3FXDA

Crystal structure of interacting domains of icmr and icmq
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
49
structure length
49
Chain Sequence
QLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
total genus 18
structure length 49
sequence length 49
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3fxdA00
2P58A 1Q2NA 2HR3A 4NPDA 2LXBA 5CBOA 1DEEG 1EDJA 2KUBA 5C39A 1LP1B 4K35A 4CPGA 1EC5A 5DJUB 1EDKA 4GOEA 2B87B 2RKLA 2Q1KA 1LP1A 2JWDA 2ZAEB 4KJMA 4HJGH 4JBZA 2M5AB 4ASWA 3RGUA 1H0TA 1OVRA 3MZWB 2LXCB 2KS1B 2KI7B 3PH0A 5DJTB 2I8DA 3S1KA 4K3AA 1X0TA 1U7MA 4ZMDA 3FXEA 4NPFX 4GOFA 3FXDA 2R44A 2B87A 2M0BA 2B89A 1LT1A 2OTKE 2KIKA 1OVVA 2QRXA 2QVAA 4ASVA 5K5GB 4GODA 2SPZA 2M5AA 1JM0A 1U7JA 4IOIH 4EYYQ 5CBNA 1BDCA 4ZNCA 2LR2A 2B88A 3QWOC 1MFTA 1Y47A 1BDDA 1JMBA 1EDLA 3MHVA 2KZIA 4NPEA 4HB1A 4BXLA 1H0TB 1SS1A 1ZXGA 1ZW0A 1S3JA 1OVUA 3ZDMA 2K3RA 4MN4C 4HKZH 2KZJA 1EDIA 1NVOA 2WMMA 2UWJE 1FC2C 4WWIA 5EFWB
chains in the Genus database with same CATH superfamily
1RE3C 1EZVI 2BCCD 1OXZA 4AUWA 2JJLA 1FZEA 5AW8B 1NTZG 1YITP 3HD7B 1L0NE 3MUDC 3A7OA 2XNXA 3TGUE 4EOTA 3KZIE 3PHLA 5DJTB 2I8DA 1GL2B 5AVUB 1KZUB 1JCCA 3KXDA 2KS1A 1LGHB 1M1KQ 2HFED 1KB9E 1QVGO 1BGYG 2JEEA 4EI2A 3CCMP 2VRSA 3KPEA 3H1JD 1NU1J 2ZYDA 5CCHC 4IOIH 4EYYQ 3L73J 1BE3G 1N2DC 3W67A 5CCGC 4D6TJ 1GL2A 1LTJB 3PRJA 1FZBA 5APWA 2MJZA 3LIDA 4D6TD 5B66E 4WB4A 1S3JA 4UB6E 1FZGA 2P7JA 1GMJA 3PTZA 1LTAC 1E5WA 1FC2C 2KNCB 2RN0A 1AQ5A 2N1TD 3AE5C 1QGKB 5AW9B 1LTSC 2N9YB 1JEKA 2YKPA 1FE6A 4R4LA 1FDMA 3AEBC 3HTKB 3GHGC 1R8EA 2IBZI 1PPJD 2O3JA 3U59A 1JUNA 1KYOD 1URQB 2WZ7A 3HE4B 5KLIB 3VTPC 3CXHE 4Z1MH 3P32A 1NTKK 1FZAA 4M3LA 3BRVB 4AYCA 3AE4C 2IYPA 1UIXA 1Y8AA 3Q5PA 3GMAA 4OVNF 1GD2E 4C46A 3HTKA 1JOCA 2WPSA 4ASVA 2N1TA 2QSIA 3W68A 