3CWBG

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 19
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cwbG00
3L75G 4PD4H 2FYUG 4D6TG 3L73G 1BCCG 2BCCG 1SQPG 3L74G 1P84H 3TGUG 1SQQG 1NTMG 1L0NG 3H1JG 2A06G 2IBZG 3BCCG 1EZVG 1SQVG 1NTZG 3H1HG 3L70G 3H1IG 1PP9G 3CXHH 5KLVG 3H1LG 1NU1G 1BGYG 1KB9H 1BE3G 1SQXG 1L0LG 3H1KG 3L71G 4U3FG 3CX5H 3CWBG 1PPJG 1SQBG 1KYOH 1NTKG 3L72G
chains in the Genus database with same CATH superfamily
1KN7A 2W83C 1SQXD 2Z5IA 2WQYC 2E5TA 1GL2A 2KB7P 1L0LK 1NTZK 3A3YB 3PLNA 4R4LA 3SWKA 5KTBA 1S2EA 2OYHA 4WBAA 4CPGA 2WSCH 2R5BA 2WSEJ 4I7ZB 4WY4A 2POHA 3II6A 3TGUG 1JB0J 5AVTB 3OA7A 1JUNA 3CL3D 3NFQA 3TYYA 1Q86Q 1BSHA 5KLIB 3CX5E 3CXHH 1KORA 4I2LC 1OW8A 4YTPC 1GU5A 4D6TD 2MKVA 3H32A 1H0TA 3RBZA 1L0LG 2E75B 5H2FH 3CCRP 2R5DA 2Z4EA 1J1EB 3CI9A 5KLVE 2Z5HA 1MV8A 3S9OA 3VP9A 3TNUB 5AW2B 5AW1B 1GMJA 4HJGH 2FKWB 4H44B 2J59M 2LXCB 1M7LA 2QJYC 2M5AA 3BCCE 4K3AA 1BSNA 2A45H 3EFGA 5AVYB 3S4RA 5GTIH 2HPCB 3UIAA 1EDJA 5H2FE 1NTZD 3L74E 2IBZD 5TJHA 5CBNA 2BCCE 4IFMA 3V6IA 3RK2C 1GDTA 3JCUH 2KLUA 1M8OB 3BASA 2KIKA 2FFDC 5CHXA 4QMAA 2AXTH 2CPBA 4HKZH 5AW3B 3L74J 2E5YA 4W7ZA 4C7NB 3G6EP 2Y0CA 1IFMA 2JWAA 1LTIC 1NTKK 4H0LC 5AW4B 3T97A 2E76D 2QJKB 5APSA 2IBZI 2O3JA 4EIJA 1NTKD 3OW2O 3V4WA 1Y9BA 4U3FG 2HG5D 3A0HH 2JWDA 4GT1A 1SQXK 2R3SA 1SLQA 4I6MC 3L70E 4ZMDA 1PIXA 1L0LD 2FYUE 2WTYA 2P67A 3BVHA 2W27A 3L72G 1SFCC 1BGYE 1YJWP 1SP4A 1IJDB 2G3AA 2QIWA 3QWOC 3M9HA 3IF4A 3V4QA 1N86A 3I55P 1MZ9A 1Q90D 3E1RA 2KK7A 4C46A 3CCVP 3JC22 4KT0J 3AE3C 4EOTA 2K9JB 1NAFA 3WMM0 1KB9E 1A02J 4EDFA 1U57A 3CCSP 1BCCE 2B9BA 3EFFK 3CCMP 1VF5C 1LTJA 2BEQD 1G2CA 3AE5C 3AE2C 4C7RA 2VRSA 3A5TA 1EXJA 2QRXA 1KFNA 2JP3A 4H13D 5M1BA 3TSIA 3KQGA 3MUDA 5AW0B 1SFCD 5B5EH 4D6TJ 2YO2A 5E79E 1BE3E 3HD7B 1NKNA 1NU1E 1XTCC 1USEA 2C0XA 1S1CX 4GOFA 1P84D 2PFXA 3C8VA 1VPCA 2Q3IA 3MHVA 2WSCJ 2OTKE 1AQ5A 1E79H 3B71A 1N73C 3AEBC 1NTME 1U7MA 1M57D 2E75C 2FYUG 3GHGB 3CXHI 5CCGC 5KLVD 5KJ7A 4U3FE 2QM7A 1FAVA 3V5BA 1SQPE 3CCEP 3AEFC 4W80A 2XNDH 1N2DC 2P10A 2QJKC 5AW6B 1P84I 4NPEA 4MN4C 4PD4E 3Q5SA 2D2CD 1HTLC 3LW5H 3GHGA 2QJPC 3ITKA 1NTZE 3CCUP 3N4XA 1PP9G 2JDIH 1URQB 3RBXA 2ZFCA 1HGZA 1SQQE 1W2EA 2KZJA 3C9IA 3CXHD 1OW7A 3H1KE 3KHUA 2RH0A 3BATA 1HJBA 5AVZB 1J1DC 4JYBA 3BRVB 2M5AB 1KQGB 1GW3A 1PPJG 4UB8E 1JY2N 2K3RA 1N7SC 4OVNF 1L0LJ 3QH9A 1RF1B 2ZXXA 3D6YA 3I56P 1RE3C 2P1JA 3CC7P 4OGQB 1LGHB 4ASVA 2QG4A 1KD1Q 4TLFA 2HODA 2O01N 3RK3B 1KQSO 1GZLA 1SQPG 3AE1C 1FC2C 2NZ2A 2UWJE 3EWKA 3FX0A 1LT9C 3TF5A 3CD6P 4NPFX 3MIWA 4LC1A 1GTWA 2IBZG 3SFDC 1IO4A 1UIIA 2ZYDA 2HODB 1NTZG 2FYNB 2IFMA 1DH3A 1BDCA 1PGOA 1YTZI 3HUSC 4IFFA 3RL0D 1L2PA 4Y99C 3CCLP 2WZ7A 2L5GB 1ZN5A 3A0BE 3RK3D 1SFCB 1SQBK 2OYHB 1DIPA 2G8YA 4L74A 3RK2B 1BGYJ 4B86A 1YI2P 1PGQA 1KTMA 1KMIZ 1W2BO 1SQBG 3CWBJ 4DJGA 