2O01N

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
85
structure length
85
Chain Sequence
GVIEEYLEKSKTNKELNDKKRLATTGANFARAYTVEFGSCKFPENFTGCQDLAKQKKVPFLSDDLDLECEGKDKYKCGSNVFWKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 3
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2o01N01
2AXCA 3O6QB 2RH0A 2O01N 1OZHA
chains in the Genus database with same CATH superfamily
3HE4A 1NTZD 1PL5A 5KLVK 2BEZF 1KV4A 2GM4A 3CPWO 1SQBG 2P7JA 1FU1A 1JMBA 2RN0A 1VQKP 1GL2C 2P67A 1Y47A 1EDKA 2VRSA 2PRRA 1JB0J 4WY4C 1JMMA 2QJKC 2IBZG 4DCKA 1RF1C 1S1CX 1FZCA 1LNQA 1VQ4P 1OIPA 4JYCA 3AE5C 2N1TB 3MUDC 1IO4A 1X0TA 2R44A 1X79B 2YIUC 1BGYG 5CHXA 4NPEA 5AW3B 3P8CD 1SQQD 1SQQK 3U59A 4BRYB 2OYHC 2YMKA 4I2LC 3HD7B 2FYNC 1AJYA 4UB8E 4I7ZB 1N7SD 3GMAA 1JCCA 3VOPA 1Z56A 3V2PA 4AQRD 2WQYC 1NTMD 3H1LE 1OX3A 1RH5B 1R5SA 3A7OA 1S5LX 5CCHC 2M8RA 4JBZA 1LP1A 4EIJA 5APVA 2YKOA 3M0DA 2AXTE 2IDBA 2A06G 3L72E 3B4SA 1BSHA 1JUNA 3EWKA 4O9BA 2QJYC 5AW6B 1S2EA 2XV5A 1USDA 4EOTA 3H1JE 1S9KE 3LIEA 3IN6A 3B71A 5APXA 1OXZA 4WVZA 5B5EH 5KLIC 1GK4A 3WUUA 1DD4A 1VQNP 1ZRTE 3H1JG 2KOGA 4C7NA 1EZVI 1SQVG 1FBMA 3GHGB 3CC2P 1CZQA 1FZEA 3CXHD 1L2PA 5TISH 3P32A 4LGDE 1JY2P 2Z5IA 1NOHA 1L0LE 1BGYD 4D6TJ 3N4XA 2IX7C 2ZJSE 1PGPA 2KI7B 1NKNA 2R32A 1FAVA 3E1IA 1H89A 2YO3A 1SFCB 1EZVG 2G3AA 2R5BA 1LTJB 3TDKA 4IL6H 1FS0E 5AW2B 3RK3C 3L70G 3P7KA 2ZAEB 1FZCC 4GODA 3AEFC 1Y9BA 2HPCA 4ASVA 2XDJA 1VQ7P 2A06D 3L74G 1SQXG 1ZV8A 1BCCE 4AUWA 1NU1J 1LTSC 4Y99B 1J1EB 3U1CA 1T6AA 3HUSB 3MIWA 1R8EA 1LT9A 1XTCC 3V2NA 1NJIQ 3S1KA 2DW3A 5GTIH 3RK2C 1M57D 1H8AA 2O1JA 1DD3A 3EFGA 4H44C 1KFMA 2KS1A 1OW6A 2Q3EA 3PH0A 3H1JD 1T3UA 4TT3H 1G2CB 2QIWA 4UB6H 1SQVD 5KTBA 1S9KD 3JC22 2BCCE 3M0DC 4BXLA 2FY8A 3KZIH 1Q81Q 2Y9ZA 2Y0CA 2P58A 2FFDB 4H0LD 3TNUA 2QRXA 1Q90D 4L75A 1BE3E 1ZRTD 2Q1KA 2RKLA 1WMKA 3M9HA 1LWUA 5DJTB 3T97B 1YHQP 1NTKG 3B5ND 1LTGC 2QM8A 1VF5D 1EXJA 2OTKE 1L0LD 5KJ7A 2GUSA 1X22A 2H88C 3L70D 2P2UA 2YXQB 3MD0A 1KILB 1LTAC 3QH9A 2XNXA 4C7RA 5APQA 1PGJA 2YXRB 1KMIZ 1E79H 3HE5A 3H1KG 3O6QA 2JDIH 3L74D 1SQXD 5APSA 4DJGA 1L0NE 1NVOA 3L71E 2R3CA 3TYYA 4XE5B 2QSIA 1IFJA 3CXHH 1UIXA 1DH3A 1VQ5P 3BCCG 1M7LA 2LXCB 3H1HE 2Y0EA 1IJDB 2KP8A 1EDJA 1E5WA 1BGYJ 2OTJP 2M5AB 4W7ZA 1N8RQ 1ZXGA 4D6TG 2Q9IA 2NPSB 1LT9C 1ZR2A 3VN0A 3G6EP 3L73E 2K37A 3LW5H 3CCJP 1H88A 1YYCA 1NTKD 3GLMA 1YIJP 4UB8H 1KZUB 4PJ0E 4AYCA 1SQPG 2B87A 1BE3D 4XFJA 1DIPA 2ZT9C 3JSVC 4H13C 4MN4C 2Q3IA 5GTHE 4K3AA 3CC7P 1FDMA 3H1KD 2OYOA 4NPFX 1GMJA 4IFMA 5AVUB 1KQGB 2GA1A 3CWBG 1K05A 2KZJA 5B66E 4JF7A 1VQ6P 1NTZG 1LWUC 2IYPA 1M90Q 3H32A 5KLVG 4RESB 1HTLC 1HH0A 2N1TA 1IFPA 3R2PA 1M1KQ 1Q2NA 5CBOA 2P10A 1N73B 1OW8A 5KJ7C 4PV1D 