1LTIC 1J2JB 2OYIA 3A0BE 4TLFA 3VOPA 3BCCJ 2HODB 1M1JB 1M57D 2Z4EA 1ZP0C 4L75A 3TF5A 4KHXA 2O01J 1K8AQ 1GK6A 5E79E 1NU1G 3BCCD 1RF0A 4N78D 1S5LX 2KOGA 1VQ4P 3L74J 3AE6C 2FFDB 3L73G 3B8EB 5KLVJ 2Y0CA 4D6TG 1NVOA 1NKZB 2UWJE 2IX7C 3L74D 4BRYB 1DEEG 1TU3F 2AXCA 4CPGA 5C39A 3L37A 1EC5A 2OTJP 1EDKA 1RQUA 2AEFA 1P84H 5KJ7C 2GUSA 1LP1A 1VQKP 4HJGH 2CPSA 4JBZA 4L73A 3D6ZA 3VP9A 1VF5D 2H7HA 1JY3O 1EZVD 4GDOA 2XU6A 1YTZT 4I6MC 3SWFA 5APQA 2KI7B 1LWUC 1H88A 4ZKPA 1RF1A 4ZMDA 2PFXA 4BRYA 3CMEP 2ZT9C 1SQBD 4ZKUA 1RQVA 3AEDC 2WT7A 4O9BA 1KILD 1NTMD 3FXDA 2Q7CA 2KSJA 1N7SC 3RL0B 2IDBA 1NTZK 2O01N 1IFJA 3NFQA 3CL3D 3GG2A 4WY4C 1YHQP 3QWOC 2WSEJ 3TK1A 3V4QA 3CC7P 1XTGB 3M9QA 1ZR2A 1FDIA 3BCCG 1Z56A 2E76B 3SWYA 2KZJA 1SVFA 2G3AA 3H1IE 2Q5UA 2NZ2A 1Q2NA 4NPDA 3U1CA 4U7JA 1KQLA 3CWBJ 3OA7A 1FAVA 1K05A 2OGUA 1HGVA 2WPVB 5APXA 2H89C 5KLVG 3L72D 2Q1KA 3E7KA 3H1KJ 2ZVNB 3CX5E 1ZN5A 3H1HD 1QEXA 1RE3A 1EZVG 4Y99C 1VPCA 3V2PA 3D6YA 5GTIH 2IBZD 5KTBA 2KB7P 4QMAA 2YKQA 2BEQD 5CCGD 3H1LJ 3MD0A 1VQ5P 1SQPK 2YMYA 2OTKE 5AVQB 1L0LK 3MUDA 3U1AA 1HVVA 4IL6X 2QVAA 2FYUE 1YJ9P 4UB6H 5AW3B 3TNUA 3WU2H 1YI2P 1SQQK 2Z5HA 1IFIA 1T3UA 2D2CD 2C0XA 1PP9D 1NTZE 3NXSA 3BVHA 1IO4A 1PFIA 3MHVA 1SS1A 1S9KE 5CCHA 3RBZA 3GF3A 2Y9ZA 4PD4I 4W80A 1GU5A 2O01H 1NH4A 5H2FH 3B5ND 3CXHH 1JY2O 5CCGA 1EQ7A 3I56P 1U57A 1BGYE 3L75J 4GOEA 3PLNA 1R5LA 3AEEC 2ZAEB 1JY3N 1NU1K 1YTZI 2XZRA 1QL2A 3AECC 1GW4A 3CWBG 3SFEC 4R4MA 3A0BH 3D71A 1SQXE 5BU5A 1KYOI 1YQ3C 3H1KG 1BCCJ 4XFJA 3CI9A 1X9VA 1WT6A 5E79H 3M9BA 2M0BA 1BCCD 3GHGA 4BWNA 1KQGB 1OVVA 3N4XA 1DH3A 4GODA 1W5CE 5AVSB 1GU4A 3T97A 2XKMA 1FBMA 3H1LG 2BCCE 3GW6A 4AQRD 3II6A 1SQVJ 1VF5C 3IAOA 4PV1D 3Q5RA 5BVZA 1RHZB 1SQXJ 2YKOA 3V5BA 2KZIA 1YQ4C 2FXMA 4U3FD 5KJ7D 3TSIA 1AV1A 4HKZH 1DIPA 3I5CA 2WSEH 1KILC 3C8VA 