2M5AB

Protein a binding by an engineered affibody molecule
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
58
structure length
58
Chain Sequence
VDNKFNKETQEASWEIFTLPNLNGRQVAAFISSLLDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
publication title High-affinity binding to staphylococcal protein A by an engineered dimeric Affibody molecule.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 15
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2m5aB00
2HR3A 2B89A 2KS1B 2I8DA 1ZW0A 5CBOA 4WWIA 1Q2NA 5CBNA 5DJTB 1MFTA 4IOIH 4NPDA 1H0TA 4MN4C 2K3RA 1LP1A 3ZDMA 2M0BA 5C39A 1LT1A 1EDIA 4ZMDA 3PH0A 2M5AA 2JWDA 4ZNCA 4CPGA 2KI7B 2UWJE 2KZJA 2WMMA 2Q1KA 4ASWA 2B87B 2P58A 4JBZA 4BXLA 1Y47A 4GOFA 1SS1A 1BDDA 1FC2C 3FXDA 2LXCB 3QWOC 4HJGH 3S1KA 1NVOA 2B88A 1U7JA 1EDKA 1EDJA 2RKLA 1S3JA 2KIKA 5K5GB 1BDCA 4HB1A 1ZXGA 2LXBA 2KZIA 4KJMA 1H0TB 1OVVA 4K35A 4NPFX 4EYYQ 1X0TA 1OVUA 1U7MA 1JMBA 2LR2A 2R44A 2QVAA 3FXEA 1JM0A 3MHVA 2OTKE 4GOEA 4NPEA 2SPZA 4HKZH 3MZWB 1LP1B 2ZAEB 4ASVA 5DJUB 2B87A 1EC5A 4K3AA 5EFWB 2M5AB 2QRXA 1EDLA 1DEEG 1OVRA 3RGUA 4GODA 2KUBA
chains in the Genus database with same CATH superfamily
1Z56A 2B89A 1OFCX 1A02F 2OYIC 1R8EA 3G4SP 2IPPA 3TNUB 3SFEC 5CCHD 1USDA 1KILE 5KAFE 3RK3D 1OW7A 2KSEA 5AVQB 1FDOA 3L70D 2E74C 1EZVG 1K04A 1EZVI 1IO4A 2E5TA 3GLMA 4YXWH 4WB4A 2W83C 2ZXEB 4RO0A 3LIEA 1S9KE 2FFDC 3QWOC 4LGDE 2FYUD 1L4AB 1VDFA 1S3JA 3GMAA 2KB7P 1BE3D 4JYBA 1PGJA 1X9VA 3CXHI 1VQKP 1H0TB 4K35A 3OA7A 3AE2C 2K9JB 5AW9B 3Q1MA 1M1KQ 3C1LA 1SQPD 1X22A 5AW4B 2HG5D 1GW3A 3L70E 1NTMK 2Z5HA 3L71D 2XDJA 2Y0CA 2KLVA 3KHUA 1G2CA 2WSEJ 3II6A 1YQ3C 1EQ7A 2FYUE 5CMZA 1IZNB 4K3AA 3H6PA 3TSIA 1E79H 3H1HD 4U3FJ 2FYNB 2OYHC 2R5DA 2XV5A 4WWIA 2OQQA 2AEJA 1SQPE 3MP7B 1MFTA 1KB9I 5KLIB 3F5HA 2M0BA 3L70G 1CI6B 1R5LA 1BSHA 2HODB 2KZJA 4HYTB 1SQBD 3AE3C 2WWWA 2Q1KA 2ZYAA 4C7RA 3VYIA 2ZVNB 3N7NA 2CPSA 2QSIA 1SFCD 3B5NC 3H1HE 4W7ZA 2FYUG 2OTLP 3NFQA 1PIXA 1BE3G 4I7ZB 3TNUA 3I5CA 1M1JA 1VF5D 3GW6A 1KYOH 4BWNA 1SQPG 3ABVC 1P84E 1LTJC 1L0LD 3L71G 1EXIA 1PP9E 5APVA 1X0TA 2YIUC 4Y99B 1SQBE 4UB8H 4L74A 4ZKPA 4H0LC 4EDFA 3OAKA 1FZCC 4GOEA 3VMAA 1RE4A 4C7NA 2FBWC 2Q6QA 1FS0E 2WT7B 1LWUC 3HE5A 3HRNA 2FKWB 1SQVK 2B87A 4GT1A 3WU2E 4JYCA 3M0AA 2BEQD 2WPQA 3NTNA 2JO1A 1SQVJ 2KS1B 1ZW0A 1L0LE 2CPBA 1LT9B 1RF1C 1DIPA 1SQXK 2PFXA 1NTZD 3RBZA 1Q7YQ 3CPWO 1CSBA 5H2FE 2QJKB 2IZ1A 3V4WA 2O3JA 3H1KG 2WSSH 2J59M 1SQQD 2WMMA 1N73B 1RE3A 2FY8A 1NU1K 3GG2A 1GL2A 2O01J 4IL6H 4I6MC 1VPCA 1VQNP 3CWBE 1KQGB 5AW1B 3RK3B 1A02J 2O1KA 3A0HH 3H1ID 3CXHH 1W2EA 3H1HJ 1SQQE 3HD7D 4LC1A 1IFDA 2GUSA 3P8CD 3MD0A 3PP5A 1VQ9P 1PP9J 1NTZG 2BCCD 3H1JJ 2D2CB 1SQBJ 2KP8A 3PLNA 1OIPA 3H1IE 1PZQA 2YO2A 4ZKUA 1LJ2A 4Z1MH 1JEKA 3CLQA 1QX8A 3LW5H 2WPSA 1WMKA 1PGOA 2NPSD 1SP4A 1SVFA 1NH4A 4ZMDA 3CL3D 4BRYB 4CPGA 4WBAA 4RJTA 1L0LJ 4PD4I 1LT9A 3BATA 1N7SA 4JBZA 4KHXA 3E1RA 2E43A 5GTIH 2R3CA 1L4AD 2OTJP 1L0NK 3L37A 3D6YA 5KLVK 1KILA 3G6EP 2W6AA 1OWAA 2KNCB 5AW6B 4WY4B 5AVUB 1Y9BA 1J1DB 1NAFA 1GMJA 1ZRTD 2YO3A 1DD3A 2ZYDA 5B66H 5CJ0A 3Q5PA 1PPJG 