3H1JJ 1PPJE 1SQVJ 1L0NK 2E75C 1IFNA 1BDDA 2NZ2A 3L71D 1GDTA 2ZFCA 1S5LE 3I5CA 2I1JA 1T2KC 1FOSF 3CCQP 5CCGA 2GUVA 4TLFA 3A3YB 4C46A 3RBZA 2C0WA 4YXDC 1SQQG 2YMYA 3D6YA 2KNCB 1N2DC 3W68A 2OYIB 2M3BA 2N9YB 5APWA 2N1TD 3BRTB 2C0XA 1FZGA 2K88A 1NTMG 1L0LJ 1JY3O 3L70J 3HD7D 3H25A 4GIFA 1SQPD 3VP9A 2I8DA 4K35A 1RQVA 1FC2C 5L8RJ 2WPRA 3L74J 1SQXJ 1ZN5A 2HFED 3AE2C 3CXHI 2R5DA 2CPBA 1T8ZA 3D70A 2SPZA 4JQ0D 4HH2A 4U7JA 1KB9E 5KLVD 2WT7A 3SWYA 1N7SA 1MFTA 5AVZB 3SFEC 3HTKA 4W80A 2O01H 1GL2B 3TGUG 2W83C 3MGNA 4WY4B 2QJKB 2CK3H 1RF1B 2O01J 2HODA 1Q82Q 1KYOE 3RGUA 3CMEP 3G71P 2YIUB 1L4AA 3PJSK 1YBKA 3U1AA 1NAFA 2Q5UA 3B8EB 1Q7YQ 2OYHB 2H43A 1RY3A 2FYNB 5M1BA 4A7PA 1NTKJ 2N1TC 1URQB 2B89A 5BU8B 1X8YA 1H0TA 1QGKB 1IFMA 2J59M 3P8MC 4KHXA 1JY2N 1XTGB 4U3FE 1KILE 1PIXA 3RL0C 1GU4A 4DZOA 3H1IE 4DT0A 2O1KA 3V5BA 2KK7A 1EDLA 1NYHA 2Q7CA 2MKVA 4OGQD 3H1KJ 5CCGC 1PGOA 1L4AD 2QJYB 4R4LA 1HJ0A 1HUCA 1KQFB 3USSA 3H1LG 1QVFO 3D6ZA 4DOJA 3R4YA 3VYIA 2W90A 2C9LY 1JTHA 2K9JB 3VMYA 5KLIB 3L72G 3BCCJ 3FX0A 3L35A 3HRNA 3TGUD 1LT1A 3L71J 3VMZA 3CD6P 1KB9D 4Z1MH 3VMXA 2WSFH 1SQBK 4WB4A 1RHZB 2E74D 4WWIA 3N7NA 1W2EA 2QJPC 1AFOA 2QM7A 3ZDMA 2R3SA 3HE4B 3M91A 1LJ2A 3PLNA 1KYOD 3IFMA 4YPCA 3VP8A 3AE4C 1N7SC 3OAKA 3SSUA 1AA0A 3S4RA 3M9QA 2FYUE 5E79E 1L0LG 2RH0A 1SQPJ 2O01N 3RK3B 2WTYA 3L36A 1FZCB 2WSCH 3C9IA 2QA4P 4PJ0H 1SVFA 1NGMB 3PHLA 4OGQC 2L91A 2JR8A 2Z5HA 2WSCJ 1L4AC 4B86A 3OW2O 3BATA 3A2AA 2ITAA 3CWBJ 3AEDC 3H1LD 2G8YA 4U3FD 1KILD 5AW7B 1NTZJ 3H1ID 2YKQA 4RJTA 5KLVJ 2PP6A 1NAYA 3RK2B 1HBWA 1JNMA 1CW5A 5B66H 4H44B 3WUTA 2CPSA 3B5NA 2HLOA 2HYNA 1YTZI 3KQGA 3L72D 1BCCG 2PAJA 2V7QH 3LIDA 5K5GB 4PD4E 2NPSA 2H8PD 1LP1B 4N3YB 1GW3A 1HVVA 1PGQA 2FXMA 5AW1B 3V6IA 1W2BO 1WT6A 1VPCA 1OW7A 2E74C 3MTUE 1SQQJ 2OGUA 1MKMA 1S5LH 1NHLA 3FXEA 2J5UA 3I55P 1FJPA 1FDOA 3G3ZA 4RKUJ 1HJBA 1LTIC 3TSIA 2BCCG 1CSBA 1NTMJ 3TF5A 1U7JA 1FE6A 2E76D 2H7HA 2NPSD 4C7NB 1BE3G 1MFZA 3UIAA 3L75E 1PP9E 4KJMA 1ZOYC 5KKZC 4L73A 2YNYA 1KFNA 2FYUK 2JP3A 2AEFA 1DEBA 1UIIA 2M3EA 3KXDA 3E1RA 3CXHE 3BVHA 3C1LA 2LKMA 1DEEG 2ZVOB 4XA4A 4JPZB 1KB9H 3OA7A 1BCCD 1GTWA 3TGUJ 2HG5D 4ZKUA 1L0NG 1M1JA 1CI6A 2WITA 3A0BE 3CCMP 3RBXA 2JJLA 3L71G 2HPCB 4GT1A 1T3JA 3Q5PA 1J1DC 4OVNF 3A0HE 2IYOA 5KAFE 1KYOH 3F89A 3V2QA 4H0LC 1LT9B 3H1HG 1OFCX 3M0AA 2FKWB 2ZYGA 1LGHB 1JOCA 1IK7A 2Q6QA 2BCCD 2LR2A 3B5NC 2KS1B 3AE1C 1KD1Q 1FOSE 1VF5C 3LW5J 2E76C 2NPSC 2WSSH 1PV3A 2ZT9B 2IZ1A 2OTLP 2WWWA 4H13B 2W6AA 2WVRA 3L73G 1BDCA 2OQQA 1YJ9P 5BU5A 2XU6A 3A5TA 1NU1E 3TNUB 2PGDA 3H1LJ 2AXTH 2D2CD 3IAOA 3CCSP 1U7MA 1LWUB 3L75D 4HJGH 1PP9D 4I6MC 5APUA 3L72J 3BASA 5AW9B 4BRYA 2QEXP 1L0ND 2AXCA 2E75B 1PFIA 3HD7A 4ZKPA 3FWNA 