2C9LY 2WITA 1A02J 4N3YB 2W8ZA 3KDPB 1HBWA 1IFDA 1KV4A 2A45I 3CCSP 2ZT9D 2BCCJ 4H44B 3L35A 2ZVOB 4I7ZB 3KYQA 5CMZA 1G2CA 3L75G 1N7SD 2KS1B 1VQ7P 1D7MA 1EXJA 2C0WA 3UIAA 1NU1E 1LT9B 1X0TA 1PGJA 1M56D 4EDFA 5KJ7A 2E74D 1PGQA 3BRTB 4WY4D 3L73E 2Q3IA 3BASA 4D6TE 3HD7D 1GTWA 1SQPD 1KFMA 5APTA 1BCCG 3B71A 4TT3H 3MIWA 5AW2B 2L5GB 1LWUA 1BDCA 3EQ2A 1NO4A 1SQQD 2Y0EA 3H1JJ 1MUUA 2Q9IA 2A06D 2OYOA 3PJSK 1LT9A 1LJ2A 4I1LA 3IFMA 2QJYC 1IC2A 4OGQD 3RK3C 1PPJE 1KTMA 3CX5H 1J1DC 2CK3H 4YXWH 1T2KC 2I1KA 3RK2B 2K3RA 1JY2N 1SQVG 2WMMA 1N86A 5GTIE 4IFMA 1SQXG 5CBOA 3E1RA 2KYVA 3FGAD 4B86A 1OFCX 1S1CX 1IJDB 1IFNA 2QEXP 1NGMB 2FXPA 5AW5B 4PD4D 1G1IA 3WU2E 1ZR4A 3H6PA 2D2CC 2JDIH 1JTHA 4Y99B 3AEAC 1N73B 2NRGA 1L0ND 3PH0A 1JY3P 2E5TA 2KXPB 3S1KA 2BCCG 1JMMA 3MP7B 3P8MC 2FYNC 2QM8A 3TGUD 3G3ZA 1FZCC 3M0DC 1VQOP 1KMIZ 3BCCE 1CI6B 2N1TB 4N78E 1S72P 2PGDA 4GKGA 3B5NC 2OYIB 2RH0A 2NPSD 1KB9D 5H2FE 3H32B 2WQYC 1CW5A 3L74E 3VMZA 1OX3A 1N73A 5KLVE 2YIUC 1EXIA 1NHLA 1ZOYC 1QVFO 3BATA 1K04A 3EFGA 1MFTA 1Y47A 1MV8A 4YXDC 1BSNA 1CI6A 3V2QA 1SP4A 4NPEA 3F89A 2V7QJ 1DX7A 3H1JG 4H13D 1EZVE 1AQTA 1PGOA 4MN4C 3KHUA 1Q81Q 3H32A 1LNQA 1RE4C 2P58A 2QJPC 1LP1B 2POHA 1VQNP 1SQBE 3C1LA 3L70D 1HWTC 1NTME 3JSVC 1L4AC 2OYHB 2P1JA 1YJNP 3V4WA 1T8ZA 1JO5A 1Q86Q 1RF1B 4PV1C 3G71P 1SFCC 1FS0E 5B5EH 2Z5IA 5AVZB 2WT7B 2K9YA 3USSA 4K3AA 1JNMA 4DOJA 1QLED 2QA4P 2J59M 2K9JB 1CSBA 2E75D 2Q3EA 2OYHA 1T6AA 3WMM0 1SQBJ 1PPJG 2ZFCA 1KQFB 2JR8A 3O6QA 1Q82Q 1NTMJ 1FJPA 1N7LA 2FYUK 5AW0B 1YBKA 1VF5B 2J58A 2K37A 5AVRB 2M3EA 2OARA 3PP5A 2K9JA 3ABVC 1NAYA 3CWBE 1EDLA 3JC22 1NAFA 2YNYA 3FX0A 4HB1A 1YIJP 3WUTA 1H89A 1AA0A 3H1KE 2W6BA 5KKZC 2E74C 2QJKB 3S9OA 1RH5B 4RO0A 2IZ1A 5EFWB 1WRGA 2HR3A 3HD7C 2Q6QA 2IBZE 1AVOA 1JY2P 2JWDA 2W6JH 3QH9A 2YXRB 3SFDC 2KK7A 