3FXDA

Crystal structure of interacting domains of icmr and icmq
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
49
structure length
49
Chain Sequence
QLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 18
structure length 49
sequence length 49
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3fxdA00
2M0BA 1EDIA 1S3JA 1Y47A 4GODA 3PH0A 2WMMA 2B87A 2JWDA 3RGUA 4ASVA 1JMBA 3QWOC 2OTKE 1SS1A 2Q1KA 5C39A 2HR3A 1X0TA 4ASWA 1EC5A 4NPDA 1Q2NA 4JBZA 2UWJE 2LXCB 1U7MA 1ZW0A 2B89A 5DJTB 1ZXGA 2SPZA 1MFTA 4HB1A 1EDLA 4K3AA 4K35A 4NPEA 2B88A 2KZJA 3S1KA 1OVRA 3FXEA 2RKLA 4WWIA 2M5AA 1EDJA 2LR2A 2K3RA 2P58A 3ZDMA 1LT1A 2KS1B 2KZIA 2QRXA 1H0TB 1FC2C 3MZWB 4HJGH 4KJMA 2KIKA 3MHVA 1JM0A 1OVUA 1LP1A 4GOEA 4CPGA 4IOIH 4MN4C 2B87B 5K5GB 1DEEG 2LXBA 1OVVA 1BDDA 2ZAEB 4HKZH 2M5AB 2KUBA 4BXLA 2I8DA 1U7JA 4ZNCA 3FXDA 1EDKA 1BDCA 5CBNA 5EFWB 2QVAA 2R44A 5CBOA 1LP1B 2KI7B 4GOFA 5DJUB 4ZMDA 1H0TA 4EYYQ 4NPFX 1NVOA
chains in the Genus database with same CATH superfamily
2CPBA 1VQ8P 1L0LG 1IFPA 5KLVD 3M0AA 3W68A 2ZT9D 3G71P 1SQXE 3BRVB 1IK9A 1LTBC 3KYQA 5AW2B 3QWOC 2QJYC 2FYNC 4GIFA 4L73A 1VQ5P 1S5LX 1Q86Q 2YKPA 2XDJA 1EC5A 1OW8A 2ZYGA 1AVYA 3Q5RA 1GU4A 3CXHH 3QH9A 2OYHC 2V7QJ 5AVZB 1BE3J 3BCCG 1RF0C 5DJTB 1ZXGA 1CI6B 1T8ZA 3H1JD 4K35A 3H1LE 2RMZA 1X22A 1IFIA 2ZXEB 1GU5A 3L35A 4IFDK 3L74D 3FXEA 3L71G 1YIJP 4D6TE 4WWIA 5B5EH 3TGUG 2A06G 2LR2A 3L37A 4YTPC 2B9BA 1VDFA 3NFQA 2OYIB 4WVZA 1PP9E 5CCGC 4IL6E 3KQGA 5KKZC 1FZCA 1SQXK 3CWBG 4DCKA 3RBXA 3H1HE 1GK6A 2YXRB 4AUWA 3I56P 5B66H 3H1LD 1VQOP 2ZYDA 2G3AA 1VQPP 3IR9A 3D6YA 4ZNCA 3CCMP 1PGJA 2FYUJ 3AE7C 3M0DA 1RE4C 2A45I 2AXTE 2AEMA 4D6TD 1M1JA 3L72G 4EOTA 2RN0A 2QVAA 1M56D 1LP1B 3IFMA 2OYOA 2ZVNB 2HPCB 3HD7D 1JMMA 1JB0J 2Y0EA 1NGMB 3CCLP 2FBWC 1Y47A 2W83C 3P8MC 3PH0A 2CPSA 1PP9D 1HJBA 3AEBC 2XZRA 3G9RA 1YJWP 2IBZE 4JBZA 1L0NG 1K9MQ 3CXHE 1KB9I 1U7MA 3TK1A 4HB1A 3WUTA 4R4LA 2NPSD 1M57D 2KP8A 1JTHB 1HGZA 1IFDA 3HTKA 1Q7YQ 2QM7A 3SWFA 1NO4A 2KZIA 3D70A 1LTAC 3L70E 3MZWB 4HJGH 4GOEA 4YPCA 1YTZI 2IBZD 1ZP0C 4OH8B 4MN4C 5KAFH 4EIJA 2N1TD 3RL0C 1RF1C 3CXHD 3RK3E 2HFED 3IAOA 1NHLA 2JO1A 3SFEC 1SQQE 5B66E 5AVWB 1N86A 1BGYE 2WITA 2Z4EA 2KNCA 1SQPJ 2YO2A 2R44A 1BCCJ 3OAKA 4ZMDA 1FZCB 2M0BA 2K88A 3Q2YA 3AECC 3NXSA 2QEXP 2B87A 1SS1A 2N9BA 1M1KQ 2HR3A 3RK3D 3CLQA 2E76D 2Y0DA 1NTKG 1KQFB 3OW2O 1LWUC 3HD7C 3CPWO 3R2PA 1PIXA 2E74D 1ZW0A 5H2FH 3NTNA 3USSA 3AEEC 3L75D 3H1IE 2R5BA 2NRGA 1LGHB 2CK3H 1GK4A 1NAYA 3JCUH 3C1LA 1EZVD 2WT7A 1LTJA 1SQQK 2IFNA 3L4FA 1SQBE 3CI9A 1LT1A 1FJKA 4PV1B 3B5ND 3L73J 3MHVA 4DJGA 2XKMA 1HWTC 2J59M 3VMZA 1G2CA 5KAFE 1AFOA 2Q6QA 3PLNA 1HF9A 1GZLA 5KJ7D 1DIPA 5KLVG 2K1AA 1NKZB 1SQBD 3GHGA 2KS1A 3TF5A 3L71J 2N1TC 1NVOA 3TGUJ 4PD4E 4Y99C 4GODA 4PJ0E 2PRRA 1UIXA 2PGDA 5KLIC 1L4AD 2P2UA 3P8CE 2KLUA 2YO3A 3WUVA 2BCCE 5CMZA 1RQUA 2JJLA 1DEBA 2KOGA 5APXA 1VQ9P 3G4SP 1A02F 1VQKP 1FU1A 1EDLA 1GDTA 1SQVJ 1JEKA 3O6QB 5H2FE 4LC1A 1MUUA 1SQXG 3JCUE 3RK3C 2E76C 1QVGO 2HG5D 3GF7A 1HH0A 2E74C 1WT6A 1IFMA 4KJMA 2K37A 1HVVA 1RH5B 3P8CD 3H1LG 