2O01N

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
85
structure length
85
Chain Sequence
GVIEEYLEKSKTNKELNDKKRLATTGANFARAYTVEFGSCKFPENFTGCQDLAKQKKVPFLSDDLDLECEGKDKYKCGSNVFWKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
total genus 3
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2o01N01
2RH0A 3O6QB 2AXCA 2O01N 1OZHA
chains in the Genus database with same CATH superfamily
2O01H 3AE8C 3VMYA 4GOEA 2H89C 3F89A 5TISE 3NMDA 2IPPA 4IL6E 1BE3D 2E75B 1QL2A 1JEKA 1KYOE 1OVVA 1HVVA 1RE4C 1VF5B 1P84D 1BGYJ 1LTSC 4PD4H 4PV1C 3TGUE 1L4AB 3QWOC 3H1KJ 4D6TG 3L70E 5APSA 1SFCA 1ZOYC 2E74D 3SFDC 1DIPA 4AQRD 4U3FJ 5KAIH 2OYHC 4MN4C 2Z4EA 3H1ID 1S3JA 1U7MA 3M06A 1PZQA 1IJDB 1QVGO 4Y99B 5KLVE 3EQ2A 4EDFA 3LIDA 1SQPK 1X0TA 2PP6A 3MHVA 1L2PA 1AJYA 4ASVA 4GODA 1PP9E 5AW5B 1VQ4P 3E7KA 1OXZA 1OX3A 3AEEC 1IC2A 3JCUH 1GW3A 1NTMJ 2I1JA 3L4FA 2W6JH 5AW7B 3H1JJ 4PJ0H 3AE1C 1XTGB 1VQ5P 4D6TD 5KAFH 2CK3H 3FXEA 3L75E 3L74J 1M1JB 2W27A 4K3AA 2Y0EA 4W80A 2FFDB 3ZDMA 1L0NJ 1FAVA 4H13D 2M3BA 4UB6H 2C0WA 1S4XA 4GT1A 1RF0A 1ZMEC 1NU1K 2Y0DA 1L0LG 1EDJA 2HR3A 2E74B 2G8YA 1SQXE 1BDCA 1LTIC 3VN0A 2H8PD 2JKVA 3VP9A 4IFDK 4UB8H 1M90Q 2WSCJ 3CCJP 3HD7D 3CX5I 3CCEP 2QJYC 4LLHA 3TGUJ 2QM8A 5AVYB 1T6AA 1M1JA 5AW2B 2HLOA 1EC5A 3WU2E 1X9VA 1KQFB 2FFDA 1NU1J 1N73C 1MFZA 5AVQB 3GF3A 2BCCJ 2YIUB 1AVYA 5E79E 3CC4P 2KXPB 2OTLP 3TDKA 3AE2C 1PGQA 2FYUG 3CCLP 3L73G 1URQC 2HG5D 1VQ9P 3EWKA 1L0LD 3BVHA 2DW3A 2YMYA 5APQA 1KZUB 1FJPA 4RKUJ 3TSIA 2WWWA 5AVXB 2V7QH 1NTZE 3Q2YA 1NTKG 3E1IA 4LGDE 3M9HA 3H1LJ 4H13B 1KV4A 4KT0J 1RHZB 2KI7B 1VDFA 5CCHD 1W5CE 2IFMA 2IX7C 3G9RA 1KYOI 3LW5H 5CJ4A 3RL0C 3CX5D 3OAKA 1FDMA 1JM0A 3AE7C 3U1AA 2H43A 4DT0A 2N9YB 3HD7B 3P8CD 2D2CC 2FYUD 1LT9C 2XNDH 3BCCJ 1JCCA 3O6QB 1Y47A 4L74A 4ZKPA 4DZOA 3L73D 3IAOA 1Q86Q 2OARA 5C39A 2OTJP 1IO4A 3U59A 2W83C 1FE6A 1EZVE 5CMZA 1GD2E 2WMMA 2WPQA 4IL6X 1FDOA 3L70G 3CWBJ 4WVZA 1S2EA 1NTKD 1ZRTE 5K5GB 1NO4A 3RBXA 1K8AQ 5APTA 3SWFA 4ZNCA 4R4MA 1T8ZA 3H1HG 3CCQP 2O1KA 2K88A 2V7QJ 2Q5UA 2N1TB 4H44C 3IR9A 1QL1A 3HD7A 5KLVG 1FJKA 2ZYAA 5BVZA 3O6QA 1HH0A 1BE3J 1KYOD 1G1IA 1GMJA 1SQQE 3A5TA 1PP9G 4JQ0D 4PV1D 4TT3H 1M1KQ 5AW9B 3TGUD 3IF4A 2BASA 1H0TB 3V2QA 2R5BA 2OYIC 1JMMA 4W7YA 2Q9IA 3L70D 2R3CA 2WZ7A 3L37A 3L75G 1KTMA 2K9JB 2AXCA 4C46A 3CPWO 3V2RA 2PGDA 1QVFO 3L36A 1SQVE 3H1IJ 1J1EC 3H1HD 3NFQA 4U7JA 1LTJC 1OZHA 3HTKB 5CCHA 5KLVD 3B71A 1N8RQ 2E5YA 5H2FH 3CXHE 1SQXG 2QJKB 1ZLLA 1PFIA 3BRTB 4EIJA 4BRYB 1AFOA 3M0AA 1H0TA 3RK3E 1PP9D 2ZFCA 2E76C 3RK3C 5CCHC 1OIPA 5AVVB 2M5AB 3O8ZA 2JJLA 2FYNC 3CC2P 1YJ9P 2WPVB 5APYA 2K9JA 5APWA 4D6TJ 4RJTA 2J5UA 4HB1A 2C9LY 2R3SA 3HE5A 3L75D 1IFMA 1PGOA 1J2JB 1AQTA 