3CWBG

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cwbG00
1PPJG 5KLVG 2BCCG 2FYUG 1NTZG 1L0LG 3H1KG 1KYOH 2IBZG 4U3FG 1BE3G 1SQVG 1BGYG 3CXHH 1P84H 1PP9G 3L74G 1SQQG 3H1LG 1SQBG 3H1HG 1BCCG 1SQXG 3L73G 1L0NG 1NU1G 1SQPG 3H1JG 2A06G 3L71G 1EZVG 3L72G 3CWBG 1KB9H 4D6TG 4PD4H 1NTMG 3H1IG 3L70G 3CX5H 3L75G 1NTKG 3TGUG 3BCCG
chains in the Genus database with same CATH superfamily
2YMKA 3HTKA 1L4AB 1PP9J 1GW4A 3H1HG 1A02J 2YKQA 3L71J 1NKNA 4D6TJ 5EFWB 3AEBC 1RF1A 3KHUA 3AE6C 2R32A 4NPEA 2E5TA 2WT7A 5APVA 1GK6A 1DEBA 1NU1K 3VP8A 4JQ0D 3JCUH 2O1JA 3GW6A 4WY4D 1GU5A 2ZYDA 1OXZA 2FXMA 5TISH 3LW5H 2JR8A 1LP1B 1NTKE 1OW6A 1MV8A 1VQOP 1BCCJ 5AVSB 1Q86Q 1SFCD 1PPJD 1VL2A 1SQXE 4H0LC 1EZVG 2PFXA 3IF4A 3NFQA 5KAIE 3CCEP 3N4XA 1SQBD 1NTZK 5CCGC 3CWBD 2XNXA 4C46A 1LTIC 1NU1J 3A0BH 3VMZA 4L74A 3AE5C 3L74E 1T8ZA 2FYZA 1IJDB 2D2CC 1OWAA 2P67A 2ZT9C 1OIPA 2E76D 1H0TB 1URQD 1KFMA 3F5HA 3Q1MA 1T2KC 3HE5A 1VPCA 1LWUB 2O01N 2WWWA 2I1JA 3SFEC 1KILE 4WVZA 2OYHC 3RK2B 2LKMA 2W6BA 1S72P 1FDIA 2RMZA 4N6JA 1KYOD 1SQPK 2WSEH 3BCCD 3S1KA 3AE2C 4PV1D 2KLUA 1TU3F 3HUSC 1SLQA 1R5SA 3RBZA 1VQNP 1JOCA 1YHQP 5H2FH 2VRSA 2OYHB 1QX8A 3CC7P 3L72J 2KUBA 4N78E 3CC2P 1H8AA 3H1JD 5DJUB 4H13C 3F89A 1AFOA 2J5UA 3V2QA 1FOSE 1ZW0A 1AV1A 3H1LE 2ZVNB 1RF1B 1JTHA 5AVRB 1N7SC 1KYOI 3GG2A 1PPJG 3KXDA 2WT7B 1JCCA 1L0ND 3RBXA 2QJPB 2HG5D 1SQBG 1LTGC 1FOSF 4UB8H 1NO4A 1PGJA 1T6AA 1VQ9P 2E43A 3CWBG 1XTCC 2KLVA 4YTPC 2N1TA 3HD7A 3Q5SA 1L4AD 2YKOA 3L71D 5BVZA 2IYPA 3D6ZA 4D6TD 1KILA 2IFMA 4EOTA 2KOGA 2Y9ZA 5KTBA 1X22A 1BSNA 5KKZB 2I1KA 3O8ZA 4JBZA 1NKZB 4IOIH 1VQ7P 4GOFA 3PTZA 1JUNA 3L70E 3PRJA 1LTTC 1WMKA 1N86A 1T3JA 4I7ZB 1UIXA 2XNDH 3E1IA 1MZ9A 5AW3B 1NHLA 4ZNCA 5AW2B 5KLVK 2K9JA 3BCCG 3P8CD 2M8RA 3AECC 1NOHA 3HE5B 1MFTA 3ABVC 2H89C 1L0LE 3L75D 3CCQP 1JB0J 1DEEG 2A06E 4IFFA 1NTKK 1KN7A 1KB9D 4DJGA 1NU1D 3CXHE 1IC2A 1KMIZ 3H1KG 1KQFB 4WY4C 3MTUE 2M3BA 4GOEA 2FYUE 2HLOA 4DOJA 2K37A 2KSJA 3KQGA 2C9NY 1LT1A 3H1JG 1KB9H 2JJLA 2AEMA 2QJKB 3NMDA 4TT3H 2JDIH 1SFCC 1HGZA 1USDA 1L0NG 1S5LX 3JC22 1Y9BA 3RK2D 1NTZD 1NTKJ 1KD1Q 2W6AA 3FXEA 5APWA 4DT0A 1P84E 4RO0A 1SQXJ 3M9QA 1YIJP 2JO1A 4W80A 1ZV8A 2E76C 1URQC 3L71G 4D6TG 1SFCB 5KJ7D 5CBNA 3I56P 2PRRA 4ASWA 2QE7H 4OWFA 1P84I 1VQKP 3L74J 3L72D 3MP7B 2A45I 2PP6A 3WU2H 1ZRTD 4PD4E 1SQVE 2ZFCA 1IK9A 4NPDA 5E79H 1M1JA 1FE6A 1OX3A 1ZR2A 3P8MC 1SQPD 3FGAD 1URQB 4PV1C 2Q6QA 4HYTB 1LTSC 1EXJA 4PD4I 5GTHH 3RL0B 3NTNA 3KYQA 2BEZF 5CJ0A 1GTWA 2AXCA 3V2PA 4JYBA 3L75G 3TDKA 1NTME 1NGMB 3CCJP 2WSFJ 2BCCE 4H44B 1CI6A 2JP3A 2FYNC 1W5CE 3U1CA 1NU1G 2YO2A 3H1HE 3BRTB 2K9JB 4PV1B 3PP5A 1BGYD 5GTIH 3P7KA 3L36A 2B88A 1RE4C 4EI2A 4XA4A 2R5DA 5KAFH 4HH2A 5AW6B 1T3UA 1JMMA 2FKWB 3QH9A 2B87B 1K04A 1JMBA 3JSVC 4ZKUA 5APXA 1JY2O 2WTYA 1JNMA 5B66H 2GA1A 1NTZG 3TGUE 