3HUSC 3CCRP 3L72J 3H1LE 1KILA 2LXCB 2FYZA 3L74G 3KQGA 4OGQC 2WTYA 2MKVA 2QE7H 2Y9YA 3H1HJ 2A45G 1SQXK 2KSEA 4N6JA 4NPFX 4KT0J 4PJ0H 3TNUB 1PGPA 1LT1A 1X79B 2KIKA 5AVVB 3L36A 1P84I 1LTJC 3RK3D 1KYOH 3F5HA 1NTKD 3Q5SA 2FKWB 5CBNA 1T2KD 1FU1A 2P10A 3FWLA 2O1JA 4L74A 1PIXA 1SQBG 1W2EA 1ZV8A 1NTMG 1BDDA 3AE9C 1AFOA 3L4FA 2R3CA 2XV5A 3L75E 1PP9J 3CCUP 1OVUA 3IN6A 1IK9A 1Y9BA 1FDOA 3TYYA 2YO3A 3R4YA 2R5BA 3VMYA 2HLOA 2QM7A 4K35A 5CJ4A 4JPZB 1G1JA 2N9BA 2NPSC 1KFNA 3H1ID 2V7QH 1URQC 4IFDK 1BCCE 3P8CE 2D2CB 2B9BA 1WMKA 2M5AB 3Q1MA 4JF7A 4DZOA 1OWAA 3L71D 4C7NA 4H0LD 2WSSH 1ZLLA 3GHGB 2A45H 1HH0A 3G6EP 4H13C 4LLHA 3B5NB 3L72G 1RY3A 2W90A 2R44A 1M1JC 1SQVE 5APSA 3T97B 1Q90D 2RMZA 3A0HH 5TJHA 2M5AA 3H1HG 1KB9I 3TDKA 2YIUB 3M06A 3CD6P 4OWFA 2FFDC 2B88A 1FZCA 3M0DA 1AJYA 1ZRTE 2IBZG 4Y28J 3B5NA 3EFFK 3M9HA 1NTZD 1L4AD 2LKMA 5B5EE 1DEBA 4C7RA 5AVYB 3CCEP 2QJPB 1LTBC 2JO1A 2E75C 1S9KD 4U3FJ 3WUUA 1SFCD 1PP9G 5DJUB 3AE3C 3V6IA 1X8YA 1GK4A 3N7NA 3A5TA 1BGYD 1G2CB 2IPPA 5GTHH 1J1EC 1VDFA 2CPBA 2H8PD 3MZWB 1RE4A 2E43A 2HG5D 2A06E 2HPCB 1BE3D 3GF7A 3FXEA 4UB8H 1L4AA 1VQ8P 5AW4B 3FWNA 3CMAP 3CXHI 3H1JE 4WVZA 4OH8B 2B89A 1IFPA 1GDTA 2H43A 2J5UA 3E1IA 1LWUB 3VMXA 2R5DA 2QRXA 1BSHA 2KLVA 2E42A 3K5BA 2ZT9B 1JCDA 1E79H 1SQPJ 4RKUJ 1L0LJ 3NTNA 4ZNCA 3G4SP 2E76C 4GIFA 5AW7B 2YMKA 2HPCA 4LC1A 4DJGA 1N7SB 5KLVK 4PD4E 1L0LD 1P84D 1SQQJ 5TISH 4A7PA 1UIIA 5KKZB 2E74B 2YO2A 2C9NY 4WY4B 3MTUE 1GL2D 5KAIH 4L76A 2G8YA 2WPQA 3HE5A 4PJ0E 2GM4A 3AEFC 3OAKA 3HUSB 3LW5J 1N7SA 1SQBK 1JTHB 1KYOE 4U3FG 1NTMK 3RK2D 3AEGC 4OGQB 2GA1A 4WY4A 5CJ0A 3HD7A 2ITAA 1U7MA 2PP6A 3CCVP 1USEA 1L0NJ 1NU1D 3HUSA 3G9RA 2V4HA 3TGUJ 5KAFH 3L73D 2L91A 2IFMA 2KLUA 1SLQA 1JM0A 2AXTH 3RL0g 3O8ZA 1IK7A 4JQ0D 2LR2A 3RBXA 3D70A 1CZQA 3L70E 2IZ0A 1S2EA 2E5YA 4H0LC 