2OARA 3CCEP 4IFDK 1URQA 2JWAA 1BSNA 3HE5B 4HB1A 1FZBA 1GL2D 3CMAP 5CMZA 1ZR4A 4ASWA 4WY4D 1YI2P 1OMIA 1PPJG 3H1HD 1HGZA 3WU2E 2KLVA 4LC1A 3CCUP 3PTZA 2Y0DA 3TK1A 3CCVP 2KZIA 3RK3E 3ITKA 2PFXA 3Q3DA 1IK9A 3M06A 4CPGA 2QG4A 3CCRP 1M1JC 1URQD 5E79H 2KYVA 5EFWB 3L73D 2Z4EA 5AVWB 4N6JA 2AEJA 1YQ4C 2D2CC 3GHGA 3AE8C 1KB9I 2L5GB 3IR9A 4WBAA 5BVZA 1OZHA 4GOEA 1SQBE 3VMAA 2KSEA 4LLHA 1MV8A 1BCCJ 1P84E 3JCUE 3F5HA 4IL6X 1NU1K 2IBZE 1JEKA 1KYOI 2B87B 3CL3D 4PV1C 3MZWB 1NTZK 2E5TA 1SFCA 4PD4H 3II6A 1BGYE 1LTJA 1AQ5A 1YJNP 1FZFA 4M3LA 2IZ0A 1Q86Q 5H2FE 3KYQA 5C39A 2JWDA 1EQ7A 1SP4A 1PPJD 2K1AA 4EI2A 3H32B 1RE3A 3OJAB 2BCCJ 3MHVA 2V4HA 1QLED 2JO1A 3V4WA 5TJHA 1U57A 2HR3A 1USEA 2IFNA 3HUSA 2IPPA 1BE3J 3RL0B 2A45H 3HD7C 2BASA 3GF3A 4I7ZC 1SFCD 2A06E 1URQC 1OVRA 3L37A 5AVQB 1FZAA 1D7MA 1NTMK 5KAIE 3V2RA 3RK3D 5CJ0A 5APTA 1A02F 5AVSB 1ZLLA 4U3FG 1G2CA 1SLQA 3PP5A 4GDOA 3H1IG 3CX5I 3L75J 2N9BA 1PP9J 3FXDA 2H89C 3CX5E 3GW6A 2FFDA 5AW5B 3KDPB 1RQUA 1SQVE 2WPVB 1L0NJ 2XNDH 1VQ9P 2POHA 1VQMP 1R5LA 2K9YA 3RK2D 1IC2A 3T97A 1AV1A 4H44D 2MJZA 1SQBD 3A0BH 4EDFA 3IF4A 3NMDA 1KQSO 1GU5A 1P84D 2QJPB 1YTZT 2IBZD 3GHGC 1JM0A 4R4MA 3E7KA 3H1HJ 2WSFJ 3VTPC 4IOIH 3CCLP 3A0HH 5KAFH 1EZVE 1KILA 1QEXA 5AVTB 3MP7B 2WT7B 1N7SB 3SWKA 2FYZA 2WMMA 2AEMA 3HTKB 1N86A 3M9BA 2WPSA 3EQ2A 2YO2A 5AVVB 3AEBC 3L70E 2JKVA 1IZNB 1JY3N 1K9MQ 1M8OB 2HODB 3EFFK 3G9RA 2WPQA 3AE7C 1SFCC 3L73J 1RF0A 3L74E 1SQXE 2ZVNB 4OGQB 1MZ9A 1LTJC 1L4AB 1KN7A 5GTHH 2FYUG 1NKZB 3SFDC 1ZW0A 1OWAA 1RE3C 1LTTC 3PRJA 1AQTA 2KXPB 2BEQD 1H0TB 2FBWC 4BWNA 2M5AA 4PD4I 1VQPP 4Y99C 1J1EC 4ZMDA 3HUSC 2ZXEB 2Y9YA 5AVRB 1GW4A 1S72P 1S4XA 2FXOA 5AW4B 3AE6C 3K5BA 1PZQA 4N78E 1X9VA 1K04A 2V7QJ 3NXSA 5DJUB 1HF9A 2E5YA 3L4FA 1J2JB 1VDFA 3CX5D 2FXPA 5APYA 1JY3P 2E74B 2W8ZA 1SQVK 1G1IA 2UWJE 2KUBA 5AW8B 1AVYA 2K3RA 1NTKE 2A45I 1JTHB 2KLUA 1VQ8P 3AEGC 3AE9C 1QVGO 2KIKA 1FDIA 3Q5RA 2FFDC 3WU2H 3O8ZA 5AW0B 1EDIA 1KORA 3I56P 3BRVB 2ZXXA 3GF7A 2XZRA 1EZVD 1SS1A 3H1KE 1M56D 3FGAD 2A45G 5KKZB 1N73A 1L0LK 1NH4A 1GK6A 2W6JH 2ZT9D 1K73Q 2FYUD 1VQOP 4RO0A 2C9NY 1RE4A 2YKPA 4H13D 3WMM0 3WUVA 1GZLA 1KILC 1JO5A 1ZMEC 3L75G 1HGVA 1PP9G 5AVYB 1N7LA 1SQXK 3BCCE 1WRGA 3AE3C 3CLQA 3CC4P 2E42A 2M0BA 5B5EE 2KNCA 2OYIA 4GKGA 1A02J 1P84H 2QVAA 1JCDA 3JCUH 1K8AQ 1RF0C 1SQBJ 1J1DB 1DX7A 4IFFA 5KJ7D 4D6TE 5TISE 2NRGA 2ZYAA 4H0LB 1W5CE 2E75D 3W67A 4PD4D 2WSEH 2XKMA 1T2KD 3CI9A 5H2FH 2P1JA 4N78D 3B5NB 2WSEJ 4L74A 1VF5B 1SQPE 2E76B 1AVOA 3H6PA 2KB7P 2LXBA 4IL6E 1FJKA 3GG2A 5CBNA 1NTKK 3RL0g 3ABVC 1MUUA 3AECC 1JY2O 1GL2A 3CWBE 1KQLA 2O3JA 3D71A 5CJ4A 3FWLA 1ZP0C 4WY4A 4U3FJ 2QE7H 1YITP 1NTZE 1RF1A 3KPEA 3H1IJ 2B9BA 4ZNCA 5KLVE 5KAIH 3AEEC 