3RL0C 1IFNA 2YKQA 2B89A 2PRRA 5DJUB 1QX8A 5AVQB 3HD7C 4JBZA 2YKOA 1VF5B 2B87A 3EQ2A 2XKMA 4IFDK 1JTHB 1JY2O 1ZOYC 4DZOA 1RF0A 3MD0A 4W7YA 4N3YB 2CPSA 2PGDA 3VOPA 2YMYA 2M0BA 2WPQA 1SQVD 3B5NB 1OX3A 3VMYA 4UB6E 1RHZB 4DOJA 4EYYQ 3G4SP 3D6ZA 2OQQA 1NTMD 1OFCX 3AE6C 3GG2A 1CW5A 3NXSA 1PV3A 4PV1C 1GL2C 3L35A 2FFDA 4N6JA 1YQ3C 3H1IG 1JCDA 1OVVA 1JY3O 5CJ4A 1LT9B 1LTAC 2KXPB 2KI7B 2Y9ZA 2FXPA 2H89C 1KILD 1U7JA 2NRGA 2XU6A 5KAIE 3LIEA 1N73B 4Z1MH 3R2PA 1SQBJ 3GHGC 2C0WA 3GF3A 4WY4B 3S1KA 1ZXGA 1FZCA 1ZLLA 3WUTA 4HYTB 5KLIC 1A02F 1T3JA 4OWFA 4U3FJ 3M0DC 1HWTC 1QLED 2NPSC 2IBZE 5BU8B 4N78D 2O1KA 4OGQD 1S72P 1YJNP 2RKLA 1SQBE 1VQ4P 4IOIH 1NU1K 1EQ7A 3IR9A 1EZVD 3H6PA 3BCCJ 2AXCA 1KYOD 1FZBA 4L73A 2H88C 2I1KA 2YXRB 2KOGA 2V7QH 3U1CA 3KPEA 1T3UA 1YJ9P 4WY4D 2A06D 2ZVOB 5APQA 1VL2A 1BDDA 1OZHA 1SQQJ 2E75D 3GW6A 4K35A 5AVWB 2Q3EA 3VP8A 1NTMK 5CCGD 3Q1MA 1IFIA 4GIFA 1KQFB 1N7SA 1AV1A 3MUDC 3M9QA 3TK1A 5AW7B 1NH4A 2ZAEB 3GMAA 1VQLP 3RL0B 3PHLA 5GTHH 3L72D 1S3JA 1L0LE 2FYUD 2RN0A 2N9BA 3VTPC 2WVRA 1Q2NA 2NPSA 1JY3N 2ZT9B 3L36A 3HE4B 4YXWH 1QVGO 3HD7D 3SSUA 1LTJB 1QGKB 1YITP 2P2UA 1K04A 2AXTE 2J5UA 3CC2P 1NHLA 1IFJA 2Q5UA 2KYVA 3RGUA 3H1IJ 3MGNA 2PP6A 2B88A 2E43A 3H1HD 1DD3A 1LP1A 5APXA 5BU5A 2KLVA 3AEDC 4PJ0E 3V2NA 1D7MA 1SQVJ 3TGUD 3D71A 1VQOP 3D70A 5CCHA 1X8YA 1SQQG 1LTTC 3KDPB 1LNQA 1T6AA 1KQLA 3W67A 3H1HG 1EC5A 2KS1A 1KILC 1AVOA 1RE4C 2GA1A 2I8DA 2XV5A 3KYQA 3L74D 3L73D 3U59A 4YXDC 3AE8C 1S9KD 1DX7A 1HBWA 2ZJSE 1EDLA 5DJTB 5KKZC 1PGPA 1BE3G 1FOSF 1KZUB 4RJTA 2E42A 1NTKJ 2E74C 1PPJD 2E76C 5E79H 1FDMA 1HF9A 1LTGC 4D6TE 1R5SA 2OYIC 1KYOH 3AEEC 2O01H 1H89A 1IFPA 1AVYA 2R32A 1G1JA 4NPDA 2HPCA 1JY2P 3L70D 1PL5A 3SWFA 1L0ND 2W8ZA 3G71P 4JPZB 1P84H 3PH0A 1EZVG 1SQPJ 1VQ8P 4JQ0D 2JEEA 5CCGA 5KJ7C 1T8ZA 3L70G 1VDFA 1ZV8A 1TU3F 1IZNB 2FYZA 2SPZA 2JKVA 1BCCD 5AW8B 1JY3P 2BASA 3L72J 3VYIA 1KFMA 4M3LA 2ZXEB 3P8MC 4LGDE 1J2JB 5CJ0A 2JO1A 1R8EA 5TISE 3WU2E 1YYCA 5KAFH 2GM4A 3A7OA 4WVZA 1GK4A 5APWA 1AA0A 1JMBA 1L4AC 1LWUA 1M1JA 1OIPA 1ZRTD 3H1KJ 2GUVA 1OXZA 3U1AA 4A7PA 2E74D 2N1TA 3L72E 1CZQA 1KB9I 2JR8A 3CLQA 3H1LD 3L71E 3L75G 5AW5B 1YIJP 1T2KD 2D2CB 1CSBA 4ASWA 1NVOA 1GL2D 1X22A 4I1LA 5KLVJ 1QVFO 2BCCG 3M9BA 1URQD 4RESB 3M06A 2WT7A 3AE4C 3I5CA 2Y0DA 2YKPA 4IL6E 3CX5D 1LTBC 1LT1A 1JTHA 5KLVG 3IFMA 2LXBA 2XZRA 1W5CE 1KB9D 2KP8A 1AJYA 1XTGB 1M56D 2KSJA 2LR2A 2WPRA 1NYHA 1JCCA 1LTJC 2YXQB 3B5NA 3L73J 1S5LH 4UB8H 1NOHA 1L4AA 1WMKA 3P8CD 1LT9A 4BXLA 3CCQP 1H8AA 1KYOI 3FGAD 3H1KG 3LW5J 2K1AA 1YHQP 1KILB 1YBKA 2W6BA 3HTKA 2H43A 1NAYA 2HLOA 2ZYGA 2V7QJ 3MTUE 3CMEP 2WSEH 1BE3D 1E5WA 1ZMEC 3MZWB 1KV4A 3AE9C 1VQNP 5APUA 1P84E 4PV1D 1PPJE 3CWBE 2QJPB 5KLVK 1SQQK 2O01J 3L70J 4ZKUA 3M0AA 3HTKB 4H0LD 2OYIA 1L0NJ 2WSFH 1K05A 3HUSB 5B5EE 1FZCB 1NTMG 4DCKA 2QA4P 2A06G 1PP9E 3HE4A 