP B;  2XKM A;  1VQ6 P;  1Q86 Q;  2POH A;  1L0N K;  3LW5 H;  2K9J B;  2ZT9 D;  2FYU J;  4C46 A;  2KOG A;  4AUW A;  1NU1 J;  3FWN A;  3L70 J;  3T97 B;  2K9J A;  2M3E A;  2XU6 A;  2IBZ G;  4JQ0 D;  3T97 A;  4AYC A;  2P2U A;  1J1E C;  1PP9 G;  5CCG C;  1SFC B;  1L0N D;  4UB8 E;  4H0L D;  5H2F H;  4H44 D;  2P58 A;  3JCU E;  3IFM A;  1GW4 A;  3GHG B;  2QG4 A;  2WIT A;  2HPC B;  3CI9 A;  1ZW0 A;  3GHG A;  3AEC C;  2HPC A;  3CWB E;  3VYI A;  4N78 D;  1GL2 D;  1QVG O;  3E1I A;  1KN7 A;  3UIA A;  1X9V A;  3ABV C;  2HOD B;  1HTL C;  3MD0 A;  2ZYA A;  4LGD E;  2R3C A;  1GD2 E;  1FE6 A;  2E75 B;  4YTP C;  1HJ0 A;  2E76 C;  4GOF A;  2K88 A;  1PP9 E;  1FZG A;  2QJK B;  2WPV B;  1LTJ C;  1BE3 D;  1NTK G;  1JNM A;  3TGU J;  3CXH E;  3HE4 B;  3CCM P;  4KT0 J;  2J5U A;  3HE4 A;  1SQV E;  4K35 A;  1WT6 A;  1KFM A;  1ZLL A;  5KJ7 C;  4I6M C;  2B87 B;  1AJY A;  2Q1K A;  2YO3 A;  3KXD A;  4HB1 A;  2B87 A;  3AE1 C;  1VQ4 P;  3I5C A;  2Y0C A;  1X79 B;  1RQV A;  5GTI E;  1VF5 D;  1FZB A;  1Q2N A;  4PD4 H;  3O8Z A;  3M0D C;  2WT7 B;  1KD1 Q;  2FFD B;  4JYB A;  4YPC A;  3M9H A;  2WT7 A;  2FFD A;  5M1B A;  1QL1 A;  1FJP A;  3V4W A;  2G8Y A;  4W7Y A;  2OQQ A;  2QVA A;  2MJZ A;  4C7R A;  3BRT B;  1LTG C;  4Y99 C;  2HR3 A;  4L76 A;  2P1J A;  2B89 A;  2BCC J;  2M3B A;  3H1K J;  3L73 G;  1FU1 A;  1SFC D;  2Q6Q A;  2XND H;  2YIU C;  2IFM A;  5AW1 B;  5KAI H;  2NRG A;  5C39 A;  3A3Y B;  3A0H H;  2FXO A;  1SQX E;  4BRY B;  4BWN A;  5APQ A;  4BRY A;  1NTZ E;  2XZR A;  3N7N A;  1LTI C;  1HWT C;  1S5L E;  1QX8 A;  1SQB J;  2E75 D;  1QLE D;  2N9Y B;  3V4Q A;  4I7Z C;  3HD7 C;  3E7K A;  2OYI B;  1FDO A;  3L73 E;  1HGZ A;  2CK3 H;  2OYI A;  3P32 A;  1IFP A;  1UII A;  1RF0 C;  1AV1 A;  1OVV A;  1BGY E;  1ZV8 A;  3CXH I;  3RL0 C;  1ZME C;  5EFW B;  3KHU A;  4O9B A;  3C1L A;  3H1I J;  5AW8 B;  3HUS C;  3VP8 A;  1LTB C;  3BCC G;  1VQL P;  3CWB D;  1T3J A;  1LP1 B;  4WB4 A;  5CJ4 A;  1H8A A;  3LIE A;  1K9M Q;  2W6A A;  1JO5 A;  1LP1 A;  2Y0D A;  2W6J H;  1RF1 B;  1PP9 D;  1SQV K;  1N73 C;  2BEZ F;  1DH3 A;  1N7S D;  4GDO A;  1RF1 A;  1NHL A;  2C0X A;  3WUT A;  2H88 