2I1JA 1SQPG 1URQD 1LTGC 1L0LG 1M8OB 1ZW0A 1LTJA 5BU8B 1DD3A 3CCJP 3MGNA 1DD4A 1NWQA 2NPSB 3EWKA 5AW6B 1SQQG 2QIWA 1KQSO 1EDJA 1LTTC 2A06G 1FOSE 2KNCA 3A0HE 2W6AA 2QG4A 1NYHA 3L70J 2FXOA 2K1AA 3H25A 4ASWA 3RGUA 4XA4A 4IL6H 2JWAA 3VP8A 3HRNA 1YYCA 3CX5I 4H13B 2NPSA 1KILE 1QL1A 3VN0A 1URQA 1VQLP 3SWKA 3HE4A 2P67A 2WSCJ 3O6QB 1MZ9A 3OW2O 4DT0A 2ZYGA 2YXQB 5APUA 1IFMA 1L0NG 1KD1Q 3CCLP 1R5SA 2WWWA 2AEMA 3CXHD 1VQ9P 3TGUG 1M90Q 2WSFJ 5KLVD 5GTHE 1KC8Q 2HODA 1A02F 1M1JA 3V2RA 1K9MQ 4W7YA 2E75B 2PRRA 1KN7A 4WWIA 4UB8E 4H44C 2FFDA 2ZXEB 2BEZF 3L72E 3CC2P 2GUVA 2OTLP 3A2AA 4I7ZC 3IR9A 4YTPC 3JCUE 4I2LC 2B87B 2RKLA 3RL0D 1J1EB 1S5LE 1KILB 3H1HE 4KJMA 1LT9C 1HF9A 3P7KA 3RK3E 1NTKE 1MKMA 4LGDE 4IFFA 3I55P 5AVXB 3LW5H 2DW3A 1H8AA 3VMAA 1NOHA 5TISE 2K88A 2ZJSE 3L70G 3IF4A 1N8RQ 2Y0DA 1GL2C 4PD4H 2E76D 3M91A 2R32A 2B87A 1Q7YQ 5KAIE 3B4SA 3CPWO 1SQVK 1FJKA 1ZMEC 1PP9E 2WPRA 2O1KA 5L8RJ 3RK2C 1NTKJ 3KZIH 4EIJA 3V2NA 1JMBA 1XTCC 5AW1B 4BXLA 1ZXGA 1KB9H 3L71E 1VL2A 1VQPP 4WBAA 3ZDMA 3CWBD 1OMIA 3R2PA 1M7LA 2IYOA 2QJYB 3AE8C 3C9IA 2LXBA 3H1KD 5M1BA 4XE5B 2FY8A 1YJWP 4HH2A 3RK3B 1HGZA 1J1DB 5CCHD 4JYBA 1N73C 1OW7A 5KAFE 1NKNA 4C7NB 1K73Q 3H1IJ 1VQMP 2AXTE 2WVRA 1W2BO 2N1TC 5B66H 1KORA 4DCKA 2OYIC 1GZLA 2FBWC 4HYTB 3H1LD 3LIEA 3L71J 2PAJA 5KLIC 3M0AA 1S4XA 1RF0C 2IFNA 2H88C 3CX5D 3WUVA 1T3JA 2SPZA 2FYNB 1FZCB 1U7JA 2OQQA 4JYCA 3GLMA 2WSCH 1OIPA 3Q2YA 4H0LB 1HJ0A 4U3FE 2FYUJ 3AE7C 4GT1A 2R3SA 5APYA 4IL6E 1H0TB 1X22A 1HUCA 3AE1C 1JB0J 2FYUD 2OYHC 1NTKG 1EDIA 2WSFH 3L75D 3CCQP 1NTZJ 1HTLC 3NMDA 1BE3E 3CLQA 1OW8A 2KUBA 4RJTA 1L0NK 2P2UA 1RF1C 1FOSF 2W83C 3CC4P 1IZNB 2KP8A 3OJAB 1QX8A 1AVYA 1PV3A 2XNDH 1L2PA 3P8CD 1OVRA 1H0TA 1FZFA 2BASA 1BGYJ 2M8RA 3VYIA 1L4AB 2HYNA 3A3YB 2JP3A 4RESB 3H1IG 1GW3A 1SQPE 2ZXXA 5APVA 