2M5AB

Protein a binding by an engineered affibody molecule
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
58
structure length
58
Chain Sequence
b'VDNKFNKETQEASWEIFTLPNLNGRQVAAFISSLLDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Immunoglobulin G-binding protein A
publication title High-affinity binding to staphylococcal protein A by an engineered dimeric Affibody molecule.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 15
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2m5aB00
2SPZA 4GODA 4HJGH 1H0TA 4GOFA 1SS1A 2LXBA 1LP1A 4NPFX 1X0TA 1Q2NA 2JWDA 2M5AB 4WWIA 5C39A 4CPGA 2QRXA 1EC5A 4JBZA 4NPDA 2P58A 2KUBA 1LT1A 2ZAEB 1FC2C 2RKLA 2WMMA 1H0TB 1EDIA 1EDJA 1U7JA 2LXCB 3MZWB 2B88A 1DEEG 1EDKA 5EFWB 5CBOA 2B87B 2HR3A 4GOEA 1OVVA 1BDDA 1OVUA 1ZW0A 4HB1A 1Y47A 5K5GB 4ASWA 2KI7B 5DJTB 2M0BA 2R44A 4KJMA 4BXLA 2KZIA 2I8DA 1EDLA 1JM0A 3S1KA 1S3JA 1LP1B 4ZNCA 2UWJE 4ZMDA 3ZDMA 2OTKE 3FXDA 2K3RA 4MN4C 3PH0A 3QWOC 2QVAA 2KS1B 1OVRA 1BDCA 1MFTA 4ASVA 2LR2A 5CBNA 2KIKA 1U7MA 4EYYQ 2KZJA 1JMBA 2B87A 2M5AA 5DJUB 1NVOA 3FXEA 2B89A 4IOIH 2Q1KA 4NPEA 4HKZH 4K3AA 3MHVA 1ZXGA 4K35A 3RGUA
chains in the Genus database with same CATH superfamily
3H1IJ 1EZVG 1T6AA 2JR8A 1SFCD 1A02J 3KXDA 3KYQA 2M5AB 4CPGA 1PP9E 3L35A 5AVZB 3KZIH 3L74E 5H2FE 3HTKA 2QM7A 3A2AA 3JCUE 3CCEP 1G2CA 4WY4B 1VQ4P 3CCMP 4M3LA 4XE5B 3CC4P 3AEAC 2XV5A 1DEEG 2QG4A 3O6QA 2NPSB 1X22A 1CI6A 1BDDA 2HYNA 3H1IE 1NTME 3CLQA 3A0HE 1M57D 2KS1A 1MFZA 1YTZI 2KK7A 3USSA 1KD1Q 2Y9YA 2HLOA 3TGUD 1GK6A 2KSEA 5KLIB 2JDIH 3V6IA 1LWUC 1BGYD 5CCGD 3L4FA 2ZYDA 2QM8A 3G6EP 5E79H 2O01N 3K5BA 3H1HD 1HUCA 5CBNA 5AW6B 3ITKA 1SQBE 4Y99C 1YQ4C 1Y8AA 2YXQB 4GIFA 1EXJA 3S9OA 1KILD 1MZ9A 3OA7A 3KDPB 2Q7CA 1JCDA 1L0NK 1LNQA 1NTMG 1L0NG 1PL5A 3WU2E 5B5EE 1FOSE 2KXPB 3EFGA 1SQXJ 3O8ZA 1YHQP 3VN0A 3L75J 2Z5HA 2WSSH 4ZKUA 3CWBG 3HUSC 1A02F 2YXRB 2KI7B 2QEXP 1ZLLA 1RF0A 2K9JB 4WY4D 5KLVK 3TYYA 5KKZB 1N7SB 2PFXA 1UIIA 1AJYA 5KLVG 1NU1D 2NPSD 1NGMB 4H0LC 1MV8A 1X9VA 1PPJE 1SQXE 5CJ0A 2OQQA 3L75E 1EZVI 2CPSA 2MJZA 1U7MA 1MKMA 2NRGA 3GHGB 2KZJA 1URQD 3JC22 5AW9B 1NVOA 1NAYA 3A0BE 5CCHD 2PAJA 3SFDC 3RL0B 1GK4A 4DZOA 1BCCD 1GW4A 4JQ0D 4D6TJ 1N73C 2QJYB 3H1LJ 3SWKA 3D70A 1FZAA 5APYA 3H1HJ 1P84D 3U1CA 1RH5B 3AEBC 2OYIC 1CW5A 3AEEC 3RK3B 1KILC 2AXTH 4AYCA 1FOSF 3H1KD 1M1JB 1BSHA 1NYHA 5AVVB 1AQTA 2YMYA 4RKUJ 3CMAP 4D6TE 1BGYE 1OW7A 2FYUK 2HFED 2GA1A 4YPCA 3WUUA 1G1JA 1NTZJ 1USEA 3WUVA 4I7ZC 3H1HE 3SWYA 3V2RA 3N7NA 2C0WA 4Z1MH 2W83C 4UB6H 3KZIE 4U7JA 3BCCD 3U59A 2FKWB 3AEFC 1JUNA 3FGAD 2AXCA 1L4AB 3AE5C 1QVGO 2JO1A 2IDBA 2C9LY 3CX5I 1K9MQ 1T2KC 1PGQA 4PV1D 2Q6QA 3EQ2A 2E5TA 4EDFA 1NTZE 2N1TA 4U3FD 3P8CD 3B71A 3F5HA 3TGUG 5AW1B 2W90A 1Q2NA 5C39A 1HJ0A 2PGDA 3CX5H 3BATA 2Y0CA 1PFIA 3L72D 1BCCJ 2W6JH 2WMMA 1HVVA 2D2CC 5CBOA 1NU1E 1KYOI 1GL2C 1YITP 1IFMA 2J59M 2FXOA 3OAKA 2C0XA 3ABVC 3H1KJ 1S4XA 2XDJA 2J5UA 4H44C 1GW3A 1OFCX 1S3JA 2R3SA 1YJNP 3CCLP 2ZXEB 1K8AQ 2KB7P 1BSNA 1BCCE 3WMM0 1ZP0C 5BU8B 3R4YA 1KYOH 1VQ6P 4Y99B 4JPZB 4BWNA 1D7MA 4I2LC 3G71P 1Q81Q 2ZYGA 3HD7A 