1N73A 1BCCE 2POHA 1NYHA 3HUSA 2ZT9C 1SFCB 3GHGB 4H0LD 3CWBJ 4GDOA 2L91A 1FOSF 1KYOD 5CCHA 1HJBA 1NKNA 2N1TD 3BCCD 2BCCG 4ASVA 1IFJA 4H13B 1JNMA 4L75A 1SQQJ 2JP3A 3H1LE 3L72D 2AXTH 1N7LA 2P67A 3WUVA 3L74D 3KZIH 3CCQP 2IFNA 2HFED 2KOGA 1VQ5P 2JJLA 2YNYA 3A3YB 2V4HA 1AFOA 1KYOE 3H32B 4QMAA 3FWNA 3BCCE 3JSVC 1NKZB 2PP6A 1XTGB 3U1CA 4M3LA 3H1IJ 1FZBA 1PGPA 4D6TE 2C0XA 3AEEC 4UB8E 1BDDA 3RK2C 5CCGD 3S1KA 2OYIB 3TYYA 4TT3H 1NTMD 1GTWA 2WPVB 2IBZG 2IBZI 1AJYA 3BVHA 2DW3A 1EZVD 3G3ZA 1JCCA 2WITA 2E74B 4IFMA 3SFDC 3L73D 1Q82Q 1LTBC 3UIAA 1RF0A 4DOJA 1FZFA 2A06D 2FFDB 2IZ0A 3L72G 3CXHD 5KKZC 3M0DA 2Y9ZA 1NTKK 1BCCJ 3L74G 4GODA 2PRRA 3IR9A 1FOSE 3M9HA 1SFCA 1EZVE 2XNXA 1M8OB 2JDIH 2H88C 4NPDA 3L73E 3MUDA 4IL6E 1YQ4C 1DD4A 3T97B 1VQLP 4EI2A 2I1KA 4KT0J 3A0HE 3H1LJ 5AVZB 1IJDB 2N9YB 3CXHE 2HPCA 1WT6A 3PJSK 2RMZA 4JQ0D 4PD4H 3CCJP 1L2PA 2R5BA 2OYHB 3QH9A 3CI9A 1MFZA 1NTMG 5BU5A 5AW0B 3AEGC 2NPSB 3KXDA 3H32A 3BCCJ 2JR8A 5K5GB 1WRGA 4GKGA 3BRTB 3MGNA 1ZOYC 3L73G 2QEXP 2IFMA 5TISH 1H89A 4D6TJ 1OW8A 1T8ZA 3L75D 4AYCA 2A06G 1N2DC 3B5NB 1YHQP 2AEMA 4XA4A 1ZP0C 3RK3E 3KDPB 3AE4C 3HE4B 1S5LH 1VQPP 2QIWA 2D2CD 1LTGC 3E7KA 1JY3P 1TU3F 3O6QA 3WMM0 1EDLA 3EFGA 1QVGO 3V2QA 1KQSO 2KSJA 1MV8A 4C46A 1JB0J 2YIUB 5GTIE 5CBNA 1MZ9A 3L75E 4H0LB 1RQUA 1FZCB 3FGAD 1PL5A 3KPEA 1BE3E 2N1TB 2JWDA 1JTHB 1NU1D 1LWUB 2GUVA 2P10A 1G1JA 1FZAA 3RL0C 2WZ7A 5B66E 3L71E 2JWAA 3VMXA 3P32A 5TJHA 3HD7A 3GF3A 4WY4D 1RF1B 2E76C 1JCDA 1S5LX 2QM7A 5AVVB 2O01N 2B88A 1EDKA 1M1JC 1YYCA 1YI2P 1QL1A 4AUWA 1KQFB 4AQRD 2P7JA 3H1KD 1HBWA 2H7HA 3KYQA 3L75G 3D70A 1NU1E 1M57D 1G1IA 2YKQA 2WQYC 2LR2A 2AXTE 3AE8C 3PRJA 4H13D 1SQXG 2SPZA 2NPSA 3KZIE 5BVZA 3JCUH 2E5YA 1KD1Q 3HTKB 1GU5A 3Q5RA 1FZGA 3H1KE 1BGYD 2M3BA 3B71A 5CBOA 1T2KC 1GK4A 4TLFA 1L4AA 2WSCH 3LW5J 2ZVOB 5DJTB 1NU1G 4R4LA 2KYVA 1H0TA 3S4RA 4JF7A 1NHLA 2K9JA 2Y0EA 3WUTA 3L70J 3CCEP 2UWJE 1L0ND 5KLVD 1FBMA 2FYNC 3N4XA 1Y8AA 2V7QH 3V2RA 2A45I 4EOTA 1RE3C 1BGYE 1PV3A 1FC2C 3AEAC 1QVFO 2FYUJ 4N6JA 1QEXA 2W6BA 1GL2C 2Q3EA 1FZCA 1BE3J 1J1EB 3VMZA 2N1TA 2KIKA 5E79H 1NO4A 4IFDK 1JTHA 1YBKA 1BDCA 2E74D 3V2PA 1P84I 1VQ4P 2KZIA 1OVVA 2P2UA 1T6AA 1SQPJ 4LLHA 3L71J 4PD4D 1NOHA 1L0NE 2E75C 5KLVE 2G8YA 1HH0A 1NTZE 3W68A 1ZMEC 3EFFK 1CI6A 1GD2E 1K9MQ 2MKVA 1N86A 2Y0DA 2HODA 1M56D 1URQC 2QM8A 4XE5B 2E42A 2WSFH 3MIWA 3NMDA 5DJUB 1BGYG 5AW3B 2Y9YA 3RGUA 1PFIA 1PPJD 1LTSC 4Y99C 4PD4E 3V4QA 3G71P 3D6ZA 5CCGA 2ZT9B 1SQBK 1R5SA 3TK1A 1UIXA 1L0NG 5KLVG 1X8YA 4OGQC 3A5TA 1HTLC 1T3JA 1YJWP 1JUNA 3H1KJ 2GM4A 4IL6X 2N9BA 4BXLA 1ZR4A 4H44C 5TISE 1LT9C 1N7SC 4I1LA 1FU1A 4N78D 3VP8A 5B5EH 2PAJA 4PV1C 1SS1A 2WT7A 1PPJE 1AQTA 2K37A 4HJGH 3P8CE 1L0LK 1KB9H 1KILC 1NVOA 1U7JA 2W6JH 1EDJA 2NZ2A 2Q7CA 1GU4A 1S5LE 2KS1A 5AW7B 4OVNF 1ZV8A 1JY2O 2BCCE 5KJ7A 3S9OA 3B5ND 2H43A 3GF7A 1N73C 3B8EB 3CMAP 2R44A 1JOCA 2KLUA 3CD6P 3HUSC 2K88A 1HWTC 3RK2B 1NTKD 1OW6A 5CCHC 1LP1B 1IFPA 3CC4P 3RK3C 3CCLP 2M5AB 1USEA 3TF5A 2IBZD 3U1AA 2KUBA 3R2PA 2HR3A 2ZFCA 1NGMB 2ZYGA 1NTZJ 3OJAB 1M7LA 3P7KA 2JEEA 4A7PA 3PTZA 4IOIH 1SQQK 1LNQA 3ZDMA 2O01H 1LT1A 1EDIA 1GDTA 3TGUG 4ZNCA 3W67A 1ZRTE 2FXPA 5APTA 1RH5B 5KKZB 3SWKA 2P58A 5APQA 2LKMA 2HYNA 1Y47A 2IBZE 2G3AA 1KV4A 3USSA 2ZXXA 2WPRA 1JY3O 2H8PD 2R3SA 1GL2D 3AECC 4W7YA 1MKMA 1NJIQ 3CMEP 1IFIA 3CC2P 4NPFX 3JCUE 1VQMP 3ITKA 3L72E 1ZR2A 2QVAA 1NTKG 3IN6A 3L74E 2ITAA 1W2BO 2K1AA 2IX7C 4BRYA 3G9RA 1RF0C 2CK3H 2IDBA 3FX0A 4B86A 1URQD 1NAYA 1K8AQ 1AV1A 1XTCC 2YMYA 5EFWB 2BCCJ 2M8RA 3M0DC 1YJ9P 2M3EA 2AEFA 2B9BA 1YIJP 1Q2NA 1SFCC 2KNCA 4WY4A 1QGKB 2IYPA 1U57A 1J2JB 2K3RA 1LP1A 1HJ0A 3MUDC 2RN0A 2ZJSE 1VF5C 2BASA 1KZUB 2M5AA 1NTME 5E79E 4L76A 1G2CB 3SSUA 3JC22 3GHGA 1X79B 1BSNA 3FXDA 3BRVB 1RQVA 2A06E 1W5CE 2RKLA 1N8RQ 5APXA 4KJMA 1DEBA 3BASA 4HH2A 3SWFA 1H8AA 3RL0B 3VOPA 1JM0A 3V6IA 1KB9D 1S9KD 5BU8B 4JPZB 4HKZH 3MZWB 2E76B 3I56P 1SLQA 5AVTB 1EC5A 2J5UA 4U3FG 3OW2O 1M1JB 1DEEG 2Z5IA 1HGVA 1HUCA 3L72J 1FZEA 1M90Q 2NRGA 2FXMA 1KQLA 2I8DA 3CX5I 5KAIH 2ZT9D 3IAOA 3L74J 1SQVD 2OYIA 2WSCJ 5B5EE 1KB9E 4PJ0H 1SQXD 4YPCA 2WVRA 5AVSB 3A0BH 4C7NB 1IC2A 4IFFA 1LTJB 2BEZF 3HE5B 5AW5B 3VN0A 2B87B 2V7QJ 4YTPC 3PHLA 4N3YB 1LTTC 2YMKA 5AVRB 3RL0g 2FFDA 3HD7C 1SQVE 2W8ZA 2W27A 2QJYC 2Q9IA 1FE6A 1NTMJ 1S4XA 2XKMA 2QJPC 1SQXE 1MUUA 4WVZA 2XZRA 1VQ8P 2IYOA 3H25A 1QL2A 3L73J 3P8MC 3RK2D 5AW2B 3V5BA 3T97A 3LIDA 1GK6A 1GL2B 2NPSC 2WSFJ 2ZAEB 3AEDC 1P84D 1SQVG 1VQ7P 1S1CX 1S72P 1PP9D 2OYHA 4RESB 3R4YA 3H1JD 4XFJA 2WTYA 2YKOA 2E75B 1RE4C 2OARA 1L4AC 3CCMP 3KQGA 4MN4C 5C39A 5GTHH 5CJ4A 1URQB 2R32A 4ASWA 4O9BA 3B5NA 2YKPA 1QLED 5APYA 4GOFA 2H89C 3H1JE 3FWLA 3HE4A 1OXZA 2N1TC 1LTJA 4EIJA 5AVYB 3H1HG 2HLOA 2A45G 2FYUK 3B4SA 4EYYQ 4OGQB 2XNDH 3L75J 3Q2YA 1OVUA 1U7MA 2QE7H 3O8ZA 1KMIZ 2MJZA 2KK7A 3F89A 4H44B 1VL2A 2AXCA 1IK7A 1N7SB 4NPEA 5KLIC 1KC8Q 5APWA 1SQPK 4PV1B 4UB6H 4L73A 3CWBD 1AA0A 1LWUA 2WSEH 1ZN5A 1OMIA 1Q86Q 1KILB 2GA1A 1SQXJ 1Q81Q 1PP9G 3Q3DA 3H1JG 3WUUA 1SQBG 2QRXA 1D7MA 5AW8B 4DJGA 1FDMA 1RF1A 4I7ZC 1LGHB 1OZHA 3CX5H 2YXRB 1JY2N 1GW4A 1RY3A 5CCGC 3HUSB 1NU1J 2C9LY 1L0LG 3IF4A 2W90A 5M1BA 3AEFC 1EXJA 3M9BA 3Q5SA 3M91A 1VQ6P 3AE5C 3VP9A 2LXCB 4RKUJ 5KAFH 1KTMA 1KORA 3HTKA 3L4FA 1URQA 1ZXGA 1CZQA 2LXBA 2QG4A 3AE6C 3TGUD 3CCSP 3RL0D 1KFNA 3C8VA 4YXDC 4DCKA 5KJ7C 1NWQA 1DH3A 3CCRP 1H88A 1PGQA 3CWBG 5KAIE 2E76D 1UIIA 1K73Q 3U59A 2QJKC 2J58A 3A7OA 1IFMA 2OGUA 3M9QA 1FDIA 1J1EC 2C9NY 4PJ0E 1SQQG 3V2NA 3A0BE 1JY3N 2FXOA 1BGYJ 4R4MA 5APSA 2XU6A 1FJKA 1BCCD 3TGUE 1LTIC 4N78E 1YITP 4DT0A 3C9IA 4Y28J 1FJPA 1JO5A 1JMMA 1NTZK 3IFMA 4W80A 1VQOP 3D71A 2RH0A 1L0NJ 3H1IG 5KLVJ 2KI7B 5APUA 2Q3IA 3AE9C 3VTPC 1T2KD 1K05A 4GIFA 3H1LD 3K5BA 1GZLA 1CW5A 2I1JA 1NTKE 3CCUP 3CC7P 1YTZI 1FAVA 5L8RJ 2D2CC 3SWYA 3I55P 1VF5B 5KTBA 3E1IA 1LTAC 2A45H 1IFNA 4D6TD 2L5GB 3EWKA 5CHXA 2KXPB 2C0WA 2HPCB 3MHVA 2OTKE 3AE7C 4U7JA 2QA4P 1AQ5A 5GTHE 1BCCG 1P84H 3EQ2A 1OVRA 2O1JA 2E75D 2PGDA 3TDKA 1YJNP 2K9YA 1S2EA 2YXQB 3L35A 1RHZB 2OYOA 1T3UA 4WY4C 4OH8B 1J1DC 2VRSA 3PH0A 3WU2H 3H1LG 1E5WA 4U3FD 1DX7A 3TGUJ 3NXSA 3MTUE 3VMYA 3CX5D 3GHGC 3O6QB 1HF9A 1KFMA 1YTZT 2Q5UA 5AVXB 5H2FH 1KN7A 1KYOI 3BCCG 5AVWB 4UB6E 3L36A 4H13C 4OGQD 1HVVA 2FYZA 4HB1A 3A2AA 4D6TG 3AE1C 4H44D 1N7SD 4OWFA 3AEBC 4U3FE 1OX3A 4PV1D 1IK9A 1AVYA 5KJ7D 4DZOA 1Q90D 1JMBA 4I2LC 1ZLLA 3FXEA 1KILD 1HGZA 3CX5E 2P1JA 3RBXA 1NTKJ 1JY2P 3HD7B 3CCVP 1AVOA 2QJYB 2JKVA 3M06A 2Z4EA 2QJPB