C;  1Q7Y Q;  1KB9 H;  2KSJ A;  4LC1 A;  4R4M A;  1RE4 A;  2GUV A;  1KQL A;  1FZC A;  2R44 A;  1IFN A;  1IJD B;  1M57 D;  1RH5 B;  1SQV D;  3BCC E;  3JSV C;  1S5L X;  2Z5H A;  3WU2 E;  1NKN A;  2JJL A;  3KYQ A;  1PGQ A;  1PGP A;  2I1K A;  3TK1 A;  4RO0 A;  1SQP K;  3OA7 A;  5KLI C;  3KQG A;  5KAF H;  1L2P A;  1S4X A;  3FWL A;  2N1T C;  2WSC J;  2ZFC A;  4HH2 A;  3P8C E;  4WY4 C;  4D6T E;  3L74 G;  2A06 D;  3H1H E;  1EDK A;  3A5T A;  2B88 A;  2YKO A;  3PRJ A;  4ASW A;  1S2E A;  3CC2 P;  3WMM 0;  1LWU B;  1DD3 A;  1N7L A;  1SQX K;  2NZ2 A;  1LWU A;  1VQO P;  1IO4 A;  1IK7 A;  3AEB C;  3SWY A;  1NTZ K;  2JP3 A;  1LJ2 A;  1ZRT E;  2IX7 C;  5BVZ A;  3L71 E;  2OTL P;  2Z4E A;  5KKZ C;  2LXB A;  4A7P A;  2ZXE B;  1SQX D;  1N86 A;  2V4H A;  3L72 G;  4N3Y B;  3I55 P;  3L74 E;  1IC2 A;  3EWK A;  2HLO A;  1AQ5 A;  1NTZ D;  3H1L E;  2O01 N;  3FXD A;  4CPG A;  1KTM A;  3A2A A;  2KK7 A;  1K05 A;  1OWA A;  3B4S A;  3SSU A;  4JPZ B;  2KXP B;  1EC5 A;  4H0L C;  2I1J A;  2J58 A;  2KS1 B;  4GKG A;  3CCQ P;  2KS1 A;  3B5N B;  1PGJ A;  2N9B A;  3IR9 A;  1GL2 C;  3H1J G;  1BSN A;  2ZVN B;  3B5N A;  4HYT B;  1P84 D;  1BGY D;  1JY2 N;  3PHL A;  3P8M C;  3II6 A;  4JYC A;  3PP5 A;  2KLU A;  5AVX B;  3NFQ A;  5CBN A;  2OYH B;  5KLV K;  1L0L E;  2FBW C;  2QJY C;  4IL6 H;  2OYH A;  1NU1 G;  3A0H E;  3L70 G;  3KDP B;  3S4R A;  2YXR B;  1WMK A;  3AE4 C;  4H44 B;  3QH9 A;  1EZV E;  4EIJ A;  1ZP0 C;  2QM7 A;  2AEJ A;  1A02 F;  1N2D C;  1NWQ A;  2W8Z A;  3AED C;  5AVZ B;  2XNX A;  1UIX A;  1EXI A;  3PLN A;  3AEA C;  1L0N J;  1VF5 C;  3SWK A;  2WMM A;  5APS A;  1JY3 N;  2WQY C;  2FYU E;  3AE7 C;  1NU1 E;  2HFE D;  3L70 E;  1NGM B;  2Y0E A;  2Q5U A;  3RK3 E;  2OYO A;  4DOJ A;  2QJP C;  2H7H A;  1AVO A;  4NPF X;  3P8C D;  3TGU G;  4D6T D;  5DJT B;  3H25 A;  3FXE A;  1KIL E;  2RKL A;  3Q1M A;  3H1H D;  3CCE P;  1J1D B;  2WSC H;  3L75 J;  4L73 A;  1JCD A;  3L36 A;  1NVO A;  1LTA C;  4XA4 A;  3GHG C;  2FKW B;  1E5W A;  3CCV P;  2G3A A;  2LKM A;  1ZRT D;  4I1L A;  4YXW H;  1G2C B;  3CME P;  3B5N D;  3D70 A;  3RK3 B;  3L71 D;  1G2C A;  1FS0 E;  4DCK A;  1BCC