3L70J 1IO4A 5KAFH 3B5NA 4L74A 1SQQJ 1W2EA 2BCCJ 3TDKA 4IOIH 3H1KE 2E76C 2OYIA 2WPQA 3A5TA 3C8VA 1SFCB 2WZ7A 1L0ND 4PV1C 4XFJA 1KFNA 1YJ9P 1L4AD 4RO0A 3RL0g 3QH9A 4BRYA 2CK3H 2JKVA 4W80A 4N3YB 2WPSA 1LT1A 3IFMA 3AE8C 4OVNF 1NO4A 4AUWA 3B4SA 2FFDC 5AVUB 3L70E 3HUSB 3G3ZA 2FXMA 3CXHD 4W7YA 3GMAA 2R3CA 2HR3A 3D71A 3VP8A 1RE3A 1IFIA 4LGDE 3BCCE 3AE7C 3L36A 1ZRTE 1KYOD 5K5GB 5KLVD 1SQVJ 3L73D 1RE4C 1FDIA 4KJMA 3M0AA 4H0LB 1KFMA 5CMZA 1EZVE 2AXTE 3V4QA 4WB4A 1RF1C 1YJWP 2GUVA 1SVFA 5APQA 2HPCB 2LR2A 4JYCA 2FBWC 3CCSP 1N73B 2N9BA 4L76A 1FDOA 5AW3B 3T97B 4EIJA 4NPEA 1GU4A 1SLQA 5TJHA 2WT7B 3HE4B 1RF0C 3VTPC 2H43A 2P1JA 3C1LA 4GKGA 1KILB 5AVXB 2ZT9C 2IFNA 2IPPA 4GDOA 3BRTB 2IBZG 1LT9A 4UB6E 2HODB 2Y0DA 1JY3N 4DJGA 1T8ZA 3UIAA 2WTYA 1JY2O 1JY2P 2L5GB 2IYOA 1NTMJ 3M0DA 1S9KD 2FXPA 3MZWB 2FYUD 4U3FG 1NOHA 2KNCB 1IFJA 5AW0B 3FX0A 1W5CE 2HG5D 1ZW0A 1IFNA 3TF5A 2XNDH 3CWBJ 1S72P 3S1KA 4C7NB 3B8EB 1QVFO 2UWJE 3ZDMA 1KTMA 3CX5E 3L72G 1FZBA 3CCJP 1LTJB 1NJIQ 4ZKPA 2Z4EA 3H25A 1SQBJ 1H8AA 1L0LK 1L0NE 1NTKD 1R5LA 1J1DC 3CCQP 4H13C 1JTHA 4H0LD 1URQB 3M9HA 3TSIA 4HYTB 5KAIH 3FWLA 1NHLA 2L91A 1HTLC 3CWBE 1JY3O 1JY3P 1VQLP 3SSUA 2FFDA 1Q7YQ 2WSCH 1CZQA 2QRXA 4R4MA 3B5ND 2D2CB 3LW5H 1KYOE 3AE1C 2W27A 5KLVE 3L73E 2OYHA 2RKLA 1EDIA 2W6AA 1QX8A 5KAFE 1P84I 1RE4A 2ZVNB 2N1TC 2QJPC 1SQPK 2WPVB 3CC2P 1MUUA 1KC8Q 5KJ7C 1OVUA 1SQPG 3CPWO 1N86A 4AQRD 4JF7A 1G1IA 3NTNA 3P8MC 1RF1A 1G2CB 1VQ5P 1OX3A 1VQ7P 1P84H 1CI6B 3HE5A 4PD4D 1OXZA 1S5LH 1RQUA 2E42A 5APXA 3JSVC 3H1JD 2KS1B 3H32A 2E76B 4OWFA 4EYYQ 5BU5A 1ZMEC 3H6PA 4PV1B 3FXEA 4IL6X 2IBZI 3L73G 3VYIA 1IFDA 2A06G 4K35A 3GG2A 4LC1A 1T2KD 2Y9ZA 4GOFA 1DX7A 2NZ2A 3CL3D 2FYUE 1H89A 2OTLP 1USDA 4WWIA 3TGUJ 3E1IA 2Q3IA 5CJ4A 1QLED 1FC2C 1BGYJ 3HD7C 2BEZF 3A3YB 1OW6A 3B5NC 1PGPA 4UB8E 4DOJA 1LTBC 1M56D 2QIWA 2AEMA 4WBAA 2XKMA 2D2CD 1AQ5A 4ASWA 4EI2A 2E75D 3A7OA 3AEGC 1KN7A 3KPEA 1PIXA 1GL2D 3II6A 3MGNA 1S1CX 1ZOYC 4ZMDA 3TGUE 3FXDA 3VOPA 4H44D 4GT1A 3BASA 4HH2A 1JCCA 3BVHA 3CCUP 2FYUG 1ZR4A 4ASVA 2R32A 4O9BA 2POHA 2KIKA 2FYNC 1RE3C 1S5LX 1SQXK 3NFQA 1VQOP 2DW3A 2IBZD 1LGHB 1JEKA 1VL2A 2QJKC 1VPCA 1H0TA 4A7PA 1KILE 2AEFA 2E76D 2Q5UA 1S2EA 1NTKK 5L8RJ 1QGKB 2W6BA 1NTKG 1NU1J 2ZAEB 2O01H 3LW5J 3G4SP 5B66H 5KJ7A 1U7JA 1AFOA 1U57A 1BE3D 1EDKA 2ZJSE 1Q90D 4YXDC 1RY3A 5KAIE 3KHUA 2FYZA 1GZLA 5KTBA 3GF7A 3VMYA 1SFCA 1WT6A 3AE6C 1VF5C 3Q3DA 1NWQA 3CXHI 1LT9C 2ZVOB 2RN0A 3H1LG 1DD4A 4IFMA 1VDFA 2E75C 2ZFCA 1J1DB 4H13B 3V2QA 1L0LD 1FZEA 2WSEH 1PGJA 3M0DC 2V7QH 3S4RA 5AVSB 1BDCA 1LWUB 3RK2C 4L75A 4B86A 1JMBA 2QA4P 3CXHH 3VMXA 2B89A 2YIUC 4WVZA 1YTZT 4K3AA 4TLFA 2I1JA 1HGZA 4OGQC 2QE7H 3EWKA 2JP3A 1X0TA 1P84E 1PGOA 4LLHA 1FZGA 1PP9D 3M91A 5CCGA 2ZT9D 5APUA 1AA0A 3H1JG 1S5LE 1HWTC 2QJPB 3IR9A 2LKMA 3BCCJ 5BVZA 1SQPD 1FU1A 2KSJA 2H8PD 3PLNA 1NAFA 4DT0A 1RQVA 1FZCA 1HGVA 3M9BA 1OWAA 4GOEA 3RBZA 3E7KA 3H1ID 2Z5IA 2K37A 5M1BA 1KB9I 1Y47A 5DJTB 2I1KA 1X8YA 4U3FJ 1LTIC 5KKZC 2O1KA 4BXLA 1KZUB 2VRSA 2ZYAA 1FJPA 2BEQD 1OMIA 2MKVA 4JYBA 5GTIH 3TNUA 2OYHC 2XU6A 2IBZE 2IZ1A 4MN4C 3RBXA 4IFFA 1JY2N 3QWOC 