chains in the Genus database with same CATH topology
2HR3A 2B89A 2KS1B 2I8DA 1ZW0A 5CBOA 4WWIA 1Q2NA 5CBNA 5DJTB 1MFTA 4IOIH 4NPDA 1H0TA 4MN4C 2K3RA 1LP1A 3ZDMA 2M0BA 5C39A 1LT1A 1EDIA 4ZMDA 3PH0A 2M5AA 2JWDA 4ZNCA 4CPGA 2KI7B 2UWJE 2KZJA 2WMMA 2Q1KA 4ASWA 2B87B 2P58A 4JBZA 4BXLA 1Y47A 4GOFA 1SS1A 1BDDA 1FC2C 3FXDA 2LXCB 3QWOC 4HJGH 3S1KA 1NVOA 2B88A 1U7JA 1EDKA 1EDJA 2RKLA 1S3JA 2KIKA 5K5GB 1BDCA 4HB1A 1ZXGA 2LXBA 2KZIA 4KJMA 1H0TB 1OVVA 4K35A 4NPFX 4EYYQ 1X0TA 1OVUA 1U7MA 1JMBA 2LR2A 2R44A 2QVAA 3FXEA 1JM0A 3MHVA 2OTKE 4GOEA 4NPEA 2SPZA 4HKZH 3MZWB 1LP1B 2ZAEB 4ASVA 5DJUB 2B87A 1EC5A 4K3AA 5EFWB 2M5AB 2QRXA 1EDLA 1DEEG 1OVRA 3RGUA 4GODA 2KUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR3 A;  2B89 A;  2KS1 B;  2I8D A;  1ZW0 A;  5CBO A;  4WWI A;  1Q2N A;  5CBN A;  5DJT B;  1MFT A;  4IOI H;  4NPD A;  1H0T A;  4MN4 C;  2K3R A;  1LP1 A;  3ZDM A;  2M0B A;  5C39 A;  1LT1 A;  1EDI A;  4ZMD A;  3PH0 A;  2M5A A;  2JWD A;  4ZNC A;  4CPG A;  2KI7 B;  2UWJ E;  2KZJ A;  2WMM A;  2Q1K A;  4ASW A;  2B87 B;  2P58 A;  4JBZ A;  4BXL A;  1Y47 A;  4GOF A;  1SS1 A;  1BDD A;  1FC2 C;  3FXD A;  2LXC B;  3QWO C;  4HJG H;  3S1K A;  1NVO A;  2B88 A;  1U7J A;  1EDK A;  1EDJ A;  2RKL A;  1S3J A;  2KIK A;  5K5G B;  1BDC A;  4HB1 A;  1ZXG A;  2LXB A;  2KZI A;  4KJM A;  1H0T B;  1OVV A;  4K35 A;  4NPF X;  4EYY Q;  1X0T A;  1OVU A;  1U7M A;  1JMB A;  2LR2 A;  2R44 A;  2QVA A;  3FXE A;  1JM0 A;  3MHV A;  2OTK E;  4GOE A;  4NPE A;  2SPZ A;  4HKZ H;  3MZW B;  1LP1 B;  2ZAE B;  4ASV A;  5DJU B;  2B87 A;  1EC5 A;  4K3A A;  5EFW B;  2M5A B;  2QRX A;  1EDL A;  1DEE G;  1OVR A;  3RGU A;  4GOD A;  2KUB A; 
#chains in the Genus database with same CATH topology
 1Z56 A;  2B89 A;  1OFC X;  1A02 F;  2OYI C;  1R8E A;  3G4S P;  2IPP A;  3TNU B;  3SFE C;  5CCH D;  1USD A;  1KIL E;  5KAF E;  3RK3 D;  1OW7 A;  2KSE A;  5AVQ B;  1FDO A;  3L70 D;  2E74 C;  1EZV G;  1K04 A;  1EZV I;  1IO4 A;  2E5T A;  3GLM A;  4YXW H;  4WB4 A;  2W83 C;  2ZXE B;  4RO0 A;  3LIE A;  1S9K E;  2FFD C;  3QWO C;  4LGD E;  2FYU D;  1L4A B;  1VDF A;  1S3J A;  3GMA A;  2KB7 P;  1BE3 D;  4JYB A;  1PGJ A;  1X9V A;  3CXH I;  1VQK P;  1H0T B;  4K35 A;  3OA7 A;  3AE2 C;  2K9J B;  5AW9 B;  3Q1M A;  1M1K Q;  3C1L A;  1SQP D;  1X22 A;  5AW4 B;  2HG5 D;  1GW3 A;  3L70 E;  1NTM K;  2Z5H A;  3L71 D;  2XDJ A;  2Y0C A;  2KLV A;  3KHU A;  1G2C A;  2WSE J;  3II6 A;  1YQ3 C;  1EQ7 A;  2FYU E;  5CMZ A;  1IZN B;  4K3A A;  3H6P A;  3TSI A;  1E79 H;  3H1H D;  4U3F J;  2FYN B;  2OYH C;  2R5D A;  2XV5 A;  4WWI A;  2OQQ A;  2AEJ A;  1SQP E;  3MP7 B;  1MFT A;  1KB9 I;  5KLI B;  3F5H A;  2M0B A;  3L70 G;  1CI6 B;  1R5L A;  1BSH A;  2HOD B;  2KZJ A;  4HYT B;  1SQB D;  3AE3 C;  2WWW A;  2Q1K A;  2ZYA A;  4C7R A;  3VYI A;  2ZVN B;  3N7N A;  2CPS A;  2QSI A;  1SFC D;  3B5N C;  3H1H E;  