2W83C 2YIUB 3H1LJ 2OTLP 2FFDA 4JPZB 3E7KA 1DH3A 1L4AC 1JM0A 3C9IA 1EZVE 5APQA 2QVAA 4UB6E 1YJNP 1BE3D 1IK7A 1Y8AA 2IDBA 1M90Q 2P7JA 2O1KA 1GZLA 3IFMA 2WZ7A 3VMAA 3T97A 1DD4A 1E5WA 1Z56A 3II6A 3L37A 3L72G 3H6PA 1Y47A 2GM4A 2OARA 4DCKA 2IBZD 2NPSA 2E75B 3OJAB 1JO5A 2Q9IA 1PV3A 1RH5B 1GD2E 1L0LK 2KK7A 3B5NA 1YTZI 2Y9YA 3L4FA 1FBMA 1FJKA 2Z5IA 3OW2O 3I55P 1N73C 1SQPG 5KLVD 1RQUA 3CCUP 2NRGA 3L70J 4YPCA 2G3AA 1OFCX 4GKGA 3GHGA 1GK4A 3L73D 4DZOA 2W27A 1LT9A 4O9BA 1LTJA 5AVYB 4RKUJ 1NTKD 3G3ZA 3VP9A 3HUSA 2RKLA 1M1JB 1OVVA 3CL3D 3AEFC 1L0LJ 3BRVB 1G1IA 1N73B 4MN4C 3VOPA 2CPBA 1ZN5A 3CI9A 3IN6A 1K05A 1BGYG 2LR2A 4IFMA 4RESB 5TISE 1UIIA 4R4LA 3KZIE 2IX7C 1LWUC 4C7NB 4L76A 5KAIH 2FYUJ 3H1IE 3G4SP 4GIFA 3C1LA 2JEEA 1CI6B 4WWIA 2WSSH 1USEA 1ZOYC 1IFMA 3RK2C 1HUCA 3Q5RA 4A7PA 3O6QA 1VQ6P 1VQ4P 2IZ1A 1AVYA 1K9MQ 3FX0A 1FZBA 2XZRA 1KILD 1PPJE 1SQVK 3IAOA 5C39A 1RF0A 1BE3G 5KJ7C 1PGOA 3RL0D 2N9YB 1SQBE 1SQQE 1RE3C 5CJ4A 3CWBE 5BU5A 2K1AA 4H44D 1PIXA 2IBZG 4JYCA 1YTZT 1RHZB 3BVHA 2OYIA 1FZEA 2AEJA 1JY2N 5KLVG 1RF1C 1SQVJ 3T97B 1WT6A 1ZMEC 1FC2C 5M1BA 5CBOA 1GW3A 3L73G 1GMJA 4W7YA 2HFED 2QJPC 2QJYB 2NPSB 2XKMA 3H1KD 1NTKG 1U57A 3HTKB 1KYOE 3B5NB 3BCCE 2H43A 2WMMA 2WPRA 1Q7YQ 1FS0E 1GL2A 1NTMJ 1AVOA 2IZ0A 2M5AA 3GHGB 1MFZA 3W68A 2BCCJ 2JWDA 3AEGC 5KKZC 5CMZA 1JY2P 1LTJB 3HE4A 3H1HJ 1VF5B 1HBWA 3MZWB 3PJSK 1JY3O 1M7LA 1PGQA 2WQYC 2E75D 4I7ZC 2POHA 1QVGO 1PP9D 3CCMP 1JCDA 3CCSP 2FBWC 1G1JA 4LLHA 3D71A 2DW3A 2B9BA 1LJ2A 1IFPA 5B5EE 1X9VA 3S4RA 1N8RQ 1L0NE 3K5BA 3TGUJ 2G8YA 2XV5A 3MUDA 1PFIA 1KFNA 5APUA 1YITP 3RK3B 1HH0A 3O6QB 4IFDK 1HJBA 2R3CA 4YXWH 3CC4P 2Z5HA 2J59M 1L0LD 3M0DA 1S9KD 3LIDA 3EFFK 1AJYA 3PH0A 1BCCD 2W6JH 4IL6H 2LXBA 2ZXXA 1OVRA 2QJKC 3CXHD 1FZCA 1QGKB 1KC8Q 1LTAC 5CCHA 5AVZB 1RQVA 4BXLA 3V2NA 1SP4A 1SQXK 3CXHH 1EDKA 3USSA 2OYIB 2E74B 4U3FE 2OTKE 4I2LC 2P10A 4PJ0E 4HB1A 3VN0A 4K3AA 3L75E 3GF3A 1KB9E 1U7MA 2RH0A 1NAYA 2Y0CA 2AXTH 3TNUA 2ZYGA 3I5CA 2K9YA 1YI2P 2WITA 1SQQK 1KB9I 1P84H 1PP9G 3OA7A 1BSHA 4W7ZA 3W67A 5K5GB 3M06A 1JTHB 1KILC 3H1IJ 4WB4A 1S3JA 2OGUA 3L70G 2CPSA 2BEQD 1SQVD 2YNYA 3RL0C 3ZDMA 5APYA 4XFJA 1N2DC 3HE4B 2Q3EA 1L4AA 3R4YA 2H8PD 1NTZE 2HPCA 1YJWP 4KHXA 2NPSD 1MUUA 3FWLA 2N1TB 4H44C 3HD7B 3B5ND 2KZJA 3MHVA 3WU2E 1L0LG 4JF7A 1SQBJ 1KILB 1SQQJ 5AVXB 5AW1B 3MD0A 2JWAA 1BCCG 1JY3N 4Z1MH 1M56D 3R2PA 3CWBJ 1NVOA 2QM7A 3MIWA 4OGQD 2O01J 1W2EA 2I8DA 3M0AA 1ZRTE 5DJTB 1VF5D 2FYUG 2Q1KA 2ZYAA 4LC1A 1AQ5A 1S5LE 3VMYA 1FAVA 1U7JA 2YIUC 1SQPE 3GF7A 5AW0B 2GUVA 2WSEJ 4AYCA 3KDPB 3SFDC 2L5GB 2C0WA 3CX5D 1KQSO 1PZQA 2KS1A 4GDOA 1FZCB 3QWOC 2C9LY 3TGUD 3UIAA 2R44A 1DX7A 1VQ8P 1JY3P 3AEDC 3WMM0 3BCCJ 1LGHB 3CX5H 4NPFX 3A3YB 1IO4A 2N9BA 1FZGA 4AQRD 1IZNB 3RK3D 5KAFE 2FXOA 4BWNA 4Y99C 3AE3C 2E75C 5AVTB 1BGYE 1EC5A 2BASA 2K88A 5CCGA 4TLFA 