5C39A 1X79B 1EXIA 2KZIA 2IYOA 3AE7C 2ITAA 4IL6X 3SWYA 4AYCA 1L0NE 2YIUB 2OYIB 2GUSA 1NO4A 2A45I 1BCCJ 4H44C 3AEAC 1NU1G 5L8RJ 1JMMA 1KB9H 1UIXA 2KUBA 1NKZB 1SS1A 1VF5D 4OGQC 1Q7YQ 1BGYD 2WT7B 1ZR2A 1GD2E 1OW6A 2BEZF 1IK7A 3G9RA 4OH8B 2IPPA 1YQ4C 1RF1A 4I7ZC 1DD4A 1JOCA 1NTKG 2N9YB 2QSIA 4HB1A 3H1LJ 3FWNA 2MJZA 2FFDB 1IK9A 1JM0A 1SQVK 3ABVC 1NJIQ 2WPSA 4RO0A 2IZ0A 1NTZJ 1L4AB 1RE3A 1ZRTE 2IZ1A 2OGUA 2P7JA 2V4HA 5EFWB 4YPCA 3T97B 1SQXE 1FOSE 1URQA 4AUWA 2QE7H 4H44D 3H1LE 2FXMA 1FZFA 1NTMJ 1QL1A 3H1JG 1OVRA 2YMKA 1IC2A 3AECC 4JF7A 2Q7CA 3CCJP 1DEEG 2OARA 2HFED 1J1EC 5AW9B 2OYOA 2W6AA 5APVA 2A45G 2H8PD 4RKUJ 1PZQA 1N7SD 1FZAA 3ZDMA 2M3BA 1FZGA 3E1IA 3M0DA 1VQ5P 3A0HE 2QJYB 1L4AD 3NMDA 3CMAP 1K73Q 1K9MQ 2M8RA 4L75A 4ZKPA 5GTHE 3L71J 1MKMA 2K9YA 3HUSA 2OTJP 2R3CA 2K9JA 4LLHA 1ZW0A 2HYNA 5APTA 2YIUC 1OMIA 1FS0E 4U3FD 1BGYG 3MP7B 1MUUA 3VN0A 1KILE 3V2QA 2Q9IA 5AVSB 3H1JE 1OWAA 1RY3A 4GODA 4PV1B 2IFNA 4PD4D 5KJ7D 3JCUE 3L74G 2QM8A 3BCCD 2AEFA 3VMXA 2PAJA 1Y47A 5CCHD 3L73E 3H1JJ 1SQQD 4O9BA 1RF0C 3TDKA 2W6JH 2ZT9D 1SVFA 2BCCD 3SFEC 2CK3H 1KC8Q 1SQVE 4GOEA 1EZVE 2IDBA 3FXDA 3LIDA 5CBOA 1SFCA 1Q81Q 4IL6H 3F89A 3L75D 2C9NY 1MFTA 4PD4I 1RQVA 2FYUJ 1NWQA 2ZVNB 3RL0g 1M1JC 4WB4A 1FZCC 1QEXA 5AVRB 2N1TC 3CX5I 1G2CB 4H13B 3USSA 1M90Q 3Q5PA 1LWUC 1NTKE 1FDIA 2AEMA 1FJKA 2WWWA 4DT0A 4D6TG 3KXDA 1PFIA 1FZEA 2E74B 2ZT9C 3H1ID 2AEJA 2DW3A 2JJLA 1JEKA 2Y9YA 2YO3A 2K37A 1LTSC 1PP9J 2LKMA 3H1HJ 5KAFE 3WU2H 2WMMA 5TISH 3TNUA 2XDJA 4N78E 5KAIH 3TGUJ 3G3ZA 3PRJA 4GDOA 5KKZB 1SQPK 2QVAA 1L0NG 1GK6A 2WSSH 3KZIH 3O6QA 1J1DB 2HR3A 2Q1KA 2Y0EA 3IN6A 4L76A 3RK3E 1VQPP 2E76B 3FXEA 2KSEA 4U7JA 1HUCA 3GF7A 3Q2YA 1GU4A 1M1KQ 2A06E 3M91A 1N7SB 1VQMP 1LP1B 1RH5B 4UB6H 4HH2A 4KJMA 3R4YA 3V2PA 1EZVI 3L37A 4XE5B 1OVUA 5B66H 3A0BH 2FYUK 1GW4A 3JSVC 3L71D 4JYCA 4BRYA 1K8AQ 1LJ2A 3HD7A 3CWBG 3Q5RA 1JO5A 1URQC 3A2AA 2WSFJ 3K5BA 3P7KA 1T2KC 3CC4P 1NU1D 1HGVA 2R44A 1SQXJ 1CI6A 1CI6B 4KHXA 3L73G 4WWIA 1BCCG 1X9VA 2O1JA 4ZNCA 1FJPA 1WRGA 2C9LY 1FBMA 2P58A 2FYNC 3E7KA 4GKGA 1Y8AA 4PJ0H 2FBWC 2YNYA 2RMZA 4H13C 4XFJA 1VQKP 1X0TA 3B8EB 1S5LE 2J58A 1IFDA 1RF1C 3H1JD 4BWNA 2KNCB 3P32A 1RQUA 3V2RA 3WUUA 1M1JB 1SQPD 1SQVG 2L91A 2BCCJ 1HVVA 3OAKA 4EI2A 5CCHC 3H32B 1AFOA 3L75J 3PP5A 4TT3H 2K88A 2Q6QA 4R4MA 1KILA 1RE4A 2ZYAA 3O8ZA 3OJAB 1GL2B 1AQTA 5AVVB 1S9KE 2WPVB 3CX5H 3CXHE 3RK3C 3IAOA 1VQ9P 5GTIE 1G1IA 2IX7C 3H1KD 3CWBD 3VMZA 3F5HA 3PJSK 3B5NC 1WT6A 3L75E 3L71G 3WUVA 4C7NA 2OTLP 1HH0A 2N1TD 4PD4H 3Q3DA 3W68A 4BRYB 1FE6A 1FU1A 1FDOA 1QL2A 3BRTB 3L4FA 3PTZA 3RK2D 3H25A 4AQRD 1N8RQ 2M3EA 4Y28J 1L0NK 1PP9D 1N73A 2H7HA 5B66E 3NTNA 5AVUB 2NPSB 4Y99B 5CMZA 5BVZA 1R5LA 2IYPA 3HRNA 2FY8A 3TGUE 1PGJA 1ZR4A 2OYHC 1MFZA 3HE5B 3BCCG 3H1IE 3HE5A 3N7NA 1N7LA 3B4SA 3O6QB 3AEGC 4WY4C 3FWLA 1S5LX 1YTZT 1Z56A 5AVXB 2QEXP 2N1TB 3KZIE 3GLMA 2XNXA 2WITA 3B5ND 3H1LG 5K5GB 1H88A 2FXOA 1S4XA 1LWUB 1USDA 1VQ6P 2KNCA 1VQ7P 1SQXG 1EDKA 1JNMA 2I1JA 1SQBD 1ZP0C 2B87B 2D2CC 2KS1B 1HJ0A 1DEBA 2W90A 5APYA 2NPSD 1Q82Q 1H0TB 1EDIA 4H0LB 3C1LA 4XA4A 1KYOE 3CPWO 3H1HE 1BE3J 3VMAA 1NU1J 1NGMB 3P8CE