4W7Z A;  2FYU G;  2OTL P;  3NFQ A;  1PIX A;  1BE3 G;  4I7Z B;  3TNU A;  3I5C A;  1M1J A;  1VF5 D;  3GW6 A;  1KYO H;  4BWN A;  1SQP G;  3ABV C;  1P84 E;  1LTJ C;  1L0L D;  3L71 G;  1EXI A;  1PP9 E;  5APV A;  1X0T A;  2YIU C;  4Y99 B;  1SQB E;  4UB8 H;  4L74 A;  4ZKP A;  4H0L C;  4EDF A;  3OAK A;  1FZC C;  4GOE A;  3VMA A;  1RE4 A;  4C7N A;  2FBW C;  2Q6Q A;  1FS0 E;  2WT7 B;  1LWU C;  3HE5 A;  3HRN A;  2FKW B;  1SQV K;  2B87 A;  4GT1 A;  3WU2 E;  4JYC A;  3M0A A;  2BEQ D;  2WPQ A;  3NTN A;  2JO1 A;  1SQV J;  2KS1 B;  1ZW0 A;  1L0L E;  2CPB A;  1LT9 B;  1RF1 C;  1DIP A;  1SQX K;  2PFX A;  1NTZ D;  3RBZ A;  1Q7Y Q;  3CPW O;  1CSB A;  5H2F E;  2QJK B;  2IZ1 A;  3V4W A;  2O3J A;  3H1K G;  2WSS H;  2J59 M;  1SQQ D;  2WMM A;  1N73 B;  1RE3 A;  2FY8 A;  1NU1 K;  3GG2 A;  1GL2 A;  2O01 J;  4IL6 H;  4I6M C;  1VPC A;  1VQN P;  3CWB E;  1KQG B;  5AW1 B;  3RK3 B;  1A02 J;  2O1K A;  3A0H H;  3H1I D;  3CXH H;  1W2E A;  3H1H J;  1SQQ E;  3HD7 D;  4LC1 A;  1IFD A;  2GUS A;  3P8C D;  3MD0 A;  3PP5 A;  1VQ9 P;  1PP9 J;  1NTZ G;  2BCC D;  3H1J J;  2D2C B;  1SQB J;  2KP8 A;  3PLN A;  1OIP A;  3H1I E;  1PZQ A;  2YO2 A;  4ZKU A;  1LJ2 A;  4Z1M H;  1JEK A;  3CLQ A;  1QX8 A;  3LW5 H;  2WPS A;  1WMK A;  1PGO A;  2NPS D;  1SP4 A;  1SVF A;  1NH4 A;  4ZMD A;  3CL3 D;  4BRY B;  4CPG A;  4WBA A;  4RJT A;  1L0L J;  4PD4 I;  1LT9 A;  3BAT A;  1N7S A;  4JBZ A;  4KHX A;  3E1R A;  2E43 A;  5GTI H;  2R3C A;  1L4A D;  2OTJ P;  1L0N K;  3L37 A;  3D6Y A;  5KLV K;  1KIL A;  3G6E P;  2W6A A;  1OWA A;  2KNC B;  5AW6 B;  4WY4 B;  5AVU B;  1Y9B A;  1J1D B;  1NAF A;  1GMJ A;  1ZRT D;  2YO3 A;  1DD3 A;  2ZYD A;  5B66 H;  5CJ0 A;  3Q5P A;  1PPJ G;  1N73 A;  1BCC E;  2POH A;  1NYH A;  3HUS A;  2ZT9 C;  1SFC B;  3GHG B;  4H0L D;  3CWB J;  4GDO A;  2L91 A;  1FOS F;  1KYO D;  5CCH A;  1HJB A;  1NKN A;  2N1T D;  3BCC D;  2BCC G;  4ASV A;  1IFJ A;  4H13 B;  1JNM A;  4L75 A;  1SQQ J;  2JP3 A;  3H1L E;  3L72 D;  2AXT H;  1N7L A;  2P67 A;  3WUV A;  3L74 D;  3KZI H;  3CCQ P;  2IFN A;  2HFE D;  2KOG A;  1VQ5 P;  2JJL A;  2YNY A;  3A3Y B;  2V4H A;  1AFO A;  1KYO E;  3H32 B;  4QMA A;  3FWN A;  3BCC E;  3JSV C;  1NKZ B;  2PP6 A;  1XTG B;  3U1C A;  4M3L A;  3H1I J;  1FZB A;  1PGP A;  4D6T E;  2C0X A;  3AEE C;  4UB8 E;  1BDD A;  3RK2 C;  5CCG D;  3S1K A;  2OYI B;  3TYY A;  4TT3 H;  1NTM D;  1GTW A;  2WPV B;  2IBZ G;  2IBZ I;  1AJY A;  3BVH A;  2DW3 A;  1EZV D;  3G3Z A;  1JCC A;  2WIT A;  2E74 B;  4IFM A;  3SFD C;  3L73 D;  1Q82 Q;  1LTB C;  3UIA A;  1RF0 A;  4DOJ A;  1FZF A;  2A06 D;  2FFD B;  2IZ0 A;  3L72 G;  3CXH D;  5KKZ C;  3M0D A;  2Y9Z A;  1NTK K;  1BCC J;  3L74 G;  4GOD A;  2PRR A;  3IR9 A;  1FOS E;  3M9H A;  1SFC A;  1EZV E;  2XNX A;  1M8O B;  2JDI H;  2H88 C;  4NPD A;  3L73 E;  3MUD A;  4IL6 E;  1YQ4 C;  1DD4 A;  3T97 B;  1VQL P;  4EI2 A;  2I1K A;  4KT0 J;  3A0H E;  3H1L J;  5AVZ B;  1IJD B;  2N9Y B;  3CXH E;  2HPC A;  1WT6 A;  3PJS K;  2RMZ A;  4JQ0 D;  4PD4 H;  3CCJ P;  1L2P A;  2R5B A;  2OYH B;  3QH9 A;  3CI9 A;  1MFZ A;  1NTM G;  