2YMYA 4UB6H 4RJTA 1BDCA 1SQVG 2PGDA 3NXSA 2IPPA 3TNUB 5APSA 1FU1A 4Y99B 3TK1A 3A0HE 4GT1A 4HJGH 3WUVA 1M1JC 1CZQA 4Y28J 1L0NJ 2E74D 4LGDE 3MGNA 1BE3E 2LXCB 2KNCA 2OYHA 2QRXA 2C0XA 2ZXEB 2YXRB 1NTMG 1NWQA 3H25A 3G71P 2P58A 1CSBA 5APTA 1HJ0A 1DD3A 2BCCG 2FYUK 2WPQA 1M57D 3CCLP 3EQ2A 1EQ7A 2HPCB 1HTLC 3M91A 2IBZE 2SPZA 2P1JA 1J2JB 1SQXD 5KLVE 1GL2D 2IBZI 1KQGB 3JCUE 3RGUA 3WUTA 3H1ID 2QEXP 3V4QA 3L73E 1FZFA 3Q3DA 2KP8A 3TGUG 3KZIH 3L74D 4I1LA 4QMAA 4U3FJ 5AW7B 2Y0DA 1N7SA 2N1TD 1FZAA 2K3RA 2R5BA 2FFDC 3HD7D 3L75J 3TYYA 4L75A 1HF9A 1N7LA 4BRYA 1QEXA 1SQQD 1KQLA 3A0BE 2V7QJ 2KS1B 2M0BA 4XE5B 2HODA 1KZUB 5CHXA 2H7HA 3A5TA 1FJPA 2ZVOB 1EXIA 1L2PA 2UWJE 1OMIA 1G2CA 1KORA 1WRGA 2QJYC 4H0LB 1YJ9P 2NPSC 2FFDB 2O01H 1S1CX 5KLIC 1QL2A 3B5NC 3KPEA 3AE9C 2FY8A 3V5BA 1NTMK 2WSFH 2Z4EA 1NTZJ 1PGPA 1OW7A 2P2UA 3FXDA 4N78D 2D2CB 4OGQC 2ZT9B 4KT0J 3GHGC 1ZXGA 3AEEC 3Q2YA 1LT9C 2W90A 1LTJC 3AE8C 1XTGB 3AE7C 3GLMA 1VF5C 5CCHD 3A7OA 2KSEA 1YBKA 2OYOA 5KLIB 3E1RA 3H1LD 4R4MA 2KZIA 1KYOH 5H2FE 4YXDC 2KNCB 1K8AQ 3A2AA 1SQXG 2IFNA 5BU8B 1VQMP 2MKVA 1EDLA 3H1IG 4OGQB 1NH4A 4WY4A 2NZ2A 3LIEA 1ZLLA 1LT9B 4IL6X 1SQPJ 3L74G 3H1KE 3V6IA 1Q2NA 3HUSB 3Q5PA 1SS1A 1W2BO 3RK3C 3IR9A 3H1JE 1SFCA 1Q90D 3L35A 3D70A 4UB8E 1SQQG 1OW8A 3L70D 2KXPB 1RF0C 2QM8A 1VQLP 3SWYA 2OTJP 4H13B 4ZMDA 5B5EH 1EDJA 5AVUB 1LTBC 3AE4C 1VQ5P 3CLQA 2O3JA 1BGYJ 2RN0A 1URQA 1IFDA 1H89A 1D7MA 1N7SB 2QSIA 2OQQA 1IFJA 1Q82Q 1PP9E 4L73A 1FDMA 1HWTC 4BRYB 3L71E 2OYIC 2E74C 2WPSA 4D6TE 4N3YB 2WSCJ 2A06D 1AA0A 2HODB 1AQTA 3ITKA 3P32A 2AEFA 2XU6A 1MKMA 2ZAEB 1RY3A 1NYHA 4K35A 3B71A 1A02F 1DIPA 2FYUD 3VMXA 2QG4A 4IL6E 4U3FD 1G2CB 1BE3J 1LNQA 2L91A 1ZP0C 2Q5UA 1S9KE 3H1LG 3M9HA 1JEKA 3RL0g 1QL1A 3P8CE 1BCCE 1GL2C 2YKPA 2B87A 3D6YA 3N7NA 1M1KQ 1X79B 3SWKA 4PJ0H 1NAFA 3CMEP 3AEAC 2V4HA 1IFIA 5AVVB 5AVWB 3H32A 1HGVA 3G6EP 1P84D 1J1DC 1S2EA 2QIWA 1NU1E 1X8YA 5KLVJ 2V7QH 1RE4A 3U1AA 2E5YA 3CXHI 1M8OB 4H0LD 2IYOA 5TJHA 2N1TC 2XDJA 3WUUA 2HR3A 4CPGA 3HD7C 3L73J 1SQBK 1GL2B 2AXTE 3LW5J 1GU4A 3S9OA 5CCGD 2M5AB 3EFGA 2A45H 2WVRA 1K73Q 1VDFA 4WY4B 3CCVP 4EIJA 4PD4D 2YO3A 2D2CD 3PHLA 2ZT9D 1J1DB 5AW4B 2B89A 3MUDC 4OVNF 2YXQB 2KB7P 1T2KD 1QLED 5AW5B 4PD4H 3CD6P 4WBAA 3C8VA 3M0DC 3CPWO 1NTMD 2A06G 5E79E 2BCCD 4HKZH 3L72E 1FZCC 3VTPC 3H1HD 3U59A 2E76B 1ZR4A 1PL5A 3TF5A 1N73A 1OVUA 1LP1A 3M9BA 2ZJSE 4U3FG 5GTHE 3SWFA 2KYVA 3BATA 5CCHC 3V4WA 3BASA 5AW9B 1R8EA 1S5LH 2MJZA 2E42A 1J1EC 4C7NA 1QVFO 3B4SA 3TSIA 1VQPP 1KV4A 1EDIA 2JKVA 1OZHA 2PAJA 1NJIQ 3V2RA 1KTMA 4H13D 1BDDA 3CCRP 5GTIE 4AUWA 4M3LA 2FXPA 2ITAA 1Q81Q 1H0TA 3B8EB 1HVVA 1N7SD 1EZVD 2A45G 2M3EA 3GMAA 1J1EB 1GDTA 1L0NK 1LWUA 3AE1C 2KIKA 3SSUA 2HYNA 2CK3H 4KJMA 3CX5E 1FDOA 1YQ4C 4I6MC 4EDFA 5AVQB 5B66E 2Y0EA 3OAKA 2J58A 2FYNB 4ASVA 3H1KJ 1E79H 3G9RA 3VYIA 1YYCA 4U7JA 3H32B 3CMAP 3H1JJ 4EYYQ 4OH8B 3CX5I 5AW8B 1R5LA 2WSCH 3RK3E 1X0TA 2GUSA 1CW5A 2R3SA 4ZKPA 2WPVB 5KJ7A 3FWNA 4B86A 1SVFA 2H88C 1H88A 3A0HH 2QA4P 2W8ZA 3HRNA 1RE3A 2KI7B 4C7RA 3EWKA 1S4XA 1EZVI 3PLNA 4GODA 5L8RJ 2Q3IA 1IFNA 1YQ3C 2Q7CA