3U1AA 1KB9H 3GF3A 4C7RA 3CI9A 2A06D 3L72J 2KNCA 1H88A 2M5AA 5DJUB 2QJYC 1XTCC 3AE2C 4U3FE 4H13D 3P8CE 3Q5PA 1N7LA 4WY4A 3RK3C 3M06A 1JOCA 2NPSA 3B5NB 4UB8H 5APTA 2P7JA 2H88C 1VQ8P 1LTJA 2V4HA 2P58A 1Q86Q 3GW6A 3L72E 2OYIB 3P7KA 2Y0EA 1M8OB 1VQ9P 3TK1A 5TISH 2YO2A 2KOGA 5CCHA 1PV3A 2B87B 1AVOA 4BRYB 1L0LE 1SQQK 3NMDA 2WWWA 3Q5SA 1FE6A 2KLVA 4HB1A 3V2NA 1KV4A 2BCCG 2N1TD 2M0BA 1KB9D 1TU3F 5KJ7D 1EDLA 3V4WA 2CPBA 2K88A 2M8RA 1LP1B 2H7HA 1FBMA 4L73A 1L0NJ 1Y9BA 1AV1A 4I7ZB 2OTKE 2IYPA 2FYNB 3W67A 2K3RA 5AVRB 2WSEJ 5B66E 3N4XA 1BE3G 1PPJD 2QVAA 1SQXD 3MIWA 4W7ZA 2V7QJ 2XZRA 3L75D 1ZN5A 2QJKB 1YI2P 1YBKA 3MUDA 1VQKP 5CHXA 3VP9A 2E74D 4PD4I 3L71G 4KT0J 1KMIZ 1ZXGA 4YXWH 3RGUA 4HJGH 1SQPE 4IL6H 1GMJA 1SQVK 5KLVJ 1WMKA 3L73J 1L0LG 1SQVG 2JWDA 3HRNA 3AE4C 5AW2B 5AVTB 1N2DC 1OW8A 1IC2A 4PD4H 1J1EC 1VQMP 1E79H 2P10A 2K9JA 1KQSO 1QEXA 2LXCB 3CXHE 1N7SA 1VF5B 3HD7D 1LT9B 3OW2O 4D6TD 1YYCA 2R5DA 3PTZA 3H1LD 2E43A 4I1LA 2E75B 3PHLA 5APWA 1GL2B 2A06E 3WUTA 2I8DA 2P67A 1PP9G 3LIEA 3GHGA 1K05A 4ZNCA 3CD6P 3L74G 3RK2B 4H44B 1FZFA 2E5YA 3OJAB 2H89C 2K1AA 2YIUB 3F89A 1IFPA 2RMZA 3HTKB 1E5WA 1ZR2A 1PZQA 4KHXA 1NTMK 4OGQB 3H1IG 3O6QB 1IJDB 2FYUJ 5APSA 1SFCC 1NTZD 3I56P 1M1JA 1CSBA 2M3BA 1QL1A 4RJTA 3CCVP 1GDTA 2E74C 2G8YA 4DCKA 3CC7P 2RH0A 1JTHB 5GTIE 3AE9C 3AE3C 4JBZA 4NPDA 3IN6A 1KB9E 2G3AA 1GD2E 3PJSK 1AVYA 1SQBK 3M9QA 1VQPP 1HBWA 1S9KE 1SQBG 5GTHH 2FFDB 5AW5B 1NTKJ 2M3EA 1DEBA 2JJLA 1R5SA 2WQYC 5AW4B 3G9RA 2IX7C 4N6JA 2OYHB 1W2BO 1L4AA 1N8RQ 5CCGC 1M1KQ 1VF5D 2J58A 1LTTC 2P2UA 1K73Q 1FDMA 1LTSC 1NKZB 1HJBA 4EOTA 1NTKE 1FZCC 1RF1B 5TISE 1JNMA 2IZ0A 1DH3A 3Q1MA 1NKNA 1R8EA 3SWFA 3NXSA 3RK2D 3Q5RA 4HKZH 3HE5B 1IZNB 1ZV8A 2OARA 1SS1A 3H32B 4NPFX 2Q3EA 2QSIA 2WPRA 3IF4A 2YO3A 3LIDA 4OGQD 2ZT9B 2FY8A 1PPJG 3H1LE 1SQXG 1EQ7A 2YNYA 3E1RA 3L75G 3SFEC 3Q2YA 1LWUA 1YIJP 2YKPA 3L70D 2YKQA 2Q9IA 2PRRA 1SQQD 3H1JJ 2YKOA 2BCCD 2WSFH 2B88A 5EFWB 2N9YB 1OVVA 2WSCJ 3GLMA 2JEEA 4WY4C 1ZRTD 1IK9A 4PJ0H 2JWAA 4IL6E 1LJ2A 1OIPA 2NPSC 4YTPC 4XA4A 2K9YA 2ZXXA 5APVA 1EZVD 1LTJC 3IAOA 1DIPA 1N7SD 4PD4E 3BRVB 3CMEP 3H1JE 1URQC 5H2FH 3L71D 2A45G 3JCUH 5AVWB 2R5BA 1K04A 5CCHC 3D6YA 4D6TG 5KLIC 1JO5A 1BGYG 5AVQB 1FJKA 1T3UA 1SQVD 3H1HG 3RL0D 5E79E 2SPZA 3A0HH 3HUSA 4IFDK 3AEDC 4C46A 2LXBA 2O1JA 4QMAA 2KYVA 1GU5A 1J1EB 3W68A 3I55P 3V5BA 2WITA 4N78D 1EC5A 3RK3D 2KUBA 1XTGB 2WVRA 1GTWA 1KQFB 1HF9A 1H0TB 3KQGA 1NTZK 3MUDC 1EDJA 1EXIA 1NTZG 3R2PA 2PP6A 3L37A 3EFFK 4TT3H 2N1TB 3L74D 1RHZB 2OGUA 2HPCA 2KZIA 1N73A 1JM0A 3MD0A 1QL2A 1JMMA 1JB0J 3T97A 3CX5D 5AVYB 1UIXA 3CCRP 4OH8B 3P32A 1T3JA 2WT7A 3PH0A 2BASA 1LTAC 3HE4A 1NTMD 3WU2H 1NU1K 2KLUA 2ITAA 5B5EH 1KILA 1N7SC 5GTHE 1NU1G 1FAVA 3I5CA 2B87A 1X79B 1M7LA 2E74B 2HODA 1BE3J 1OZHA 2Q1KA 2GM4A 1SP4A 3MHVA 4R4LA 1IK7A 1L2PA 3FWNA 3CWBD 3V2PA 4GODA 1M90Q 3GHGC 3AECC 3VMZA 1SQQE 2BCCE 1LP1A 4I6MC 3L71J 1FS0E 1Q82Q 1BCCG 3RL0C 1SQBD 1YQ3C 2OTJP 1HH0A 1L0LJ 3PP5A 5AW7B 3C9IA 1Z56A 4C7NA 2KP8A 1BE3E 3HD7B 3H1KG 3MP7B 2WSFJ 2C9NY 1M1JC 1VQNP 3A0BH 1NH4A 1WRGA 1DD3A 3PRJA 1LTGC 2R44A 3L71E 2IFMA 2O01J 3D6ZA 1KQGB 2GUSA 1URQA 2A45I 1FZCB 2O3JA 2OYOA 1SQVE 3MTUE 3L70G 1PP9J 5AW8B 1SQQG 2W8ZA 1OVRA 2YMKA 1MFTA 3L74J 1KQLA 2AEJA 4Y28J 1SQPJ 3BCCG 2XNXA 2B9BA 2A45H 1KORA 4N78E 3TNUB 3VMAA 3RK3E 4PJ0E 1L4AC 1J2JB 4RESB 1GL2A