5BU5 A;  5AW0 B;  3AEG C;  2NPS B;  3KXD A;  3H32 A;  3BCC J;  2JR8 A;  5K5G B;  1WRG A;  4GKG A;  3BRT B;  3MGN A;  1ZOY C;  3L73 G;  2QEX P;  2IFM A;  5TIS H;  1H89 A;  4D6T J;  1OW8 A;  1T8Z A;  3L75 D;  4AYC A;  2A06 G;  1N2D C;  3B5N B;  1YHQ P;  2AEM A;  4XA4 A;  1ZP0 C;  3RK3 E;  3KDP B;  3AE4 C;  3HE4 B;  1S5L H;  1VQP P;  2QIW A;  2D2C D;  1LTG C;  3E7K A;  1JY3 P;  1TU3 F;  3O6Q A;  3WMM 0;  1EDL A;  3EFG A;  1QVG O;  3V2Q A;  1KQS O;  2KSJ A;  1MV8 A;  4C46 A;  1JB0 J;  2YIU B;  5GTI E;  5CBN A;  1MZ9 A;  3L75 E;  4H0L B;  1RQU A;  1FZC B;  3FGA D;  1PL5 A;  3KPE A;  1BE3 E;  2N1T B;  2JWD A;  1JTH B;  1NU1 D;  1LWU B;  2GUV A;  2P10 A;  1G1J A;  1FZA A;  3RL0 C;  2WZ7 A;  5B66 E;  3L71 E;  2JWA A;  3VMX A;  3P32 A;  5TJH A;  3HD7 A;  3GF3 A;  4WY4 D;  1RF1 B;  2E76 C;  1JCD A;  1S5L X;  2QM7 A;  5AVV B;  2O01 N;  2B88 A;  1EDK A;  1M1J C;  1YYC A;  1YI2 P;  1QL1 A;  4AUW A;  1KQF B;  4AQR D;  2P7J A;  3H1K D;  1HBW A;  2H7H A;  3KYQ A;  3L75 G;  3D70 A;  1NU1 E;  1M57 D;  1G1I A;  2YKQ A;  2WQY C;  2LR2 A;  2AXT E;  3AE8 C;  3PRJ A;  4H13 D;  1SQX G;  2SPZ A;  2NPS A;  3KZI E;  5BVZ A;  3JCU H;  2E5Y A;  1KD1 Q;  3HTK B;  1GU5 A;  3Q5R A;  1FZG A;  3H1K E;  1BGY D;  2M3B A;  3B71 A;  5CBO A;  1T2K C;  1GK4 A;  4TLF A;  1L4A A;  2WSC H;  3LW5 J;  2ZVO B;  5DJT B;  1NU1 G;  4R4L A;  2KYV A;  1H0T A;  3S4R A;  4JF7 A;  1NHL A;  2K9J A;  2Y0E A;  3WUT A;  3L70 J;  3CCE P;  2UWJ E;  1L0N D;  5KLV D;  1FBM A;  2FYN C;  3N4X A;  1Y8A A;  2V7Q H;  3V2R A;  2A45 I;  4EOT A;  1RE3 C;  1BGY E;  1PV3 A;  1FC2 C;  3AEA C;  1QVF O;  2FYU J;  4N6J A;  1QEX A;  2W6B A;  1GL2 C;  2Q3E A;  1FZC A;  1BE3 J;  1J1E B;  3VMZ A;  2N1T A;  2KIK A;  5E79 H;  1NO4 A;  4IFD K;  1JTH A;  1YBK A;  1BDC A;  2E74 D;  3V2P A;  1P84 I;  1VQ4 P;  2KZI A;  1OVV A;  2P2U A;  1T6A A;  1SQP J;  4LLH A;  3L71 J;  4PD4 D;  1NOH A;  1L0N E;  2E75 C;  5KLV E;  2G8Y A;  1HH0 A;  1NTZ E;  3W68 A;  1ZME C;  3EFF K;  1CI6 A;  1GD2 E;  1K9M Q;  2MKV A;  1N86 A;  2Y0D A;  2HOD A;  1M56 D;  1URQ C;  2QM8 A;  4XE5 B;  2E42 A;  2WSF H;  3MIW A;  3NMD A;  5DJU B;  1BGY G;  5AW3 B;  2Y9Y A;  3RGU A;  1PFI A;  1PPJ D;  1LTS C;  4Y99 C;  4PD4 E;  3V4Q A;  3G71 P;  3D6Z A;  5CCG A;  2ZT9 B;  1SQB K;  1R5S A;  3TK1 A;  1UIX A;  1L0N G;  5KLV G;  1X8Y A;  4OGQ C;  3A5T A;  1HTL C;  1T3J A;  1YJW P;  1JUN A;  3H1K J;  2GM4 A;  4IL6 X;  2N9B A;  4BXL A;  1ZR4 A;  4H44 C;  5TIS E;  1LT9 C;  1N7S C;  4I1L A;  1FU1 A;  4N78 D;  3VP8 A;  5B5E H;  2PAJ A;  4PV1 C;  1SS1 A;  2WT7 A;  1PPJ E;  1AQT A;  2K37 A;  4HJG H;  3P8C E;  1L0L K;  1KB9 H;  1KIL C;  1NVO A;  1U7J A;  2W6J H;  1EDJ A;  2NZ2 A;  2Q7C A;  1GU4 A;  1S5L E;  2KS1 A;  5AW7 B;  4OVN F;  1ZV8 A;  1JY2 O;  2BCC E;  5KJ7 A;  3S9O A;  3B5N D;  2H43 A;  3GF7 A;  1N73 C;  3B8E B;  3CMA P;  2R44 A;  1JOC A;  2KLU A;  3CD6 P;  3HUS C;  2K88 A;  1HWT C;  3RK2 B;  1NTK D;  1OW6 A;  5CCH C;  1LP1 B;  1IFP A;  3CC4 P;  3RK3 C;  3CCL P;  2M5A B;  1USE A;  3TF5 A;  2IBZ D;  3U1A A;  2KUB