3AE2C 1L0LE 1P84E 5AVTB 4PV1B 4GOFA 2ZYAA 1SFCB 1BE3J 3SSUA 1USDA 3L71G 5K5GB 1SQQE 1SQVD 1PZQA 3RL0C 2XDJA 1VQ6P 2JKVA 3ITKA 1MFZA 1SQXD 3Q3DA 1OZHA 2AEJA 1PL5A 4W7ZA 5CHXA 2QJKC 4H44D 1NJIQ 3JCUH 5AVWB 2W27A 1OW6A 2M3BA 1S5LH 1ZRTD 1SFCA 3S4RA 3HE5B 4YPCA 2FYUG 1HJBA
chains in the Genus database with same CATH topology
2P58A 1Q2NA 2HR3A 4NPDA 2LXBA 5CBOA 1DEEG 1EDJA 2KUBA 5C39A 1LP1B 4K35A 4CPGA 1EC5A 5DJUB 1EDKA 4GOEA 2B87B 2RKLA 2Q1KA 1LP1A 2JWDA 2ZAEB 4KJMA 4HJGH 4JBZA 2M5AB 4ASWA 3RGUA 1H0TA 1OVRA 3MZWB 2LXCB 2KS1B 2KI7B 3PH0A 5DJTB 2I8DA 3S1KA 4K3AA 1X0TA 1U7MA 4ZMDA 3FXEA 4NPFX 4GOFA 3FXDA 2R44A 2B87A 2M0BA 2B89A 1LT1A 2OTKE 2KIKA 1OVVA 2QRXA 2QVAA 4ASVA 5K5GB 4GODA 2SPZA 2M5AA 1JM0A 1U7JA 4IOIH 4EYYQ 5CBNA 1BDCA 4ZNCA 2LR2A 2B88A 3QWOC 1MFTA 1Y47A 1BDDA 1JMBA 1EDLA 3MHVA 2KZIA 4NPEA 4HB1A 4BXLA 1H0TB 1SS1A 1ZXGA 1ZW0A 1S3JA 1OVUA 3ZDMA 2K3RA 4MN4C 4HKZH 2KZJA 1EDIA 1NVOA 2WMMA 2UWJE 1FC2C 4WWIA 5EFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P58 A;  1Q2N A;  2HR3 A;  4NPD A;  2LXB A;  5CBO A;  1DEE G;  1EDJ A;  2KUB A;  5C39 A;  1LP1 B;  4K35 A;  4CPG A;  1EC5 A;  5DJU B;  1EDK A;  4GOE A;  2B87 B;  2RKL A;  2Q1K A;  1LP1 A;  2JWD A;  2ZAE B;  4KJM A;  4HJG H;  4JBZ A;  2M5A B;  4ASW A;  3RGU A;  1H0T A;  1OVR A;  3MZW B;  2LXC B;  2KS1 B;  2KI7 B;  3PH0 A;  5DJT B;  2I8D A;  3S1K A;  4K3A A;  1X0T A;  1U7M A;  4ZMD A;  3FXE A;  4NPF X;  4GOF A;  3FXD A;  2R44 A;  2B87 A;  2M0B A;  2B89 A;  1LT1 A;  2OTK E;  2KIK A;  1OVV A;  2QRX A;  2QVA A;  4ASV A;  5K5G B;  4GOD A;  2SPZ A;  2M5A A;  1JM0 A;  1U7J A;  4IOI H;  4EYY Q;  5CBN A;  1BDC A;  4ZNC A;  2LR2 A;  2B88 A;  3QWO C;  1MFT A;  1Y47 A;  1BDD A;  1JMB A;  1EDL A;  3MHV A;  2KZI A;  4NPE A;  4HB1 A;  4BXL A;  1H0T B;  1SS1 A;  1ZXG A;  1ZW0 A;  1S3J A;  1OVU A;  3ZDM A;  2K3R A;  4MN4 C;  4HKZ H;  2KZJ A;  1EDI A;  1NVO A;  2WMM A;  2UWJ E;  1FC2 C;  4WWI A;  5EFW B; 