3G71P 1W2EA 3H32B 3HTKA 3H25A 2Q3IA 3KZIE 2M0BA 1CZQA 4BRYA 4OGQD 1LT1A 1NAFA 2B87B 1SQXD 1X79B 2C9NY 1IFDA 1NTZG 3L72G 4CPGA 3CMEP 3OW2O 2QVAA 2M5AA 1SVFA 1GW4A 1IK9A 1L0LK 3G4SP 1RQVA 1T2KC 1SP4A 1SQPE 2A45G 1E5WA 1ZW0A 1QEXA 3VOPA 1JNMA 2VRSA 2A06E 5B5EE 3H32A 3U1CA 3CI9A 4WBAA 1ZV8A 1HWTC 3K5BA 5AW0B 1D7MA 2KS1A 3RGUA 3WUUA 2WSEJ 5GTIH 1N7SA 2ZAEB 2YKPA 1URQD 3CCUP 5KAIE 2B87A 3I56P 1JB0J 4N3YB 2OYHA 1EZVI 3TK1A 3V4WA 3MTUE 3KYQA 1L0LJ 3TF5A 4L76A 1KQLA 1KB9H 1GK6A 2ZYDA 3IN6A 1EZVG 2FYUK 1NTZD 3L72D 1N7SC 3Q1MA 2WSFJ 1NTMK 1Z56A 2LXCB 2KNCB 2ZXEB 3H1HE 1H89A 1LP1B 2K3RA 2WSCH 3FWNA 4HYTB 5KJ7C 3JCUE 3RL0D 1KORA 1NTKK 3V2PA 3A0HH 1R8EA 5KTBA 5KAFE 1L0NK 3MGNA 1LNQA 4IFMA 2ZYGA 1K05A 2D2CD 1GL2A 3AE6C 1DD3A 2QJYB 1Y9BA 2FY8A 3OJAB 3EFGA 2FYUJ 4Y28J 3GG2A 3M9BA 1SQQG 1BCCG 2GA1A 4WWIA 3B8EB 3L73J 1N73B 2H88C 2W6AA 2YMKA 1DD4A 1LTGC 3FGAD 1GL2C 1IFJA 1EZVD 2KNCA 3CL3D 3PLNA 2CPSA 3C1LA 2HODA 4C7NB 1NTKJ 3A7OA 1LP1A 1URQB 3CLQA 3KQGA 1ZR2A 2HFED 1ZRTD 1RE3A 2P2UA 1LTBC 2MKVA 1L4AC 3MIWA 5DJTB 2M8RA 3V6IA 3L71E 5AVUB 2QIWA 1VQ7P 1SQVG 4UB8E 4H44D 3CXHI 3GMAA 2K1AA 2OGUA 4LC1A 1JTHA 3M0DC 1S5LH 4OGQC 5DJUB 2IBZG 2Q7CA 1A02J 1RE3C 2W8ZA 1EXJA 1GU4A 1N73A 3GLMA 1YTZT 3Q5PA 1SQQD 5KLIC 1MKMA 3HRNA 3F5HA 3RL0B 5KLVK 2WQYC 1G2CB 4YPCA 4C7NA 1NAYA 2IDBA 4WB4A 1URQA 1W2BO 1LTTC 1OVUA 1WRGA 2D2CB 1LT9B 1JCDA 3L70J 1NH4A 5APXA 3TYYA 1SQBE 3B5NC 1RH5B 1FZEA 2R44A 5KKZC 2YNYA 1HJ0A 4JYCA 4I1LA 1Q90D 1SQVD 3H1HJ 4M3LA 3S1KA 5AVRB 2RH0A 5KLVJ 3C8VA 2OQQA 3L72E 3VYIA 3CXHD 2Z5IA 2YKQA 3GHGC 1M57D 3WU2H 1FOSF 1Q7YQ 1G2CA 4PD4I 2E76D 2WPRA 2P67A 1PP9J 2Y0CA 3RK3D 1K9MQ 1P84H 2XZRA 4H44B 5E79H 2FXPA 1KQGB 3L74G 1LT9A 3NXSA 4WY4C 1SQXK 5AW8B 1SQPG 3II6A 3OA7A 3AEDC 2RKLA 1J1DB 3PH0A 1OW7A 4KHXA 1RF1C 1N86A 2A06G 1AA0A 2G3AA 2I8DA 1DH3A 2FYZA 3L75J 1HF9A 4YTPC 1TU3F 1KD1Q 3MP7B 1ZN5A 5AVSB 2OYIB 2B9BA 2ZJSE 4HJGH 1X22A 2KUBA 3TNUB 1PGPA 4IOIH 3USSA 4Z1MH 2ZXXA 1FZAA 2AEJA 3CCSP 2JP3A 4XFJA 2KSJA 1G1JA 1SQXJ 1DEEG 4JYBA 1KILD 5B66H 3BRVB 2SPZA 1J1EB 2O3JA 4ASWA 1YIJP 1JY2P 1LTJB 4RO0A 4DJGA 1USDA 2KP8A 1T2KD 1ZP0C 3I55P 2JO1A 2FKWB 1FZCA 4PD4D 1SQPD 2MJZA 2ZVNB 2BEZF 2XV5A 1IFPA 2A06D 2OYIA 1FZFA 2L5GB 3ITKA 2Q1KA 2E76B 3I5CA 3SWYA 2GUSA 1S72P 5BU5A 3RK3B 2WITA 3TNUA 1N7LA 1R5LA 2LXBA 1BCCE 1NVOA 4AUWA 2FYNB 4GDOA 1DEBA 1FZCC 3RBZA 3VMXA 2E42A 4EI2A 5CHXA 2LR2A 2FXOA 4NPDA 4N6JA 4NPEA 3CCMP 3AE9C 1CSBA 5AW3B 2Z5HA 1LTJA 2K37A 3V4QA 3UIAA 1GK4A 1N7SD 1NTZJ 3L72J 5CBNA 3Q3DA 2ITAA 5H2FE 1FU1A 1CW5A 1FC2C 1HUCA 2ZVOB 1T3JA 2YO3A 3R4YA 3GW6A 3HE5B 1PIXA 3KHUA 3T97A 5AW6B 1MUUA 5KJ7D 3L71G 1BGYE 1FZBA 1JO5A 2IBZE 1VQKP 3SWKA 1VQOP 1EDKA 1KFMA 