chains in the Genus database with same CATH topology
2SPZA 4GODA 4HJGH 1H0TA 4GOFA 1SS1A 2LXBA 1LP1A 4NPFX 1X0TA 1Q2NA 2JWDA 2M5AB 4WWIA 5C39A 4CPGA 2QRXA 1EC5A 4JBZA 4NPDA 2P58A 2KUBA 1LT1A 2ZAEB 1FC2C 2RKLA 2WMMA 1H0TB 1EDIA 1EDJA 1U7JA 2LXCB 3MZWB 2B88A 1DEEG 1EDKA 5EFWB 5CBOA 2B87B 2HR3A 4GOEA 1OVVA 1BDDA 1OVUA 1ZW0A 4HB1A 1Y47A 5K5GB 4ASWA 2KI7B 5DJTB 2M0BA 2R44A 4KJMA 4BXLA 2KZIA 2I8DA 1EDLA 1JM0A 3S1KA 1S3JA 1LP1B 4ZNCA 2UWJE 4ZMDA 3ZDMA 2OTKE 3FXDA 2K3RA 4MN4C 3PH0A 3QWOC 2QVAA 2KS1B 1OVRA 1BDCA 1MFTA 4ASVA 2LR2A 5CBNA 2KIKA 1U7MA 4EYYQ 2KZJA 1JMBA 2B87A 2M5AA 5DJUB 1NVOA 3FXEA 2B89A 4IOIH 2Q1KA 4NPEA 4HKZH 4K3AA 3MHVA 1ZXGA 4K35A 3RGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SPZ A;  4GOD A;  4HJG H;  1H0T A;  4GOF A;  1SS1 A;  2LXB A;  1LP1 A;  4NPF X;  1X0T A;  1Q2N A;  2JWD A;  2M5A B;  4WWI A;  5C39 A;  4CPG A;  2QRX A;  1EC5 A;  4JBZ A;  4NPD A;  2P58 A;  2KUB A;  1LT1 A;  2ZAE B;  1FC2 C;  2RKL A;  2WMM A;  1H0T B;  1EDI A;  1EDJ A;  1U7J A;  2LXC B;  3MZW B;  2B88 A;  1DEE G;  1EDK A;  5EFW B;  5CBO A;  2B87 B;  2HR3 A;  4GOE A;  1OVV A;  1BDD A;  1OVU A;  1ZW0 A;  4HB1 A;  1Y47 A;  5K5G B;  4ASW A;  2KI7 B;  5DJT B;  2M0B A;  2R44 A;  4KJM A;  4BXL A;  2KZI A;  2I8D A;  1EDL A;  1JM0 A;  3S1K A;  1S3J A;  1LP1 B;  4ZNC A;  2UWJ E;  4ZMD A;  3ZDM A;  2OTK E;  3FXD A;  2K3R A;  4MN4 C;  3PH0 A;  3QWO C;  2QVA A;  2KS1 B;  1OVR A;  1BDC A;  1MFT A;  4ASV A;  2LR2 A;  5CBN A;  2KIK A;  1U7M A;  4EYY Q;  2KZJ A;  1JMB A;  2B87 A;  2M5A A;  5DJU B;  1NVO A;  3FXE A;  2B89 A;  4IOI H;  2Q1K A;  4NPE A;  4HKZ H;  4K3A A;  3MHV A;  1ZXG A;  4K35 A;  3RGU A; 
#chains in the Genus database with same CATH topology
 3H1I J;  1EZV G;  1T6A A;  2JR8 A;  1SFC D;  1A02 J;  3KXD A;  3KYQ A;  2M5A B;  4CPG A;  1PP9 E;  3L35 A;  5AVZ B;  3KZI H;  3L74 E;  5H2F E;  3HTK A;  2QM7 A;  3A2A A;  3JCU E;  3CCE P;  1G2C A;  4WY4 B;  1VQ4 P;  3CCM P;  4M3L A;  4XE5 B;  3CC4 P;  3AEA C;  2XV5 A;  1DEE G;  2QG4 A;  3O6Q A;  2NPS B;  1X22 A;  1CI6 A;  1BDD A;  2HYN A;  3H1I E;  1NTM E;  3CLQ A;  3A0H E;  1M57 D;  2KS1 A;  1MFZ A;  1YTZ I;  2KK7 A;  3USS A;  1KD1 Q;  2Y9Y A;  2HLO A;  3TGU D;  1GK6 A;  2KSE A;  5KLI B;  2JDI H;  3V6I A;  1LWU C;  1BGY D;  5CCG D;  3L4F A;  2ZYD A;  2QM8 A;  3G6E P;  5E79 H;  2O01 N;  3K5B A;  3H1H D;  1HUC A;  5CBN A;  5AW6 B;  3ITK A;  1SQB E;  4Y99 C;  1YQ4 C;  1Y8A A;  2YXQ B;  4GIF A;  1EXJ A;  3S9O A;  1KIL D;  1MZ9 A;  3OA7 A;  3KDP B;  2Q7C A;  1JCD A;  1L0N K;  1LNQ A;  1NTM G;  1L0N G;  1PL5 A;  3WU2 E;  5B5E E;  1FOS E;  2KXP B;  3EFG A;  1SQX J;  3O8Z A;  1YHQ P;  3VN0 A;  3L75 J;  2Z5H A;  2WSS H;  4ZKU A;  3CWB G;  3HUS C;  1A02 F;  2YXR B;  2KI7 B;  2QEX P;  1ZLL A;  1RF0 A;  2K9J B;  4WY4 D;  5KLV K;  3TYY A;  5KKZ B;  1N7S B;  