#chains in the Genus database with same CATH topology
 1RE3 C;  1EZV I;  2BCC D;  1OXZ A;  4AUW A;  2JJL A;  1FZE A;  5AW8 B;  1NTZ G;  1YIT P;  3HD7 B;  1L0N E;  3MUD C;  3A7O A;  2XNX A;  3TGU E;  4EOT A;  3KZI E;  3PHL A;  5DJT B;  2I8D A;  1GL2 B;  5AVU B;  1KZU B;  1JCC A;  3KXD A;  2KS1 A;  1LGH B;  1M1K Q;  2HFE D;  1KB9 E;  1QVG O;  1BGY G;  2JEE A;  4EI2 A;  3CCM P;  2VRS A;  3KPE A;  3H1J D;  1NU1 J;  2ZYD A;  5CCH C;  4IOI H;  4EYY Q;  3L73 J;  1BE3 G;  1N2D C;  3W67 A;  5CCG C;  4D6T J;  1GL2 A;  1LTJ B;  3PRJ A;  1FZB A;  5APW A;  2MJZ A;  3LID A;  4D6T D;  5B66 E;  4WB4 A;  1S3J A;  4UB6 E;  1FZG A;  2P7J A;  1GMJ A;  3PTZ A;  1LTA C;  1E5W A;  1FC2 C;  2KNC B;  2RN0 A;  1AQ5 A;  2N1T D;  3AE5 C;  1QGK B;  5AW9 B;  1LTS C;  2N9Y B;  1JEK A;  2YKP A;  1FE6 A;  4R4L A;  1FDM A;  3AEB C;  3HTK B;  3GHG C;  1R8E A;  2IBZ I;  1PPJ D;  2O3J A;  3U59 A;  1JUN A;  1KYO D;  1URQ B;  2WZ7 A;  3HE4 B;  5KLI B;  3VTP C;  3CXH E;  4Z1M H;  3P32 A;  1NTK K;  1FZA A;  4M3L A;  3BRV B;  4AYC A;  3AE4 C;  2IYP A;  1UIX A;  1Y8A A;  3Q5P A;  3GMA A;  4OVN F;  1GD2 E;  4C46 A;  3HTK A;  1JOC A;  2WPS A;  4ASV A;  2N1T A;  2QSI A;  3W68 A;  1LTI C;  1J2J B;  2OYI A;  3A0B E;  4TLF A;  3VOP A;  3BCC J;  2HOD B;  1M1J B;  1M57 D;  2Z4E A;  1ZP0 C;  4L75 A;  3TF5 A;  4KHX A;  2O01 J;  1K8A Q;  1GK6 A;  5E79 E;  1NU1 G;  3BCC D;  1RF0 A;  4N78 D;  1S5L X;  2KOG A;  1VQ4 P;  3L74 J;  3AE6 C;  2FFD B;  3L73 G;  3B8E B;  5KLV J;  2Y0C A;  4D6T G;  1NVO A;  1NKZ B;  2UWJ E;  2IX7 C;  3L74 D;  4BRY B;  1DEE G;  1TU3 F;  2AXC A;  4CPG A;  5C39 A;  3L37 A;  