1MFTA 1YITP 3Q5SA 3H1KE 1JOCA 1HGVA 4JBZA 4QMAA 1OWAA 3AEAC 1QX8A 2J58A 2WSEH 1NKZB 1CI6A 3BASA 3VP8A 1USEA 3A0BE 2QM7A 1PPJE 2PAJA 5GTHH 4OWFA 1ZR4A 5APVA 3AEGC 1DX7A 1GL2D 2P1JA 4YXDC 3MZWB 5AW1B 1K04A 2R5DA 1VF5D 1WMKA 4PV1B 3VMZA 4I7ZC 2B88A 1L4AD 2WSFH 1SQBG 1KILA 1X8YA 3RK2C 3L71D 2KS1B 4O9BA 4K35A 1N7SB 1NKNA 2GUVA 2JWDA 3RL0g 2W6BA 1NTME 1KILE 2OYHB 1YJWP 3CX5H 3H1JE 1KILC 3GF7A 3HE4B 3JC22 1H88A 2A45I 3VTPC 1MV8A 1SQVK 4R4LA 2E5TA 3L74E 1SQQJ 5EFWB 2IYPA 2P58A 1EXIA 4PD4E 3MUDC 3AE5C 5BU8B 1LWUC 1H8AA 2XNXA 1L0NE 2OYOA 3KZIH 1KB9E 2AXTH 1Q82Q 2JEEA 3B5ND 4EOTA 2WTYA 2QA4P 1SQBD 1UIIA 2PFXA 3AEBC 3CCVP 1RY3A 1IFNA 3AEFC 2XU6A 2NPSC 1FBMA 3M91A 1GL2B 1QGKB 2OTKE 1SQVJ 1FOSE 3CMAP 4XE5B 3PTZA 4H0LC 2JR8A 3HE4A 2NRGA 2KZJA 4W7ZA 3HUSA 1KFNA 5KJ7A 2KIKA 3V2NA 3SFEC 3Q5RA 2L91A 2M3EA 3KDPB 5TISH 3A0HE 2IYOA 1YHQP 5B5EH 3NTNA 3N4XA 4IL6H 1NU1E 1KYOH 1GTWA 2BCCE 1NHLA 2HODB 4GIFA 4WY4D 4OGQB 3HUSC 2KYVA 1VQ6P 2GM4A 5AVTB 3FX0A 1E79H 4JPZB 4I6MC 4PJ0E 5AVZB 2ZT9C 5KLIB 2KSEA 4BXLA 1SFCC 1JTHB 2CPBA 2WVRA 2KZIA 3G3ZA 1JMBA 2QJPC 2Y9ZA 3W68A 2P7JA 1YQ4C 3H1LE 1L4AA 3PHLA 4UB6E 2E75C 2J59M 2NZ2A 2QRXA 2O01J 3B5NB 3KPEA 1JY2O 1AV1A 1VL2A 3JSVC 5KKZB 1VF5C 3M0DA 1S5LE 1YI2P 2WSSH 5TJHA 1FDIA 4DOJA 2XDJA 1NJIQ 3B4SA 2IBZI 1Q2NA 2WPSA 3IFMA 1EQ7A 4GKGA 1IFIA 1SQPJ 1VQPP 3BCCE 1VQ8P 1K73Q 1BGYG 3GHGB 4NPFX 1UIXA 1Q81Q 1YYCA 2O01N 2Q3EA 1WT6A 2KK7A 2FBWC 2YKOA 1JUNA 3D70A 2IZ0A 3H1KG 4N78E 2QEXP 4WY4B 1YJNP 1OVRA 3G6EP 4HKZH 1QLED 1BCCD 3CWBE 4OH8B 1FZGA 3B5NA 2KLVA 4Y99C 1RF1B 1PPJG 4U3FG 2B89A 1RF0C 2POHA 1MZ9A 4C7RA 2RMZA 4OVNF 2PRRA 2Y9YA 3AE4C 3GHGA 1BE3E 1JY3O 2IZ1A 1N2DC 1P84E 1BGYD 3P7KA 2IBZD 1JY2N 4WY4A 1M1JC 1A02F 3L35A 1SS1A 2QE7H 1NTMG 2FFDC 3H1JG 3H1KD 1LGHB 1RF1A 1PL5A 3FWLA 2HPCB 2IFNA 2RN0A 3D6ZA 2N1TD 1AQ5A 2E74C 1PPJD 1KB9I 4U3FD 2N9BA 1BSNA 3KXDA 5APUA 1L0NG 1LTAC 3H1IE 1IZNB 4IFFA 5CJ0A 2C0XA 1FZCB 3W67A 3S9OA 4I2LC 3P32A 3H6PA 4B86A 5B66E 3A2AA 1VQNP 3RK2D 2E43A 4L73A 4DCKA 5L8RJ 3L71J 3R2PA 1LJ2A 2YO2A 2A45H 4JF7A 1VQMP 2YIUC 1NTMD 2HPCA 3P8MC 1SQBK 1SLQA 3TGUG 1M7LA 1HTLC 3H1JD 4D6TE 3S4RA 1PV3A 1KC8Q 1BSHA 1JY3N 1YTZI 1NU1G 3L74D 2AEMA 2BCCG 3PRJA 5AVWB 3ABVC 1OFCX 4YXWH 2V4HA 1NTZK 1M56D 1L0ND 1S9KD 3T97B 1EDIA 2XKMA 1T3UA 5CCGD 4L75A 3C9IA 1KB9D 4H13C 1VQLP 3N7NA 1NWQA 2BEQD 1KN7A 2R32A 3WUVA 1SQBJ 2NPSD 2H7HA 1HBWA 1J1DC 2UWJE 4H0LD 3H1LG 2WT7B 4I7ZB 4AYCA 1CI6B 3D6YA 1RQUA 3HD7C 1GZLA 3RK2B 3LW5J 4TLFA 3D71A 1VPCA 1BDDA 1NU1D 2LKMA 1IK7A 3A3YB 3AECC 2BCCD 1Y8AA 4XA4A 1U57A 3CCRP 1S1CX 2HYNA 2I1KA 4EYYQ 1KILB 3V5BA 1JY3P 1YBKA 4A7PA 3BCCG 2N1TA 5GTHE 4GOFA 2ZT9D 2KOGA 1L0LE 1S5LX 3CD6P 2AEFA 