chains in the Genus database with same CATH topology
1PPJG 5KLVG 2BCCG 2FYUG 1NTZG 1L0LG 3H1KG 1KYOH 2IBZG 4U3FG 1BE3G 1SQVG 1BGYG 3CXHH 1P84H 1PP9G 3L74G 1SQQG 3H1LG 1SQBG 3H1HG 1BCCG 1SQXG 3L73G 1L0NG 1NU1G 1SQPG 3H1JG 2A06G 3L71G 1EZVG 3L72G 3CWBG 1KB9H 4D6TG 4PD4H 1NTMG 3H1IG 3L70G 3CX5H 3L75G 1NTKG 3TGUG 3BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ G;  5KLV G;  2BCC G;  2FYU G;  1NTZ G;  1L0L G;  3H1K G;  1KYO H;  2IBZ G;  4U3F G;  1BE3 G;  1SQV G;  1BGY G;  3CXH H;  1P84 H;  1PP9 G;  3L74 G;  1SQQ G;  3H1L G;  1SQB G;  3H1H G;  1BCC G;  1SQX G;  3L73 G;  1L0N G;  1NU1 G;  1SQP G;  3H1J G;  2A06 G;  3L71 G;  1EZV G;  3L72 G;  3CWB G;  1KB9 H;  4D6T G;  4PD4 H;  1NTM G;  3H1I G;  3L70 G;  3CX5 H;  3L75 G;  1NTK G;  3TGU G;  3BCC G; 
#chains in the Genus database with same CATH topology
 2YMK A;  3HTK A;  1L4A B;  1PP9 J;  1GW4 A;  3H1H G;  1A02 J;  2YKQ A;  3L71 J;  1NKN A;  4D6T J;  5EFW B;  3AEB C;  1RF1 A;  3KHU A;  3AE6 C;  2R32 A;  4NPE A;  2E5T A;  2WT7 A;  5APV A;  1GK6 A;  1DEB A;  1NU1 K;  3VP8 A;  4JQ0 D;  3JCU H;  2O1J A;  3GW6 A;  4WY4 D;  1GU5 A;  2ZYD A;  1OXZ A;  2FXM A;  5TIS H;  3LW5 H;  2JR8 A;  1LP1 B;  1NTK E;  1OW6 A;  1MV8 A;  1VQO P;  1BCC J;  5AVS B;  1Q86 Q;  1SFC D;  1PPJ D;  1VL2 A;  1SQX E;  4H0L C;  1EZV G;  2PFX A;  3IF4 A;  3NFQ A;  5KAI E;  3CCE P;  3N4X A;  1SQB D;  1NTZ K;  5CCG C;  3CWB D;  2XNX A;  4C46 A;  1LTI C;  1NU1 J;  3A0B H;  3VMZ A;  4L74 A;  3AE5 C;  3L74 E;  1T8Z A;  2FYZ A;  1IJD B;  2D2C C;  1OWA A;  2P67 A;  2ZT9 C;  1OIP A;  2E76 D;  1H0T B;  1URQ D;  1KFM A;  3F5H A;  3Q1M A;  1T2K C;  3HE5 A;  1VPC A;  1LWU B;  2O01 N;  2WWW A;  2I1J A;  3SFE C;  1KIL E;  4WVZ A;  2OYH C;  3RK2 B;  2LKM A;  2W6B A;  1S72 P;  1FDI A;  2RMZ A;  4N6J A;  1KYO D;  1SQP K;  2WSE H;  3BCC D;  3S1K A;  3AE2 C;  4PV1 D;  2KLU A;  1TU3 F;  3HUS C;  1SLQ A;  1R5S A;  3RBZ A;  1VQN P;  1JOC A;  1YHQ P;  5H2F H;  2VRS A;  2OYH B;  1QX8 A;  3CC7 P;  3L72 J;  2KUB A;  4N78 E;  3CC2 P;  1H8A A;  3H1J D;  5DJU B;  4H13 C;  3F89 A;  1AFO A;  2J5U A;  3V2Q A;  1FOS E;  1ZW0 A;  1AV1 A;  3H1L E;  2ZVN B;  1RF1 B;  1JTH A;  5AVR B;  1N7S C;  1KYO I;  3GG2 A;  1PPJ G;  3KXD A;  2WT7 B;  1JCC A;  1L0N D;  3RBX A;  2QJP B;  2HG5 D;  1SQB G;  1LTG C;  1FOS F;  4UB8 H;  1NO4 A;  1PGJ A;  1T6A A;  1VQ9 P;  2E43 A;  3CWB G;  1XTC C;  2KLV A;  4YTP C;  2N1T A;  3HD7 A;  3Q5S A;  1L4A D;  2YKO A;  3L71 D;  5BVZ A;  2IYP A;  3D6Z A;  4D6T D;  1KIL A;  2IFM A;  4EOT A;  