3CWBG

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
total genus 19
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cwbG00
1L0LG 3L74G 1NTZG 4D6TG 3TGUG 1SQVG 3CWBG 3H1IG 1BE3G 2A06G 1KB9H 4PD4H 1PP9G 3H1HG 1P84H 3CXHH 1EZVG 1KYOH 5KLVG 1SQQG 2BCCG 2FYUG 1NTMG 1SQPG 2IBZG 1SQBG 3CX5H 3L70G 1BGYG 3BCCG 3L72G 1BCCG 1PPJG 3H1LG 3L75G 3H1KG 3L71G 1SQXG 3L73G 4U3FG 1L0NG 3H1JG 1NTKG 1NU1G
chains in the Genus database with same CATH superfamily
2K3RA 1YITP 4ASWA 3BCCJ 2KXPB 1JO5A 2R5DA 1OW6A 3RK3E 1PP9D 1LTSC 1JUNA 2OTJP 4KT0J 1IC2A 1YJNP 2QE7H 2E42A 2I1KA 4GKGA 3SSUA 1NU1G 1P84H 1H89A 1FZEA 1T6AA 2WPVB 2Z5HA 2OGUA 1URQC 5AVTB 3HE4A 2E43A 1GD2E 3GG2A 4JQ0D 4WY4C 2C0XA 3RK2C 1PFIA 1RE4A 3H32B 2FFDB 4I6MC 1HUCA 2W6JH 2IFMA 3VMYA 1URQA 2N9BA 1JB0J 1NU1D 2ZYAA 1KB9E 3KQGA 1VF5D 3UIAA 1GK6A 5GTIE 1Q86Q 3RBZA 1S9KD 1IJDB 1U7JA 3D70A 1MZ9A 1KILD 2I8DA 4WY4A 2A06G 1K04A 3RK3C 4U7JA 5CCGD 2YIUC 5BVZA 2ZFCA 1AJYA 2D2CD 3H1LG 3V4QA 1J1EB 3BRTB 2ZYGA 1N73C 2Z4EA 3M0DA 1FJKA 3EFFK 1PV3A 4HB1A 4L76A 2Q3IA 1HGVA 1JMMA 2RKLA 2CPBA 4OWFA 2QSIA 3L71G 1N86A 1HWTC 1GTWA 1FZCC 5APWA 2IZ1A 2LR2A 2B9BA 5AVUB 1N73A 1RF0C 3PJSK 2PGDA 3Q5PA 1NTME 3WMM0 2FXMA 2R44A 3H1LD 1SFCA 3L73G 2XNDH 1G2CA 2KZIA 4LLHA 1NGMB 1SQVD 4PD4H 1VQKP 3FWLA 1FC2C 3HTKA 1FZCA 3L4FA 1YYCA 1SQPE 3CX5H 1SQBD 1P84E 2O3JA 3TK1A 1LP1A 3EFGA 4KJMA 3L71D 2ZXXA 5KJ7D 4BRYA 3JC22 4OVNF 1OW7A 1VQNP 4BWNA 4ZKUA 1YJWP 1JMBA 1EDJA 1HGZA 3TDKA 1HTLC 4WVZA 3L73D 1LTIC 2ZXEB 2YKQA 3AE6C 1FZAA 2PAJA 4U3FJ 3M9BA 3B71A 2JJLA 3CWBE 1QVGO 2K9YA 2QJKB 3CCLP 4HKZH 1J2JB 1SLQA 3CCJP 1BE3J 4EI2A 1SQBE 3LIDA 3L75E 5BU8B 1SQXG 3B5NA 2QJYB 1NTKE 4YPCA 2ZAEB 2M0BA 4L74A 3O8ZA 1M1JC 4N6JA 4B86A 2E74B 2KIKA 5CCGA 1L0LJ 2FYUD 3AEEC 2K9JB 2AEJA 1EC5A 4DZOA 1BGYE 5KKZC 1FBMA 3ABVC 5CHXA 2IDBA 3IR9A 3HE4B 2E5YA 4D6TD 1IK7A 3TYYA 1OWAA 1G1JA 1NU1K 2QEXP 4GT1A 2L91A 3AE7C 2J58A 4Y28J 5AVXB 2O01N 5KLVJ 4RO0A 2AXCA 2BCCJ 1SQXD 1Q7YQ 5GTHH 1KORA 1T3UA 4H13B 5B5EH 3CXHH 3MZWB 1K9MQ 3P7KA 2E5TA 2FYUE 5CJ0A 4GODA 4C46A 1LWUA 1E79H 2IFNA 1YTZI 1PPJE 1USEA 4PD4E 2E76B 4I7ZC 2M3EA 2P67A 4D6TE 4EOTA 1W2BO 1OXZA 5TISE 3CX5E 1X79B 3VP8A 2FYNC 2W8ZA 1GMJA 5KJ7A 3BCCD 1NYHA 3AE8C 3AEFC 1QX8A 1VQ5P 1NTZE 4IL6X 4IFMA 3PHLA 2P7JA 1VQ4P 1X9VA 1BSHA 3WU2H 1SQVK 4UB6H 3Q3DA 3S9OA 5KAFH 2H43A 2Z5IA 2R32A 2I1JA 1VQMP 3SWKA 1MV8A 3CLQA 3PH0A 4QMAA 1L0NJ 1ZP0C 3CD6P 3II6A 3NTNA 5H2FH 4NPFX 3L74J 3CCEP 1SFCB 2WPSA 2N1TC 4UB8E 5DJUB 1G2CB 1JCCA 3BCCE 5AVQB 4YTPC 1RF1C 3TF5A 5CBOA 3VMAA 1N7SC 2OTKE 4XA4A 1LTJB 1WRGA 1OVRA 1LP1B 1G1IA 3A0HH 3AEGC 4BRYB 4WWIA 1SQQJ 1USDA 3L35A 4CPGA 1FU1A 4KHXA 5C39A 3M91A 3GW6A 2OYHC 3H1JJ 1IFPA 1J1DC 1RF1A 2B87B 1N7SA 4I1LA 5GTHE 2OTLP 4GIFA 1Y9BA 5B5EE 3CXHE 1KYOI 3H1IG 5AW0B 4JYCA 2YXQB 1S5LH 2E75B 1YQ4C 