4NPDA 5AVXB 1YQ3C 3MUDA 1KTMA 4JYBA 3QWOC 1TU3F 5GTIE 1NU1G 2I1KA 4I1LA 3SWFA 3Q1MA 4W7YA 1VQLP 4KT0J 1QL1A 3CX5H 1QX8A 2OYHA 3NTNA 1VL2A 4UB6E 1Y8AA 2W6BA 3O6QB 3P8CE 1SQQE 2IFMA 3AEAC 1N73C 3BCCD 3NFQA 1LTBC 5CCHA 1NWQA 1RE4C 3KZIE 3Q2YA 1S3JA 3S9OA 1NO4A 1EXIA 1NTME 4OH8B 1EC5A 3Q5SA 4YTPC 3C8VA 4D6TD 4HKZH 1YJWP 1M1JB 1CI6B 4HYTB 2E43A 3G4SP 1OVUA 2OYIC 2KSJA 1IFIA 2JEEA 2K9JA 4OWFA 2W27A 1QL2A 2FYUJ 3RL0D 5CCHD 1KC8Q 1SQPK 2D2CB 2B88A 4Y28J 2WZ7A 3KHUA 1G1JA 1OVVA 4YXWH 4L76A 5CCGD 2RMZA 1HWTC 4EYYQ 1P84I 1GD2E 2IBZI 2ZYDA 4QMAA 2J58A 3TGUE 1IFDA 1NU1D 4GOFA 3CWBD 4PV1B 3V4QA
chains in the Genus database with same CATH topology
2AXCA 3O6QB 2RH0A 2O01N 1OZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXC A;  3O6Q B;  2RH0 A;  2O01 N;  1OZH A; 
#chains in the Genus database with same CATH topology
 3HE4 A;  1NTZ D;  1PL5 A;  5KLV K;  2BEZ F;  1KV4 A;  2GM4 A;  3CPW O;  1SQB G;  2P7J A;  1FU1 A;  1JMB A;  2RN0 A;  1VQK P;  1GL2 C;  2P67 A;  1Y47 A;  1EDK A;  2VRS A;  2PRR A;  1JB0 J;  4WY4 C;  1JMM A;  2QJK C;  2IBZ G;  4DCK A;  1RF1 C;  1S1C X;  1FZC A;  1LNQ A;  1VQ4 P;  1OIP A;  4JYC A;  3AE5 C;  2N1T B;  3MUD C;  1IO4 A;  1X0T A;  2R44 A;  1X79 B;  2YIU C;  1BGY G;  5CHX A;  4NPE A;  5AW3 B;  3P8C D;  1SQQ D;  1SQQ K;  3U59 A;  4BRY B;  2OYH C;  2YMK A;  4I2L C;  3HD7 B;  2FYN C;  1AJY A;  4UB8 E;  4I7Z B;  1N7S D;  3GMA A;  1JCC A;  3VOP A;  1Z56 A;  3V2P A;  4AQR D;  2WQY C;  1NTM D;  3H1L E;  1OX3 A;  1RH5 B;  1R5S A;  3A7O A;  1S5L X;  5CCH C;  2M8R A;  4JBZ A;  1LP1 A;  4EIJ A;  5APV A;  2YKO A;  3M0D A;  2AXT E;  2IDB A;  2A06 G;  3L72 E;  3B4S A;  1BSH A;  1JUN A;  3EWK A;  4O9B A;  2QJY C;  5AW6 B;  1S2E A;  2XV5 A;  1USD A;  4EOT A;  3H1J E;  1S9K E;  3LIE A;  3IN6 A;  3B71 A;  5APX A;  1OXZ A;  4WVZ A;  5B5E H;  5KLI C;  1GK4 A;  3WUU A;  1DD4 A;  1VQN P;  1ZRT E;  3H1J G;  2KOG A;  4C7N A;  1EZV I;  1SQV G;  1FBM A;  3GHG B;  3CC2 P;  1CZQ A;  1FZE A;  3CXH D;  1L2P A;  5TIS H;  3P32 A;  4LGD E;  1JY2 P;  2Z5I A;  1NOH A;  1L0L E;  1BGY D;  4D6T J;  3N4X A;  2IX7 C;  2ZJS E;  1PGP A;  2KI7 B;  1NKN A;  2R32 A;  1FAV A;  3E1I A;  1H89 A;  2YO3 A;  1SFC B;  1EZV G;  2G3A A;  2R5B A;  1LTJ B;  3TDK A;  4IL6 H;  1FS0 E;  5AW2 B;  3RK3 C;  3L70 G;  3P7K A;  2ZAE B;  1FZC C;  4GOD A;  3AEF C;  1Y9B A;  2HPC A;  4ASV A;  2XDJ A;  1VQ7 P;  2A06 D;  3L74 G;  1SQX G;  1ZV8 A;  1BCC E;  4AUW A;  1NU1 J;  1LTS C;  4Y99 B;  1J1E B;  3U1C A;  1T6A A;  3HUS B;  3MIW A;  1R8E A;  1LT9 A;  1XTC C;  3V2N A;  1NJI Q;  3S1K A;  2DW3 A;  5GTI H;  3RK2 C;  1M57 D;  1H8A A;  2O1J A;  1DD3 A;  3EFG A;  4H44 C;  