A;  3R2P A;  2HR3 A;  2ZFC A;  1NGM B;  2ZYG A;  1NTZ J;  3OJA B;  1M7L A;  3P7K A;  2JEE A;  4A7P A;  3PTZ A;  4IOI H;  1SQQ K;  1LNQ A;  3ZDM A;  2O01 H;  1LT1 A;  1EDI A;  1GDT A;  3TGU G;  4ZNC A;  3W67 A;  1ZRT E;  2FXP A;  5APT A;  1RH5 B;  5KKZ B;  3SWK A;  2P58 A;  5APQ A;  2LKM A;  2HYN A;  1Y47 A;  2IBZ E;  2G3A A;  1KV4 A;  3USS A;  2ZXX A;  2WPR A;  1JY3 O;  2H8P D;  2R3S A;  1GL2 D;  3AEC C;  4W7Y A;  1MKM A;  1NJI Q;  3CME P;  1IFI A;  3CC2 P;  4NPF X;  3JCU E;  1VQM P;  3ITK A;  3L72 E;  1ZR2 A;  2QVA A;  1NTK G;  3IN6 A;  3L74 E;  2ITA A;  1W2B O;  2K1A A;  2IX7 C;  4BRY A;  3G9R A;  1RF0 C;  2CK3 H;  2IDB A;  3FX0 A;  4B86 A;  1URQ D;  1NAY A;  1K8A Q;  1AV1 A;  1XTC C;  2YMY A;  5EFW B;  2BCC J;  2M8R A;  3M0D C;  1YJ9 P;  2M3E A;  2AEF A;  2B9B A;  1YIJ P;  1Q2N A;  1SFC C;  2KNC A;  4WY4 A;  1QGK B;  2IYP A;  1U57 A;  1J2J B;  2K3R A;  1LP1 A;  1HJ0 A;  3MUD C;  2RN0 A;  2ZJS E;  1VF5 C;  2BAS A;  1KZU B;  2M5A A;  1NTM E;  5E79 E;  4L76 A;  1G2C B;  3SSU A;  3JC2 2;  3GHG A;  1X79 B;  1BSN A;  3FXD A;  3BRV B;  1RQV A;  2A06 E;  1W5C E;  2RKL A;  1N8R Q;  5APX A;  4KJM A;  1DEB A;  3BAS A;  4HH2 A;  3SWF A;  1H8A A;  3RL0 B;  3VOP A;  1JM0 A;  3V6I A;  1KB9 D;  1S9K D;  5BU8 B;  4JPZ B;  4HKZ H;  3MZW B;  2E76 B;  3I56 P;  1SLQ A;  5AVT B;  1EC5 A;  2J5U A;  4U3F G;  3OW2 O;  1M1J B;  1DEE G;  2Z5I A;  1HGV A;  1HUC A;  3L72 J;  1FZE A;  1M90 Q;  2NRG A;  2FXM A;  1KQL A;  2I8D A;  3CX5 I;  5KAI H;  2ZT9 D;  3IAO A;  3L74 J;  1SQV D;  2OYI A;  2WSC J;  5B5E E;  1KB9 E;  4PJ0 H;  1SQX D;  4YPC A;  2WVR A;  5AVS B;  3A0B H;  4C7N B;  1IC2 A;  4IFF A;  1LTJ B;  2BEZ F;  3HE5 B;  5AW5 B;  3VN0 A;  2B87 B;  2V7Q J;  4YTP C;  3PHL A;  4N3Y B;  1LTT C;  2YMK A;  5AVR B;  3RL0 g;  2FFD A;  3HD7 C;  1SQV E;  2W8Z A;  2W27 A;  2QJY C;  2Q9I A;  1FE6 A;  1NTM J;  1S4X A;  2XKM A;  2QJP C;  1SQX E;  1MUU A;  4WVZ A;  2XZR A;  1VQ8 P;  2IYO A;  3H25 A;  1QL2 A;  3L73 J;  3P8M C;  3RK2 D;  5AW2 B;  3V5B A;  3T97 A;  3LID A;  1GK6 A;  1GL2 B;  2NPS C;  2WSF J;  2ZAE B;  3AED C;  1P84 D;  1SQV G;  1VQ7 P;  1S1C X;  1S72 P;  1PP9 D;  2OYH A;  4RES B;  3R4Y A;  3H1J D;  4XFJ A;  2WTY A;  2YKO A;  2E75 B;  1RE4 C;  2OAR A;  1L4A C;  3CCM P;  3KQG A;  4MN4 C;  5C39 A;  5GTH H;  5CJ4 A;  1URQ B;  2R32 A;  4ASW A;  4O9B A;  3B5N A;  2YKP A;  1QLE D;  5APY A;  4GOF A;  2H89 C;  3H1J E;  3FWL A;  3HE4 A;  1OXZ A;  2N1T C;  1LTJ A;  4EIJ A;  5AVY B;  3H1H G;  2HLO A;  2A45 G;  2FYU K;  3B4S A;  4EYY Q;  4OGQ B;  2XND H;  3L75 J;  3Q2Y A;  1OVU A;  1U7M A;  2QE7 H;  3O8Z A;  1KMI Z;  2MJZ A;  2KK7 A;  3F89 A;  4H44 B;  1VL2 A;  2AXC A;  1IK7 A;  1N7S B;  4NPE A;  5KLI C;  1KC8 Q;  5APW A;  1SQP K;  4PV1 B;  4UB6 H;  4L73 A;  3CWB D;  1AA0 A;  1LWU A;  2WSE H;  1ZN5 A;  1OMI A;  1Q86 Q;  1KIL B;  2GA1 A;  1SQX J;  1Q81 Q;  1PP9 G;  3Q3D A;  3H1J G;  3WUU A;  1SQB G;  2QRX A;  1D7M A;  5AW8 B;  4DJG A;  1FDM A;  1RF1 A;  4I7Z C;  1LGH B;  1OZH A;  3CX5 H;  2YXR B;  1JY2 N;  1GW4 A;  1RY3 