2OYHA 2SPZA 3B5NB 2WSCJ 4JF7A 1KILB 4LC1A 3H1KE 4HJGH 2QJPB 1URQD 5AW1B 2A45I 3AEBC 3FXEA 4PV1C 3WUVA 1SQXK 3VOPA 1NAFA 1RE3C 4WY4D 5AW4B 3RK2D 1VQOP 1KQLA 3L70E 3KXDA 1YBKA 4U3FG 2A45G 1HJBA 2QG4A 3LW5J 5KLIB 1BE3G 4UB6E 4DJGA 2YMKA 5KAFE 2C9LY 1U7MA 2WVRA 3S1KA 3U1AA 1VQ6P 3KPEA 1QLED 4R4LA 3OA7A 3CCMP 1DD4A 1OVVA 3P8CE 1L0LG 5H2FE 1WMKA 2QJKC 2LXBA 3Q1MA 1Q90D 3H1HE 1LWUB 3R4YA 3CCSP 2J5UA 5CMZA 4Y99B 5AW3B 1ZV8A 3L72E 4U3FD 1QEXA 4OGQC 1OMIA 4O9BA 1GL2C 3L36A 2FKWB 1SFCD 1MFTA 4AYCA 1QVFO 1BE3D 3V2NA 3R2PA 3A0HE 3Q5RA 1L4AA 2IYPA 5KLVG 2BASA 2BCCG 5M1BA 1LT9C 2JEEA 3SWFA 3I56P 1UIIA 3D6ZA 3O6QA 1CZQA 3HUSA 3PLNA 3NMDA 2IBZD 2ITAA 1L0LD 3M06A 2Q6QA 3HD7C 4ZMDA 3SWYA 5DJTB 4H0LC 4N3YB 1EZVD 3FX0A 4DCKA 2WSFH 2OYOA 4H44B 2Y0CA 3QWOC 1Q81Q 1FZBA 1JOCA 4DT0A 3AE3C 1XTCC 1GZLA 1S5LE 2NPSC 1PZQA 1PP9E 5KLVD 2BCCD 1A02J 1IFIA 2XZRA 3HD7A 4K35A 3N4XA 2V7QJ 2E76C 2C9NY 3G9RA 2IBZE 5BU5A 2AXTH 2E75D 1KTMA 3B5ND 1HJ0A 2M5AB 1KN7A 3GHGC 1KMIZ 3C1LA 5AVVB 1Q82Q 2NPSA 2FXPA 3HE5A 4L75A 2OARA 1L0NG 3U59A 4NPDA 3L74G 3MUDC 3TSIA 1N2DC 1JNMA 4HYTB 1KQFB 1YTZT 1NO4A 4MN4C 3G3ZA 5AW6B 4LGDE 3CC2P 2GUVA 1NU1E 2KUBA 1GW4A 4A7PA 1S9KE 2A06D 1KILE 3TNUA 1JEKA 1SQQG 3BASA 4JBZA 4GDOA 3JSVC 2IYOA 1T2KC 4OH8B 1RQVA 3E7KA 1L0ND 3A0BH 3H1JG 5KAIH 2HODB 3L74D 3CCVP 2ZT9C 1NJIQ 4TLFA 1YIJP 3G6EP 3PP5A 3H1IJ 3ZDMA 1U57A 2K1AA 3LW5H 1RF0A 2MKVA 3P32A 5APUA 4BXLA 1AQ5A 3V2PA 4IFDK 5AVSB 2NZ2A 1SQQD 1BDDA 1KQSO 3CC7P 3AEDC 4ZNCA 3H1LE 1R8EA 3H1JD 1FS0E 1OX3A 1ZRTD 5AW2B 2Q3EA 4H44D 3RL0C 2KS1A 1RHZB 1SQVE 1VF5C 2Y9ZA 1L0LK 2QVAA 3VP9A 2AXTE 1FJPA 2ZVNB 3L71E 2D2CC 2OQQA 1L4AB 3VN0A 4ZKPA 3GF7A 1XTGB 1VL2A 3CPWO 3O6QB 1PGPA 3HUSB 5APQA 5AW8B 5CCHC 2FY8A 1AVYA 5B66H 5KLVK 2B88A 1IFJA 3L73E 2FXOA 3G71P 1HBWA 1KZUB 3Q2YA 2HPCA 3EQ2A 4N78D 3V2RA 1N8RQ 1M1JA 3VMXA 1EXJA 1N7SD 1BCCG 2FBWC 2YNYA 2KYVA 3M9HA 5CCHA 1KQGB 1ZOYC 1Z56A 1Q2NA 3MP7B 2XNXA 1URQB 2JR8A 3SFEC 5KAIE 1S72P 2OYIC 1LT1A 2WSSH 4M3LA 1HF9A 1EXIA 1JY3P 4WY4B 3Q5SA 3RBXA 3RK2B 1VQ7P 4IL6H 2YO3A 2QM7A 1ZLLA 3SFDC 3HE5B 3CCQP 1GU4A 3E1IA 2DW3A 2KZJA 1OZHA 1EDKA 1NTMJ 1SQXE 2QIWA 3AECC 3IN6A 1M57D 1R5LA 1S4XA 3A5TA 1L0NK 1IO4A 2O1KA 2W27A 1LTGC 3RK3B 4PV1D 2YIUB 3AE9C 1SQPJ 2PP6A 2O01J 2FFDC 3TNUB 3TGUG 1N73B 4JPZB 1S2EA 2N9YB 2QM8A 3RL0g 1PGOA 1AQTA 3GLMA 4XFJA 2J59M 2ZJSE 1SQQK 1E5WA 2WSEJ 2IZ0A 2KLUA 3MTUE 3HTKB 4R4MA 1FZFA 1FZCB 2RMZA 5B66E 3CWBJ 1L4AD 1J1EC 2QRXA 2W90A 5TJHA 3P8MC 4YXDC 3L75J 2N1TA 2KK7A 1NTKJ 1PL5A 1JCDA 1KYOH 2LKMA 2MJZA 1NH4A 3KHUA 1X0TA 2BEQD 2KS1B 3FWNA 1BGYJ 2YMYA 2RH0A 2LXCB 3MIWA 2A45H 1ZR2A 5L8RJ 1PGJA 1OIPA 3H1HG 1VDFA 2JWDA 3S4RA 1MKMA 3C9IA 2POHA 5AVRB 2R3SA 3HD7D 1TU3F 1HH0A 1JY2N 4IL6E 4W80A 2Y0EA 2YO2A 3EWKA 1DH3A 2QA4P 1RH5B 5APYA 1QGKB 1ZXGA 1FOSF 3BRVB 1CI6A 2CPSA 4YXWH 