1KFM A;  2KS1 A;  1OW6 A;  2Q3E A;  3PH0 A;  3H1J D;  1T3U A;  4TT3 H;  1G2C B;  2QIW A;  4UB6 H;  1SQV D;  5KTB A;  1S9K D;  3JC2 2;  2BCC E;  3M0D C;  4BXL A;  2FY8 A;  3KZI H;  1Q81 Q;  2Y9Z A;  2Y0C A;  2P58 A;  2FFD B;  4H0L D;  3TNU A;  2QRX A;  1Q90 D;  4L75 A;  1BE3 E;  1ZRT D;  2Q1K A;  2RKL A;  1WMK A;  3M9H A;  1LWU A;  5DJT B;  3T97 B;  1YHQ P;  1NTK G;  3B5N D;  1LTG C;  2QM8 A;  1VF5 D;  1EXJ A;  2OTK E;  1L0L D;  5KJ7 A;  2GUS A;  1X22 A;  2H88 C;  3L70 D;  2P2U A;  2YXQ B;  3MD0 A;  1KIL B;  1LTA C;  3QH9 A;  2XNX A;  4C7R A;  5APQ A;  1PGJ A;  2YXR B;  1KMI Z;  1E79 H;  3HE5 A;  3H1K G;  3O6Q A;  2JDI H;  3L74 D;  1SQX D;  5APS A;  4DJG A;  1L0N E;  1NVO A;  3L71 E;  2R3C A;  3TYY A;  4XE5 B;  2QSI A;  1IFJ A;  3CXH H;  1UIX A;  1DH3 A;  1VQ5 P;  3BCC G;  1M7L A;  2LXC B;  3H1H E;  2Y0E A;  1IJD B;  2KP8 A;  1EDJ A;  1E5W A;  1BGY J;  2OTJ P;  2M5A B;  4W7Z A;  1N8R Q;  1ZXG A;  4D6T G;  2Q9I A;  2NPS B;  1LT9 C;  1ZR2 A;  3VN0 A;  3G6E P;  3L73 E;  2K37 A;  3LW5 H;  3CCJ P;  1H88 A;  1YYC A;  1NTK D;  3GLM A;  1YIJ P;  4UB8 H;  1KZU B;  4PJ0 E;  4AYC A;  1SQP G;  2B87 A;  1BE3 D;  4XFJ A;  1DIP A;  2ZT9 C;  3JSV C;  4H13 C;  4MN4 C;  2Q3I A;  5GTH E;  4K3A A;  3CC7 P;  1FDM A;  3H1K D;  2OYO A;  4NPF X;  1GMJ A;  4IFM A;  5AVU B;  1KQG B;  2GA1 A;  3CWB G;  1K05 A;  2KZJ A;  5B66 E;  4JF7 A;  1VQ6 P;  1NTZ G;  1LWU C;  2IYP A;  1M90 Q;  3H32 A;  5KLV G;  4RES B;  1HTL C;  1HH0 A;  2N1T A;  1IFP A;  3R2P A;  1M1K Q;  1Q2N A;  5CBO A;  2P10 A;  1N73 B;  1OW8 A;  5KJ7 C;  4PV1 D;  3H1J J;  1PPJ E;  1SQV J;  1L0N K;  2E75 C;  1IFN A;  1BDD A;  2NZ2 A;  3L71 D;  1GDT A;  2ZFC A;  1S5L E;  3I5C A;  2I1J A;  1T2K C;  1FOS F;  3CCQ P;  5CCG A;  2GUV A;  4TLF A;  3A3Y B;  4C46 A;  3RBZ A;  2C0W A;  4YXD C;  1SQQ G;  2YMY A;  3D6Y A;  2KNC B;  1N2D C;  3W68 A;  2OYI B;  2M3B A;  2N9Y B;  5APW A;  2N1T D;  3BRT B;  2C0X A;  1FZG A;  2K88 A;  1NTM G;  1L0L J;  1JY3 O;  3L70 J;  3HD7 D;  3H25 A;  4GIF A;  1SQP D;  3VP9 A;  2I8D A;  4K35 A;  1RQV A;  1FC2 C;  5L8R J;  2WPR A;  3L74 J;  1SQX J;  1ZN5 A;  2HFE D;  3AE2 C;  3CXH I;  2R5D A;  2CPB A;  1T8Z A;  3D70 A;  2SPZ A;  4JQ0 D;  4HH2 A;  4U7J A;  1KB9 E;  5KLV D;  2WT7 A;  3SWY A;  1N7S A;  1MFT A;  5AVZ B;  3SFE C;  3HTK A;  4W80 A;  2O01 H;  1GL2 B;  3TGU G;  2W83 C;  3MGN A;  4WY4 B;  2QJK B;  2CK3 H;  1RF1 B;  2O01 J;  2HOD A;  1Q82 Q;  1KYO E;  3RGU A;  3CME P;  3G71 P;  2YIU B;  1L4A A;  3PJS K;  1YBK A;  3U1A A;  1NAF A;  2Q5U A;  3B8E B;  1Q7Y Q;  2OYH B;  2H43 A;  1RY3 A;  2FYN B;  5M1B A;  4A7P A;  1NTK J;  2N1T C;  1URQ B;  2B89 A;  5BU8 B;  