1SFCD 3AE3C 1LWUB 1GU5A 4ZKUA 2O1JA 2WT7A 1PGJA 1R5SA 2QG4A 3CC7P 3CWBG 2N1TC 1XTCC 4U3FE 3H1LD 4HH2A 3WMM0 2E75D 3WUTA 2Q6QA 1ZXGA 1NOHA 5M1BA 2KLUA 1SQQK 1FS0E 1M8OB 4KJMA 2NPSB 3CXHH 1EDLA 3CX5E 3PP5A 2W90A 2YXQB 2QSIA 1P84I 1OMIA 4H0LB 1YQ3C 1BE3G 2KB7P 1NYHA 3LIEA 3P8CE 2FYUE 3E1RA 1NGMB 1HGZA 4BWNA 1OW8A 3BCCD 3MUDA 3MD0A 3A0BH 1LWUA 3L73E 3SSUA 3BATA 3VMAA 2AXTE 3HUSB 1OW6A 1U7JA 5CCGA 2P10A 4N78D 1BCCJ 3QH9A 2JWAA 1AVOA 5GTIE 3CWBD 2FXMA 1NTKE 3PJSK 1KMIZ 3FXDA 1HJBA 1GDTA 2ZT9B 1KQSO 4ZMDA 3M9QA 1S9KE 4RESB 2JDIH 2QJKC 1SFCB 2NPSA 2YXRB 5AW4B 2K9YA 3EFFK 1RE4A 3H1IG 2QJPB 5CBOA 5CCGC
chains in the Genus database with same CATH topology
2RH0A 3O6QB 2AXCA 2O01N 1OZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH0 A;  3O6Q B;  2AXC A;  2O01 N;  1OZH A; 
#chains in the Genus database with same CATH topology
 2O01 H;  3AE8 C;  3VMY A;  4GOE A;  2H89 C;  3F89 A;  5TIS E;  3NMD A;  2IPP A;  4IL6 E;  1BE3 D;  2E75 B;  1QL2 A;  1JEK A;  1KYO E;  1OVV A;  1HVV A;  1RE4 C;  1VF5 B;  1P84 D;  1BGY J;  1LTS C;  4PD4 H;  4PV1 C;  3TGU E;  1L4A B;  3QWO C;  3H1K J;  4D6T G;  3L70 E;  5APS A;  1SFC A;  1ZOY C;  2E74 D;  3SFD C;  1DIP A;  4AQR D;  4U3F J;  5KAI H;  2OYH C;  4MN4 C;  2Z4E A;  3H1I D;  1S3J A;  1U7M A;  3M06 A;  1PZQ A;  1IJD B;  1QVG O;  4Y99 B;  5KLV E;  3EQ2 A;  4EDF A;  3LID A;  1SQP K;  1X0T A;  2PP6 A;  3MHV A;  1L2P A;  1AJY A;  4ASV A;  4GOD A;  1PP9 E;  5AW5 B;  1VQ4 P;  3E7K A;  1OXZ A;  1OX3 A;  3AEE C;  1IC2 A;  3JCU H;  1GW3 A;  1NTM J;  2I1J A;  3L4F A;  2W6J H;  5AW7 B;  3H1J J;  4PJ0 H;  3AE1 C;  1XTG B;  1VQ5 P;  4D6T D;  5KAF H;  2CK3 H;  3FXE A;  3L75 E;  3L74 J;  1M1J B;  2W27 A;  4K3A A;  2Y0E A;  4W80 A;  2FFD B;  3ZDM A;  1L0N J;  1FAV A;  4H13 D;  2M3B A;  4UB6 H;  2C0W A;  1S4X A;  4GT1 A;  1RF0 A;  1ZME C;  1NU1 K;  2Y0D A;  1L0L G;  1EDJ A;  2HR3 A;  2E74 B;  2G8Y A;  1SQX E;  1BDC A;  1LTI C;  3VN0 A;  2H8P D;  2JKV A;  3VP9 A;  4IFD K;  4UB8 H;  1M90 Q;  2WSC J;  3CCJ P;  3HD7 D;  3CX5 I;  3CCE P;  2QJY C;  4LLH A;  3TGU J;  2QM8 A;  5AVY B;  1T6A A;  1M1J A;  5AW2 B;  2HLO A;  1EC5 A;  3WU2 E;  1X9V A;  1KQF B;  2FFD A;  1NU1 J;  1N73 C;  1MFZ A;  5AVQ B;  3GF3 A;  2BCC J;  2YIU B;  1AVY A;  5E79 E;  3CC4 P;  2KXP B;  2OTL P;  3TDK A;  3AE2 C;  1PGQ A;  2FYU G;  3CCL P;  3L73 G;  1URQ C;  2HG5 D;  1VQ9 P;  3EWK A;  1L0L D;  3BVH A;  2DW3 A;  2YMY A;  5APQ A;  1KZU B;  1FJP A;  4RKU J;  3TSI A;  2WWW A;  5AVX B;  2V7Q H;  1NTZ E;  3Q2Y A;  1NTK G;  3E1I A;  4LGD E;  3M9H A;  3H1L J;  4H13 B;  1KV4 A;  4KT0 J;  1RHZ B;  2KI7 B;  1VDF A;  5CCH D;  1W5C E;  2IFM A;  2IX7 C;  