3NXSA 2NPSD 2HPCB 4I2LC 1Y8AA 2WWWA 2Y0DA 3WU2E 3H1ID 1MUUA 1FDMA 1M1JB 1JY2O 5GTIH 2IPPA 1KV4A 3LIEA 1K73Q 4DOJA 1FDIA 1RE3A 1ZW0A 5KKZB 4AUWA 1KB9I 3W68A 1KYOD 2HG5D 3RK3D 1NTZJ 2K88A 2QJYC 2WITA 1H0TA 3OJAB 2E74C 2H88C 3I55P 1CSBA 1BCCJ 3CCRP 3H1IE 1IFMA 4RKUJ 1NOHA 1LGHB 3N7NA 4PJ0H 3K5BA 3F89A 3AE5C 1LJ2A 1S1CX 1KYOE 1FDOA 1QL1A 4I7ZB 2GA1A 1KFMA 3V4WA 1VQ9P 2ZVOB 1T2KD 3B8EB 1GL2A 1DX7A 2XU6A 1ZN5A 1RE4C 2FYNB 3H25A 2ZT9D 2K9JA 4RESB 1LTAC 2WTYA 1L2PA 4U3FE 1KB9D 2O01H 1NAYA 4H13C 1JY3N 2W83C 1LT9A 5APVA 2M3BA 1BSNA 1RQUA 3D71A 1BE3E 1DD3A 3ITKA 3GF3A 3VTPC 2XDJA 2W6AA 3A7OA 4EIJA 1NTMG 1P84I 3G4SP 2WSEH 2M8RA 1L0LE 3E1RA 1W5CE 1JM0A 3FXDA 2JKVA 1JY3O 2Y9YA 1EZVE 4L73A 3RGUA 2RN0A 3TGUJ 1SQPG 3H6PA 5AVYB 3M0DC 5E79H 2N1TB 3RL0D 2KI7B 2H8PD 1WT6A 2P10A 1OVUA 3H1KJ 1RF1B 3PTZA 2KNCA 1N7SB 2HFED 1YQ3C 5KLVE 1NTMD 2BCCE 3PRJA 3AE4C 1GDTA 3U1CA 2R3CA 1AVOA 2XV5A 5CBNA 3GHGA 3L70J 1JTHA 3GMAA 1SQVG 3AEAC 3CWBG 1SP4A 3V6IA 1SFCC 4AQRD 4GOEA 5CCHD 2OYHB 4NPEA 1SQPD 3MUDA 1P84D 1J1DB 1SQBG 1NVOA 1H8AA 2WSCH 2XKMA 3L75G 3IF4A 1NTKG 1LTJC 3HRNA 5APTA 1K05A 3A2AA 4GOFA 4PJ0E 3M9QA 2YKPA 1CI6B 2BEZF 1M7LA 4C7NA 1BGYG 1M90Q 3H1HJ 1EQ7A 1FOSE 2C0WA 1JY2P 1N7LA 3L72J 5CJ4A 3KYQA 1SS1A 3CWBD 4PV1B 2KLVA 2H7HA 2A06E 5K5GB 1LTJA 1PGQA 5KTBA 5TISH 2YXRB 1S3JA 1X22A 2WT7A 1A02F 4ASVA 3L75D 1IK9A 1NTKD 1EDIA 1L0NE 2KSJA 4PD4I 2PRRA 3L74E 2JDIH 3USSA 4IOIH 3W67A 2E75C 4K3AA 3CX5I 2K37A 3B5NC 2Q9IA 2FYUG 1KILC 1H0TB 2B87A 1BGYD 3KZIH 2QJPC 1AV1A 1PPJG 5CCGC 3T97A 4D6TG 4RJTA 2WPRA 4W7ZA 4TT3H 1MFZA 1SQQE 2CK3H 1IFDA 5E79E 4W7YA 1PP9J 1VPCA 3H1JE 5KLIC 2JP3A 4UB8H 1KILA 1ZRTE 4OGQB 1NTZG 1KC8Q 1GL2B 1K8AQ 1T8ZA 2N1TD 2GUSA 3CL3D 5AW9B 2WMMA 3WUTA 3VYIA 1ZR4A 1PPJD 2WQYC 1X8YA 1LT9B 4PD4D 4EYYQ 1YHQP 3BVHA 1H88A 1LWUC 3CX5D 2AEMA 3HD7B 4Y99C 3F5HA 3IFMA 1ZMEC 2FYZA 4H0LB 4EDFA 2KSEA 1VQPP 3A0BE 4Z1MH 2V4HA 1LTBC 2V7QH 1GU5A 3BCCG 2Q1KA 1NTMK 1UIXA 1NTZD 3CMAP 1VQ8P 5KJ7C 2O1JA 1NU1J 4N78E 1HVVA 2NPSB 2PFXA 1DEEG 1DIPA 2KOGA 1BCCD 1SQPK 2KNCB 3QH9A 3CXHI 2OYIA 2G8YA 3MHVA 3CC4P 1M8OB 4H44C 2Q5UA 2JWAA 1SVFA 3GHGB 1YI2P 3KDPB 4WBAA 2G3AA 1JTHB 3CI9A 3FGAD 3AE2C 1BDCA 1IFNA 2R5BA 1DEBA 2L5GB 5AVZB 2IX7C 3KZIE 3L37A 1T3JA 1FAVA 2H89C 2WSFJ 1FZGA 1BCCE 3H1KG 1SQBK 3H1LJ 1GK4A 1NTKK 4C7NB 1LTTC 3NFQA 3B4SA 3H32A 3OW2O 1SQVJ 2FFDA 3JCUH 3L70G 4XE5B 2W6BA 1YJ9P 1NKZB 1LNQA 1R5SA 3OAKA 1IZNB 4C7RA 3CXHD 1SQBJ 3TGUD 3L71J 5AW5B 2ZT9B 3MD0A 3I5CA 2WT7B 1OFCX 1NWQA 1M56D 2M5AA 4OGQD 2E74D 1GL2D 1NKNA 2P58A 3H1KD 2KP8A 3C8VA 5APXA 2ZYDA 4IFFA 3WUUA 2YKOA 4JYBA 3L73J 1PIXA 2UWJE 1KD1Q 3L70D 3T97B 3M0AA 2B89A 3L72G 2FYUK 2WPQA 4H0LD 3V5BA 4HH2A 2WZ7A 1AFOA 2HLOA 3TGUE 2P2UA 2HYNA 3RL0B 1VF5B 4H13D 2KB7P 2FYUJ 3P8CD 2P1JA 5AW7B 2GM4A 2HODA 1GW3A 2VRSA 2D2CB 1KB9H 1S5LX 3H1HD 1NTZK 2E76D 4D6TJ 1W2EA 3BATA 1KFNA 2AEFA 5EFWB 2JO1A 3CMEP 1EDLA 3L72D 1Y47A 2IBZI 1M1KQ 1QL2A 1D7MA 2Q7CA 3VMZA 2HR3A 1SQXJ 2NRGA 1AA0A 1PP9G 5APSA 1OW8A 1VQLP 3AE1C 1EZVI 3D6YA 3IAOA 1L4AC 2IBZG 1NHLA 3V2QA 3MGNA 5AVWB 3JCUE 4WB4A 3HUSC 1EZVG 1RY3A 1CW5A 3A3YB 3CCUP 2OYIB 1FE6A