1X8Y A;  1H0T A;  1QGK B;  1IFM A;  2J59 M;  3P8M C;  4KHX A;  1JY2 N;  1XTG B;  4U3F E;  1KIL E;  1PIX A;  3RL0 C;  1GU4 A;  4DZO A;  3H1I E;  4DT0 A;  2O1K A;  3V5B A;  2KK7 A;  1EDL A;  1NYH A;  2Q7C A;  2MKV A;  4OGQ D;  3H1K J;  5CCG C;  1PGO A;  1L4A D;  2QJY B;  4R4L A;  1HJ0 A;  1HUC A;  1KQF B;  3USS A;  3H1L G;  1QVF O;  3D6Z A;  4DOJ A;  3R4Y A;  3VYI A;  2W90 A;  2C9L Y;  1JTH A;  2K9J B;  3VMY A;  5KLI B;  3L72 G;  3BCC J;  3FX0 A;  3L35 A;  3HRN A;  3TGU D;  1LT1 A;  3L71 J;  3VMZ A;  3CD6 P;  1KB9 D;  4Z1M H;  3VMX A;  2WSF H;  1SQB K;  4WB4 A;  1RHZ B;  2E74 D;  4WWI A;  3N7N A;  1W2E A;  2QJP C;  1AFO A;  2QM7 A;  3ZDM A;  2R3S A;  3HE4 B;  3M91 A;  1LJ2 A;  3PLN A;  1KYO D;  3IFM A;  4YPC A;  3VP8 A;  3AE4 C;  1N7S C;  3OAK A;  3SSU A;  1AA0 A;  3S4R A;  3M9Q A;  2FYU E;  5E79 E;  1L0L G;  2RH0 A;  1SQP J;  2O01 N;  3RK3 B;  2WTY A;  3L36 A;  1FZC B;  2WSC H;  3C9I A;  2QA4 P;  4PJ0 H;  1SVF A;  1NGM B;  3PHL A;  4OGQ C;  2L91 A;  2JR8 A;  2Z5H A;  2WSC J;  1L4A C;  4B86 A;  3OW2 O;  3BAT A;  3A2A A;  2ITA A;  3CWB J;  3AED C;  3H1L D;  2G8Y A;  4U3F D;  1KIL D;  5AW7 B;  1NTZ J;  3H1I D;  2YKQ A;  4RJT A;  5KLV J;  2PP6 A;  1NAY A;  3RK2 B;  1HBW A;  1JNM A;  1CW5 A;  5B66 H;  4H44 B;  3WUT A;  2CPS A;  3B5N A;  2HLO A;  2HYN A;  1YTZ I;  3KQG A;  3L72 D;  1BCC G;  2PAJ A;  2V7Q H;  3LID A;  5K5G B;  4PD4 E;  2NPS A;  2H8P D;  1LP1 B;  4N3Y B;  1GW3 A;  1HVV A;  1PGQ A;  2FXM A;  5AW1 B;  3V6I A;  1W2B O;  1WT6 A;  1VPC A;  1OW7 A;  2E74 C;  3MTU E;  1SQQ J;  2OGU A;  1MKM A;  1S5L H;  1NHL A;  3FXE A;  2J5U A;  3I55 P;  1FJP A;  1FDO A;  3G3Z A;  4RKU J;  1HJB A;  1LTI C;  3TSI A;  2BCC G;  1CSB A;  1NTM J;  3TF5 A;  1U7J A;  1FE6 A;  2E76 D;  2H7H A;  2NPS D;  4C7N B;  1BE3 G;  1MFZ A;  3UIA A;  3L75 E;  1PP9 E;  4KJM A;  1ZOY C;  5KKZ C;  4L73 A;  2YNY A;  1KFN A;  2FYU K;  2JP3 A;  2AEF A;  1DEB A;  1UII A;  2M3E A;  3KXD A;  3E1R A;  3CXH E;  3BVH A;  3C1L A;  2LKM A;  1DEE G;  2ZVO B;  4XA4 A;  4JPZ B;  1KB9 H;  3OA7 A;  1BCC D;  1GTW A;  3TGU J;  2HG5 D;  4ZKU A;  1L0N G;  1M1J A;  1CI6 A;  2WIT A;  3A0B E;  3CCM P;  3RBX A;  2JJL A;  3L71 G;  2HPC B;  4GT1 A;  1T3J A;  3Q5P A;  1J1D C;  4OVN F;  3A0H E;  2IYO A;  5KAF E;  1KYO H;  3F89 A;  3V2Q A;  4H0L C;  1LT9 B;  3H1H G;  1OFC X;  3M0A A;  2FKW B;  2ZYG A;  1LGH B;  1JOC A;  1IK7 A;  2Q6Q A;  2BCC D;  2LR2 A;  3B5N C;  2KS1 B;  3AE1 C;  1KD1 Q;  1FOS E;  1VF5 C;  3LW5 J;  2E76 C;  2NPS C;  2WSS H;  1PV3 A;  2ZT9 B;  2IZ1 A;  2OTL P;  2WWW A;  4H13 B;  2W6A A;  2WVR A;  3L73 G;  1BDC A;  2OQQ A;  1YJ9 P;  5BU5 A;  2XU6 A;  3A5T A;  