2PFX A;  1UII A;  1AJY A;  5KLV G;  1NU1 D;  2NPS D;  1NGM B;  4H0L C;  1MV8 A;  1X9V A;  1PPJ E;  1SQX E;  5CJ0 A;  2OQQ A;  3L75 E;  1EZV I;  2CPS A;  2MJZ A;  1U7M A;  1MKM A;  2NRG A;  3GHG B;  2KZJ A;  1URQ D;  3JC2 2;  5AW9 B;  1NVO A;  1NAY A;  3A0B E;  5CCH D;  2PAJ A;  3SFD C;  3RL0 B;  1GK4 A;  4DZO A;  1BCC D;  1GW4 A;  4JQ0 D;  4D6T J;  1N73 C;  2QJY B;  3H1L J;  3SWK A;  3D70 A;  1FZA A;  5APY A;  3H1H J;  1P84 D;  3U1C A;  1RH5 B;  3AEB C;  2OYI C;  1CW5 A;  3AEE C;  3RK3 B;  1KIL C;  2AXT H;  4AYC A;  1FOS F;  3H1K D;  1M1J B;  1BSH A;  1NYH A;  5AVV B;  1AQT A;  2YMY A;  4RKU J;  3CMA P;  4D6T E;  1BGY E;  1OW7 A;  2FYU K;  2HFE D;  2GA1 A;  4YPC A;  3WUU A;  1G1J A;  1NTZ J;  1USE A;  3WUV A;  4I7Z C;  3H1H E;  3SWY A;  3V2R A;  3N7N A;  2C0W A;  4Z1M H;  2W83 C;  4UB6 H;  3KZI E;  4U7J A;  3BCC D;  3U59 A;  2FKW B;  3AEF C;  1JUN A;  3FGA D;  2AXC A;  1L4A B;  3AE5 C;  1QVG O;  2JO1 A;  2IDB A;  2C9L Y;  3CX5 I;  1K9M Q;  1T2K C;  1PGQ A;  4PV1 D;  2Q6Q A;  3EQ2 A;  2E5T A;  4EDF A;  1NTZ E;  2N1T A;  4U3F D;  3P8C D;  3B71 A;  3F5H A;  3TGU G;  5AW1 B;  2W90 A;  1Q2N A;  5C39 A;  1HJ0 A;  2PGD A;  3CX5 H;  3BAT A;  2Y0C A;  1PFI A;  3L72 D;  1BCC J;  2W6J H;  2WMM A;  1HVV A;  2D2C C;  5CBO A;  1NU1 E;  1KYO I;  1GL2 C;  1YIT P;  1IFM A;  2J59 M;  2FXO A;  3OAK A;  2C0X A;  3ABV C;  3H1K J;  1S4X A;  2XDJ A;  2J5U A;  4H44 C;  1GW3 A;  1OFC X;  1S3J A;  2R3S A;  1YJN P;  3CCL P;  2ZXE B;  1K8A Q;  2KB7 P;  1BSN A;  1BCC E;  3WMM 0;  1ZP0 C;  5BU8 B;  3R4Y A;  1KYO H;  1VQ6 P;  4Y99 B;  4JPZ B;  4BWN A;  1D7M A;  4I2L C;  3G71 P;  1Q81 Q;  2ZYG A;  3HD7 A;  3L70 J;  1IO4 A;  5KAF H;  3B5N A;  4L74 A;  1SQQ J;  1W2E A;  2BCC J;  3TDK A;  4IOI H;  3H1K E;  2E76 C;  2OYI A;  2WPQ A;  3A5T A;  3C8V A;  1SFC B;  2WZ7 A;  1L0N D;  4PV1 C;  4XFJ A;  1KFN A;  1YJ9 P;  1L4A D;  4RO0 A;  3RL0 g;  3QH9 A;  4BRY A;  2CK3 H;  2JKV A;  4W80 A;  4N3Y B;  2WPS A;  1LT1 A;  3IFM A;  3AE8 C;  4OVN F;  1NO4 A;  4AUW A;  3B4S A;  2FFD C;  5AVU B;  3L70 E;  3HUS B;  3G3Z A;  2FXM A;  3CXH D;  4W7Y A;  3GMA A;  2R3C A;  2HR3 A;  3D71 A;  3VP8 A;  1RE3 A;  1IFI A;  4LGD E;  3BCC E;  3AE7 C;  3L36 A;  1ZRT E;  1KYO D;  5K5G B;  5KLV D;  1SQV J;  3L73 D;  1RE4 C;  1FDI A;  4KJM A;  3M0A A;  4H0L B;  1KFM A;  5CMZ A;  1EZV E;  2AXT E;  3V4Q A;  4WB4 A;  1RF1 C;  1YJW P;  2GUV A;  1SVF A;  5APQ A;  2HPC B;  2LR2 A;  4JYC A;  2FBW C;  3CCS P;  1N73 B;  2N9B A;  4L76 A;  1FDO A;  5AW3 B;  3T97 B;  4EIJ A;  4NPE A;  1GU4 A;  1SLQ A;  5TJH A;  2WT7 B;  3HE4 B;  1RF0 C;  3VTP C;  2H43 A;  2P1J A;  3C1L A;  4GKG A;  1KIL B;  5AVX B;  2ZT9 C;  2IFN A;  2IPP A;  4GDO A;  3BRT B;  2IBZ G;  1LT9 A;  4UB6 E;  2HOD B;  2Y0D A;  1JY3 N;  4DJG A;  1T8Z A;  3UIA A;  2WTY A;  1JY2 O;  1JY2 P;  2L5G B;  2IYO A;  1NTM J;  3M0D A;  1S9K D;  2FXP A;  3MZW B;  2FYU D;  4U3F G;  1NOH A;  2KNC B;  1IFJ A;  5AW0 B;  3FX0 A;  1W5C E;  2HG5 D;  1ZW0 A;  1IFN A;  3TF5 A;  2XND H;  3CWB J;  1S72 P;  3S1K A;  4C7N B;  3B8E