chains in the Genus database with same CATH topology
1L0LG 3L74G 1NTZG 4D6TG 3TGUG 1SQVG 3CWBG 3H1IG 1BE3G 2A06G 1KB9H 4PD4H 1PP9G 3H1HG 1P84H 3CXHH 1EZVG 1KYOH 5KLVG 1SQQG 2BCCG 2FYUG 1NTMG 1SQPG 2IBZG 1SQBG 3CX5H 3L70G 1BGYG 3BCCG 3L72G 1BCCG 1PPJG 3H1LG 3L75G 3H1KG 3L71G 1SQXG 3L73G 4U3FG 1L0NG 3H1JG 1NTKG 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L G;  3L74 G;  1NTZ G;  4D6T G;  3TGU G;  1SQV G;  3CWB G;  3H1I G;  1BE3 G;  2A06 G;  1KB9 H;  4PD4 H;  1PP9 G;  3H1H G;  1P84 H;  3CXH H;  1EZV G;  1KYO H;  5KLV G;  1SQQ G;  2BCC G;  2FYU G;  1NTM G;  1SQP G;  2IBZ G;  1SQB G;  3CX5 H;  3L70 G;  1BGY G;  3BCC G;  3L72 G;  1BCC G;  1PPJ G;  3H1L G;  3L75 G;  3H1K G;  3L71 G;  1SQX G;  3L73 G;  4U3F G;  1L0N G;  3H1J G;  1NTK G;  1NU1 G; 
#chains in the Genus database with same CATH topology
 2K3R A;  1YIT P;  4ASW A;  3BCC J;  2KXP B;  1JO5 A;  2R5D A;  1OW6 A;  3RK3 E;  1PP9 D;  1LTS C;  1JUN A;  2OTJ P;  4KT0 J;  1IC2 A;  1YJN P;  2QE7 H;  2E42 A;  2I1K A;  4GKG A;  3SSU A;  1NU1 G;  1P84 H;  1H89 A;  1FZE A;  1T6A A;  2WPV B;  2Z5H A;  2OGU A;  1URQ C;  5AVT B;  3HE4 A;  2E43 A;  1GD2 E;  3GG2 A;  4JQ0 D;  4WY4 C;  2C0X A;  3RK2 C;  1PFI A;  1RE4 A;  3H32 B;  2FFD B;  4I6M C;  1HUC A;  2W6J H;  2IFM A;  3VMY A;  1URQ A;  2N9B A;  1JB0 J;  1NU1 D;  2ZYA A;  1KB9 E;  3KQG A;  1VF5 D;  3UIA A;  1GK6 A;  5GTI E;  1Q86 Q;  3RBZ A;  1S9K D;  1IJD B;  1U7J A;  3D70 A;  1MZ9 A;  1KIL D;  2I8D A;  4WY4 A;  2A06 G;  1K04 A;  3RK3 C;  4U7J A;  5CCG D;  2YIU C;  5BVZ A;  2ZFC A;  1AJY A;  2D2C D;  3H1L G;  3V4Q A;  1J1E B;  3BRT B;  2ZYG A;  1N73 C;  2Z4E A;  3M0D A;  1FJK A;  3EFF K;  1PV3 A;  4HB1 A;  4L76 A;  2Q3I A;  1HGV A;  1JMM A;  2RKL A;  2CPB A;  4OWF A;  2QSI A;  3L71 G;  1N86 A;  1HWT C;  1GTW A;  1FZC C;  5APW A;  2IZ1 A;  2LR2 A;  2B9B A;  5AVU B;  1N73 A;  1RF0 C;  3PJS K;  2PGD A;  3Q5P A;  1NTM E;  3WMM 0;  2FXM A;  2R44 A;  3H1L D;  1SFC A;  3L73 G;  2XND H;  1G2C A;  2KZI A;  4LLH A;  1NGM B;  1SQV D;  4PD4 H;  1VQK P;  3FWL A;  1FC2 C;  3HTK A;  1FZC A;  3L4F A;  1YYC A;  1SQP E;  3CX5 H;  1SQB D;  1P84 E;  2O3J A;  3TK1 A;  1LP1 A;  3EFG A;  4KJM A;  3L71 D;  2ZXX A;  5KJ7 D;  4BRY A;  3JC2 2;  4OVN F;  1OW7 A;  1VQN P;  4BWN A;  4ZKU A;  1YJW P;  1JMB A;  1EDJ A;  1HGZ A;  3TDK A;  1HTL C;  4WVZ A;  3L73 D;  1LTI C;  2ZXE B;  2YKQ A;  3AE6 C;  1FZA A;  2PAJ A;  4U3F J;  3M9B A;  3B71 A;  2JJL A;  3CWB E;  1QVG O;  2K9Y A;  2QJK B;  