chains in the Genus database with same CATH topology
3L75G 4PD4H 2FYUG 4D6TG 3L73G 1BCCG 2BCCG 1SQPG 3L74G 1P84H 3TGUG 1SQQG 1NTMG 1L0NG 3H1JG 2A06G 2IBZG 3BCCG 1EZVG 1SQVG 1NTZG 3H1HG 3L70G 3H1IG 1PP9G 3CXHH 5KLVG 3H1LG 1NU1G 1BGYG 1KB9H 1BE3G 1SQXG 1L0LG 3H1KG 3L71G 4U3FG 3CX5H 3CWBG 1PPJG 1SQBG 1KYOH 1NTKG 3L72G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 G;  4PD4 H;  2FYU G;  4D6T G;  3L73 G;  1BCC G;  2BCC G;  1SQP G;  3L74 G;  1P84 H;  3TGU G;  1SQQ G;  1NTM G;  1L0N G;  3H1J G;  2A06 G;  2IBZ G;  3BCC G;  1EZV G;  1SQV G;  1NTZ G;  3H1H G;  3L70 G;  3H1I G;  1PP9 G;  3CXH H;  5KLV G;  3H1L G;  1NU1 G;  1BGY G;  1KB9 H;  1BE3 G;  1SQX G;  1L0L G;  3H1K G;  3L71 G;  4U3F G;  3CX5 H;  3CWB G;  1PPJ G;  1SQB G;  1KYO H;  1NTK G;  3L72 G; 
#chains in the Genus database with same CATH topology
 1KN7 A;  2W83 C;  1SQX D;  2Z5I A;  2WQY C;  2E5T A;  1GL2 A;  2KB7 P;  1L0L K;  1NTZ K;  3A3Y B;  3PLN A;  4R4L A;  3SWK A;  5KTB A;  1S2E A;  2OYH A;  4WBA A;  4CPG A;  2WSC H;  2R5B A;  2WSE J;  4I7Z B;  4WY4 A;  2POH A;  3II6 A;  3TGU G;  1JB0 J;  5AVT B;  3OA7 A;  1JUN A;  3CL3 D;  3NFQ A;  3TYY A;  1Q86 Q;  1BSH A;  5KLI B;  3CX5 E;  3CXH H;  1KOR A;  4I2L C;  1OW8 A;  4YTP C;  1GU5 A;  4D6T D;  2MKV A;  3H32 A;  1H0T A;  3RBZ A;  1L0L G;  2E75 B;  5H2F H;  3CCR P;  2R5D A;  2Z4E A;  1J1E B;  3CI9 A;  5KLV E;  2Z5H A;  1MV8 A;  3S9O A;  3VP9 A;  3TNU B;  5AW2 B;  5AW1 B;  1GMJ A;  4HJG H;  2FKW B;  4H44 B;  2J59 M;  2LXC B;  1M7L A;  2QJY C;  2M5A A;  3BCC E;  4K3A A;  1BSN A;  2A45 H;  3EFG A;  5AVY B;  3S4R A;  5GTI H;  2HPC B;  3UIA A;  1EDJ A;  5H2F E;  1NTZ D;  3L74 E;  2IBZ D;  5TJH A;  5CBN A;  2BCC E;  4IFM A;  3V6I A;  3RK2 C;  1GDT A;  3JCU H;  2KLU A;  1M8O B;  3BAS A;  2KIK A;  2FFD C;  5CHX A;  4QMA A;  2AXT H;  2CPB A;  4HKZ H;  5AW3 B;  3L74 J;  2E5Y A;  4W7Z A;  4C7N B;  3G6E P;  2Y0C A;  1IFM A;  2JWA A;  1LTI C;  1NTK K;  4H0L C;  5AW4 B;  3T97 A;  2E76 D;  2QJK B;  5APS A;  2IBZ I;  2O3J A;  4EIJ A;  1NTK D;  3OW2 O;  3V4W A;  1Y9B A;  4U3F G;  2HG5 D;  3A0H H;  2JWD A;  4GT1 A;  1SQX K;  2R3S A;  1SLQ A;  4I6M C;  3L70 E;  4ZMD A;  1PIX A;  1L0L D;  2FYU E;  2WTY A;  2P67 A;  3BVH A;  2W27 A;  3L72 G;  1SFC C;  1BGY E;  1YJW P;  1SP4 A;  1IJD B;  2G3A A;  2QIW A;  3QWO C;  3M9H A;  3IF4 A;  3V4Q A;  1N86 A;  3I55 P;  1MZ9 A;  1Q90 D;  3E1R A;  2KK7 A;  4C46 A;  3CCV P;  3JC2 2;  4KT0 J;  3AE3 C;  4EOT A;  2K9J B;  1NAF A;  3WMM 0;  1KB9 