3G9R A;  1KYO I;  3LW5 H;  5CJ4 A;  3RL0 C;  3CX5 D;  3OAK A;  1FDM A;  1JM0 A;  3AE7 C;  3U1A A;  2H43 A;  4DT0 A;  2N9Y B;  3HD7 B;  3P8C D;  2D2C C;  2FYU D;  1LT9 C;  2XND H;  3BCC J;  1JCC A;  3O6Q B;  1Y47 A;  4L74 A;  4ZKP A;  4DZO A;  3L73 D;  3IAO A;  1Q86 Q;  2OAR A;  5C39 A;  2OTJ P;  1IO4 A;  3U59 A;  2W83 C;  1FE6 A;  1EZV E;  5CMZ A;  1GD2 E;  2WMM A;  2WPQ A;  4IL6 X;  1FDO A;  3L70 G;  3CWB J;  4WVZ A;  1S2E A;  1NTK D;  1ZRT E;  5K5G B;  1NO4 A;  3RBX A;  1K8A Q;  5APT A;  3SWF A;  4ZNC A;  4R4M A;  1T8Z A;  3H1H G;  3CCQ P;  2O1K A;  2K88 A;  2V7Q J;  2Q5U A;  2N1T B;  4H44 C;  3IR9 A;  1QL1 A;  3HD7 A;  5KLV G;  1FJK A;  2ZYA A;  5BVZ A;  3O6Q A;  1HH0 A;  1BE3 J;  1KYO D;  1G1I A;  1GMJ A;  1SQQ E;  3A5T A;  1PP9 G;  4JQ0 D;  4PV1 D;  4TT3 H;  1M1K Q;  5AW9 B;  3TGU D;  3IF4 A;  2BAS A;  1H0T B;  3V2Q A;  2R5B A;  2OYI C;  1JMM A;  4W7Y A;  2Q9I A;  3L70 D;  2R3C A;  2WZ7 A;  3L37 A;  3L75 G;  1KTM A;  2K9J B;  2AXC A;  4C46 A;  3CPW O;  3V2R A;  2PGD A;  1QVF O;  3L36 A;  1SQV E;  3H1I J;  1J1E C;  3H1H D;  3NFQ A;  4U7J A;  1LTJ C;  1OZH A;  3HTK B;  5CCH A;  5KLV D;  3B71 A;  1N8R Q;  2E5Y A;  5H2F H;  3CXH E;  1SQX G;  2QJK B;  1ZLL A;  1PFI A;  3BRT B;  4EIJ A;  4BRY B;  1AFO A;  3M0A A;  1H0T A;  3RK3 E;  1PP9 D;  2ZFC A;  2E76 C;  3RK3 C;  5CCH C;  1OIP A;  5AVV B;  2M5A B;  3O8Z A;  2JJL A;  2FYN C;  3CC2 P;  1YJ9 P;  2WPV B;  5APY A;  2K9J A;  5APW A;  4D6T J;  4RJT A;  2J5U A;  4HB1 A;  2C9L Y;  2R3S A;  3HE5 A;  3L75 D;  1IFM A;  1PGO A;  1J2J B;  1AQT A;  3G71 P;  1W2E A;  3H32 B;  3HTK A;  3H25 A;  2Q3I A;  3KZI E;  2M0B A;  1CZQ A;  4BRY A;  4OGQ D;  1LT1 A;  1NAF A;  2B87 B;  1SQX D;  1X79 B;  2C9N Y;  1IFD A;  1NTZ G;  3L72 G;  4CPG A;  3CME P;  3OW2 O;  2QVA A;  2M5A A;  1SVF A;  1GW4 A;  1IK9 A;  1L0L K;  3G4S P;  1RQV A;  1T2K C;  1SP4 A;  1SQP E;  2A45 G;  1E5W A;  1ZW0 A;  1QEX A;  3VOP A;  1JNM A;  2VRS A;  2A06 E;  5B5E E;  3H32 A;  3U1C A;  3CI9 A;  4WBA A;  1ZV8 A;  1HWT C;  3K5B A;  5AW0 B;  1D7M A;  2KS1 A;  3RGU A;  3WUU A;  2WSE J;  5GTI H;  1N7S A;  2ZAE B;  2YKP A;  1URQ D;  3CCU P;  5KAI E;  2B87 A;  3I56 P;  1JB0 J;  4N3Y B;  2OYH A;  1EZV I;  3TK1 A;  3V4W A;  3MTU E;  3KYQ A;  1L0L J;  3TF5 A;  4L76 A;  1KQL A;  1KB9 H;  1GK6 A;  2ZYD A;  3IN6 A;  1EZV G;  2FYU K;  1NTZ D;  3L72 D;  1N7S C;  3Q1M A;  2WSF J;  1NTM K;  1Z56 A;  2LXC B;  2KNC B;  2ZXE B;  3H1H E;  1H89 A;  1LP1 B;  2K3R A;  2WSC H;  3FWN A;  4HYT B;  5KJ7 C;  3JCU E;  3RL0 D;  1KOR A;  1NTK K;  3V2P A;  3A0H H;  1R8E A;  5KTB A;  5KAF E;  1L0N K;  3MGN A;  1LNQ A;  4IFM A;  2ZYG A;  1K05 A;  2D2C