3V2NA 5BU8B 2JP3A 1NU1J 4WY4D 2QJKC 2P67A 5K5GB 1LT9A 3V2RA 3M91A 5APQA 4D6TG 2ZAEB 1L0NJ 3AEFC 3AE1C 4H44D 3NMDA 1NTME 2QJPC 2FXPA 2KI7B 5AW5B 1K73Q 1URQA 2W8ZA 4JYCA 2O3JA 2V7QH 1RE3A 4DT0A 2QE7H 1S3JA 3B71A 3H1HG 1N73A 2OTKE 1NTZD 2Q1KA 5KJ7C 2IX7C 5AW0B 2G8YA 1Y9BA 1T3JA 3A0BH 2BEZF 1X79B 5APYA 4RO0A 5APSA 2FFDA 1R5SA 2E5TA 1L4AC 3CC2P 5AW8B 2O1KA 3RBZA 1GW4A 3CMAP 3T97B 4BRYA 1NTMK 3H25A 1X8YA 4H0LB 1VPCA 2QRXA 4GKGA 3FX0A 2W6AA 4HYTB 3H1KD 5APUA 3O8ZA 4W7YA 1N7SB 4U7JA 4WB4A 3M9BA 1P84E 1VQNP 1BDDA 1NTKJ 3VN0A 2FY8A 1NH4A 1FBMA 1GL2A 3L70G 3V5BA 3K5BA 3Q5SA 1FE6A 4WY4C 3E1RA 1LTSC 1VF5C 2OYIC 3BVHA 1BE3E 3RGUA 4H44C 1RY3A 3H1JE 1SQQG 1BGYG 2HODB 1W2BO 2OYHA 1Q2NA 3L74E 1KYOD 2XNXA 1RF0A 3V6IA 3H32A 1USEA 2ZVOB 3TNUA 4IL6X 3Q5PA 3A0BE 1MFTA 1URQB 2R5DA 5GTIH 2P7JA 2KYVA 5M1BA 4I7ZB 1FAVA 1S2EA 3U1CA 2Q9IA 1E5WA 2ZXXA 3SWYA 3HUSB 5KLVK 2Q3IA 2A45H 1DX7A 1BE3D 2WPRA 1FDOA 1NOHA 3JSVC 3PJSK 4GDOA 5CCGA 3H1IG 4DOJA 4PV1D 4QMAA 1KORA 4U3FJ 1PFIA 1RE4A 4BRYB 1EDKA 2IZ1A 3TSIA 2H7HA 4AYCA 1OX3A 4ZKUA 3CMEP 1KB9H 1N8RQ 2Y9ZA 1SQXJ 1KD1Q 1DH3A 5AW7B 3SWKA 2KLVA 3U1AA 1KFMA 5AW1B 1JY2P 3OA7A 1QL1A 1KILB 1JMBA 1FZAA 3PTZA 4M3LA 2C9NY 2FYUD 5APTA 4ASWA 1GL2B 2K9YA 2JKVA 5CHXA 2UWJE 3IN6A 3H6PA 3CXHI 5AVVB 2C0WA 1YJNP 1AA0A 1IJDB 1LTTC 1IZNB 3TYYA 1HJ0A 5GTIE 4I1LA 2QJYB 1BSHA 1K8AQ 1ZLLA 2AEFA 2E75B 2BCCG 3MUDC 1FC2C 2ZT9C 3H32B 2YIUB 3GLMA 1OVUA 3H1HJ 2ZYAA 2IZ0A 1GW3A 1RF1A 3CCQP 5KAIH 1XTGB 1PPJD 2I1JA 2R3CA 5B5EE 1H89A 2IPPA 2DW3A 1BSNA 1W5CE 2AXCA 3UIAA 2BEQD 3LW5J 4C7NA 2R32A 3M06A 1NKNA 2WSFJ 3KHUA 1RQVA 4PV1C 1AJYA 3FGAD 1FJPA 1KB9E 4W80A 4XA4A 4EI2A 2IYOA 3I55P 1VQ6P 2OGUA 1QX8A 3L75E 1EQ7A 3CX5I 4DZOA 1J1DB 1CSBA 5C39A 4OGQB 1NTMG 1LTGC 1LWUA 1EZVE 3HD7A 1SQPD 1BCCD 2FXMA 1MFZA 3F5HA 2Z5IA 2P10A 3FWNA 1VQ7P 1JCCA 1KQSO 3A7OA 1KB9D 3G3ZA 3CD6P 1M1JB 4UB8H 2K3RA 3EFFK 3G6EP 5BU5A 1KZUB 2WPVB 3MTUE 4TT3H 1YHQP 1ZR4A 3MIWA 3CC7P 3VMAA 1SQQJ 4H0LD 2H89C 4XFJA 3VYIA 1PGPA 1BGYJ 1N2DC 1SVFA 5KAIE 1SP4A 2LKMA 4B86A 3L71E 2PFXA 1L0LJ 1N7SD 2M3EA 3CCSP 3L73D 1KFNA 1OZHA 3A3YB 2A06E 3HE5A 2Z5HA 2NPSC 2N1TA 1H0TA 2KXPB 3HRNA 3RL0B 3CC4P 1ZRTE 2GM4A 1T6AA 3HE4A 3HTKB 4PD4I 3BCCJ 1IO4A 2WSCJ 1SFCD 4RESB 2JDIH 2M8RA 2ZFCA 1QL2A 1SQVE 4C7NB 3H1IJ 1JY3O 1YYCA 3CCVP 1ZOYC 5AW4B 2LXCB 2Y9YA 1KTMA 3L71D 3U59A 3TGUD 4XE5B 2A06D 1FOSE 5L8RJ 2WPQA 1OVRA 3AE3C 2C9LY 1SLQA 1SQBK 1NYHA 1BE3G 3SSUA 4BWNA 3H1JG 2KNCB 2OTLP 5APVA 1ZRTD 1M7LA 3ZDMA 1U57A 4Z1MH 3M9QA 3PP5A 2M3BA 3L74G 4UB8E 3CWBJ 1NU1E 2MKVA 2KSJA 1WMKA 1T2KD 3RL0g 1D7MA 1SQVD 1S9KE 1GD2E 2B87B 1YITP 1JY2N 2JWAA 3L72J 2RH0A 2LXBA 1Z56A 3LIDA 3B5NA 2KUBA 1KILE 1J2JB 1SQVK 1K05A 2Q5UA 1JNMA 1NTZE 1OFCX 4GOFA 2QIWA 1DD4A 4H0LC 3AE2C 1KYOH 3AE9C 3AEGC 4RJTA 1NU1D 3WU2H 2WT7B 1LTJB 2O01N 3B5NC 2WMMA 1W2EA 2JWDA 1L0ND 1S9KD 2BCCJ 1N7SC 1PGQA 3ITKA 5KJ7A 3VP8A 5CCHD 1ZR2A 2YKOA 1NU1K 4Y28J 3I5CA 1PP9G 2KB7P 1KILD 1PGOA 1G2CB 1HTLC 2IFMA 3HE4B 3V4QA 1L4AA 2Y0CA 1SFCC 2O1JA 2OTJP 3H1KE 2M5AA 1FOSF 3GHGB 2KS1B 3PHLA 1NTZK 1KQGB 2KIKA 