J;  1FDI A;  2E75 C;  1YIJ P;  1PL5 A;  1VL2 A;  3L74 D;  1OX3 A;  1FZA A;  3H1L D;  2IFN A;  2QJK C;  1KIL B;  3ZDM A;  5KAF E;  1SFC A;  1NTM E;  1KIL A;  2M0B A;  1NH4 A;  2BCC G;  1GDT A;  3EQ2 A;  2LXC B;  2AXT H;  2JO1 A;  1BSH A;  3H1K G;  1EZV I;  2P7J A;  3MUD A;  1JOC A;  1AFO A;  2H8P D;  1L0L K;  3BAT A;  2IBZ E;  3C8V A;  2HOD A;  1YQ3 C;  2H43 A;  5TIS H;  3HRN A;  3BAS A;  4DT0 A;  2KSE A;  1X0T A;  5AVU B;  1U7J A;  1YI2 P;  1IK9 A;  2FFD C;  1L0L D;  1SQB G;  3M0A A;  2PP6 A;  3FX0 A;  3H32 B;  2KNC B;  2E74 B;  2O1K A;  3H32 A;  2KNC A;  1EZV D;  3Q3D A;  4TT3 H;  1H88 A;  1YJN P;  1OIP A;  3KZI E;  3BRV B;  1OFC X;  4Z1M H;  4IFD K;  3M9B A;  4DJG A;  1N8R Q;  2P10 A;  2JKV A;  1SQP G;  1VQP P;  4JF7 A;  1G1I A;  5APX A;  3H1I G;  1NTK E;  4HKZ H;  1QEX A;  2B9B A;  1N7S B;  1SQB E;  3G9R A;  2VRS A;  2FYU D;  1N7S A;  1NU1 D;  1ZN5 A;  3L70 D;  3CWB J;  4C7N B;  1YJW P;  3RK3 D;  3W67 A;  1PPJ D;  2XV5 A;  4C7N A;  1Q82 Q;  1T6A A;  4IL6 E;  1M8O B;  4AQR D;  1DEB A;  1SQQ K;  1KC8 Q;  1X22 A;  2OYI C;  2WSE J;  1KIL D;  5E79 H;  1W2B O;  2WPR A;  4HJG H;  3H1I E;  2A45 H;  1JEK A;  3VP9 A;  1HVV A;  3V2P A;  1URQ B;  1JB0 J;  4EDF A;  1IFJ A;  1URQ A;  1KV4 A;  1SQV J;  3B8E B;  1SQQ D;  2K1A A;  2FYN B;  4N6J A;  4EOT A;  3G6E P;  2OGU A;  1SS1 A;  2FXP A;  1SLQ A;  1CW5 A;  3CC4 P;  1VQK P;  1NTM K;  2QEX P;  1VQ7 P;  5AW7 B;  2IBZ I;  2WSF J;  1RF1 C;  3NTN A;  2E74 D;  1RE4 C;  3RL0 g;  1FZC C;  4KHX A;  1NTM D;  1HGV A;  1SQP J;  1KQG B;  3KPE A;  3CLQ A;  4PV1 B;  3Q5S A;  5APW A;  3VMY A;  5KLV G;  1W2E A;  5AVQ B;  5B66 H;  1AQT A;  2YMY A;  2OTK E;  2IBZ D;  3VMX A;  1AVY A;  3GF3 A;  4IL6 X;  1FZF A;  1HJB A;  2E76 D;  1SQX J;  3G71 P;  3PTZ A;  3MTU E;  3V2N A;  1JCC A;  3U1C A;  2W90 A;  3CXH D;  2ZJS E;  1D7M A;  4W80 A;  2Y9Z A;  1ZXG A;  1ZR4 A;  1NTK K;  3SWF A;  1LWU C;  2AEM A;  5H2F E;  5KJ7 D;  3H6P A;  1RE3 A;  1LT9 B;  5AW2 B;  3CCS P;  2FXM A;  3PJS K;  4U3F G;  1LT9 A;  3TF5 A;  1URQ D;  1MZ9 A;  4W7Z A;  2AXT E;  5AVR B;  2Q3I A;  1NTK D;  1SVF A;  3FGA D;  1IZN B;  2Q7C