D;  1GL2 A;  3AE6 C;  1DD3 A;  2QJY B;  1Y9B A;  2FY8 A;  3OJA B;  3EFG A;  2FYU J;  4Y28 J;  3GG2 A;  3M9B A;  1SQQ G;  1BCC G;  2GA1 A;  4WWI A;  3B8E B;  3L73 J;  1N73 B;  2H88 C;  2W6A A;  2YMK A;  1DD4 A;  1LTG C;  3FGA D;  1GL2 C;  1IFJ A;  1EZV D;  2KNC A;  3CL3 D;  3PLN A;  2CPS A;  3C1L A;  2HOD A;  4C7N B;  1NTK J;  3A7O A;  1LP1 A;  1URQ B;  3CLQ A;  3KQG A;  1ZR2 A;  2HFE D;  1ZRT D;  1RE3 A;  2P2U A;  1LTB C;  2MKV A;  1L4A C;  3MIW A;  5DJT B;  2M8R A;  3V6I A;  3L71 E;  5AVU B;  2QIW A;  1VQ7 P;  1SQV G;  4UB8 E;  4H44 D;  3CXH I;  3GMA A;  2K1A A;  2OGU A;  4LC1 A;  1JTH A;  3M0D C;  1S5L H;  4OGQ C;  5DJU B;  2IBZ G;  2Q7C A;  1A02 J;  1RE3 C;  2W8Z A;  1EXJ A;  1GU4 A;  1N73 A;  3GLM A;  1YTZ T;  3Q5P A;  1SQQ D;  5KLI C;  1MKM A;  3HRN A;  3F5H A;  3RL0 B;  5KLV K;  2WQY C;  1G2C B;  4YPC A;  4C7N A;  1NAY A;  2IDB A;  4WB4 A;  1URQ A;  1W2B O;  1LTT C;  1OVU A;  1WRG A;  2D2C B;  1LT9 B;  1JCD A;  3L70 J;  1NH4 A;  5APX A;  3TYY A;  1SQB E;  3B5N C;  1RH5 B;  1FZE A;  2R44 A;  5KKZ C;  2YNY A;  1HJ0 A;  4JYC A;  4I1L A;  1Q90 D;  1SQV D;  3H1H J;  4M3L A;  3S1K A;  5AVR B;  2RH0 A;  5KLV J;  3C8V A;  2OQQ A;  3L72 E;  3VYI A;  3CXH D;  2Z5I A;  2YKQ A;  3GHG C;  1M57 D;  3WU2 H;  1FOS F;  1Q7Y Q;  1G2C A;  4PD4 I;  2E76 D;  2WPR A;  2P67 A;  1PP9 J;  2Y0C A;  3RK3 D;  1K9M Q;  1P84 H;  2XZR A;  4H44 B;  5E79 H;  2FXP A;  1KQG B;  3L74 G;  1LT9 A;  3NXS A;  4WY4 C;  1SQX K;  5AW8 B;  1SQP G;  3II6 A;  3OA7 A;  3AED C;  2RKL A;  1J1D B;  3PH0 A;  1OW7 A;  4KHX A;  1RF1 C;  1N86 A;  2A06 G;  1AA0 A;  2G3A A;  2I8D A;  1DH3 A;  2FYZ A;  3L75 J;  1HF9 A;  4YTP C;  1TU3 F;  1KD1 Q;  3MP7 B;  1ZN5 A;  5AVS B;  2OYI B;  2B9B A;  2ZJS E;  4HJG H;  1X22 A;  2KUB A;  3TNU B;  1PGP A;  4IOI H;  3USS A;  4Z1M H;  2ZXX A;  1FZA A;  2AEJ A;  3CCS P;  2JP3 A;  4XFJ A;  2KSJ A;  1G1J A;  1SQX J;  1DEE G;  4JYB A;  1KIL D;  5B66 H;  3BRV B;  2SPZ A;  1J1E B;  2O3J A;  4ASW A;  1YIJ P;  1JY2 P;  1LTJ B;  4RO0 A;  4DJG A;  1USD A;  2KP8 A;  1T2K D;  1ZP0 C;  3I55 P;  2JO1 A;  2FKW B;  1FZC A;  4PD4 D;  1SQP D;  2MJZ A;  2ZVN B;  2BEZ F;  2XV5 A;  1IFP A;  2A06 D;  2OYI A;  1FZF A;  2L5G B;  3ITK A;  2Q1K A;  2E76 B;  3I5C A;  3SWY A;  2GUS A;  1S72 P;  5BU5 A;  3RK3 B;  2WIT A;  3TNU A;  1N7L A;  1R5L A;  2LXB A;  1BCC E;  1NVO A;  4AUW A;  2FYN B;  4GDO A;  1DEB A;  1FZC C;  3RBZ A;  3VMX A;  2E42 A;  4EI2 A;  5CHX A;  2LR2 A;  2FXO A;  4NPD A;  4N6J A;  4NPE A;  3CCM P;  3AE9 C;  1CSB A;  5AW3 B;  2Z5H A;  1LTJ A;  2K37 A;  3V4Q A;  3UIA A;  1GK4 A;  1N7S D;  1NTZ J;  3L72 J;  5CBN A;  3Q3D A;  2ITA A;  5H2F E;  