1JM0A 3KZIH 4C46A 1NTKE 1Y8AA 1FZFA 2E75D 4W7ZA 2O01J 2D2CB 2Q3EA 1CI6A 2W6BA 1DEEG 1P84I 1NTMJ 1XTCC 3N7NA 2IBZG 4I7ZC 4JF7A 4A7PA 2FXOA 1H8AA 1HUCA 3F89A 3CCUP 3HUSC 1T2KC 4WY4A 2QM8A 2WSSH 2ITAA 3S4RA 1T3UA 1MKMA 2OYIA 1KYOE 1EDIA 3EQ2A 3VTPC 3WU2E 1NTKD 4H13B 2WQYC 1H88A 1OMIA 1J1EB 2C0XA 1X0TA 1EXJA 4NPDA 4OVNF 2QJPB 1VL2A 3ABVC 1Q82Q 3II6A 3JC22 4IL6H 1LT9B 5AW9B 4OGQD 4ZKPA 2YNYA 2FYZA 2HPCA 4YXWH 5CCHC 2V4HA 1AQ5A 1M8OB 1S5LH 3L75G 3B4SA 2P58A 1KILC 2JR8A 1EZVG 2AXTH 3GW6A 2POHA 4U3FE 3LW5H 4LLHA 1N73B 1NJIQ 1R5LA 1L4AB 5KLVJ 3RK2B 2WSFH 5E79H 1VQLP 1LTIC 2M5AB 4RKUJ 3TDKA 2JEEA 2FKWB 4BXLA 5BVZA 1JTHA 1GTWA 1QLED 1PV3A 5AVYB 2NZ2A 3WMM0 1NWQA 2FYUE 5DJUB 2E75C 1YI2P 2FFDB 3BASA 2OARA 5TISH 3H1JJ 2YIUC 4L75A 3B8EB 3V2QA 1SQBG 4U3FD 3L74J 4N78E 4ASVA 5CJ0A 3A2AA 3RL0D 1VQ4P 1ZV8A 3BRTB 3A0HH 3E1IA 1SQXD 2ZJSE 3CCEP 2E43A 3R4YA 4WY4B 1VF5B 3BATA 3SFDC 2N9YB 3IF4A 2L91A 3LIEA 1M90Q 1FDIA 4H44B 4L76A 1AVOA 1EDJA 3H1LJ 1IFJA 2IBZI 1S5LE 2XV5A 1SQVG 2KK7A 3MUDA 1PPJE 1HBWA 4I2LC 4N78D 1KV4A 1J1DC 3GF3A 4D6TJ 2FYUK 4N3YB 3V2PA 4OGQC 3EFGA 3W67A 3M9HA 2FYNB 4JQ0D 1FZCC 3C8VA 1KQLA 1OVVA 2GA1A 1PP9J 4HKZH 4KT0J 2OYHB 3CX5H 5E79E 2WSEJ 5AW6B 3TNUB 3M0DC 2PAJA 1USDA 1NU1G 5AVSB 2VRSA 5EFWB 1M1JC 2W90A 2WSCH 3H1HD 3Q3DA 3GG2A 1OIPA 1SQPE 4HH2A 1JY3N 1LJ2A 3AE5C 5TISE 1BCCE 3KPEA 2H88C 3KXDA 3D6ZA 4JYBA 2Q7CA 3VOPA 1OW7A 4JPZB 1EZVI 5KKZB 1NTZG 2YMYA 3A0HE 2SPZA 5AVXB 2B88A 2KZJA 3S1KA 3AE4C 4O9BA 4UB6H 2RKLA 3MGNA 1JOCA 1IFNA 1FZGA 4YXDC 2YKQA 3OJAB 3AE6C 2H43A 1CW5A 3FWLA 3EWKA 4CPGA 2AEJA 3L73E 2H8PD 1SQPK 3KDPB 1L0LE 1HGVA 4PD4H 3L70J 1QEXA 4PJ0H 3L70D 3O6QA 2HLOA 2QG4A 3H1KG 1U7JA 1S72P 3CX5E 1BDCA 2ZT9B 2D2CD 1FZEA 2NPSA 3BCCE 2MJZA 1SQQD 3L75J 5AW3B 1BGYD 5CJ4A 2IYPA 3VP9A 2E5YA 3TGUE 1L0LD 1GMJA 4I6MC 1YTZT 2R3SA 1WRGA 4H13D 1N7LA 4KHXA 1ZN5A 1TU3F 1RF1B 3CX5D 1YJ9P 2WVRA 4K3AA 1ZMEC 1L0LK 1R8EA 1A02J 3BCCD 1Q81Q 3CWBE 1CZQA 1Q90D 2I1KA 1KC8Q 1LNQA 4UB6E 1LTJC 2O01H 2XNDH 3H1ID 1KMIZ 1OW6A 3L72E 1FDMA 1FS0E 1SQBJ 2YXQB 1S1CX 1URQD 2XU6A 1G1JA 1YQ3C 1LWUB 3HD7B 1QVFO 3FXDA 2WZ7A 3PRJA 2IDBA 1EXIA 3CWBD 2L5GB 1MV8A 3D71A 3RK2D 1L0NE 3T97A 2P1JA 3VMYA 3L36A 4U3FG 3GHGC 3P7KA 1NAFA 2W27A 4OWFA 3L72D 1KN7A 3CCRP 1UIIA 4TLFA 1N7SA 1K04A 2GUVA 2J58A 2D2CC 3C9IA 2OQQA 4PD4D 2YMKA 2NPSB 4IFMA 3Q1MA 2QSIA 2FYUG 3MD0A 5AVRB 2K9JA 1E79H 4AQRD 1SFCA 1P84H 2BCCD 1MZ9A 1YQ4C 4IFFA 1VF5D 3HE5B 1G1IA 5KTBA 1YBKA 4H13C 2N1TB 1L0NK 1OWAA 1H0TB 2HODA 1J1EC 4Y99B 5AVTB 3MP7B 1IC2A 1GL2D 2QA4P 2J5UA 1JY3P 5KLIB 4GT1A 1LT9C 3N4XA 1NTZJ 5APWA 1PPJG 1AQTA 3HUSA 5CBNA 5GTHH 5AVQB 3GMAA 1URQC 3RK3B 2WTYA 2KSEA 2E76B 1RE3C 5AVUB 1KYOI 1NTMD 2WPSA 2E42A 3VMXA 2E74B 1DD3A 1N73C 1JUNA 3AEDC 2A45G 3RK2C 2PP6A 1VQMP 3WUUA 4LGDE 2QJKB 2B89A 1PL5A 3CCJP 4N6JA 4NPEA 3H1KJ 1IK7A 1SQPG 3B5NB 5CCGD 1PZQA 3P32A 1BCCG 5CCHA 2FFDC 1X9VA 1JO5A 3AEAC 1KILA 1QGKB 1NTKK 2BASA 5KLVE 1RHZB 3AE8C 2WSEH 1JY2O 1LP1A 1S4XA 2WWWA 3CL3D 4IOIH 2K9JB 1SFCB 4WBAA 1AV1A 1FZBA 4C7RA 2HYNA 4L74A 1OXZA 1JCDA 2I8DA 1L2PA 3E7KA 3S9OA 5TJHA 3A5TA 4R4MA 1P84D 1GL2C 3KZIE 2W6JH 5CBOA 4EDFA 3V4WA 2GUSA 4EYYQ 5GTHE 4NPFX 3L73G