E;  1A02 J;  4EDF A;  1U57 A;  3CCS P;  1BCC E;  2B9B A;  3EFF K;  3CCM P;  1VF5 C;  1LTJ A;  2BEQ D;  1G2C A;  3AE5 C;  3AE2 C;  4C7R A;  2VRS A;  3A5T A;  1EXJ A;  2QRX A;  1KFN A;  2JP3 A;  4H13 D;  5M1B A;  3TSI A;  3KQG A;  3MUD A;  5AW0 B;  1SFC D;  5B5E H;  4D6T J;  2YO2 A;  5E79 E;  1BE3 E;  3HD7 B;  1NKN A;  1NU1 E;  1XTC C;  1USE A;  2C0X A;  1S1C X;  4GOF A;  1P84 D;  2PFX A;  3C8V A;  1VPC A;  2Q3I A;  3MHV A;  2WSC J;  2OTK E;  1AQ5 A;  1E79 H;  3B71 A;  1N73 C;  3AEB C;  1NTM E;  1U7M A;  1M57 D;  2E75 C;  2FYU G;  3GHG B;  3CXH I;  5CCG C;  5KLV D;  5KJ7 A;  4U3F E;  2QM7 A;  1FAV A;  3V5B A;  1SQP E;  3CCE P;  3AEF C;  4W80 A;  2XND H;  1N2D C;  2P10 A;  2QJK C;  5AW6 B;  1P84 I;  4NPE A;  4MN4 C;  4PD4 E;  3Q5S A;  2D2C D;  1HTL C;  3LW5 H;  3GHG A;  2QJP C;  3ITK A;  1NTZ E;  3CCU P;  3N4X A;  1PP9 G;  2JDI H;  1URQ B;  3RBX A;  2ZFC A;  1HGZ A;  1SQQ E;  1W2E A;  2KZJ A;  3C9I A;  3CXH D;  1OW7 A;  3H1K E;  3KHU A;  2RH0 A;  3BAT A;  1HJB A;  5AVZ B;  1J1D C;  4JYB A;  3BRV B;  2M5A B;  1KQG B;  1GW3 A;  1PPJ G;  4UB8 E;  1JY2 N;  2K3R A;  1N7S C;  4OVN F;  1L0L J;  3QH9 A;  1RF1 B;  2ZXX A;  3D6Y A;  3I56 P;  1RE3 C;  2P1J A;  3CC7 P;  4OGQ B;  1LGH B;  4ASV A;  2QG4 A;  1KD1 Q;  4TLF A;  2HOD A;  2O01 N;  3RK3 B;  1KQS O;  1GZL A;  1SQP G;  3AE1 C;  1FC2 C;  2NZ2 A;  2UWJ E;  3EWK A;  3FX0 A;  1LT9 C;  3TF5 A;  3CD6 P;  4NPF X;  3MIW A;  4LC1 A;  1GTW A;  2IBZ G;  3SFD C;  1IO4 A;  1UII A;  2ZYD A;  2HOD B;  1NTZ G;  2FYN B;  2IFM A;  1DH3 A;  1BDC A;  1PGO A;  1YTZ I;  3HUS C;  4IFF A;  3RL0 D;  1L2P A;  4Y99 C;  3CCL P;  2WZ7 A;  2L5G B;  1ZN5 A;  3A0B E;  3RK3 D;  1SFC B;  1SQB K;  2OYH B;  1DIP A;  2G8Y A;  4L74 A;  3RK2 B;  1BGY J;  4B86 A;  1YI2 P;  1PGQ A;  1KTM A;  1KMI Z;  1W2B O;  1SQB G;  3CWB J;  4DJG A;  3RL0 C;  1IFN A;  2YKQ A;  2B89 A;  2PRR A;  5DJU B;  1QX8 A;  5AVQ B;  3HD7 C;  4JBZ A;  2YKO A;  1VF5 B;  2B87 A;  3EQ2 A;  2XKM A;  4IFD K;  1JTH B;  1JY2 O;  1ZOY C;  4DZO A;  1RF0 A;  3MD0 A;  4W7Y A;  4N3Y B;  2CPS A;  2PGD A;  3VOP A;  2YMY A;  2M0B A;  2WPQ A;  1SQV D;  3B5N B;  1OX3 A;  3VMY A;  4UB6 E;  1RHZ B;  4DOJ A;  4EYY Q;  3G4S P;  3D6Z A;  2OQQ A;  1NTM D;  1OFC X;  3AE6 C;  3GG2 A;  1CW5 A;  3NXS A;  1PV3 A;  4PV1 C;  1GL2 C;  3L35 A;  2FFD A;  4N6J A;  1YQ3 C;  3H1I G;  1JCD A;  1OVV A;  1JY3 O;  5CJ4 A;  1LT9 B;  1LTA C;  2KXP B;  2KI7 B;  2Y9Z A;  2FXP A;  2H89 C;  1KIL D;  1U7J A;  2NRG A;  2XU6 A;  5KAI E;  3LIE A;  1N73 B;  4Z1M H;  3R2P A;  1SQB J;  3GHG C;  2C0W A;  3GF3 A;  4WY4 B;  3S1K A;  1ZXG A;  1FZC A;  1ZLL A;  3WUT A;  4HYT B;  5KLI C;  1A02 F;  1T3J A;  4OWF A;  4U3F J;  3M0D C;  1HWT C;  1QLE D;  2NPS C;  2IBZ E;  5BU8 B;  4N78 D;  2O1K A;  4OGQ D;  1S72 P;  1YJN P;  