1FU1 A;  1CW5 A;  1FC2 C;  1HUC A;  2ZVO B;  1T3J A;  2YO3 A;  3R4Y A;  3GW6 A;  3HE5 B;  1PIX A;  3KHU A;  3T97 A;  5AW6 B;  1MUU A;  5KJ7 D;  3L71 G;  1BGY E;  1FZB A;  1JO5 A;  2IBZ E;  1VQK P;  3SWK A;  1VQO P;  1EDK A;  1KFM A;  1MFT A;  1YIT P;  3Q5S A;  3H1K E;  1JOC A;  1HGV A;  4JBZ A;  4QMA A;  1OWA A;  3AEA C;  1QX8 A;  2J58 A;  2WSE H;  1NKZ B;  1CI6 A;  3BAS A;  3VP8 A;  1USE A;  3A0B E;  2QM7 A;  1PPJ E;  2PAJ A;  5GTH H;  4OWF A;  1ZR4 A;  5APV A;  3AEG C;  1DX7 A;  1GL2 D;  2P1J A;  4YXD C;  3MZW B;  5AW1 B;  1K04 A;  2R5D A;  1VF5 D;  1WMK A;  4PV1 B;  3VMZ A;  4I7Z C;  2B88 A;  1L4A D;  2WSF H;  1SQB G;  1KIL A;  1X8Y A;  3RK2 C;  3L71 D;  2KS1 B;  4O9B A;  4K35 A;  1N7S B;  1NKN A;  2GUV A;  2JWD A;  3RL0 g;  2W6B A;  1NTM E;  1KIL E;  2OYH B;  1YJW P;  3CX5 H;  3H1J E;  1KIL C;  3GF7 A;  3HE4 B;  3JC2 2;  1H88 A;  2A45 I;  3VTP C;  1MV8 A;  1SQV K;  4R4L A;  2E5T A;  3L74 E;  1SQQ J;  5EFW B;  2IYP A;  2P58 A;  1EXI A;  4PD4 E;  3MUD C;  3AE5 C;  5BU8 B;  1LWU C;  1H8A A;  2XNX A;  1L0N E;  2OYO A;  3KZI H;  1KB9 E;  2AXT H;  1Q82 Q;  2JEE A;  3B5N D;  4EOT A;  2WTY A;  2QA4 P;  1SQB D;  1UII A;  2PFX A;  3AEB C;  3CCV P;  1RY3 A;  1IFN A;  3AEF C;  2XU6 A;  2NPS C;  1FBM A;  3M91 A;  1GL2 B;  1QGK B;  2OTK E;  1SQV J;  1FOS E;  3CMA P;  4XE5 B;  3PTZ A;  4H0L C;  2JR8 A;  3HE4 A;  2NRG A;  2KZJ A;  4W7Z A;  3HUS A;  1KFN A;  5KJ7 A;  2KIK A;  3V2N A;  3SFE C;  3Q5R A;  2L91 A;  2M3E A;  3KDP B;  5TIS H;  3A0H E;  2IYO A;  1YHQ P;  5B5E H;  3NTN A;  3N4X A;  4IL6 H;  1NU1 E;  1KYO H;  1GTW A;  2BCC E;  1NHL A;  2HOD B;  4GIF A;  4WY4 D;  4OGQ B;  3HUS C;  2KYV A;  1VQ6 P;  2GM4 A;  5AVT B;  3FX0 A;  1E79 H;  4JPZ B;  4I6M C;  4PJ0 E;  5AVZ B;  2ZT9 C;  5KLI B;  2KSE A;  4BXL A;  1SFC C;  1JTH B;  2CPB A;  2WVR A;  2KZI A;  3G3Z A;  1JMB A;  2QJP C;  2Y9Z A;  3W68 A;  2P7J A;  1YQ4 C;  3H1L E;  1L4A A;  3PHL A;  4UB6 E;  2E75 C;  2J59 M;  2NZ2 A;  2QRX A;  2O01 J;  3B5N B;  3KPE A;  1JY2 O;  1AV1 A;  1VL2 A;  3JSV C;  5KKZ B;  1VF5 C;  3M0D A;  1S5L E;  1YI2 P;  2WSS H;  5TJH A;  1FDI A;  4DOJ A;  2XDJ A;  1NJI Q;  3B4S A;  2IBZ I;  1Q2N A;  2WPS A;  3IFM A;  1EQ7 A;  4GKG A;  1IFI A;  1SQP J;  1VQP P;  3BCC E;  1VQ8 P;  1K73 Q;  1BGY G;  3GHG B;  4NPF X;  1UIX A;  1Q81 Q;  1YYC A;  2O01 N;  2Q3E A;  1WT6 A;  2KK7 A;  2FBW C;  2YKO A;  1JUN A;  3D70 A;  2IZ0 A;  3H1K G;  4N78 E;  2QEX P;  4WY4 B;  1YJN P;  1OVR A;  3G6E P;  4HKZ H;  1QLE D;  1BCC D;  3CWB E;  4OH8 B;  1FZG A;  3B5N A;  2KLV A;  4Y99 C;  1RF1 B;  1PPJ G;  4U3F G;  2B89 A;  1RF0 C;  2POH A;  1MZ9 A;  4C7R A;  2RMZ A;  4OVN F;  2PRR