chains in the Genus database with same CATH topology
2M0BA 1EDIA 1S3JA 1Y47A 4GODA 3PH0A 2WMMA 2B87A 2JWDA 3RGUA 4ASVA 1JMBA 3QWOC 2OTKE 1SS1A 2Q1KA 5C39A 2HR3A 1X0TA 4ASWA 1EC5A 4NPDA 1Q2NA 4JBZA 2UWJE 2LXCB 1U7MA 1ZW0A 2B89A 5DJTB 1ZXGA 2SPZA 1MFTA 4HB1A 1EDLA 4K3AA 4K35A 4NPEA 2B88A 2KZJA 3S1KA 1OVRA 3FXEA 2RKLA 4WWIA 2M5AA 1EDJA 2LR2A 2K3RA 2P58A 3ZDMA 1LT1A 2KS1B 2KZIA 2QRXA 1H0TB 1FC2C 3MZWB 4HJGH 4KJMA 2KIKA 3MHVA 1JM0A 1OVUA 1LP1A 4GOEA 4CPGA 4IOIH 4MN4C 2B87B 5K5GB 1DEEG 2LXBA 1OVVA 1BDDA 2ZAEB 4HKZH 2M5AB 2KUBA 4BXLA 2I8DA 1U7JA 4ZNCA 3FXDA 1EDKA 1BDCA 5CBNA 5EFWB 2QVAA 2R44A 5CBOA 1LP1B 2KI7B 4GOFA 5DJUB 4ZMDA 1H0TA 4EYYQ 4NPFX 1NVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0B A;  1EDI A;  1S3J A;  1Y47 A;  4GOD A;  3PH0 A;  2WMM A;  2B87 A;  2JWD A;  3RGU A;  4ASV A;  1JMB A;  3QWO C;  2OTK E;  1SS1 A;  2Q1K A;  5C39 A;  2HR3 A;  1X0T A;  4ASW A;  1EC5 A;  4NPD A;  1Q2N A;  4JBZ A;  2UWJ E;  2LXC B;  1U7M A;  1ZW0 A;  2B89 A;  5DJT B;  1ZXG A;  2SPZ A;  1MFT A;  4HB1 A;  1EDL A;  4K3A A;  4K35 A;  4NPE A;  2B88 A;  2KZJ A;  3S1K A;  1OVR A;  3FXE A;  2RKL A;  4WWI A;  2M5A A;  1EDJ A;  2LR2 A;  2K3R A;  2P58 A;  3ZDM A;  1LT1 A;  2KS1 B;  2KZI A;  2QRX A;  1H0T B;  1FC2 C;  3MZW B;  4HJG H;  4KJM A;  2KIK A;  3MHV A;  1JM0 A;  1OVU A;  1LP1 A;  4GOE A;  4CPG A;  4IOI H;  4MN4 C;  2B87 B;  5K5G B;  1DEE G;  2LXB A;  1OVV A;  1BDD A;  2ZAE B;  4HKZ H;  2M5A B;  2KUB A;  4BXL A;  2I8D A;  1U7J A;  4ZNC A;  3FXD A;  1EDK A;  1BDC A;  5CBN A;  5EFW B;  2QVA A;  2R44 A;  5CBO A;  1LP1 B;  2KI7 B;  4GOF A;  5DJU B;  4ZMD A;  1H0T A;  4EYY Q;  4NPF X;  1NVO A; 
#chains in the Genus database with same CATH topology
 2CPB A;  1VQ8 P;  1L0L G;  1IFP A;  5KLV D;  3M0A A;  3W68 A;  2ZT9 D;  3G71 P;  1SQX E;  3BRV B;  1IK9 A;  1LTB C;  3KYQ A;  5AW2 B;  3QWO C;  2QJY C;  2FYN C;  4GIF A;  4L73 A;  1VQ5 P;  1S5L X;  1Q86 Q;  2YKP A;  2XDJ A;  1EC5 A;  1OW8 A;  2ZYG A;  1AVY A;  3Q5R A;  1GU4 A;  3CXH H;  3QH9 A;  2OYH C;  2V7Q J;  5AVZ B;  1BE3 J;  3BCC G;  1RF0 C;  5DJT B;  1ZXG A;  1CI6 B;  1T8Z A;  3H1J D;  4K35 A;  3H1L E;  2RMZ A;  1X22 A;  1IFI A;  2ZXE B;  1GU5 A;  3L35 A;  4IFD K;  3L74 D;  3FXE A;  3L71 G;  1YIJ P;  4D6T E;  4WWI A;  5B5E H;  3TGU G;  2A06 G;  2LR2 A;  3L37 A;  4YTP C;  2B9B A;  1VDF A;  3NFQ A;  2OYI B;  4WVZ A;  1PP9 E;  5CCG C;  4IL6 E;  3KQG A;  5KKZ C;  1FZC A;  1SQX K;  3CWB G;  4DCK A;  3RBX A;  3H1H E;  1GK6 A;  2YXR B;  4AUW A;  3I56 P;  5B66 H;  3H1L D;  1VQO P;  2ZYD A;  2G3A A;  1VQP P;  3IR9 A;  3D6Y A;  4ZNC A;  3CCM P;  1PGJ A;  2FYU J;  3AE7 C;  3M0D A;  1RE4 C;  2A45 I;  2AXT E;  2AEM A;  4D6T D;  1M1J A;  3L72 G;  4EOT A;  2RN0 A;  2QVA A;  1M56 D;  1LP1 B;  3IFM A;  2OYO A;  2ZVN B;  2HPC B;  3HD7 D;  1JMM A;  1JB0 J;  2Y0E A;  1NGM B;  3CCL P;  2FBW C;  1Y47 A;  2W83 C;  3P8M C;  3PH0 A;  2CPS A;  1PP9 D;  1HJB