2KOG A;  2Y9Z A;  5KTB A;  1X22 A;  1BSN A;  5KKZ B;  2I1K A;  3O8Z A;  4JBZ A;  1NKZ B;  4IOI H;  1VQ7 P;  4GOF A;  3PTZ A;  1JUN A;  3L70 E;  3PRJ A;  1LTT C;  1WMK A;  1N86 A;  1T3J A;  4I7Z B;  1UIX A;  2XND H;  3E1I A;  1MZ9 A;  5AW3 B;  1NHL A;  4ZNC A;  5AW2 B;  5KLV K;  2K9J A;  3BCC G;  3P8C D;  2M8R A;  3AEC C;  1NOH A;  3HE5 B;  1MFT A;  3ABV C;  2H89 C;  1L0L E;  3L75 D;  3CCQ P;  1JB0 J;  1DEE G;  2A06 E;  4IFF A;  1NTK K;  1KN7 A;  1KB9 D;  4DJG A;  1NU1 D;  3CXH E;  1IC2 A;  1KMI Z;  3H1K G;  1KQF B;  4WY4 C;  3MTU E;  2M3B A;  4GOE A;  2FYU E;  2HLO A;  4DOJ A;  2K37 A;  2KSJ A;  3KQG A;  2C9N Y;  1LT1 A;  3H1J G;  1KB9 H;  2JJL A;  2AEM A;  2QJK B;  3NMD A;  4TT3 H;  2JDI H;  1SFC C;  1HGZ A;  1USD A;  1L0N G;  1S5L X;  3JC2 2;  1Y9B A;  3RK2 D;  1NTZ D;  1NTK J;  1KD1 Q;  2W6A A;  3FXE A;  5APW A;  4DT0 A;  1P84 E;  4RO0 A;  1SQX J;  3M9Q A;  1YIJ P;  2JO1 A;  4W80 A;  1ZV8 A;  2E76 C;  1URQ C;  3L71 G;  4D6T G;  1SFC B;  5KJ7 D;  5CBN A;  3I56 P;  2PRR A;  4ASW A;  2QE7 H;  4OWF A;  1P84 I;  1VQK P;  3L74 J;  3L72 D;  3MP7 B;  2A45 I;  2PP6 A;  3WU2 H;  1ZRT D;  4PD4 E;  1SQV E;  2ZFC A;  1IK9 A;  4NPD A;  5E79 H;  1M1J A;  1FE6 A;  1OX3 A;  1ZR2 A;  3P8M C;  1SQP D;  3FGA D;  1URQ B;  4PV1 C;  2Q6Q A;  4HYT B;  1LTS C;  1EXJ A;  4PD4 I;  5GTH H;  3RL0 B;  3NTN A;  3KYQ A;  2BEZ F;  5CJ0 A;  1GTW A;  2AXC A;  3V2P A;  4JYB A;  3L75 G;  3TDK A;  1NTM E;  1NGM B;  3CCJ P;  2WSF J;  2BCC E;  4H44 B;  1CI6 A;  2JP3 A;  2FYN C;  1W5C E;  3U1C A;  1NU1 G;  2YO2 A;  3H1H E;  3BRT B;  2K9J B;  4PV1 B;  3PP5 A;  1BGY D;  5GTI H;  3P7K A;  3L36 A;  2B88 A;  1RE4 C;  4EI2 A;  4XA4 A;  2R5D A;  5KAF H;  4HH2 A;  5AW6 B;  1T3U A;  1JMM A;  2FKW B;  3QH9 A;  2B87 B;  1K04 A;  1JMB A;  3JSV C;  4ZKU A;  5APX A;  1JY2 O;  2WTY A;  1JNM A;  5B66 H;  2GA1 A;  1NTZ G;  3TGU E;  2W83 C;  2YIU B;  3H1L J;  2OTL P;  2FFD A;  4JPZ B;  3E7K A;  1DH3 A;  1L4A C;  1JM0 A;  3C9I A;  1EZV E;  5APQ A;  2QVA A;  4UB6 E;  1YJN P;  1BE3 D;  1IK7 A;  1Y8A A;  2IDB A;  1M90 Q;  2P7J A;  2O1K A;  1GZL A;  3IFM A;  2WZ7 A;  3VMA A;  3T97 A;  1DD4 A;  1E5W A;  1Z56 A;  3II6 A;  3L37 A;  3L72 G;  3H6P A;  1Y47 A;  2GM4 A;  2OAR A;  4DCK A;  2IBZ D;  2NPS A;  2E75 B;  3OJA B;  1JO5 A;  2Q9I A;  1PV3 A;  1RH5 B;  1GD2 E;  1L0L K;  2KK7 A;  3B5N A;  1YTZ I;  2Y9Y A;  3L4F A;  1FBM A;  1FJK A;  2Z5I A;  3OW2 O;  3I55 P;  1N73 C;  1SQP G;  5KLV D;  1RQU A;  3CCU P;  2NRG A;  3L70 J;  4YPC A;  2G3A A;  1OFC X;  4GKG A;  3GHG A;  1GK4 A;  3L73 D;  4DZO A;  2W27 A;  1LT9 A;  4O9B A;  1LTJ A;  5AVY B;  4RKU J;  1NTK D;  3G3Z A;  3VP9 A;  3HUS A;  2RKL A;  1M1J B;  1OVV A;  3CL3 D;  3AEF C;  1L0L J;  3BRV B;  1G1I A;  1N73 B;  4MN4 C;  3VOP A;  2CPB A;  