A;  2Y9Y A;  3AE4 C;  3GHG A;  1BE3 E;  1JY3 O;  2IZ1 A;  1N2D C;  1P84 E;  1BGY D;  3P7K A;  2IBZ D;  1JY2 N;  4WY4 A;  1M1J C;  1A02 F;  3L35 A;  1SS1 A;  2QE7 H;  1NTM G;  2FFD C;  3H1J G;  3H1K D;  1LGH B;  1RF1 A;  1PL5 A;  3FWL A;  2HPC B;  2IFN A;  2RN0 A;  3D6Z A;  2N1T D;  1AQ5 A;  2E74 C;  1PPJ D;  1KB9 I;  4U3F D;  2N9B A;  1BSN A;  3KXD A;  5APU A;  1L0N G;  1LTA C;  3H1I E;  1IZN B;  4IFF A;  5CJ0 A;  2C0X A;  1FZC B;  3W67 A;  3S9O A;  4I2L C;  3P32 A;  3H6P A;  4B86 A;  5B66 E;  3A2A A;  1VQN P;  3RK2 D;  2E43 A;  4L73 A;  4DCK A;  5L8R J;  3L71 J;  3R2P A;  1LJ2 A;  2YO2 A;  2A45 H;  4JF7 A;  1VQM P;  2YIU C;  1NTM D;  2HPC A;  3P8M C;  1SQB K;  1SLQ A;  3TGU G;  1M7L A;  1HTL C;  3H1J D;  4D6T E;  3S4R A;  1PV3 A;  1KC8 Q;  1BSH A;  1JY3 N;  1YTZ I;  1NU1 G;  3L74 D;  2AEM A;  2BCC G;  3PRJ A;  5AVW B;  3ABV C;  1OFC X;  4YXW H;  2V4H A;  1NTZ K;  1M56 D;  1L0N D;  1S9K D;  3T97 B;  1EDI A;  2XKM A;  1T3U A;  5CCG D;  4L75 A;  3C9I A;  1KB9 D;  4H13 C;  1VQL P;  3N7N A;  1NWQ A;  2BEQ D;  1KN7 A;  2R32 A;  3WUV A;  1SQB J;  2NPS D;  2H7H A;  1HBW A;  1J1D C;  2UWJ E;  4H0L D;  3H1L G;  2WT7 B;  4I7Z B;  4AYC A;  1CI6 B;  3D6Y A;  1RQU A;  3HD7 C;  1GZL A;  3RK2 B;  3LW5 J;  4TLF A;  3D71 A;  1VPC A;  1BDD A;  1NU1 D;  2LKM A;  1IK7 A;  3A3Y B;  3AEC C;  2BCC D;  1Y8A A;  4XA4 A;  1U57 A;  3CCR P;  1S1C X;  2HYN A;  2I1K A;  4EYY Q;  1KIL B;  3V5B A;  1JY3 P;  1YBK A;  4A7P A;  3BCC G;  2N1T A;  5GTH E;  4GOF A;  2ZT9 D;  2KOG A;  1L0L E;  1S5L X;  3CD6 P;  2AEF A;  1SFC D;  3AE3 C;  1LWU B;  1GU5 A;  4ZKU A;  2O1J A;  2WT7 A;  1PGJ A;  1R5S A;  2QG4 A;  3CC7 P;  3CWB G;  2N1T C;  1XTC C;  4U3F E;  3H1L D;  4HH2 A;  3WMM 0;  2E75 D;  3WUT A;  2Q6Q A;  1ZXG A;  1NOH A;  5M1B A;  2KLU A;  1SQQ K;  1FS0 E;  1M8O B;  4KJM A;  2NPS B;  3CXH H;  1EDL A;  3CX5 E;  3PP5 A;  2W90 A;  2YXQ B;  2QSI A;  1P84 I;  1OMI A;  4H0L B;  1YQ3 C;  1BE3 G;  2KB7 P;  1NYH A;  3LIE A;  3P8C E;  2FYU E;  3E1R A;  1NGM B;  1HGZ A;  4BWN A;  1OW8 A;  3BCC D;  3MUD A;  3MD0 A;  3A0B H;  1LWU A;  3L73 E;  3SSU A;  3BAT A;  3VMA A;  2AXT E;  3HUS B;  1OW6 A;  1U7J A;  5CCG A;  2P10 A;  4N78 D;  1BCC J;  3QH9 A;  2JWA A;  1AVO A;  5GTI E;  3CWB D;  2FXM A;  1NTK E;  3PJS K;  1KMI Z;  3FXD A;  1HJB A;  1GDT A;  2ZT9 B;  1KQS O;  4ZMD A;  3M9Q A;  1S9K E;  4RES B;  2JDI H;  2QJK C;  1SFC B;  2NPS A;  2YXR B;  5AW4 B;  2K9Y A;  3EFF K;  1RE4 A;  3H1I G;  2QJP B;  5CBO A;  5CCG C; 
#chains in the Genus database with same CATH homology
 2RH0 A;  3O6Q B;  2AXC A;  2O01 N;  1OZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...