A;  2R32 A;  3MHV A;  1GTW A;  3MP7 B;  5AVY B;  5TIS E;  4UB8 H;  4KJM A;  1OW6 A;  3JCU H;  3AE8 C;  3U1A A;  1U57 A;  4Y28 J;  1BDD A;  2WPQ A;  4OGQ B;  1H0T B;  4WVZ A;  1EDJ A;  1H0T A;  5KLV J;  1S9K E;  1L0N G;  1HH0 A;  1VQM P;  3H1I D;  3CC7 P;  1YQ4 C;  2ITA A;  1PV3 A;  2W6B A;  1TU3 F;  2JWD A;  3B5N C;  1Y9B A;  4PV1 D;  2ZT9 C;  2D2C B;  2WSE H;  1KYO H;  1KOR A;  4PD4 E;  1HF9 A;  3VN0 A;  3C9I A;  2A45 G;  3AEE C;  2OYH C;  3AE3 C;  2OAR A;  3CD6 P;  3V2R A;  4H44 C;  1YBK A;  3L73 D;  3TYY A;  3V6I A;  1S72 P;  3HD7 D;  4MN4 C;  3L75 G;  5GTI H;  4D6T J;  2R3S A;  3L72 E;  1VDF A;  1OVR A;  1XTC C;  3RGU A;  3H1H J;  2GM4 A;  2NPS B;  2YMK A;  2WSF H;  4U3F J;  1MFZ A;  4PJ0 H;  1EXJ A;  1FBM A;  1JY2 O;  2NPS A;  1ZOY C;  1OMI A;  2KZI A;  1KZU B;  3RL0 D;  1M90 Q;  5DJU B;  1H89 A;  2YKQ A;  5KAI E;  2WWW A;  2R5B A;  2KYV A;  1BCC G;  1GW3 A;  3G3Z A;  1KMI Z;  3NXS A;  4QMA A;  5CCH A;  2C9L Y;  3F89 A;  4GOE A;  3RBZ A;  2E5Y A;  3RK2 B;  3V5B A;  3L75 E;  2P67 A;  4H13 B;  3H1J E;  3JC2 2;  1LTT C;  1JY2 P;  3H1L J;  1IFD A;  5AW0 B;  1M1J B;  1K04 A;  2KP8 A;  2KIK A;  1M1J A;  3BCC D;  1J1D C;  4OGQ D;  1JY3 O;  3MZW B;  1FOS F;  1Y8A A;  1BCC E;  1YTZ T;  2SPZ A;  2XDJ A;  1QGK B;  2K37 A;  1LGH B;  5AW6 B;  5L8R J;  1FDM A;  1T3U A;  2UWJ E;  2L91 A;  3D6Z A;  3RK3 C;  2D2C D;  3VTP C;  1XTG B;  1E79 H;  5CBO A;  3Q5P A;  2V7Q H;  2IZ0 A;  1JMM A;  2N1T D;  4GOD A;  1BE3 J;  3B71 A;  2QM8 A;  1HUC A;  1OVU A;  1BDC A;  1L0L J;  2AEF A;  1JY3 P;  1FAV A;  1P84 H;  1SFC C;  4PD4 I;  1KIL C;  3WUV A;  1KB9 E;  1L4A B;  2QA4 P;  2WSS H;  2PGD A;  1FJK A;  1L4A A;  4U7J A;  2W27 A;  3MUD C;  3TNU B;  1S9K D;  1IFM A;  5K5G B;  2CPS A;  1Y47 A;  2QE7 H;  3AEG C;  2NPS D;  1QVF O;  2C0W A;  2RN0 A;  3TGU E;  2BEQ D;  1RY3 A;  2M8R A;  4DZO A;  3USS A;  2E43 A;  5APT A;  3CWB G;  1VQ9 P;  2K3R A;  4PD4 D;  1GK6 A;  5CCH D;  1U7M A;  2A45 I;  4I2L C;  2R5D A;  2E74 C;  3MIW A;  4XFJ A;  3RK2 D;  1PIX A;  3WU2 H;  1JM0 A;  1GU5 A;  1FZE A;  4H13 D;  1S1C X;  2Z5I A;  3CX5 H;  2YO2 A;  2JDI H;  1NKZ B;  2KUB A;  1RQU A;  2KLV A;  2E5T A;  1Z56 A;  3L72 D;  1T8Z A;  1SQV G;  4ASV A;  2IZ1 A;  4RJT A;  1W5C E;  4ZNC A;  3CCR P;  4BXL A;  1N7S C;  1SQQ J;  1J1E B;  2JWA A;  2BCC E;  1VQN P;  1K73 Q;  3MGN A;  3H1K E;  2RH0 A;  1KYO E;  5CCG A;  3A7O A;  5AW4 B;  1LNQ A;  3CCJ P;  1HBW A;  2FYU K;  3IN6 A;  1T2K D;  2A06 G;  3L75 D;  2PFX A;  1NU1 K;  4M3L A;  4NPE A;  1YTZ I;  3H1J D;  5BU8 B;  2HYN A;  1GMJ A;  2FY8 A;  1ZR2 A;  3V2Q A;  1PFI A;  1X8Y A;  1NTM J;  4IFF A;  3S9O A;  2E76 B;  1URQ C;  2JR8 A;  1L4A D;  2YXQ B;  2IPP A;  2RMZ A;  2YKP A;  1BCC D;  1LTJ B;  1KB9 I;  1QL2 A;  5AW3 B;  4PJ0 E;  1LTJ A;  3Q2Y A;  2K9Y A;  2FYN C;  1Q90 D;  3GF7 A;  3R4Y A;  1SQX G;  3M91 A;  2GA1 A;  2A06 E;  1KFN A;  1PP9 J;  1NTZ G;  5CHX A;  1VQ8 P;  5AVS B;  1SQP E;  3SFE C;  5APV A;  3SFD C;  1NAF A;  2O01 J;  2H89 C;  5KJ7 A;  3L4F A;  1M56 D;  3GW6 A;  3CPW O;  2ZXX A;  1KB9 D;  1M7L A;  1EDL A;  4PV1 C;  4OH8 B;  2O3J A;  3M0D A;  2LR2 A;  2ZAE B;  3L35 A;  2M5A B;  4WBA A;  3OAK A;  5KTB A;  1USE A;  2WVR A;  2M5A A;  1BGY G;  2PRR A;  1R5L A; 
#chains in the Genus database with same CATH homology
 3E1I A;  3LID A;  4ZKP A;  3UIA A;  1X9V A;  3U1A A;  1GL2 D;  2HOD B;  1HTL C;  3MD0 A;  4LGD E;  2R3C A;  1GD2 E;  4IFM A;  3N4X A;  2WPQ A;  2WZ7 A;  1G1J A;  5APS A;  4Y99 B;  1JY3 N;  1FZG A;  1LTJ C;  2HFE D;  1S9K E;  5CCG D;  1HH0 A;  3NMD A;  2Q5U A;  1JNM A;  4DOJ A;  1GZL A;  3HE4 B;  2W6B A;  3B5N C;  4XE5 B;  2H7H A;  3HE4 A;  2WSE H;  1FOS E;  1WT6 A;  1KFM A;  1ZLL A;  5KJ7 C;  3P8C D;  3VOP A;  1RE3 C;  4I6M C;  3VN0 A;  2YO3 A;  2A45 G;  3C9I A;  2OYH C;  1LT9 C;  1JUN A;  2OAR A;  3I5C A;  3OJA B;  1X79 B;  1J1D B;  2WSC H;  2C9N Y;  1FZB A;  3V2R A;  2JEE A;  1JCD A;  3L36 A;  3O8Z A;  3M0D C;  3HD7 B;  3TYY A;  2WT7 B;  2FFD B;  1LTA C;  4JYB A;  4XA4 A;  1GU4 A;  1SP4 A;  3GHG C;  3HD7 D;  3M9H A;  3HD7 A;  2WT7 A;  2FKW B;  1IFI A;  1E5W A;  2FFD A;  2LKM A;  4I1L A;  1VDF A;  1G2C B;  1XTC C;  3B5N D;  1JTH B;  1QL1 A;  3RK3 B;  2NPS B;  2GM4 A;  1FJP A;  1G2C A;  2HG5 D;  2WSF H;  1MFZ A;  3V4W