1ZN5 A;  3CI9 A;  3IN6 A;  1K05 A;  1BGY G;  2LR2 A;  4IFM A;  4RES B;  5TIS E;  1UII A;  4R4L A;  3KZI E;  2IX7 C;  1LWU C;  4C7N B;  4L76 A;  5KAI H;  2FYU J;  3H1I E;  3G4S P;  4GIF A;  3C1L A;  2JEE A;  1CI6 B;  4WWI A;  2WSS H;  1USE A;  1ZOY C;  1IFM A;  3RK2 C;  1HUC A;  3Q5R A;  4A7P A;  3O6Q A;  1VQ6 P;  1VQ4 P;  2IZ1 A;  1AVY A;  1K9M Q;  3FX0 A;  1FZB A;  2XZR A;  1KIL D;  1PPJ E;  1SQV K;  3IAO A;  5C39 A;  1RF0 A;  1BE3 G;  5KJ7 C;  1PGO A;  3RL0 D;  2N9Y B;  1SQB E;  1SQQ E;  1RE3 C;  5CJ4 A;  3CWB E;  5BU5 A;  2K1A A;  4H44 D;  1PIX A;  2IBZ G;  4JYC A;  1YTZ T;  1RHZ B;  3BVH A;  2OYI A;  1FZE A;  2AEJ A;  1JY2 N;  5KLV G;  1RF1 C;  1SQV J;  3T97 B;  1WT6 A;  1ZME C;  1FC2 C;  5M1B A;  5CBO A;  1GW3 A;  3L73 G;  1GMJ A;  4W7Y A;  2HFE D;  2QJP C;  2QJY B;  2NPS B;  2XKM A;  3H1K D;  1NTK G;  1U57 A;  3HTK B;  1KYO E;  3B5N B;  3BCC E;  2H43 A;  2WMM A;  2WPR A;  1Q7Y Q;  1FS0 E;  1GL2 A;  1NTM J;  1AVO A;  2IZ0 A;  2M5A A;  3GHG B;  1MFZ A;  3W68 A;  2BCC J;  2JWD A;  3AEG C;  5KKZ C;  5CMZ A;  1JY2 P;  1LTJ B;  3HE4 A;  3H1H J;  1VF5 B;  1HBW A;  3MZW B;  3PJS K;  1JY3 O;  1M7L A;  1PGQ A;  2WQY C;  2E75 D;  4I7Z C;  2POH A;  1QVG O;  1PP9 D;  3CCM P;  1JCD A;  3CCS P;  2FBW C;  1G1J A;  4LLH A;  3D71 A;  2DW3 A;  2B9B A;  1LJ2 A;  1IFP A;  5B5E E;  1X9V A;  3S4R A;  1N8R Q;  1L0N E;  3K5B A;  3TGU J;  2G8Y A;  2XV5 A;  3MUD A;  1PFI A;  1KFN A;  5APU A;  1YIT P;  3RK3 B;  1HH0 A;  3O6Q B;  4IFD K;  1HJB A;  2R3C A;  4YXW H;  3CC4 P;  2Z5H A;  2J59 M;  1L0L D;  3M0D A;  1S9K D;  3LID A;  3EFF K;  1AJY A;  3PH0 A;  1BCC D;  2W6J H;  4IL6 H;  2LXB A;  2ZXX A;  1OVR A;  2QJK C;  3CXH D;  1FZC A;  1QGK B;  1KC8 Q;  1LTA C;  5CCH A;  5AVZ B;  1RQV A;  4BXL A;  3V2N A;  1SP4 A;  1SQX K;  3CXH H;  1EDK A;  3USS A;  2OYI B;  2E74 B;  4U3F E;  2OTK E;  4I2L C;  2P10 A;  4PJ0 E;  4HB1 A;  3VN0 A;  4K3A A;  3L75 E;  3GF3 A;  1KB9 E;  1U7M A;  2RH0 A;  1NAY A;  2Y0C A;  2AXT H;  3TNU A;  2ZYG A;  3I5C A;  2K9Y A;  1YI2 P;  2WIT A;  1SQQ K;  1KB9 I;  1P84 H;  1PP9 G;  3OA7 A;  1BSH A;  4W7Z A;  3W67 A;  5K5G B;  3M06 A;  1JTH B;  1KIL C;  3H1I J;  4WB4 A;  1S3J A;  2OGU A;  3L70 G;  2CPS A;  2BEQ D;  1SQV D;  2YNY A;  3RL0 C;  3ZDM A;  5APY A;  4XFJ A;  1N2D C;  3HE4 B;  2Q3E A;  1L4A A;  3R4Y A;  2H8P D;  1NTZ E;  2HPC A;  1YJW P;  4KHX A;  2NPS D;  1MUU A;  3FWL A;  2N1T B;  4H44 C;  3HD7 B;  3B5N D;  2KZJ A;  3MHV A;  3WU2 E;  1L0L G;  4JF7 A;  1SQB J;  1KIL B;  1SQQ J;  5AVX B;  5AW1 B;  3MD0 A;  2JWA A;  1BCC G;  1JY3 N;  4Z1M H;  1M56 D;  3R2P A;  3CWB J;  1NVO A;  2QM7 A;  3MIW A;  4OGQ D;  2O01 J;  1W2E A;  2I8D A;  3M0A A;  1ZRT E;  5DJT B;  1VF5 D;  2FYU G;  2Q1K A;  2ZYA A;  4LC1 A;  1AQ5 A;  1S5L E;  3VMY A;  