A;  3AEB C;  2XZR A;  3G9R A;  1YJW P;  2IBZ E;  4JBZ A;  1L0N G;  1K9M Q;  3CXH E;  1KB9 I;  1U7M A;  3TK1 A;  4HB1 A;  3WUT A;  4R4L A;  2NPS D;  1M57 D;  2KP8 A;  1JTH B;  1HGZ A;  1IFD A;  3HTK A;  1Q7Y Q;  2QM7 A;  3SWF A;  1NO4 A;  2KZI A;  3D70 A;  1LTA C;  3L70 E;  3MZW B;  4HJG H;  4GOE A;  4YPC A;  1YTZ I;  2IBZ D;  1ZP0 C;  4OH8 B;  4MN4 C;  5KAF H;  4EIJ A;  2N1T D;  3RL0 C;  1RF1 C;  3CXH D;  3RK3 E;  2HFE D;  3IAO A;  1NHL A;  2JO1 A;  3SFE C;  1SQQ E;  5B66 E;  5AVW B;  1N86 A;  1BGY E;  2WIT A;  2Z4E A;  2KNC A;  1SQP J;  2YO2 A;  2R44 A;  1BCC J;  3OAK A;  4ZMD A;  1FZC B;  2M0B A;  2K88 A;  3Q2Y A;  3AEC C;  3NXS A;  2QEX P;  2B87 A;  1SS1 A;  2N9B A;  1M1K Q;  2HR3 A;  3RK3 D;  3CLQ A;  2E76 D;  2Y0D A;  1NTK G;  1KQF B;  3OW2 O;  1LWU C;  3HD7 C;  3CPW O;  3R2P A;  1PIX A;  2E74 D;  1ZW0 A;  5H2F H;  3NTN A;  3USS A;  3AEE C;  3L75 D;  3H1I E;  2R5B A;  2NRG A;  1LGH B;  2CK3 H;  1GK4 A;  1NAY A;  3JCU H;  3C1L A;  1EZV D;  2WT7 A;  1LTJ A;  1SQQ K;  2IFN A;  3L4F A;  1SQB E;  3CI9 A;  1LT1 A;  1FJK A;  4PV1 B;  3B5N D;  3L73 J;  3MHV A;  4DJG A;  2XKM A;  1HWT C;  2J59 M;  3VMZ A;  1G2C A;  5KAF E;  1AFO A;  2Q6Q A;  3PLN A;  1HF9 A;  1GZL A;  5KJ7 D;  1DIP A;  5KLV G;  2K1A A;  1NKZ B;  1SQB D;  3GHG A;  2KS1 A;  3TF5 A;  3L71 J;  2N1T C;  1NVO A;  3TGU J;  4PD4 E;  4Y99 C;  4GOD A;  4PJ0 E;  2PRR A;  1UIX A;  2PGD A;  5KLI C;  1L4A D;  2P2U A;  3P8C E;  2KLU A;  2YO3 A;  3WUV A;  2BCC E;  5CMZ A;  1RQU A;  2JJL A;  1DEB A;  2KOG A;  5APX A;  1VQ9 P;  3G4S P;  1A02 F;  1VQK P;  1FU1 A;  1EDL A;  1GDT A;  1SQV J;  1JEK A;  3O6Q B;  5H2F E;  4LC1 A;  1MUU A;  1SQX G;  3JCU E;  3RK3 C;  2E76 C;  1QVG O;  2HG5 D;  3GF7 A;  1HH0 A;  2E74 C;  1WT6 A;  1IFM A;  4KJM A;  2K37 A;  1HVV A;  1RH5 B;  3P8C D;  3H1L G;  3V2N A;  5BU8 B;  2JP3 A;  1NU1 J;  4WY4 D;  2QJK C;  2P67 A;  5K5G B;  1LT9 A;  3V2R A;  3M91 A;  5APQ A;  4D6T G;  2ZAE B;  1L0N J;  3AEF C;  3AE1 C;  4H44 D;  3NMD A;  1NTM E;  2QJP C;  2FXP A;  2KI7 B;  5AW5 B;  1K73 Q;  1URQ A;  2W8Z A;  4JYC A;  2O3J A;  2V7Q H;  1RE3 A;  4DT0 A;  2QE7 H;  1S3J A;  3B71 A;  3H1H G;  1N73 A;  2OTK E;  1NTZ D;  2Q1K A;  5KJ7 C;  2IX7 C;  5AW0 B;  2G8Y A;  1Y9B A;  1T3J A;  3A0B H;  2BEZ F;  1X79 B;  5APY A;  4RO0 A;  5APS A;  2FFD A;  1R5S A;  2E5T A;  1L4A C;  3CC2 P;  5AW8 B;  2O1K A;  3RBZ A;  1GW4 A;  3CMA P;  3T97 B;  4BRY A;  1NTM K;  3H25 A;  1X8Y A;  4H0L B;  1VPC A;  2QRX A;  4GKG A;  3FX0 A;  2W6A A;  4HYT B;  3H1K D;  5APU A;  3O8Z A;  4W7Y A;  1N7S B;  4U7J A;  4WB4 A;  3M9B A;  1P84 E;  1VQN P;  1BDD A;  1NTK J;  3VN0 A;  2FY8 A;  1NH4 A;  1FBM A;  1GL2 A;  3L70 G;  3V5B A;  3K5B A;  3Q5S A;  1FE6 A;  4WY4 C;  3E1R A;  1LTS C;  1VF5 C;  2OYI C;  3BVH A;  1BE3 E;  3RGU A;  4H44 C;  1RY3 A;  3H1J E;  1SQQ G;  1BGY G;  2HOD B;  1W2B O;  2OYH A;  1Q2N A;  3L74 E;  1KYO D;  2XNX A;  1RF0 A;  3V6I A;  3H32 A;  1USE A;  2ZVO B;  3TNU A;  4IL6 X;  3Q5P A;  3A0B E;  1MFT A;  1URQ B;  2R5D A;  5GTI