A;  1FBM A;  1FZC B;  1JTH A;  1JY2 O;  1SQB K;  2NPS A;  3RL0 B;  4W7Y A;  2WPS A;  1RF0 A;  1KZU B;  2MJZ A;  3RL0 D;  4C7R A;  3BRT B;  1A02 J;  2J59 M;  3HUS B;  3EFG A;  1H89 A;  1FZA A;  1LTG C;  2YKQ A;  4Y99 C;  2WWW A;  2R5B A;  2P1J A;  2IFN A;  3HUS A;  2KYV A;  5AW5 B;  2M3B A;  1GW3 A;  3G3Z A;  1KIL B;  2KB7 P;  3NXS A;  5CMZ A;  5CCH A;  1FU1 A;  1SFC D;  2C9L Y;  1SFC A;  1KIL A;  2IFM A;  2PAJ A;  5AW1 B;  3A3Y B;  1NH4 A;  1N73 B;  1GDT A;  3RK2 B;  3V5B A;  1OXZ A;  1NOH A;  3EQ2 A;  2P67 A;  5APQ A;  1N73 A;  2E42 A;  2P7J A;  1LTT C;  3MUD A;  1JY2 P;  1JOC A;  1DX7 A;  1AFO A;  2H8P D;  1L0L K;  1J2J B;  2XZR A;  1IFD A;  3N7N A;  1LTI C;  5AW0 B;  1HWT C;  1M1J B;  2KP8 A;  3BAT A;  2HOD A;  2H43 A;  1M1J A;  1J1D C;  1WRG A;  3HRN A;  3M9Q A;  5BU5 A;  3BAS A;  3V4Q A;  1JY3 O;  1FOS F;  5AVU B;  3HD7 C;  2OYI B;  1YTZ T;  1IK9 A;  2FFD C;  3M0A A;  2XDJ A;  1HGZ A;  2PP6 A;  2OYI A;  3H32 B;  1LGH B;  5AW6 B;  3TSI A;  5AW9 B;  3BVH A;  3P32 A;  1FDM A;  2O1K A;  1T3U A;  3H32 A;  3RK3 C;  2NPS C;  2O01 H;  3VTP C;  1RF0 C;  1XTG B;  2N1T B;  1EQ7 A;  1ZV8 A;  3RL0 C;  3VMZ A;  1H88 A;  1JMM A;  2N1T D;  4GIF A;  2N1T A;  1LTS C;  4O9B A;  3BRV B;  1CSB A;  2QM8 A;  4WY4 B;  1HUC A;  4B86 A;  5AW8 B;  3HUS C;  3VP8 A;  4IFD K;  1LTB C;  2GUS A;  3M9B A;  4WY4 A;  1T3J A;  1JY3 P;  4WB4 A;  5AVT B;  5CJ4 A;  3LIE A;  1H8A A;  1FAV A;  2CPB A;  1MV8 A;  5CCH C;  4GT1 A;  4JF7 A;  1SFC C;  2W6A A;  3P7K A;  1KIL C;  1G1I A;  2L5G B;  1JO5 A;  3CL3 D;  5APX A;  1YYC A;  1L4A B;  1RF1 B;  1N7S B;  2VRS A;  1SQV K;  1FJK A;  1N73 C;  3RK2 C;  1L4A A;  1DH3 A;  2W27 A;  1N7S D;  1RF1 A;  1N7S A;  1ZN5 A;  1NHL A;  2C0X A;  4LLH A;  3TNU B;  1S9K D;  1IFM A;  1GK4 A;  2CPS A;  4C7N B;  2KSJ A;  2YNY A;  4LC1 A;  2NPS D;  4N78 E;  3RK3 D;  1RE4 A;  2XV5 A;  4C7N A;  2C0W A;  1M1J C;  1KQL A;  1RY3 A;  2GUV A;  1FZC A;  2M8R A;  1IFN A;  4DZO A;  1IJD B;  3HE5 B;  2E43 A;  5APT A;  3HE5 A;  1VPC A;  4AQR D;  1DEB A;  1GK6 A;  1SQQ K;  2Z5H A;  1NKN A;  2JJL A;  3KYQ A;  5CCH D;  2OYI C;  1KIL D;  2A45 