1NU1 E;  3TNU B;  2PGD A;  3H1L J;  2AXT H;  2D2C D;  3IAO A;  3CCS P;  1U7M A;  1LWU B;  3L75 D;  4HJG H;  1PP9 D;  4I6M C;  5APU A;  3L72 J;  3BAS A;  5AW9 B;  4BRY A;  2QEX P;  1L0N D;  2AXC A;  2E75 B;  1PFI A;  3HD7 A;  4ZKP A;  3FWN A;  2OAR A;  3CCE P;  4IFD K;  1URQ A;  2JWA A;  1BSN A;  3HE5 B;  4HB1 A;  1FZB A;  1GL2 D;  3CMA P;  5CMZ A;  1ZR4 A;  4ASW A;  4WY4 D;  1YI2 P;  1OMI A;  1PPJ G;  3H1H D;  1HGZ A;  3WU2 E;  2KLV A;  4LC1 A;  3CCU P;  3PTZ A;  2Y0D A;  3TK1 A;  3CCV P;  2KZI A;  3RK3 E;  3ITK A;  2PFX A;  3Q3D A;  1IK9 A;  3M06 A;  4CPG A;  2QG4 A;  3CCR P;  1M1J C;  1URQ D;  5E79 H;  2KYV A;  5EFW B;  3L73 D;  2Z4E A;  5AVW B;  4N6J A;  2AEJ A;  1YQ4 C;  2D2C C;  3GHG A;  3AE8 C;  1KB9 I;  2L5G B;  3IR9 A;  4WBA A;  5BVZ A;  1OZH A;  4GOE A;  1SQB E;  3VMA A;  2KSE A;  4LLH A;  1MV8 A;  1BCC J;  1P84 E;  3JCU E;  3F5H A;  4IL6 X;  1NU1 K;  2IBZ E;  1JEK A;  1KYO I;  2B87 B;  3CL3 D;  4PV1 C;  3MZW B;  1NTZ K;  2E5T A;  1SFC A;  4PD4 H;  3II6 A;  1BGY E;  1LTJ A;  1AQ5 A;  1YJN P;  1FZF A;  4M3L A;  2IZ0 A;  1Q86 Q;  5H2F E;  3KYQ A;  5C39 A;  2JWD A;  1EQ7 A;  1SP4 A;  1PPJ D;  2K1A A;  4EI2 A;  3H32 B;  1RE3 A;  3OJA B;  2BCC J;  3MHV A;  2V4H A;  1QLE D;  2JO1 A;  3V4W A;  5TJH A;  1U57 A;  2HR3 A;  1USE A;  2IFN A;  3HUS A;  2IPP A;  1BE3 J;  3RL0 B;  2A45 H;  3HD7 C;  2BAS A;  3GF3 A;  4I7Z C;  1SFC D;  2A06 E;  1URQ C;  1OVR A;  3L37 A;  5AVQ B;  1FZA A;  1D7M A;  1NTM K;  5KAI E;  3V2R A;  3RK3 D;  5CJ0 A;  5APT A;  1A02 F;  5AVS B;  1ZLL A;  4U3F G;  1G2C A;  1SLQ A;  3PP5 A;  4GDO A;  3H1I G;  3CX5 I;  3L75 J;  2N9B A;  1PP9 J;  3FXD A;  2H89 C;  3CX5 E;  3GW6 A;  2FFD A;  5AW5 B;  3KDP B;  1RQU A;  1SQV E;  2WPV B;  1L0N J;  2XND H;  1VQ9 P;  2POH A;  1VQM P;  1R5L A;  2K9Y A;  3RK2 D;  1IC2 A;  3T97 A;  1AV1 A;  4H44 D;  2MJZ A;  1SQB D;  3A0B H;  4EDF A;  3IF4 A;  3NMD A;  1KQS O;  1GU5 A;  1P84 D;  2QJP B;  1YTZ T;  2IBZ D;  3GHG C;  1JM0 A;  4R4M A;  3E7K A;  3H1H J;  2WSF J;  3VTP C;  4IOI H;  3CCL P;  3A0H H;  5KAF H;  1EZV E;  1KIL A;  1QEX A;  5AVT B;  3MP7 B;  2WT7 B;  1N7S B;  3SWK A;  2FYZ A;  2WMM A;  2AEM A;  3HTK B;  1N86 A;  3M9B A;  2WPS A;  3EQ2 A;  2YO2 A;  5AVV B;  3AEB C;  3L70 E;  2JKV A;  1IZN B;  1JY3 N;  1K9M Q;  1M8O B;  2HOD B;  3EFF K;  3G9R A;  2WPQ A;  3AE7 C;  1SFC C;  3L73 J;  1RF0 A;  3L74 E;  1SQX E;  2ZVN B;  4OGQ B;  1MZ9 A;  1LTJ C;  1L4A B;  1KN7 A;  5GTH H;  2FYU G;  1NKZ B;  3SFD C;  1ZW0 A;  1OWA A;  1RE3 C;  1LTT C;  3PRJ A;  1AQT A;  2KXP B;  2BEQ D;  1H0T B;  2FBW C;  4BWN A;  2M5A A;  4PD4 I;  1VQP P;  4Y99 C;  1J1E C;  4ZMD A;  3HUS C;  2ZXE