H;  2P7J A;  2KYV A;  5M1B A;  4I7Z B;  1FAV A;  1S2E A;  3U1C A;  2Q9I A;  1E5W A;  2ZXX A;  3SWY A;  3HUS B;  5KLV K;  2Q3I A;  2A45 H;  1DX7 A;  1BE3 D;  2WPR A;  1FDO A;  1NOH A;  3JSV C;  3PJS K;  4GDO A;  5CCG A;  3H1I G;  4DOJ A;  4PV1 D;  4QMA A;  1KOR A;  4U3F J;  1PFI A;  1RE4 A;  4BRY B;  1EDK A;  2IZ1 A;  3TSI A;  2H7H A;  4AYC A;  1OX3 A;  4ZKU A;  3CME P;  1KB9 H;  1N8R Q;  2Y9Z A;  1SQX J;  1KD1 Q;  1DH3 A;  5AW7 B;  3SWK A;  2KLV A;  3U1A A;  1KFM A;  5AW1 B;  1JY2 P;  3OA7 A;  1QL1 A;  1KIL B;  1JMB A;  1FZA A;  3PTZ A;  4M3L A;  2C9N Y;  2FYU D;  5APT A;  4ASW A;  1GL2 B;  2K9Y A;  2JKV A;  5CHX A;  2UWJ E;  3IN6 A;  3H6P A;  3CXH I;  5AVV B;  2C0W A;  1YJN P;  1AA0 A;  1IJD B;  1LTT C;  1IZN B;  3TYY A;  1HJ0 A;  5GTI E;  4I1L A;  2QJY B;  1BSH A;  1K8A Q;  1ZLL A;  2AEF A;  2E75 B;  2BCC G;  3MUD C;  1FC2 C;  2ZT9 C;  3H32 B;  2YIU B;  3GLM A;  1OVU A;  3H1H J;  2ZYA A;  2IZ0 A;  1GW3 A;  1RF1 A;  3CCQ P;  5KAI H;  1XTG B;  1PPJ D;  2I1J A;  2R3C A;  5B5E E;  1H89 A;  2IPP A;  2DW3 A;  1BSN A;  1W5C E;  2AXC A;  3UIA A;  2BEQ D;  3LW5 J;  4C7N A;  2R32 A;  3M06 A;  1NKN A;  2WSF J;  3KHU A;  1RQV A;  4PV1 C;  1AJY A;  3FGA D;  1FJP A;  1KB9 E;  4W80 A;  4XA4 A;  4EI2 A;  2IYO A;  3I55 P;  1VQ6 P;  2OGU A;  1QX8 A;  3L75 E;  1EQ7 A;  3CX5 I;  4DZO A;  1J1D B;  1CSB A;  5C39 A;  4OGQ B;  1NTM G;  1LTG C;  1LWU A;  1EZV E;  3HD7 A;  1SQP D;  1BCC D;  2FXM A;  1MFZ A;  3F5H A;  2Z5I A;  2P10 A;  3FWN A;  1VQ7 P;  1JCC A;  1KQS O;  3A7O A;  1KB9 D;  3G3Z A;  3CD6 P;  1M1J B;  4UB8 H;  2K3R A;  3EFF K;  3G6E P;  5BU5 A;  1KZU B;  2WPV B;  3MTU E;  4TT3 H;  1YHQ P;  1ZR4 A;  3MIW A;  3CC7 P;  3VMA A;  1SQQ J;  4H0L D;  2H89 C;  4XFJ A;  3VYI A;  1PGP A;  1BGY J;  1N2D C;  1SVF A;  5KAI E;  1SP4 A;  2LKM A;  4B86 A;  3L71 E;  2PFX A;  1L0L J;  1N7S D;  2M3E A;  3CCS P;  3L73 D;  1KFN A;  1OZH A;  3A3Y B;  2A06 E;  3HE5 A;  2Z5H A;  2NPS C;  2N1T A;  1H0T A;  2KXP B;  3HRN A;  3RL0 B;  3CC4 P;  1ZRT E;  2GM4 A;  1T6A A;  3HE4 A;  3HTK B;  4PD4 I;  3BCC J;  1IO4 A;  2WSC J;  1SFC D;  4RES B;  2JDI H;  2M8R A;  2ZFC A;  1QL2 A;  1SQV E;  4C7N B;  3H1I J;  1JY3 O;  1YYC A;  3CCV P;  1ZOY C;  5AW4 B;  2LXC B;  2Y9Y A;  1KTM A;  3L71 D;  3U59 A;  3TGU D;  4XE5 B;  2A06 D;  1FOS E;  5L8R J;  2WPQ A;  1OVR A;  3AE3 C;  2C9L Y;  1SLQ A;  1SQB K;  1NYH A;  1BE3 G;  3SSU A;  4BWN A;  3H1J G;  2KNC B;  2OTL P;  5APV A;  1ZRT D;  1M7L A;  3ZDM A;  1U57 A;  4Z1M H;  3M9Q A;  3PP5 A;  2M3B A;  3L74 G;  4UB8 E;  3CWB J;  1NU1 E;  2MKV A;  2KSJ A;  1WMK A;  1T2K D;  3RL0 g;  1D7M A;  1SQV D;  1S9K E;  1GD2 E;  2B87 B;  1YIT P;  1JY2 N;  2JWA A;  3L72 J;  2RH0 A;  2LXB A;  1Z56 A;  3LID A;  3B5N A;  2KUB A;  1KIL E;  1J2J B;  1SQV K;  1K05 A;  2Q5U A;  1JNM A;  1NTZ E;  1OFC X;  4GOF A;  2QIW A;  1DD4 A;  4H0L C;  3AE2 C;  1KYO H;  3AE9 C;  3AEG C;  4RJT A;  1NU1 D;  3WU2 H;  2WT7 B;  1LTJ B;  2O01 N;  3B5N C;  2WMM A;  1W2E A;  2JWD A;  1L0N D;  1S9K D;  2BCC J;  1N7S