B;  1QVF O;  2UWJ E;  3ZDM A;  1KTM A;  3CX5 E;  3L72 G;  1FZB A;  3CCJ P;  1LTJ B;  1NJI Q;  4ZKP A;  2Z4E A;  3H25 A;  1SQB J;  1H8A A;  1L0L K;  1L0N E;  1NTK D;  1R5L A;  1J1D C;  3CCQ P;  4H13 C;  1JTH A;  4H0L D;  1URQ B;  3M9H A;  3TSI A;  4HYT B;  5KAI H;  3FWL A;  1NHL A;  2L91 A;  1HTL C;  3CWB E;  1JY3 O;  1JY3 P;  1VQL P;  3SSU A;  2FFD A;  1Q7Y Q;  2WSC H;  1CZQ A;  2QRX A;  4R4M A;  3B5N D;  2D2C B;  3LW5 H;  1KYO E;  3AE1 C;  2W27 A;  5KLV E;  3L73 E;  2OYH A;  2RKL A;  1EDI A;  2W6A A;  1QX8 A;  5KAF E;  1P84 I;  1RE4 A;  2ZVN B;  2N1T C;  2QJP C;  1SQP K;  2WPV B;  3CC2 P;  1MUU A;  1KC8 Q;  5KJ7 C;  1OVU A;  1SQP G;  3CPW O;  1N86 A;  4AQR D;  4JF7 A;  1G1I A;  3NTN A;  3P8M C;  1RF1 A;  1G2C B;  1VQ5 P;  1OX3 A;  1VQ7 P;  1P84 H;  1CI6 B;  3HE5 A;  4PD4 D;  1OXZ A;  1S5L H;  1RQU A;  2E42 A;  5APX A;  3JSV C;  3H1J D;  2KS1 B;  3H32 A;  2E76 B;  4OWF A;  4EYY Q;  5BU5 A;  1ZME C;  3H6P A;  4PV1 B;  3FXE A;  4IL6 X;  2IBZ I;  3L73 G;  3VYI A;  1IFD A;  2A06 G;  4K35 A;  3GG2 A;  4LC1 A;  1T2K D;  2Y9Z A;  4GOF A;  1DX7 A;  2NZ2 A;  3CL3 D;  2FYU E;  1H89 A;  2OTL P;  1USD A;  4WWI A;  3TGU J;  3E1I A;  2Q3I A;  5CJ4 A;  1QLE D;  1FC2 C;  1BGY J;  3HD7 C;  2BEZ F;  3A3Y B;  1OW6 A;  3B5N C;  1PGP A;  4UB8 E;  4DOJ A;  1LTB C;  1M56 D;  2QIW A;  2AEM A;  4WBA A;  2XKM A;  2D2C D;  1AQ5 A;  4ASW A;  4EI2 A;  2E75 D;  3A7O A;  3AEG C;  1KN7 A;  3KPE A;  1PIX A;  1GL2 D;  3II6 A;  3MGN A;  1S1C X;  1ZOY C;  4ZMD A;  3TGU E;  3FXD A;  3VOP A;  4H44 D;  4GT1 A;  3BAS A;  4HH2 A;  1JCC A;  3BVH A;  3CCU P;  2FYU G;  1ZR4 A;  4ASV A;  2R32 A;  4O9B A;  2POH A;  2KIK A;  2FYN C;  1RE3 C;  1S5L X;  1SQX K;  3NFQ A;  1VQO P;  2DW3 A;  2IBZ D;  1LGH B;  1JEK A;  1VL2 A;  2QJK C;  1VPC A;  1H0T A;  4A7P A;  1KIL E;  2AEF A;  2E76 D;  2Q5U A;  1S2E A;  1NTK K;  5L8R J;  1QGK B;  2W6B A;  1NTK G;  1NU1 J;  2ZAE B;  2O01 H;  3LW5 J;  3G4S P;  5B66 H;  5KJ7 A;  1U7J A;  1AFO A;  1U57 A;  1BE3 D;  1EDK A;  2ZJS E;  1Q90 D;  4YXD C;  1RY3 A;  5KAI E;  3KHU A;  2FYZ A;  1GZL A;  5KTB A;  3GF7 A;  3VMY A;  1SFC A;  1WT6 A;  3AE6 C;  1VF5 C;  3Q3D A;  1NWQ A;  3CXH I;  1LT9 C;  2ZVO B;  2RN0 A;  3H1L G;  1DD4 A;  4IFM A;  1VDF A;  2E75 C;  2ZFC A;  1J1D B;  4H13 B;  3V2Q A;  1L0L D;  1FZE A;  2WSE H;  1PGJ A;  3M0D C;  2V7Q H;  3S4R A;  5AVS B;  1BDC A;  1LWU B;  3RK2 C;  4L75 A;  4B86 A;  1JMB A;  2QA4 P;  3CXH H;  3VMX A;  2B89 A;  2YIU C;  4WVZ A;  1YTZ T;  4K3A A;  4TLF A;  2I1J A;  1HGZ A;  4OGQ C;  2QE7 H;  3EWK A;  2JP3 A;  1X0T A;  1P84 E;  1PGO A;  4LLH A;  1FZG A;  1PP9 D;  3M91 A;  5CCG A;  2ZT9 D;  5APU A;  1AA0 A;  3H1J G;  1S5L E;  1HWT C;  2QJP B;  3IR9 A;  2LKM A;  3BCC J;  5BVZ A;  1SQP D;  1FU1 A;  2KSJ A;  2H8P D;  3PLN A;  1NAF A;  4DT0 A;  1RQV A;  1FZC A;  1HGV A;  3M9B A;  1OWA A;  4GOE A;  3RBZ A;  3E7K A;  3H1I D;  2Z5I A;  2K37 A;  5M1B A;  1KB9 I;  1Y47 A;  5DJT B;  2I1K A;  1X8Y A;  4U3F J;  1LTI C;  5KKZ C;  2O1K A;  4BXL A;  1KZU B;  2VRS A;  2ZYA A;  1FJP A;  2BEQ D;  1OMI A;  2MKV A;  4JYB A;  5GTI H;  3TNU A;  2OYH C;  2XU6 A;  2IBZ E;  2IZ1 A;  4MN4 C;  3RBX A;  4IFF A;  1JY2 N;  3QWO C;  3U1A A;  1KB9 H;  3GF3 A;  4C7R A;  3CI9 A;  2A06 D;  3L72 J;  2KNC A;  1H88 A;  2M5A A;  5DJU B;  2QJY C;  1XTC C;  3AE2 C;  4U3F E;  4H13 D;  3P8C E;  3Q5P A;  1N7L A;  4WY4 A;  3RK3 C;  3M06 A;  1JOC A;  2NPS A;  3B5N B;  4UB8 H;  5APT A;  2P7J A;  2H88 C;  1VQ8 P;  1LTJ A;  2V4H A;  2P58 A;  1Q86 Q;  3GW6 A;  3L72 E;  2OYI B;  3P7K A;  2Y0E A;  1M8O B;  1VQ9 P;  3TK1 A;  5TIS H;  2YO2 A;  2KOG A;  5CCH A;  1PV3 A;  2B87 B;  1AVO A;  4BRY B;  1L0L E;  1SQQ K;  3NMD A;  2WWW A;  3Q5S A;  1FE6 A;  2KLV A;  4HB1 A;  3V2N A;  1KV4 A;  2BCC G;  2N1T D;  2M0B A;  1KB9 D;  1TU3 F;  5KJ7 D;  1EDL A;  3V4W A;  2CPB A;  2K88 A;  2M8R A;  1LP1 B;  2H7H A;  1FBM A;  4L73 A;  1L0N J;  1Y9B A;  1AV1 A;  4I7Z B;  2OTK E;  2IYP A;  2FYN B;  3W67 A;  2K3R A;  5AVR B;  2WSE J;  5B66 E;  3N4X A;  1BE3 G;  1PPJ D;  2QVA A;  1SQX D;  3MIW A;  4W7Z A;  2V7Q J;  2XZR A;  3L75 D;  1ZN5 A;  2QJK B;  1YI2 P;  1YBK A;  3MUD A;  1VQK P;  5CHX A;  3VP9 A;  2E74 D;  4PD4 I;  3L71 G;  4KT0 J;  1KMI Z;  1ZXG A;  4YXW H;  3RGU A;  4HJG H;  1SQP E;  4IL6 H;  1GMJ A;  1SQV K;  5KLV J;  1WMK A;  3L73 J;  1L0L G;  1SQV G;  2JWD A;  3HRN A;  3AE4 C;  5AW2 B;  5AVT B;  1N2D C;  1OW8 A;  1IC2 A;  4PD4 H;  1J1E C;  1VQM P;  1E79 H;  2P10 A;  2K9J A;  1KQS O;  1QEX A;  2LXC B;  3CXH E;  1N7S A;  1VF5 B;  3HD7 D;  1LT9 B;  3OW2 O;  4D6T D;  1YYC A;  2R5D A;  3PTZ A;  3H1L D;  2E43 A;  4I1L A;  2E75 B;  3PHL A;  5APW A;  1GL2 B;  2A06 E;  3WUT A;  2I8D A;  2P67 A;  1PP9 G;  3LIE A;  3GHG A;  1K05 A;  4ZNC A;  3CD6 P;  3L74 G;  3RK2 B;  4H44 B;  1FZF A;  2E5Y A;  3OJA B;  2H89 C;  2K1A A;  2YIU B;  3F89 A;  1IFP A;  2RMZ A;  3HTK B;  1E5W A;  1ZR2 A;  1PZQ A;  4KHX A;  1NTM K;  4OGQ B;  3H1I G;  3O6Q B;  1IJD B;  2FYU J;  5APS A;  1SFC C;  1NTZ D;  3I56 P;  1M1J A;  1CSB A;  2M3B A;  1QL1 A;  4RJT A;  3CCV P;  1GDT A;  2E74 C;  2G8Y A;  4DCK A;  3CC7 P;  2RH0 A;  1JTH B;  5GTI E;  3AE9 C;  3AE3 C;  4JBZ A;  4NPD A;  3IN6 A;  1KB9 E;  2G3A A;  1GD2 E;  3PJS K;  1AVY A;  1SQB K;  3M9Q A;  1VQP P;  1HBW A;  1S9K E;  1SQB G;  5GTH H;  2FFD B;  5AW5 B;  1NTK J;  2M3E A;  1DEB A;  2JJL A;  1R5S A;  2WQY C;  5AW4 B;  3G9R A;  2IX7 C;  4N6J A;  2OYH B;  1W2B O;  1L4A A;  1N8R Q;  5CCG C;  1M1K Q;  1VF5 D;  2J58 A;  1LTT C;  2P2U A;  1K73 Q;  1FDM A;  1LTS C;  1NKZ B;  1HJB A;  4EOT A;  1NTK E;  1FZC C;  1RF1 B;  5TIS E;  1JNM A;  2IZ0 A;  1DH3 A;  3Q1M A;  1NKN A;  1R8E A;  3SWF A;  3NXS A;  3RK2 D;  3Q5R A;  4HKZ H;  3HE5 B;  1IZN B;  1ZV8 A;  2OAR A;  1SS1 A;  3H32 B;  4NPF X;  2Q3E A;  2QSI A;  2WPR A;  3IF4 A;  2YO3 A;  3LID A;  4OGQ D;  2ZT9 B;  2FY8 A;  1PPJ G;  3H1L E;  1SQX G;  1EQ7 A;  2YNY A;  3E1R A;  3L75 G;  3SFE C;  3Q2Y A;  1LWU A;  1YIJ P;  2YKP A;  3L70 D;  2YKQ A;  2Q9I A;  2PRR A;  1SQQ D;  3H1J J;  2YKO A;  2BCC D;  2WSF H;  2B88 A;  5EFW B;  2N9Y B;  1OVV A;  2WSC J;  3GLM A;  2JEE A;  