B;  2Y9Y A;  5AVR B;  1GW4 A;  1S72 P;  1S4X A;  2FXO A;  5AW4 B;  3AE6 C;  3K5B A;  1PZQ A;  4N78 E;  1X9V A;  1K04 A;  2V7Q J;  3NXS A;  5DJU B;  1HF9 A;  2E5Y A;  3L4F A;  1J2J B;  1VDF A;  3CX5 D;  2FXP A;  5APY A;  1JY3 P;  2E74 B;  2W8Z A;  1SQV K;  1G1I A;  2UWJ E;  2KUB A;  5AW8 B;  1AVY A;  2K3R A;  1NTK E;  2A45 I;  1JTH B;  2KLU A;  1VQ8 P;  3AEG C;  3AE9 C;  1QVG O;  2KIK A;  1FDI A;  3Q5R A;  2FFD C;  3WU2 H;  3O8Z A;  5AW0 B;  1EDI A;  1KOR A;  3I56 P;  3BRV B;  2ZXX A;  3GF7 A;  2XZR A;  1EZV D;  1SS1 A;  3H1K E;  1M56 D;  3FGA D;  2A45 G;  5KKZ B;  1N73 A;  1L0L K;  1NH4 A;  1GK6 A;  2W6J H;  2ZT9 D;  1K73 Q;  2FYU D;  1VQO P;  4RO0 A;  2C9N Y;  1RE4 A;  2YKP A;  4H13 D;  3WMM 0;  3WUV A;  1GZL A;  1KIL C;  1JO5 A;  1ZME C;  3L75 G;  1HGV A;  1PP9 G;  5AVY B;  1N7L A;  1SQX K;  3BCC E;  1WRG A;  3AE3 C;  3CLQ A;  3CC4 P;  2E42 A;  2M0B A;  5B5E E;  2KNC A;  2OYI A;  4GKG A;  1A02 J;  1P84 H;  2QVA A;  1JCD A;  3JCU H;  1K8A Q;  1RF0 C;  1SQB J;  1J1D B;  1DX7 A;  4IFF A;  5KJ7 D;  4D6T E;  5TIS E;  2NRG A;  2ZYA A;  4H0L B;  1W5C E;  2E75 D;  3W67 A;  4PD4 D;  2WSE H;  2XKM A;  1T2K D;  3CI9 A;  5H2F H;  2P1J A;  4N78 D;  3B5N B;  2WSE J;  4L74 A;  1VF5 B;  1SQP E;  2E76 B;  1AVO A;  3H6P A;  2KB7 P;  2LXB A;  4IL6 E;  1FJK A;  3GG2 A;  5CBN A;  1NTK K;  3RL0 g;  3ABV C;  1MUU A;  3AEC C;  1JY2 O;  1GL2 A;  3CWB E;  1KQL A;  2O3J A;  3D71 A;  5CJ4 A;  3FWL A;  1ZP0 C;  4WY4 A;  4U3F J;  2QE7 H;  1YIT P;  1NTZ E;  1RF1 A;  3KPE A;  3H1I J;  2B9B A;  4ZNC A;  5KLV E;  5KAI H;  3AEE C;  4NPD A;  5AVX B;  1YQ3 C;  3MUD A;  1KTM A;  4JYB A;  3QWO C;  1TU3 F;  5GTI E;  1NU1 G;  2I1K A;  4I1L A;  3SWF A;  3Q1M A;  4W7Y A;  1VQL P;  4KT0 J;  1QL1 A;  3CX5 H;  1QX8 A;  2OYH A;  3NTN A;  1VL2 A;  4UB6 E;  1Y8A A;  2W6B A;  3O6Q B;  3P8C E;  1SQQ E;  2IFM A;  3AEA C;  1N73 C;  3BCC D;  3NFQ A;  1LTB C;  5CCH A;  1NWQ A;  1RE4 C;  3KZI E;  3Q2Y A;  1S3J A;  3S9O A;  1NO4 A;  1EXI A;  1NTM E;  4OH8 B;  1EC5 A;  3Q5S A;  4YTP C;  3C8V A;  4D6T D;  4HKZ H;  1YJW P;  1M1J B;  1CI6 B;  4HYT B;  2E43 A;  3G4S P;  1OVU A;  2OYI C;  2KSJ A;  1IFI A;  2JEE A;  2K9J A;  4OWF A;  2W27 A;  1QL2 A;  2FYU J;  3RL0 D;  5CCH D;  1KC8 Q;  1SQP K;  2D2C B;  2B88 A;  4Y28 J;  2WZ7 A;  3KHU A;  1G1J A;  1OVV A;  4YXW H;  4L76 A;  5CCG D;  2RMZ A;  1HWT C;  4EYY Q;  1P84 I;  1GD2 E;  2IBZ I;  2ZYD A;  4QMA A;  2J58 A;  3TGU E;  1IFD A;  1NU1 D;  4GOF A;  3CWB D;  4PV1 B;  3V4Q A; 
#chains in the Genus database with same CATH homology
 2AXC A;  3O6Q B;  2RH0 A;  2O01 N;  1OZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...