I;  2WPR A;  4I2L C;  2WTY A;  2A45 H;  2I1K A;  3VP9 A;  1HVV A;  2R5D A;  3TK1 A;  1URQ B;  3V2P A;  5CJ0 A;  3L37 A;  1IFJ A;  1SQP K;  3MIW A;  3OA7 A;  1URQ A;  3RK2 D;  3KQG A;  5APU A;  1GU5 A;  1FZE A;  2N1T C;  2ZFC A;  3B8E B;  2Z5I A;  2YO2 A;  4HH2 A;  1T2K C;  3P8C E;  2Q9I A;  1NKZ B;  4WY4 C;  2KLV A;  4N6J A;  1Z56 A;  1T8Z A;  4EOT A;  3R2P A;  1GL2 B;  1SLQ A;  1CW5 A;  3A5T A;  2O1J A;  2YKO A;  1NTM K;  1GL2 A;  5AVW B;  3WMM 0;  2FYZ A;  1LWU B;  5AW7 B;  1L4A C;  1N7L A;  1SQX K;  1RF1 C;  1N7S C;  1LWU A;  1J1E B;  1NO4 A;  3NTN A;  1IO4 A;  3SWY A;  1NTZ K;  2IX7 C;  1RE4 C;  1CI6 B;  5AVV B;  3MGN A;  5BVZ A;  1FZC C;  4KHX A;  5CCG A;  3A7O A;  1HGV A;  5AW4 B;  2Z4E A;  1HBW A;  1CI6 A;  3KPE A;  3CLQ A;  1CZQ A;  3M06 A;  5APW A;  2FYU K;  2ZXE B;  1T2K D;  1N86 A;  3VMY A;  5APY A;  1NU1 K;  4N3Y B;  4WY4 D;  1W2E A;  4M3L A;  5AVQ B;  1YTZ I;  5BU8 B;  1IC2 A;  2HYN A;  2HLO A;  1AQ5 A;  1ZR2 A;  2YMY A;  3V2Q A;  1MUU A;  1PFI A;  3VMX A;  3A2A A;  1X8Y A;  3HTK B;  3U59 A;  1OWA A;  4IFF A;  1URQ C;  1L4A D;  3HTK A;  1FZF A;  1HJB A;  2IPP A;  2YKP A;  2I1J A;  2BAS A;  2J58 A;  1LTJ B;  3MTU E;  3TNU A;  1QL2 A;  3V2N A;  1JCC A;  5AW3 B;  3U1C A;  4GKG A;  1LTJ A;  4RES B;  4ZKU A;  3B5N B;  3M91 A;  2N9B A;  3IR9 A;  4W80 A;  2XKM A;  1GL2 C;  3B5N A;  1KFN A;  2POH A;  4HYT B;  1L0N K;  3LW5 H;  1ZR4 A;  1NTK K;  1JY2 N;  5CHX A;  3P8M C;  2KOG A;  4C46 A;  3SWF A;  4AUW A;  5AVS B;  3II6 A;  4JYC A;  3PP5 A;  5APV A;  1LWU C;  1NAF A;  5AVX B;  3NFQ A;  5KJ7 D;  2XU6 A;  3H6P A;  5KJ7 A;  3L4F A;  2OYH B;  3T97 A;  1RE3 A;  1LT9 B;  2P2U A;  4AYC A;  1J1E C;  5KLV K;  5AW2 B;  2FXM A;  2OYH A;  1LT9 A;  1URQ D;  3KDP B;  5CCG C;  1MZ9 A;  4W7Z A;  5AVR B;  1SFC B;  1M7L A;  2Q3I A;  1SVF A;  4EIJ A;  4OH8 B;  3IFM A;  2QM7 A;  1GW4 A;  3M0D A;  3GHG B;  2WIT A;  1A02 F;  2HPC B;  3CI9 A;  1N2D C;  3L35 A;  4WBA A;  2Q7C A;  2R32 A;  3OAK A;  5KTB A;  1NWQ A;  1GTW A;  5AVY B;  3GHG A;  2HPC A;  5AVZ B;  3VYI A;  4N78 D;  2XNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...