C;  1PGQ A;  3ITK A;  5KJ7 A;  3VP8 A;  5CCH D;  1ZR2 A;  2YKO A;  1NU1 K;  4Y28 J;  3I5C A;  1PP9 G;  2KB7 P;  1KIL D;  1PGO A;  1G2C B;  1HTL C;  2IFM A;  3HE4 B;  3V4Q A;  1L4A A;  2Y0C A;  1SFC C;  2O1J A;  2OTJ P;  3H1K E;  2M5A A;  1FOS F;  3GHG B;  2KS1 B;  3PHL A;  1NTZ K;  1KQG B;  2KIK A;  1JM0 A;  3KZI H;  4C46 A;  1NTK E;  1Y8A A;  1FZF A;  2E75 D;  4W7Z A;  2O01 J;  2D2C B;  2Q3E A;  1CI6 A;  2W6B A;  1DEE G;  1P84 I;  1NTM J;  1XTC C;  3N7N A;  2IBZ G;  4I7Z C;  4JF7 A;  4A7P A;  2FXO A;  1H8A A;  1HUC A;  3F89 A;  3CCU P;  3HUS C;  1T2K C;  4WY4 A;  2QM8 A;  2WSS H;  2ITA A;  3S4R A;  1T3U A;  1MKM A;  2OYI A;  1KYO E;  1EDI A;  3EQ2 A;  3VTP C;  3WU2 E;  1NTK D;  4H13 B;  2WQY C;  1H88 A;  1OMI A;  1J1E B;  2C0X A;  1X0T A;  1EXJ A;  4NPD A;  4OVN F;  2QJP B;  1VL2 A;  3ABV C;  1Q82 Q;  3II6 A;  3JC2 2;  4IL6 H;  1LT9 B;  5AW9 B;  4OGQ D;  4ZKP A;  2YNY A;  2FYZ A;  2HPC A;  4YXW H;  5CCH C;  2V4H A;  1AQ5 A;  1M8O B;  1S5L H;  3L75 G;  3B4S A;  2P58 A;  1KIL C;  2JR8 A;  1EZV G;  2AXT H;  3GW6 A;  2POH A;  4U3F E;  3LW5 H;  4LLH A;  1N73 B;  1NJI Q;  1R5L A;  1L4A B;  5KLV J;  3RK2 B;  2WSF H;  5E79 H;  1VQL P;  1LTI C;  2M5A B;  4RKU J;  3TDK A;  2JEE A;  2FKW B;  4BXL A;  5BVZ A;  1JTH A;  1GTW A;  1QLE D;  1PV3 A;  5AVY B;  2NZ2 A;  3WMM 0;  1NWQ A;  2FYU E;  5DJU B;  2E75 C;  1YI2 P;  2FFD B;  3BAS A;  2OAR A;  5TIS H;  3H1J J;  2YIU C;  4L75 A;  3B8E B;  3V2Q A;  1SQB G;  4U3F D;  3L74 J;  4N78 E;  4ASV A;  5CJ0 A;  3A2A A;  3RL0 D;  1VQ4 P;  1ZV8 A;  3BRT B;  3A0H H;  3E1I A;  1SQX D;  2ZJS E;  3CCE P;  2E43 A;  3R4Y A;  4WY4 B;  1VF5 B;  3BAT A;  3SFD C;  2N9Y B;  3IF4 A;  2L91 A;  3LIE A;  1M90 Q;  1FDI A;  4H44 B;  4L76 A;  1AVO A;  1EDJ A;  3H1L J;  1IFJ A;  2IBZ I;  1S5L E;  2XV5 A;  1SQV G;  2KK7 A;  3MUD A;  1PPJ E;  1HBW A;  4I2L C;  4N78 D;  1KV4 A;  1J1D C;  3GF3 A;  4D6T J;  2FYU K;  4N3Y B;  3V2P A;  4OGQ C;  3EFG A;  3W67 A;  3M9H A;  2FYN B;  4JQ0 D;  1FZC C;  3C8V A;  1KQL A;  1OVV A;  2GA1 A;  1PP9 J;  4HKZ H;  4KT0 J;  2OYH B;  3CX5 H;  5E79 E;  2WSE J;  5AW6 B;  3TNU B;  3M0D C;  2PAJ A;  1USD A;  1NU1 G;  5AVS B;  2VRS A;  5EFW B;  1M1J C;  2W90 A;  2WSC H;  3H1H D;  3Q3D A;  3GG2 A;  1OIP A;  1SQP E;  4HH2 A;  1JY3 N;  1LJ2 A;  3AE5 C;  5TIS E;  1BCC E;  3KPE A;  2H88 C;  3KXD A;  3D6Z A;  4JYB A;  2Q7C A;  3VOP A;  1OW7 A;  4JPZ B;  1EZV I;  5KKZ B;  1NTZ G;  2YMY A;  3A0H E;  2SPZ A;  5AVX B;  2B88 A;  2KZJ A;  3S1K A;  3AE4 C;  4O9B A;  4UB6 H;  2RKL A;  3MGN A;  1JOC A;  1IFN A;  1FZG A;  4YXD C;  2YKQ A;  3OJA B;  3AE6 C;  2H43 A;  1CW5 A;  3FWL A;  3EWK A;  4CPG A;  2AEJ A;  3L73 E;  2H8P D;  1SQP K;  3KDP B;  1L0L E;  1HGV A;  4PD4 H;  3L70 J;  1QEX A;  4PJ0 H;  3L70 D;  3O6Q A;  2HLO A;  2QG4 A;  3H1K G;  1U7J A;  1S72 P;  3CX5 E;  1BDC A;  2ZT9 B;  2D2C D;  1FZE A;  2NPS A;  3BCC E;  2MJZ A;  1SQQ D;  3L75 J;  5AW3 B;  1BGY D;  5CJ4 A;  2IYP A;  3VP9 A;  2E5Y A;  3TGU E;  1L0L D;  1GMJ A;  4I6M C;  1YTZ T;  2R3S