3CCL P;  4HKZ H;  1J2J B;  1SLQ A;  3CCJ P;  1BE3 J;  4EI2 A;  1SQB E;  3LID A;  3L75 E;  5BU8 B;  1SQX G;  3B5N A;  2QJY B;  1NTK E;  4YPC A;  2ZAE B;  2M0B A;  4L74 A;  3O8Z A;  1M1J C;  4N6J A;  4B86 A;  2E74 B;  2KIK A;  5CCG A;  1L0L J;  2FYU D;  3AEE C;  2K9J B;  2AEJ A;  1EC5 A;  4DZO A;  1BGY E;  5KKZ C;  1FBM A;  3ABV C;  5CHX A;  2IDB A;  3IR9 A;  3HE4 B;  2E5Y A;  4D6T D;  1IK7 A;  3TYY A;  1OWA A;  1G1J A;  1NU1 K;  2QEX P;  4GT1 A;  2L91 A;  3AE7 C;  2J58 A;  4Y28 J;  5AVX B;  2O01 N;  5KLV J;  4RO0 A;  2AXC A;  2BCC J;  1SQX D;  1Q7Y Q;  5GTH H;  1KOR A;  1T3U A;  4H13 B;  5B5E H;  3CXH H;  3MZW B;  1K9M Q;  3P7K A;  2E5T A;  2FYU E;  5CJ0 A;  4GOD A;  4C46 A;  1LWU A;  1E79 H;  2IFN A;  1YTZ I;  1PPJ E;  1USE A;  4PD4 E;  2E76 B;  4I7Z C;  2M3E A;  2P67 A;  4D6T E;  4EOT A;  1W2B O;  1OXZ A;  5TIS E;  3CX5 E;  1X79 B;  3VP8 A;  2FYN C;  2W8Z A;  1GMJ A;  5KJ7 A;  3BCC D;  1NYH A;  3AE8 C;  3AEF C;  1QX8 A;  1VQ5 P;  1NTZ E;  4IL6 X;  4IFM A;  3PHL A;  2P7J A;  1VQ4 P;  1X9V A;  1BSH A;  3WU2 H;  1SQV K;  4UB6 H;  3Q3D A;  3S9O A;  5KAF H;  2H43 A;  2Z5I A;  2R32 A;  2I1J A;  1VQM P;  3SWK A;  1MV8 A;  3CLQ A;  3PH0 A;  4QMA A;  1L0N J;  1ZP0 C;  3CD6 P;  3II6 A;  3NTN A;  5H2F H;  4NPF X;  3L74 J;  3CCE P;  1SFC B;  2WPS A;  2N1T C;  4UB8 E;  5DJU B;  1G2C B;  1JCC A;  3BCC E;  5AVQ B;  4YTP C;  1RF1 C;  3TF5 A;  5CBO A;  3VMA A;  1N7S C;  2OTK E;  4XA4 A;  1LTJ B;  1WRG A;  1OVR A;  1LP1 B;  1G1I A;  3A0H H;  3AEG C;  4BRY B;  4WWI A;  1SQQ J;  1USD A;  3L35 A;  4CPG A;  1FU1 A;  4KHX A;  5C39 A;  3M91 A;  3GW6 A;  2OYH C;  3H1J J;  1IFP A;  1J1D C;  1RF1 A;  2B87 B;  1N7S A;  4I1L A;  5GTH E;  2OTL P;  4GIF A;  1Y9B A;  5B5E E;  3CXH E;  1KYO I;  3H1I G;  5AW0 B;  4JYC A;  2YXQ B;  1S5L H;  2E75 B;  1YQ4 C;  2OYH A;  2SPZ A;  3B5N B;  2WSC J;  4JF7 A;  1KIL B;  4LC1 A;  3H1K E;  4HJG H;  2QJP B;  1URQ D;  5AW1 B;  2A45 I;  3AEB C;  3FXE A;  4PV1 C;  3WUV A;  1SQX K;  3VOP A;  1NAF A;  1RE3 C;  4WY4 D;  5AW4 B;  3RK2 D;  1VQO P;  1KQL A;  3L70 E;  3KXD A;  1YBK A;  4U3F G;  2A45 G;  1HJB A;  2QG4 A;  3LW5 J;  5KLI B;  1BE3 G;  4UB6 E;  4DJG A;  2YMK A;  5KAF E;  2C9L Y;  1U7M A;  2WVR A;  3S1K A;  3U1A A;  1VQ6 P;  3KPE A;  1QLE D;  4R4L A;  3OA7 A;  3CCM P;  1DD4 A;  1OVV A;  3P8C E;  1L0L G;  5H2F E;  1WMK A;  2QJK C;  2LXB A;  3Q1M A;  1Q90 D;  3H1H E;  1LWU B;  3R4Y A;  3CCS P;  2J5U A;  5CMZ A;  4Y99 B;  5AW3 B;  1ZV8 A;  3L72 E;  4U3F D;  1QEX A;  4OGQ C;  1OMI A;  4O9B A;  1GL2 C;  3L36 A;  2FKW B;  1SFC D;  1MFT A;  4AYC A;  1QVF O;  1BE3 D;  3V2N A;  3R2P A;  3A0H E;  3Q5R A;  1L4A A;  2IYP A;  5KLV G;  2BAS A;  2BCC G;  5M1B A;  1LT9 C;  2JEE A;  3SWF A;  3I56 P;  1UII A;  3D6Z A;  3O6Q A;  1CZQ A;  3HUS A;  