4WY4 C;  1ZRT D;  1IK9 A;  4PJ0 H;  2JWA A;  4IL6 E;  1LJ2 A;  1OIP A;  2NPS C;  4YTP C;  4XA4 A;  2K9Y A;  2ZXX A;  5APV A;  1EZV D;  1LTJ C;  3IAO A;  1DIP A;  1N7S D;  4PD4 E;  3BRV B;  3CME P;  3H1J E;  1URQ C;  5H2F H;  3L71 D;  2A45 G;  3JCU H;  5AVW B;  2R5B A;  1K04 A;  5CCH C;  3D6Y A;  4D6T G;  5KLI C;  1JO5 A;  1BGY G;  5AVQ B;  1FJK A;  1T3U A;  1SQV D;  3H1H G;  3RL0 D;  5E79 E;  2SPZ A;  3A0H H;  3HUS A;  4IFD K;  3AED C;  4C46 A;  2LXB A;  2O1J A;  4QMA A;  2KYV A;  1GU5 A;  1J1E B;  3W68 A;  3I55 P;  3V5B A;  2WIT A;  4N78 D;  1EC5 A;  3RK3 D;  2KUB A;  1XTG B;  2WVR A;  1GTW A;  1KQF B;  1HF9 A;  1H0T B;  3KQG A;  1NTZ K;  3MUD C;  1EDJ A;  1EXI A;  1NTZ G;  3R2P A;  2PP6 A;  3L37 A;  3EFF K;  4TT3 H;  2N1T B;  3L74 D;  1RHZ B;  2OGU A;  2HPC A;  2KZI A;  1N73 A;  1JM0 A;  3MD0 A;  1QL2 A;  1JMM A;  1JB0 J;  3T97 A;  3CX5 D;  5AVY B;  1UIX A;  3CCR P;  4OH8 B;  3P32 A;  1T3J A;  2WT7 A;  3PH0 A;  2BAS A;  1LTA C;  3HE4 A;  1NTM D;  3WU2 H;  1NU1 K;  2KLU A;  2ITA A;  5B5E H;  1KIL A;  1N7S C;  5GTH E;  1NU1 G;  1FAV A;  3I5C A;  2B87 A;  1X79 B;  1M7L A;  2E74 B;  2HOD A;  1BE3 J;  1OZH A;  2Q1K A;  2GM4 A;  1SP4 A;  3MHV A;  4R4L A;  1IK7 A;  1L2P A;  3FWN A;  3CWB D;  3V2P A;  4GOD A;  1M90 Q;  3GHG C;  3AEC C;  3VMZ A;  1SQQ E;  2BCC E;  1LP1 A;  4I6M C;  3L71 J;  1FS0 E;  1Q82 Q;  1BCC G;  3RL0 C;  1SQB D;  1YQ3 C;  2OTJ P;  1HH0 A;  1L0L J;  3PP5 A;  5AW7 B;  3C9I A;  1Z56 A;  4C7N A;  2KP8 A;  1BE3 E;  3HD7 B;  3H1K G;  3MP7 B;  2WSF J;  2C9N Y;  1M1J C;  1VQN P;  3A0B H;  1NH4 A;  1WRG A;  1DD3 A;  3PRJ A;  1LTG C;  2R44 A;  3L71 E;  2IFM A;  2O01 J;  3D6Z A;  1KQG B;  2GUS A;  1URQ A;  2A45 I;  1FZC B;  2O3J A;  2OYO A;  1SQV E;  3MTU E;  3L70 G;  1PP9 J;  5AW8 B;  1SQQ G;  2W8Z A;  1OVR A;  2YMK A;  1MFT A;  3L74 J;  1KQL A;  2AEJ A;  4Y28 J;  1SQP J;  3BCC G;  2XNX A;  2B9B A;  2A45 H;  1KOR A;  4N78 E;  3TNU B;  3VMA A;  3RK3 E;  4PJ0 E;  1L4A C;  1J2J B;  4RES B;  1GL2 A; 
#chains in the Genus database with same CATH homology
 2SPZ A;  4GOD A;  4HJG H;  1H0T A;  4GOF A;  1SS1 A;  2LXB A;  1LP1 A;  4NPF X;  1X0T A;  1Q2N A;  2JWD A;  2M5A B;  4WWI A;  5C39 A;  4CPG A;  2QRX A;  1EC5 A;  4JBZ A;  4NPD A;  2P58 A;  2KUB A;  1LT1 A;  2ZAE B;  1FC2 C;  2RKL A;  2WMM A;  1H0T B;  1EDI A;  1EDJ A;  1U7J A;  2LXC B;  3MZW B;  2B88 A;  1DEE G;  1EDK A;  5EFW B;  5CBO A;  2B87 B;  2HR3 A;  4GOE A;  1OVV A;  1BDD A;  1OVU A;  1ZW0 A;  4HB1 A;  1Y47 A;  5K5G B;  4ASW A;  2KI7 B;  5DJT B;  2M0B A;  2R44 A;  4KJM A;  4BXL A;  2KZI A;  2I8D A;  1EDL A;  1JM0 A;  3S1K A;  1S3J A;  1LP1 B;  4ZNC A;  2UWJ E;  4ZMD A;  3ZDM A;  2OTK E;  3FXD A;  2K3R A;  4MN4 C;  3PH0 A;  3QWO C;  2QVA A;  2KS1 B;  1OVR A;  1BDC A;  1MFT A;  4ASV A;  2LR2 A;  5CBN A;  2KIK A;  1U7M A;  4EYY Q;  2KZJ A;  1JMB A;  2B87 A;  2M5A A;  5DJU B;  1NVO A;  3FXE A;  2B89 A;  4IOI H;  2Q1K A;  4NPE A;  4HKZ H;  4K3A A;  3MHV A;  1ZXG A;  4K35 A;  3RGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...