A;  1WRG A;  4H13 D;  1N7L A;  4KHX A;  1ZN5 A;  1TU3 F;  1RF1 B;  3CX5 D;  1YJ9 P;  2WVR A;  4K3A A;  1ZME C;  1L0L K;  1R8E A;  1A02 J;  3BCC D;  1Q81 Q;  3CWB E;  1CZQ A;  1Q90 D;  2I1K A;  1KC8 Q;  1LNQ A;  4UB6 E;  1LTJ C;  2O01 H;  2XND H;  3H1I D;  1KMI Z;  1OW6 A;  3L72 E;  1FDM A;  1FS0 E;  1SQB J;  2YXQ B;  1S1C X;  1URQ D;  2XU6 A;  1G1J A;  1YQ3 C;  1LWU B;  3HD7 B;  1QVF O;  3FXD A;  2WZ7 A;  3PRJ A;  2IDB A;  1EXI A;  3CWB D;  2L5G B;  1MV8 A;  3D71 A;  3RK2 D;  1L0N E;  3T97 A;  2P1J A;  3VMY A;  3L36 A;  4U3F G;  3GHG C;  3P7K A;  1NAF A;  2W27 A;  4OWF A;  3L72 D;  1KN7 A;  3CCR P;  1UII A;  4TLF A;  1N7S A;  1K04 A;  2GUV A;  2J58 A;  2D2C C;  3C9I A;  2OQQ A;  4PD4 D;  2YMK A;  2NPS B;  4IFM A;  3Q1M A;  2QSI A;  2FYU G;  3MD0 A;  5AVR B;  2K9J A;  1E79 H;  4AQR D;  1SFC A;  1P84 H;  2BCC D;  1MZ9 A;  1YQ4 C;  4IFF A;  1VF5 D;  3HE5 B;  1G1I A;  5KTB A;  1YBK A;  4H13 C;  2N1T B;  1L0N K;  1OWA A;  1H0T B;  2HOD A;  1J1E C;  4Y99 B;  5AVT B;  3MP7 B;  1IC2 A;  1GL2 D;  2QA4 P;  2J5U A;  1JY3 P;  5KLI B;  4GT1 A;  1LT9 C;  3N4X A;  1NTZ J;  5APW A;  1PPJ G;  1AQT A;  3HUS A;  5CBN A;  5GTH H;  5AVQ B;  3GMA A;  1URQ C;  3RK3 B;  2WTY A;  2KSE A;  2E76 B;  1RE3 C;  5AVU B;  1KYO I;  1NTM D;  2WPS A;  2E42 A;  3VMX A;  2E74 B;  1DD3 A;  1N73 C;  1JUN A;  3AED C;  2A45 G;  3RK2 C;  2PP6 A;  1VQM P;  3WUU A;  4LGD E;  2QJK B;  2B89 A;  1PL5 A;  3CCJ P;  4N6J A;  4NPE A;  3H1K J;  1IK7 A;  1SQP G;  3B5N B;  5CCG D;  1PZQ A;  3P32 A;  1BCC G;  5CCH A;  2FFD C;  1X9V A;  1JO5 A;  3AEA C;  1KIL A;  1QGK B;  1NTK K;  2BAS A;  5KLV E;  1RHZ B;  3AE8 C;  2WSE H;  1JY2 O;  1LP1 A;  1S4X A;  2WWW A;  3CL3 D;  4IOI H;  2K9J B;  1SFC B;  4WBA A;  1AV1 A;  1FZB A;  4C7R A;  2HYN A;  4L74 A;  1OXZ A;  1JCD A;  2I8D A;  1L2P A;  3E7K A;  3S9O A;  5TJH A;  3A5T A;  4R4M A;  1P84 D;  1GL2 C;  3KZI E;  2W6J H;  5CBO A;  4EDF A;  3V4W A;  2GUS A;  4EYY Q;  5GTH E;  4NPF X;  3L73 G; 
#chains in the Genus database with same CATH homology
 2M0B A;  1EDI A;  1S3J A;  1Y47 A;  4GOD A;  3PH0 A;  2WMM A;  2B87 A;  2JWD A;  3RGU A;  4ASV A;  1JMB A;  3QWO C;  2OTK E;  1SS1 A;  2Q1K A;  5C39 A;  2HR3 A;  1X0T A;  4ASW A;  1EC5 A;  4NPD A;  1Q2N A;  4JBZ A;  2UWJ E;  2LXC B;  1U7M A;  1ZW0 A;  2B89 A;  5DJT B;  1ZXG A;  2SPZ A;  1MFT A;  4HB1 A;  1EDL A;  4K3A A;  4K35 A;  4NPE A;  2B88 A;  2KZJ A;  3S1K A;  1OVR A;  3FXE A;  2RKL A;  4WWI A;  2M5A A;  1EDJ A;  2LR2 A;  2K3R A;  2P58 A;  3ZDM A;  1LT1 A;  2KS1 B;  2KZI A;  2QRX A;  1H0T B;  1FC2 C;  3MZW B;  4HJG H;  4KJM A;  2KIK A;  3MHV A;  1JM0 A;  1OVU A;  1LP1 A;  4GOE A;  4CPG A;  4IOI H;  4MN4 C;  2B87 B;  5K5G B;  1DEE G;  2LXB A;  1OVV A;  1BDD A;  2ZAE B;  4HKZ H;  2M5A B;  2KUB A;  4BXL A;  2I8D A;  1U7J A;  4ZNC A;  3FXD A;  1EDK A;  1BDC A;  5CBN A;  5EFW B;  2QVA A;  2R44 A;  5CBO A;  1LP1 B;  2KI7 B;  4GOF A;  5DJU B;  4ZMD A;  1H0T A;  4EYY Q;  4NPF X;  1NVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...