3PLN A;  3NMD A;  2IBZ D;  2ITA A;  1L0L D;  3M06 A;  2Q6Q A;  3HD7 C;  4ZMD A;  3SWY A;  5DJT B;  4H0L C;  4N3Y B;  1EZV D;  3FX0 A;  4DCK A;  2WSF H;  2OYO A;  4H44 B;  2Y0C A;  3QWO C;  1Q81 Q;  1FZB A;  1JOC A;  4DT0 A;  3AE3 C;  1XTC C;  1GZL A;  1S5L E;  2NPS C;  1PZQ A;  1PP9 E;  5KLV D;  2BCC D;  1A02 J;  1IFI A;  2XZR A;  3HD7 A;  4K35 A;  3N4X A;  2V7Q J;  2E76 C;  2C9N Y;  3G9R A;  2IBZ E;  5BU5 A;  2AXT H;  2E75 D;  1KTM A;  3B5N D;  1HJ0 A;  2M5A B;  1KN7 A;  3GHG C;  1KMI Z;  3C1L A;  5AVV B;  1Q82 Q;  2NPS A;  2FXP A;  3HE5 A;  4L75 A;  2OAR A;  1L0N G;  3U59 A;  4NPD A;  3L74 G;  3MUD C;  3TSI A;  1N2D C;  1JNM A;  4HYT B;  1KQF B;  1YTZ T;  1NO4 A;  4MN4 C;  3G3Z A;  5AW6 B;  4LGD E;  3CC2 P;  2GUV A;  1NU1 E;  2KUB A;  1GW4 A;  4A7P A;  1S9K E;  2A06 D;  1KIL E;  3TNU A;  1JEK A;  1SQQ G;  3BAS A;  4JBZ A;  4GDO A;  3JSV C;  2IYO A;  1T2K C;  4OH8 B;  1RQV A;  3E7K A;  1L0N D;  3A0B H;  3H1J G;  5KAI H;  2HOD B;  3L74 D;  3CCV P;  2ZT9 C;  1NJI Q;  4TLF A;  1YIJ P;  3G6E P;  3PP5 A;  3H1I J;  3ZDM A;  1U57 A;  2K1A A;  3LW5 H;  1RF0 A;  2MKV A;  3P32 A;  5APU A;  4BXL A;  1AQ5 A;  3V2P A;  4IFD K;  5AVS B;  2NZ2 A;  1SQQ D;  1BDD A;  1KQS O;  3CC7 P;  3AED C;  4ZNC A;  3H1L E;  1R8E A;  3H1J D;  1FS0 E;  1OX3 A;  1ZRT D;  5AW2 B;  2Q3E A;  4H44 D;  3RL0 C;  2KS1 A;  1RHZ B;  1SQV E;  1VF5 C;  2Y9Z A;  1L0L K;  2QVA A;  3VP9 A;  2AXT E;  1FJP A;  2ZVN B;  3L71 E;  2D2C C;  2OQQ A;  1L4A B;  3VN0 A;  4ZKP A;  3GF7 A;  1XTG B;  1VL2 A;  3CPW O;  3O6Q B;  1PGP A;  3HUS B;  5APQ A;  5AW8 B;  5CCH C;  2FY8 A;  1AVY A;  5B66 H;  5KLV K;  2B88 A;  1IFJ A;  3L73 E;  2FXO A;  3G71 P;  1HBW A;  1KZU B;  3Q2Y A;  2HPC A;  3EQ2 A;  4N78 D;  3V2R A;  1N8R Q;  1M1J A;  3VMX A;  1EXJ A;  1N7S D;  1BCC G;  2FBW C;  2YNY A;  2KYV A;  3M9H A;  5CCH A;  1KQG B;  1ZOY C;  1Z56 A;  1Q2N A;  3MP7 B;  2XNX A;  1URQ B;  2JR8 A;  3SFE C;  5KAI E;  1S72 P;  2OYI C;  1LT1 A;  2WSS H;  4M3L A;  1HF9 A;  1EXI A;  1JY3 P;  4WY4 B;  3Q5S A;  3RBX A;  3RK2 B;  1VQ7 P;  4IL6 H;  2YO3 A;  2QM7 A;  1ZLL A;  3SFD C;  3HE5 B;  3CCQ P;  1GU4 A;  3E1I A;  2DW3 A;  2KZJ A;  1OZH A;  1EDK A;  1NTM J;  1SQX E;  2QIW A;  3AEC C;  3IN6 A;  1M57 D;  1R5L A;  1S4X A;  3A5T A;  1L0N K;  1IO4 A;  2O1K A;  2W27 A;  1LTG C;  3RK3 B;  4PV1 D;  2YIU B;  3AE9 C;  1SQP J;  2PP6 A;  2O01 J;  2FFD C;  3TNU B;  3TGU G;  1N73 B;  4JPZ B;  1S2E A;  2N9Y B;  2QM8 A;  3RL0 g;  1PGO A;  1AQT A;  3GLM A;  4XFJ A;  2J59 M;  2ZJS E;  1SQQ K;  1E5W A;  2WSE J;  2IZ0 A;  2KLU A;  3MTU E;  3HTK B;  4R4M A;  1FZF A;  1FZC B;  2RMZ A;  5B66 E;  3CWB J;  1L4A D;  1J1E C;  2QRX A;  2W90 A;  5TJH A;  3P8M C;  4YXD C;  3L75 J;  2N1T A;  2KK7 A;  1NTK J;  1PL5 A;  1JCD A;  1KYO H;  2LKM A;  