2RKL A;  1SQB E;  1VQ4 P;  4IOI H;  1NU1 K;  1EQ7 A;  3IR9 A;  1EZV D;  3H6P A;  3BCC J;  2AXC A;  1KYO D;  1FZB A;  4L73 A;  2H88 C;  2I1K A;  2YXR B;  2KOG A;  2V7Q H;  3U1C A;  3KPE A;  1T3U A;  1YJ9 P;  4WY4 D;  2A06 D;  2ZVO B;  5APQ A;  1VL2 A;  1BDD A;  1OZH A;  1SQQ J;  2E75 D;  3GW6 A;  4K35 A;  5AVW B;  2Q3E A;  3VP8 A;  1NTM K;  5CCG D;  3Q1M A;  1IFI A;  4GIF A;  1KQF B;  1N7S A;  1AV1 A;  3MUD C;  3M9Q A;  3TK1 A;  5AW7 B;  1NH4 A;  2ZAE B;  3GMA A;  1VQL P;  3RL0 B;  3PHL A;  5GTH H;  3L72 D;  1S3J A;  1L0L E;  2FYU D;  2RN0 A;  2N9B A;  3VTP C;  2WVR A;  1Q2N A;  2NPS A;  1JY3 N;  2ZT9 B;  3L36 A;  3HE4 B;  4YXW H;  1QVG O;  3HD7 D;  3SSU A;  1LTJ B;  1QGK B;  1YIT P;  2P2U A;  1K04 A;  2AXT E;  2J5U A;  3CC2 P;  1NHL A;  1IFJ A;  2Q5U A;  2KYV A;  3RGU A;  3H1I J;  3MGN A;  2PP6 A;  2B88 A;  2E43 A;  3H1H D;  1DD3 A;  1LP1 A;  5APX A;  5BU5 A;  2KLV A;  3AED C;  4PJ0 E;  3V2N A;  1D7M A;  1SQV J;  3TGU D;  3D71 A;  1VQO P;  3D70 A;  5CCH A;  1X8Y A;  1SQQ G;  1LTT C;  3KDP B;  1LNQ A;  1T6A A;  1KQL A;  3W67 A;  3H1H G;  1EC5 A;  2KS1 A;  1KIL C;  1AVO A;  1RE4 C;  2GA1 A;  2I8D A;  2XV5 A;  3KYQ A;  3L74 D;  3L73 D;  3U59 A;  4YXD C;  3AE8 C;  1S9K D;  1DX7 A;  1HBW A;  2ZJS E;  1EDL A;  5DJT B;  5KKZ C;  1PGP A;  1BE3 G;  1FOS F;  1KZU B;  4RJT A;  2E42 A;  1NTK J;  2E74 C;  1PPJ D;  2E76 C;  5E79 H;  1FDM A;  1HF9 A;  1LTG C;  4D6T E;  1R5S A;  2OYI C;  1KYO H;  3AEE C;  2O01 H;  1H89 A;  1IFP A;  1AVY A;  2R32 A;  1G1J A;  4NPD A;  2HPC A;  1JY2 P;  3L70 D;  1PL5 A;  3SWF A;  1L0N D;  2W8Z A;  3G71 P;  4JPZ B;  1P84 H;  3PH0 A;  1EZV G;  1SQP J;  1VQ8 P;  4JQ0 D;  2JEE A;  5CCG A;  5KJ7 C;  1T8Z A;  3L70 G;  1VDF A;  1ZV8 A;  1TU3 F;  1IZN B;  2FYZ A;  2SPZ A;  2JKV A;  1BCC D;  5AW8 B;  1JY3 P;  2BAS A;  3L72 J;  3VYI A;  1KFM A;  4M3L A;  2ZXE B;  3P8M C;  4LGD E;  1J2J B;  5CJ0 A;  2JO1 A;  1R8E A;  5TIS E;  3WU2 E;  1YYC A;  5KAF H;  2GM4 A;  3A7O A;  4WVZ A;  1GK4 A;  5APW A;  1AA0 A;  1JMB A;  1L4A C;  1LWU A;  1M1J A;  1OIP A;  1ZRT D;  3H1K J;  2GUV A;  1OXZ A;  3U1A A;  4A7P A;  2E74 D;  2N1T A;  3L72 E;  1CZQ A;  1KB9 I;  2JR8 A;  3CLQ A;  3H1L D;  3L71 E;  3L75 G;  5AW5 B;  1YIJ P;  1T2K D;  2D2C B;  1CSB A;  4ASW A;  1NVO A;  1GL2 D;  1X22 A;  4I1L A;  5KLV J;  1QVF O;  2BCC G;  3M9B A;  1URQ D;  4RES B;  3M06 A;  2WT7 A;  3AE4 C;  3I5C A;  2Y0D A;  2YKP A;  4IL6 E;  3CX5 D;  1LTB C;  1LT1 A;  1JTH A;  5KLV G;  3IFM A;  2LXB A;  2XZR A;  1W5C E;  1KB9 D;  2KP8 A;  1AJY A;  1XTG B;  1M56 D;  2KSJ A;  2LR2 A;  2WPR A;  1NYH A;  1JCC A;  1LTJ C;  2YXQ B;  3B5N A;  3L73 J;  1S5L H;  4UB8 H;  1NOH A;  1L4A A;  1WMK A;  3P8C D;  1LT9 A;  4BXL A;  3CCQ P;  1H8A A;  1KYO I;  3FGA D;  3H1K G;  3LW5 J;  2K1A A;  1YHQ P;  1KIL B;  1YBK A;  2W6B A;  3HTK A;  2H43 A;  1NAY A;  2HLO A;  2ZYG A;  2V7Q J;  3MTU E;  3CME P;  2WSE H;  1BE3 D;  1E5W A;  1ZME C;  3MZW B;  1KV4 A;  3AE9 C;  1VQN P;  5APU A;  1P84 E;  4PV1 D;  1PPJ E;  3CWB E;  2QJP B;  5KLV K;  1SQQ K;  2O01 J;  3L70 J;  4ZKU A;  3M0A A;  3HTK B;  4H0L D;  2OYI A;  1L0N J;  2WSF H;  1K05 A;  3HUS B;  5B5E E;  1FZC B;  1NTM G;  4DCK A;  2QA4 P;  2A06 G;  1PP9 E;  3HE4 A;  5C39 A;  1X79 B;  1EXI A;  2KZI A;  2IYO A;  3AE7 C;  2ITA A;  4IL6 X;  3SWY A;  4AYC A;  1L0N E;  2YIU B;  2OYI B;  2GUS A;  1NO4 A;  2A45 I;  1BCC J;  4H44 C;  3AEA C;  1NU1 G;  5L8R J;  1JMM A;  1KB9 H;  1UIX A;  2KUB A;  1NKZ B;  1SS1 A;  1VF5 D;  4OGQ C;  1Q7Y Q;  1BGY D;  2WT7 B;  1ZR2 A;  1GD2 E;  1OW6 A;  2BEZ F;  1IK7 A;  3G9R A;  4OH8 B;  2IPP A;  1YQ4 C;  1RF1 A;  4I7Z C;  1DD4 A;  1JOC A;  1NTK G;  2N9Y B;  2QSI A;  4HB1 A;  3H1L J;  3FWN A;  2MJZ A;  2FFD B;  1IK9 A;  1JM0 A;  1SQV K;  3ABV C;  1NJI Q;  2WPS A;  4RO0 A;  2IZ0 A;  1NTZ J;  1L4A B;  1RE3 A;  1ZRT E;  2IZ1 A;  2OGU A;  2P7J A;  2V4H A;  5EFW B;  4YPC A;  3T97 B;  1SQX E;  1FOS E;  1URQ A;  4AUW A;  2QE7 H;  4H44 D;  3H1L E;  2FXM A;  1FZF A;  1NTM J;  1QL1 A;  3H1J G;  1OVR A;  2YMK A;  1IC2 A;  3AEC C;  4JF7 A;  2Q7C A;  3CCJ P;  1DEE G;  2OAR A;  2HFE D;  1J1E C;  5AW9 B;  2OYO A;  2W6A A;  5APV A;  2A45 G;  2H8P D;  4RKU J;  1PZQ A;  1N7S D;  1FZA A;  3ZDM A;  2M3B A;  1FZG A;  3E1I A;  3M0D A;  1VQ5 P;  3A0H E;  2QJY B;  1L4A D;  3NMD A;  3CMA P;  1K73 Q;  1K9M Q;  2M8R A;  4L75 A;  4ZKP A;  5GTH E;  3L71 J;  1MKM A;  2K9Y A;  3HUS A;  2OTJ P;  2R3C A;  2K9J A;  4LLH A;  1ZW0 A;  2HYN A;  5APT A;  2YIU C;  1OMI A;  1FS0 E;  4U3F D;  1BGY G;  3MP7 B;  1MUU A;  3VN0 A;  1KIL E;  3V2Q A;  2Q9I A;  5AVS B;  3H1J E;  1OWA A;  1RY3 A;  4GOD A;  4PV1 B;  2IFN A;  4PD4 D;  5KJ7 D;  3JCU E;  3L74 G;  2QM8 A;  3BCC D;  2AEF A;  3VMX A;  2PAJ A;  1Y47 A;  5CCH D;  3L73 E;  3H1J J;  1SQQ D;  4O9B A;  1RF0 C;  3TDK A;  2W6J H;  2ZT9 D;  1SVF A;  2BCC D;  3SFE C;  2CK3 H;  1KC8 Q;  1SQV E;  4GOE A;  1EZV E;  2IDB A;  3FXD A;  3LID A;  5CBO A;  1SFC A;  1Q81 Q;  4IL6 H;  3F89 A;  3L75 D;  2C9N Y;  1MFT A;  4PD4 I;  1RQV A;  2FYU J;  1NWQ A;  2ZVN B;  3RL0 g;  1M1J C;  4WB4 A;  1FZC C;  1QEX A;  5AVR B;  2N1T C;  3CX5 I;  1G2C B;  4H13 B;  3USS A;  1M90 Q;  3Q5P A;  1LWU C;  1NTK E;  1FDI A;  2AEM A;  1FJK A;  2WWW A;  4DT0 A;  4D6T G;  3KXD A;  1PFI A;  1FZE A;  2E74 B;  2ZT9 C;  3H1I D;  2AEJ A;  2DW3 A;  2JJL A;  1JEK A;  2Y9Y A;  2YO3 A;  2K37 A;  1LTS C;  1PP9 J;  2LKM A;  3H1H J;  5KAF E;  3WU2 H;  2WMM A;  5TIS H;  3TNU A;  2XDJ A;  4N78 E;  5KAI H;  3TGU J;  3G3Z A;  3PRJ A;  4GDO A;  5KKZ B;  1SQP K;  2QVA A;  1L0N G;  1GK6 A;  2WSS H;  3KZI H;  