A;  5CCG C;  3HUS B;  1NU1 J;  2C9L Y;  1L0L G;  3IF4 A;  2W90 A;  5M1B A;  3AEF C;  1EXJ A;  3M9B A;  3Q5S A;  3M91 A;  1VQ6 P;  3AE5 C;  3VP9 A;  2LXC B;  4RKU J;  5KAF H;  1KTM A;  1KOR A;  3HTK A;  3L4F A;  1URQ A;  1ZXG A;  1CZQ A;  2LXB A;  2QG4 A;  3AE6 C;  3TGU D;  3CCS P;  3RL0 D;  1KFN A;  3C8V A;  4YXD C;  4DCK A;  5KJ7 C;  1NWQ A;  1DH3 A;  3CCR P;  1H88 A;  1PGQ A;  3CWB G;  5KAI E;  2E76 D;  1UII A;  1K73 Q;  3U59 A;  2QJK C;  2J58 A;  3A7O A;  1IFM A;  2OGU A;  3M9Q A;  1FDI A;  1J1E C;  2C9N Y;  4PJ0 E;  1SQQ G;  3V2N A;  3A0B E;  1JY3 N;  2FXO A;  1BGY J;  4R4M A;  5APS A;  2XU6 A;  1FJK A;  1BCC D;  3TGU E;  1LTI C;  4N78 E;  1YIT P;  4DT0 A;  3C9I A;  4Y28 J;  1FJP A;  1JO5 A;  1JMM A;  1NTZ K;  3IFM A;  4W80 A;  1VQO P;  3D71 A;  2RH0 A;  1L0N J;  3H1I G;  5KLV J;  2KI7 B;  5APU A;  2Q3I A;  3AE9 C;  3VTP C;  1T2K D;  1K05 A;  4GIF A;  3H1L D;  3K5B A;  1GZL A;  1CW5 A;  2I1J A;  1NTK E;  3CCU P;  3CC7 P;  1YTZ I;  1FAV A;  5L8R J;  2D2C C;  3SWY A;  3I55 P;  1VF5 B;  5KTB A;  3E1I A;  1LTA C;  2A45 H;  1IFN A;  4D6T D;  2L5G B;  3EWK A;  5CHX A;  2KXP B;  2C0W A;  2HPC B;  3MHV A;  2OTK E;  3AE7 C;  4U7J A;  2QA4 P;  1AQ5 A;  5GTH E;  1BCC G;  1P84 H;  3EQ2 A;  1OVR A;  2O1J A;  2E75 D;  2PGD A;  3TDK A;  1YJN P;  2K9Y A;  1S2E A;  2YXQ B;  3L35 A;  1RHZ B;  2OYO A;  1T3U A;  4WY4 C;  4OH8 B;  1J1D C;  2VRS A;  3PH0 A;  3WU2 H;  3H1L G;  1E5W A;  4U3F D;  1DX7 A;  3TGU J;  3NXS A;  3MTU E;  3VMY A;  3CX5 D;  3GHG C;  3O6Q B;  1HF9 A;  1KFM A;  1YTZ T;  2Q5U A;  5AVX B;  5H2F H;  1KN7 A;  1KYO I;  3BCC G;  5AVW B;  4UB6 E;  3L36 A;  4H13 C;  4OGQ D;  1HVV A;  2FYZ A;  4HB1 A;  3A2A A;  4D6T G;  3AE1 C;  4H44 D;  1N7S D;  4OWF A;  3AEB C;  4U3F E;  1OX3 A;  4PV1 D;  1IK9 A;  1AVY A;  5KJ7 D;  4DZO A;  1Q90 D;  1JMB A;  4I2L C;  1ZLL A;  3FXE A;  1KIL D;  1HGZ A;  3CX5 E;  2P1J A;  3RBX A;  1NTK J;  1JY2 P;  3HD7 B;  3CCV P;  1AVO A;  2QJY B;  2JKV A;  3M06 A;  2Z4E A;  2QJP B; 
#chains in the Genus database with same CATH homology
 2HR3 A;  2B89 A;  2KS1 B;  2I8D A;  1ZW0 A;  5CBO A;  4WWI A;  1Q2N A;  5CBN A;  5DJT B;  1MFT A;  4IOI H;  4NPD A;  1H0T A;  4MN4 C;  2K3R A;  1LP1 A;  3ZDM A;  2M0B A;  5C39 A;  1LT1 A;  1EDI A;  4ZMD A;  3PH0 A;  2M5A A;  2JWD A;  4ZNC A;  4CPG A;  2KI7 B;  2UWJ E;  2KZJ A;  2WMM A;  2Q1K A;  4ASW A;  2B87 B;  2P58 A;  4JBZ A;  4BXL A;  1Y47 A;  4GOF A;  1SS1 A;  1BDD A;  1FC2 C;  3FXD A;  2LXC B;  3QWO C;  4HJG H;  3S1K A;  1NVO A;  2B88 A;  1U7J A;  1EDK A;  1EDJ A;  2RKL A;  1S3J A;  2KIK A;  5K5G B;  1BDC A;  4HB1 A;  1ZXG A;  2LXB A;  2KZI A;  4KJM A;  1H0T B;  1OVV A;  4K35 A;  4NPF X;  4EYY Q;  1X0T A;  1OVU A;  1U7M A;  1JMB A;  2LR2 A;  2R44 A;  2QVA A;  3FXE A;  1JM0 A;  3MHV A;  2OTK E;  4GOE A;  4NPE A;  2SPZ A;  4HKZ H;  3MZW B;  1LP1 B;  2ZAE B;  4ASV A;  5DJU B;  2B87 A;  1EC5 A;  4K3A A;  5EFW B;  2M5A B;  2QRX A;  1EDL A;  1DEE G;  1OVR A;  3RGU A;  4GOD A;  2KUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...