2MJZ A;  1NH4 A;  3KHU A;  1X0T A;  2BEQ D;  2KS1 B;  3FWN A;  1BGY J;  2YMY A;  2RH0 A;  2LXC B;  3MIW A;  2A45 H;  1ZR2 A;  5L8R J;  1PGJ A;  1OIP A;  3H1H G;  1VDF A;  2JWD A;  3S4R A;  1MKM A;  3C9I A;  2POH A;  5AVR B;  2R3S A;  3HD7 D;  1TU3 F;  1HH0 A;  1JY2 N;  4IL6 E;  4W80 A;  2Y0E A;  2YO2 A;  3EWK A;  1DH3 A;  2QA4 P;  1RH5 B;  5APY A;  1QGK B;  1ZXG A;  1FOS F;  3BRV B;  1CI6 A;  2CPS A;  4YXW H;  3NXS A;  2NPS D;  2HPC B;  4I2L C;  1Y8A A;  2WWW A;  2Y0D A;  3WU2 E;  3H1I D;  1MUU A;  1FDM A;  1M1J B;  1JY2 O;  5GTI H;  2IPP A;  1KV4 A;  3LIE A;  1K73 Q;  4DOJ A;  1FDI A;  1RE3 A;  1ZW0 A;  5KKZ B;  4AUW A;  1KB9 I;  3W68 A;  1KYO D;  2HG5 D;  3RK3 D;  1NTZ J;  2K88 A;  2QJY C;  2WIT A;  1H0T A;  3OJA B;  2E74 C;  2H88 C;  3I55 P;  1CSB A;  1BCC J;  3CCR P;  3H1I E;  1IFM A;  4RKU J;  1NOH A;  1LGH B;  3N7N A;  4PJ0 H;  3K5B A;  3F89 A;  3AE5 C;  1LJ2 A;  1S1C X;  1KYO E;  1FDO A;  1QL1 A;  4I7Z B;  2GA1 A;  1KFM A;  3V4W A;  1VQ9 P;  2ZVO B;  1T2K D;  3B8E B;  1GL2 A;  1DX7 A;  2XU6 A;  1ZN5 A;  1RE4 C;  2FYN B;  3H25 A;  2ZT9 D;  2K9J A;  4RES B;  1LTA C;  2WTY A;  1L2P A;  4U3F E;  1KB9 D;  2O01 H;  1NAY A;  4H13 C;  1JY3 N;  2W83 C;  1LT9 A;  5APV A;  2M3B A;  1BSN A;  1RQU A;  3D71 A;  1BE3 E;  1DD3 A;  3ITK A;  3GF3 A;  3VTP C;  2XDJ A;  2W6A A;  3A7O A;  4EIJ A;  1NTM G;  1P84 I;  3G4S P;  2WSE H;  2M8R A;  1L0L E;  3E1R A;  1W5C E;  1JM0 A;  3FXD A;  2JKV A;  1JY3 O;  2Y9Y A;  1EZV E;  4L73 A;  3RGU A;  2RN0 A;  3TGU J;  1SQP G;  3H6P A;  5AVY B;  3M0D C;  5E79 H;  2N1T B;  3RL0 D;  2KI7 B;  2H8P D;  1WT6 A;  2P10 A;  1OVU A;  3H1K J;  1RF1 B;  3PTZ A;  2KNC A;  1N7S B;  2HFE D;  1YQ3 C;  5KLV E;  1NTM D;  2BCC E;  3PRJ A;  3AE4 C;  1GDT A;  3U1C A;  2R3C A;  1AVO A;  2XV5 A;  5CBN A;  3GHG A;  3L70 J;  1JTH A;  3GMA A;  1SQV G;  3AEA C;  3CWB G;  1SP4 A;  3V6I A;  1SFC C;  4AQR D;  4GOE A;  5CCH D;  2OYH B;  4NPE A;  1SQP D;  3MUD A;  1P84 D;  1J1D B;  1SQB G;  1NVO A;  1H8A A;  2WSC H;  2XKM A;  3L75 G;  3IF4 A;  1NTK G;  1LTJ C;  3HRN A;  5APT A;  1K05 A;  3A2A A;  4GOF A;  4PJ0 E;  3M9Q A;  2YKP A;  1CI6 B;  2BEZ F;  1M7L A;  4C7N A;  1BGY G;  1M90 Q;  3H1H J;  1EQ7 A;  1FOS E;  2C0W A;  1JY2 P;  1N7L A;  3L72 J;  5CJ4 A;  3KYQ A;  1SS1 A;  3CWB D;  4PV1 B;  2KLV A;  2H7H A;  2A06 E;  5K5G B;  1LTJ A;  1PGQ A;  5KTB A;  5TIS H;  2YXR B;  1S3J A;  1X22 A;  2WT7 A;  1A02 F;  4ASV A;  3L75 D;  1IK9 A;  1NTK D;  1EDI A;  1L0N E;  2KSJ A;  4PD4 I;  2PRR A;  3L74 E;  2JDI H;  3USS A;  4IOI H;  3W67 A;  2E75 C;  4K3A A;  3CX5 I;  2K37 A;  3B5N C;  2Q9I A;  2FYU G;  1KIL C;  1H0T B;  2B87 A;  1BGY D;  3KZI H;  2QJP C;  1AV1 A;  1PPJ G;  5CCG C;  3T97 A;  4D6T G;  4RJT A;  2WPR A;  4W7Z A;  4TT3 H;  1MFZ A;  1SQQ E;  