3O6Q A;  1J1D B;  2HR3 A;  2Q1K A;  2Y0E A;  3IN6 A;  4L76 A;  3RK3 E;  1VQP P;  2E76 B;  3FXE A;  2KSE A;  4U7J A;  1HUC A;  3GF7 A;  3Q2Y A;  1GU4 A;  1M1K Q;  2A06 E;  3M91 A;  1N7S B;  1VQM P;  1LP1 B;  1RH5 B;  4UB6 H;  4HH2 A;  4KJM A;  3R4Y A;  3V2P A;  1EZV I;  3L37 A;  4XE5 B;  1OVU A;  5B66 H;  3A0B H;  2FYU K;  1GW4 A;  3JSV C;  3L71 D;  4JYC A;  4BRY A;  1K8A Q;  1LJ2 A;  3HD7 A;  3CWB G;  3Q5R A;  1JO5 A;  1URQ C;  3A2A A;  2WSF J;  3K5B A;  3P7K A;  1T2K C;  3CC4 P;  1NU1 D;  1HGV A;  2R44 A;  1SQX J;  1CI6 A;  1CI6 B;  4KHX A;  3L73 G;  4WWI A;  1BCC G;  1X9V A;  2O1J A;  4ZNC A;  1FJP A;  1WRG A;  2C9L Y;  1FBM A;  2P58 A;  2FYN C;  3E7K A;  4GKG A;  1Y8A A;  4PJ0 H;  2FBW C;  2YNY A;  2RMZ A;  4H13 C;  4XFJ A;  1VQK P;  1X0T A;  3B8E B;  1S5L E;  2J58 A;  1IFD A;  1RF1 C;  3H1J D;  4BWN A;  2KNC B;  3P32 A;  1RQU A;  3V2R A;  3WUU A;  1M1J B;  1SQP D;  1SQV G;  2L91 A;  2BCC J;  1HVV A;  3OAK A;  4EI2 A;  5CCH C;  3H32 B;  1AFO A;  3L75 J;  3PP5 A;  4TT3 H;  2K88 A;  2Q6Q A;  4R4M A;  1KIL A;  1RE4 A;  2ZYA A;  3O8Z A;  3OJA B;  1GL2 B;  1AQT A;  5AVV B;  1S9K E;  2WPV B;  3CX5 H;  3CXH E;  3RK3 C;  3IAO A;  1VQ9 P;  5GTI E;  1G1I A;  2IX7 C;  3H1K D;  3CWB D;  3VMZ A;  3F5H A;  3PJS K;  3B5N C;  1WT6 A;  3L75 E;  3L71 G;  3WUV A;  4C7N A;  2OTL P;  1HH0 A;  2N1T D;  4PD4 H;  3Q3D A;  3W68 A;  4BRY B;  1FE6 A;  1FU1 A;  1FDO A;  1QL2 A;  3BRT B;  3L4F A;  3PTZ A;  3RK2 D;  3H25 A;  4AQR D;  1N8R Q;  2M3E A;  4Y28 J;  1L0N K;  1PP9 D;  1N73 A;  2H7H A;  5B66 E;  3NTN A;  5AVU B;  2NPS B;  4Y99 B;  5CMZ A;  5BVZ A;  1R5L A;  2IYP A;  3HRN A;  2FY8 A;  3TGU E;  1PGJ A;  1ZR4 A;  2OYH C;  1MFZ A;  3HE5 B;  3BCC G;  3H1I E;  3HE5 A;  3N7N A;  1N7L A;  3B4S A;  3O6Q B;  3AEG C;  4WY4 C;  3FWL A;  1S5L X;  1YTZ T;  1Z56 A;  5AVX B;  2QEX P;  2N1T B;  3KZI E;  3GLM A;  2XNX A;  2WIT A;  3B5N D;  3H1L G;  5K5G B;  1H88 A;  2FXO A;  1S4X A;  1LWU B;  1USD A;  1VQ6 P;  2KNC A;  1VQ7 P;  1SQX G;  1EDK A;  1JNM A;  2I1J A;  1SQB D;  1ZP0 C;  2B87 B;  2D2C C;  2KS1 B;  1HJ0 A;  1DEB A;  2W90 A;  5APY A;  2NPS D;  1Q82 Q;  1H0T B;  1EDI A;  4H0L B;  3C1L A;  4XA4 A;  1KYO E;  3CPW O;  3H1H E;  1BE3 J;  3VMA A;  1NU1 J;  1NGM B;  3P8C E; 
#chains in the Genus database with same CATH homology
 3L75 G;  4PD4 H;  2FYU G;  4D6T G;  3L73 G;  1BCC G;  2BCC G;  1SQP G;  3L74 G;  1P84 H;  3TGU G;  1SQQ G;  1NTM G;  1L0N G;  3H1J G;  2A06 G;  2IBZ G;  3BCC G;  1EZV G;  1SQV G;  1NTZ G;  3H1H G;  3L70 G;  3H1I G;  1PP9 G;  3CXH H;  5KLV G;  3H1L G;  1NU1 G;  1BGY G;  1KB9 H;  1BE3 G;  1SQX G;  1L0L G;  3H1K G;  3L71 G;  4U3F G;  3CX5 H;  3CWB G;  1PPJ G;  1SQB G;  1KYO H;  1NTK G;  3L72 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...