1FAV A;  1U7J A;  2YIU C;  1SQP E;  3GF7 A;  5AW0 B;  2GUV A;  2WSE J;  4AYC A;  3KDP B;  3SFD C;  2L5G B;  2C0W A;  3CX5 D;  1KQS O;  1PZQ A;  2KS1 A;  4GDO A;  1FZC B;  3QWO C;  2C9L Y;  3TGU D;  3UIA A;  2R44 A;  1DX7 A;  1VQ8 P;  1JY3 P;  3AED C;  3WMM 0;  3BCC J;  1LGH B;  3CX5 H;  4NPF X;  3A3Y B;  1IO4 A;  2N9B A;  1FZG A;  4AQR D;  1IZN B;  3RK3 D;  5KAF E;  2FXO A;  4BWN A;  4Y99 C;  3AE3 C;  2E75 C;  5AVT B;  1BGY E;  1EC5 A;  2BAS A;  2K88 A;  5CCG A;  4TLF A;  2YMY A;  4UB6 H;  4RJT A;  1BDC A;  1SQV G;  2PGD A;  3NXS A;  2IPP A;  3TNU B;  5APS A;  1FU1 A;  4Y99 B;  3TK1 A;  3A0H E;  4GT1 A;  4HJG H;  3WUV A;  1M1J C;  1CZQ A;  4Y28 J;  1L0N J;  2E74 D;  4LGD E;  3MGN A;  1BE3 E;  2LXC B;  2KNC A;  2OYH A;  2QRX A;  2C0X A;  2ZXE B;  2YXR B;  1NTM G;  1NWQ A;  3H25 A;  3G71 P;  2P58 A;  1CSB A;  5APT A;  1HJ0 A;  1DD3 A;  2BCC G;  2FYU K;  2WPQ A;  1M57 D;  3CCL P;  3EQ2 A;  1EQ7 A;  2HPC B;  1HTL C;  3M91 A;  2IBZ E;  2SPZ A;  2P1J A;  1J2J B;  1SQX D;  5KLV E;  1GL2 D;  2IBZ I;  1KQG B;  3JCU E;  3RGU A;  3WUT A;  3H1I D;  2QEX P;  3V4Q A;  3L73 E;  1FZF A;  3Q3D A;  2KP8 A;  3TGU G;  3KZI H;  3L74 D;  4I1L A;  4QMA A;  4U3F J;  5AW7 B;  2Y0D A;  1N7S A;  2N1T D;  1FZA A;  2K3R A;  2R5B A;  2FFD C;  3HD7 D;  3L75 J;  3TYY A;  4L75 A;  1HF9 A;  1N7L A;  4BRY A;  1QEX A;  1SQQ D;  1KQL A;  3A0B E;  2V7Q J;  2KS1 B;  2M0B A;  4XE5 B;  2HOD A;  1KZU B;  5CHX A;  2H7H A;  3A5T A;  1FJP A;  2ZVO B;  1EXI A;  1L2P A;  2UWJ E;  1OMI A;  1G2C A;  1KOR A;  1WRG A;  2QJY C;  4H0L B;  1YJ9 P;  2NPS C;  2FFD B;  2O01 H;  1S1C X;  5KLI C;  1QL2 A;  3B5N C;  3KPE A;  3AE9 C;  2FY8 A;  3V5B A;  1NTM K;  2WSF H;  2Z4E A;  1NTZ J;  1PGP A;  1OW7 A;  2P2U A;  3FXD A;  4N78 D;  2D2C B;  4OGQ C;  2ZT9 B;  4KT0 J;  3GHG C;  1ZXG A;  3AEE C;  3Q2Y A;  1LT9 C;  2W90 A;  1LTJ C;  3AE8 C;  1XTG B;  3AE7 C;  3GLM A;  1VF5 C;  5CCH D;  3A7O A;  2KSE A;  1YBK A;  2OYO A;  5KLI B;  3E1R A;  3H1L D;  4R4M A;  2KZI A;  1KYO H;  5H2F E;  4YXD C;  2KNC B;  1K8A Q;  3A2A A;  1SQX G;  2IFN A;  5BU8 B;  1VQM P;  2MKV A;  1EDL A;  3H1I G;  4OGQ B;  1NH4 A;  4WY4 A;  2NZ2 A;  3LIE A;  1ZLL A;  1LT9 B;  4IL6 X;  1SQP J;  3L74 G;  3H1K E;  3V6I A;  1Q2N A;  3HUS B;  3Q5P A;  1SS1 A;  1W2B O;  3RK3 C;  3IR9 A;  3H1J E;  1SFC A;  1Q90 D;  3L35 A;  3D70 A;  4UB8 E;  1SQQ G;  1OW8 A;  3L70 D;  2KXP B;  1RF0 C;  2QM8 A;  1VQL P;  3SWY A;  2OTJ P;  4H13 B;  4ZMD A;  5B5E H;  1EDJ A;  5AVU B;  1LTB C;  3AE4 C;  1VQ5 P;  3CLQ A;  2O3J A;  1BGY J;  2RN0 A;  1URQ A;  1IFD A;  1H89 A;  1D7M A;  1N7S B;  2QSI A;  2OQQ A;  1IFJ A;  1Q82 Q;  1PP9 E;  4L73 A;  1FDM A;  1HWT C;  4BRY B;  3L71 E;  2OYI C;  2E74 C;  2WPS A;  4D6T E;  4N3Y B;  2WSC J;  2A06 D;  1AA0 A;  2HOD