2CK3 H;  1IFD A;  5E79 E;  4W7Y A;  1PP9 J;  1VPC A;  3H1J E;  5KLI C;  2JP3 A;  4UB8 H;  1KIL A;  1ZRT E;  4OGQ B;  1NTZ G;  1KC8 Q;  1GL2 B;  1K8A Q;  1T8Z A;  2N1T D;  2GUS A;  3CL3 D;  5AW9 B;  2WMM A;  3WUT A;  3VYI A;  1ZR4 A;  1PPJ D;  2WQY C;  1X8Y A;  1LT9 B;  4PD4 D;  4EYY Q;  1YHQ P;  3BVH A;  1H88 A;  1LWU C;  3CX5 D;  2AEM A;  3HD7 B;  4Y99 C;  3F5H A;  3IFM A;  1ZME C;  2FYZ A;  4H0L B;  4EDF A;  2KSE A;  1VQP P;  3A0B E;  4Z1M H;  2V4H A;  1LTB C;  2V7Q H;  1GU5 A;  3BCC G;  2Q1K A;  1NTM K;  1UIX A;  1NTZ D;  3CMA P;  1VQ8 P;  5KJ7 C;  2O1J A;  1NU1 J;  4N78 E;  1HVV A;  2NPS B;  2PFX A;  1DEE G;  1DIP A;  2KOG A;  1BCC D;  1SQP K;  2KNC B;  3QH9 A;  3CXH I;  2OYI A;  2G8Y A;  3MHV A;  3CC4 P;  1M8O B;  4H44 C;  2Q5U A;  2JWA A;  1SVF A;  3GHG B;  1YI2 P;  3KDP B;  4WBA A;  2G3A A;  1JTH B;  3CI9 A;  3FGA D;  3AE2 C;  1BDC A;  1IFN A;  2R5B A;  1DEB A;  2L5G B;  5AVZ B;  2IX7 C;  3KZI E;  3L37 A;  1T3J A;  1FAV A;  2H89 C;  2WSF J;  1FZG A;  1BCC E;  3H1K G;  1SQB K;  3H1L J;  1GK4 A;  1NTK K;  4C7N B;  1LTT C;  3NFQ A;  3B4S A;  3H32 A;  3OW2 O;  1SQV J;  2FFD A;  3JCU H;  3L70 G;  4XE5 B;  2W6B A;  1YJ9 P;  1NKZ B;  1LNQ A;  1R5S A;  3OAK A;  1IZN B;  4C7R A;  3CXH D;  1SQB J;  3TGU D;  3L71 J;  5AW5 B;  2ZT9 B;  3MD0 A;  3I5C A;  2WT7 B;  1OFC X;  1NWQ A;  1M56 D;  2M5A A;  4OGQ D;  2E74 D;  1GL2 D;  1NKN A;  2P58 A;  3H1K D;  2KP8 A;  3C8V A;  5APX A;  2ZYD A;  4IFF A;  3WUU A;  2YKO A;  4JYB A;  3L73 J;  1PIX A;  2UWJ E;  1KD1 Q;  3L70 D;  3T97 B;  3M0A A;  2B89 A;  3L72 G;  2FYU K;  2WPQ A;  4H0L D;  3V5B A;  4HH2 A;  2WZ7 A;  1AFO A;  2HLO A;  3TGU E;  2P2U A;  2HYN A;  3RL0 B;  1VF5 B;  4H13 D;  2KB7 P;  2FYU J;  3P8C D;  2P1J A;  5AW7 B;  2GM4 A;  2HOD A;  1GW3 A;  2VRS A;  2D2C B;  1KB9 H;  1S5L X;  3H1H D;  1NTZ K;  2E76 D;  4D6T J;  1W2E A;  3BAT A;  1KFN A;  2AEF A;  5EFW B;  2JO1 A;  3CME P;  1EDL A;  3L72 D;  1Y47 A;  2IBZ I;  1M1K Q;  1QL2 A;  1D7M A;  2Q7C A;  3VMZ A;  2HR3 A;  1SQX J;  2NRG A;  1AA0 A;  1PP9 G;  5APS A;  1OW8 A;  1VQL P;  3AE1 C;  1EZV I;  3D6Y A;  3IAO A;  1L4A C;  2IBZ G;  1NHL A;  3V2Q A;  3MGN A;  5AVW B;  3JCU E;  4WB4 A;  3HUS C;  1EZV G;  1RY3 A;  1CW5 A;  3A3Y B;  3CCU P;  2OYI B;  1FE6 A; 
#chains in the Genus database with same CATH homology
 1L0L G;  3L74 G;  1NTZ G;  4D6T G;  3TGU G;  1SQV G;  3CWB G;  3H1I G;  1BE3 G;  2A06 G;  1KB9 H;  4PD4 H;  1PP9 G;  3H1H G;  1P84 H;  3CXH H;  1EZV G;  1KYO H;  5KLV G;  1SQQ G;  2BCC G;  2FYU G;  1NTM G;  1SQP G;  2IBZ G;  1SQB G;  3CX5 H;  3L70 G;  1BGY G;  3BCC G;  3L72 G;  1BCC G;  1PPJ G;  3H1L G;  3L75 G;  3H1K G;  3L71 G;  1SQX G;  3L73 G;  4U3F G;  1L0N G;  3H1J G;  1NTK G;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...