B;  1AQT A;  3ITK A;  3P32 A;  2AEF A;  2XU6 A;  1MKM A;  2ZAE B;  1RY3 A;  1NYH A;  4K35 A;  3B71 A;  1A02 F;  1DIP A;  2FYU D;  3VMX A;  2QG4 A;  4IL6 E;  4U3F D;  1G2C B;  1BE3 J;  1LNQ A;  2L91 A;  1ZP0 C;  2Q5U A;  1S9K E;  3H1L G;  3M9H A;  1JEK A;  3RL0 g;  1QL1 A;  3P8C E;  1BCC E;  1GL2 C;  2YKP A;  2B87 A;  3D6Y A;  3N7N A;  1M1K Q;  1X79 B;  3SWK A;  4PJ0 H;  1NAF A;  3CME P;  3AEA C;  2V4H A;  1IFI A;  5AVV B;  5AVW B;  3H32 A;  1HGV A;  3G6E P;  1P84 D;  1J1D C;  1S2E A;  2QIW A;  1NU1 E;  1X8Y A;  5KLV J;  2V7Q H;  1RE4 A;  3U1A A;  2E5Y A;  3CXH I;  1M8O B;  4H0L D;  2IYO A;  5TJH A;  2N1T C;  2XDJ A;  3WUU A;  2HR3 A;  4CPG A;  3HD7 C;  3L73 J;  1SQB K;  1GL2 B;  2AXT E;  3LW5 J;  1GU4 A;  3S9O A;  5CCG D;  2M5A B;  3EFG A;  2A45 H;  2WVR A;  1K73 Q;  1VDF A;  4WY4 B;  3CCV P;  4EIJ A;  4PD4 D;  2YO3 A;  2D2C D;  3PHL A;  2ZT9 D;  1J1D B;  5AW4 B;  2B89 A;  3MUD C;  4OVN F;  2YXQ B;  2KB7 P;  1T2K D;  1QLE D;  5AW5 B;  4PD4 H;  3CD6 P;  4WBA A;  3C8V A;  3M0D C;  3CPW O;  1NTM D;  2A06 G;  5E79 E;  2BCC D;  4HKZ H;  3L72 E;  1FZC C;  3VTP C;  3H1H D;  3U59 A;  2E76 B;  1ZR4 A;  1PL5 A;  3TF5 A;  1N73 A;  1OVU A;  1LP1 A;  3M9B A;  2ZJS E;  4U3F G;  5GTH E;  3SWF A;  2KYV A;  3BAT A;  5CCH C;  3V4W A;  3BAS A;  5AW9 B;  1R8E A;  1S5L H;  2MJZ A;  2E42 A;  1J1E C;  4C7N A;  1QVF O;  3B4S A;  3TSI A;  1VQP P;  1KV4 A;  1EDI A;  2JKV A;  1OZH A;  2PAJ A;  1NJI Q;  3V2R A;  1KTM A;  4H13 D;  1BDD A;  3CCR P;  5GTI E;  4AUW A;  4M3L A;  2FXP A;  2ITA A;  1Q81 Q;  1H0T A;  3B8E B;  1HVV A;  1N7S D;  1EZV D;  2A45 G;  2M3E A;  3GMA A;  1J1E B;  1GDT A;  1L0N K;  1LWU A;  3AE1 C;  2KIK A;  3SSU A;  2HYN A;  2CK3 H;  4KJM A;  3CX5 E;  1FDO A;  1YQ4 C;  4I6M C;  4EDF A;  5AVQ B;  5B66 E;  2Y0E A;  3OAK A;  2J58 A;  2FYN B;  4ASV A;  3H1K J;  1E79 H;  3G9R A;  3VYI A;  1YYC A;  4U7J A;  3H32 B;  3CMA P;  3H1J J;  4EYY Q;  4OH8 B;  3CX5 I;  5AW8 B;  1R5L A;  2WSC H;  3RK3 E;  1X0T A;  2GUS A;  1CW5 A;  2R3S A;  4ZKP A;  2WPV B;  5KJ7 A;  3FWN A;  4B86 A;  1SVF A;  2H88 C;  1H88 A;  3A0H H;  2QA4 P;  2W8Z A;  3HRN A;  1RE3 A;  2KI7 B;  4C7R A;  3EWK A;  1S4X A;  1EZV I;  3PLN A;  4GOD A;  5L8R J;  2Q3I A;  1IFN A;  1YQ3 C;  2Q7C A; 
#chains in the Genus database with same CATH homology
 1PPJ G;  5KLV G;  2BCC G;  2FYU G;  1NTZ G;  1L0L G;  3H1K G;  1KYO H;  2IBZ G;  4U3F G;  1BE3 G;  1SQV G;  1BGY G;  3CXH H;  1P84 H;  1PP9 G;  3L74 G;  1SQQ G;  3H1L G;  1SQB G;  3H1H G;  1BCC G;  1SQX G;  3L73 G;  1L0N G;  1NU1 G;  1SQP G;  3H1J G;  2A06 G;  3L71 G;  1EZV G;  3L72 G;  3CWB G;  1KB9 H;  4D6T G;  4PD4 H;  1NTM G;  3H1I G;  3L70 G;  3CX5 H;  3L75 G;  1NTK G;  3TGU G;  3BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...