1EC5 A;  2OTJ P;  1EDK A;  1RQU A;  2AEF A;  1P84 H;  5KJ7 C;  2GUS A;  1LP1 A;  1VQK P;  4HJG H;  2CPS A;  4JBZ A;  4L73 A;  3D6Z A;  3VP9 A;  1VF5 D;  2H7H A;  1JY3 O;  1EZV D;  4GDO A;  2XU6 A;  1YTZ T;  4I6M C;  3SWF A;  5APQ A;  2KI7 B;  1LWU C;  1H88 A;  4ZKP A;  1RF1 A;  4ZMD A;  2PFX A;  4BRY A;  3CME P;  2ZT9 C;  1SQB D;  4ZKU A;  1RQV A;  3AED C;  2WT7 A;  4O9B A;  1KIL D;  1NTM D;  3FXD A;  2Q7C A;  2KSJ A;  1N7S C;  3RL0 B;  2IDB A;  1NTZ K;  2O01 N;  1IFJ A;  3NFQ A;  3CL3 D;  3GG2 A;  4WY4 C;  1YHQ P;  3QWO C;  2WSE J;  3TK1 A;  3V4Q A;  3CC7 P;  1XTG B;  3M9Q A;  1ZR2 A;  1FDI A;  3BCC G;  1Z56 A;  2E76 B;  3SWY A;  2KZJ A;  1SVF A;  2G3A A;  3H1I E;  2Q5U A;  2NZ2 A;  1Q2N A;  4NPD A;  3U1C A;  4U7J A;  1KQL A;  3CWB J;  3OA7 A;  1FAV A;  1K05 A;  2OGU A;  1HGV A;  2WPV B;  5APX A;  2H89 C;  5KLV G;  3L72 D;  2Q1K A;  3E7K A;  3H1K J;  2ZVN B;  3CX5 E;  1ZN5 A;  3H1H D;  1QEX A;  1RE3 A;  1EZV G;  4Y99 C;  1VPC A;  3V2P A;  3D6Y A;  5GTI H;  2IBZ D;  5KTB A;  2KB7 P;  4QMA A;  2YKQ A;  2BEQ D;  5CCG D;  3H1L J;  3MD0 A;  1VQ5 P;  1SQP K;  2YMY A;  2OTK E;  5AVQ B;  1L0L K;  3MUD A;  3U1A A;  1HVV A;  4IL6 X;  2QVA A;  2FYU E;  1YJ9 P;  4UB6 H;  5AW3 B;  3TNU A;  3WU2 H;  1YI2 P;  1SQQ K;  2Z5H A;  1IFI A;  1T3U A;  2D2C D;  2C0X A;  1PP9 D;  1NTZ E;  3NXS A;  3BVH A;  1IO4 A;  1PFI A;  3MHV A;  1SS1 A;  1S9K E;  5CCH A;  3RBZ A;  3GF3 A;  2Y9Z A;  4PD4 I;  4W80 A;  1GU5 A;  2O01 H;  1NH4 A;  5H2F H;  3B5N D;  3CXH H;  1JY2 O;  5CCG A;  1EQ7 A;  3I56 P;  1U57 A;  1BGY E;  3L75 J;  4GOE A;  3PLN A;  1R5L A;  3AEE C;  2ZAE B;  1JY3 N;  1NU1 K;  1YTZ I;  2XZR A;  1QL2 A;  3AEC C;  1GW4 A;  3CWB G;  3SFE C;  4R4M A;  3A0B H;  3D71 A;  1SQX E;  5BU5 A;  1KYO I;  1YQ3 C;  3H1K G;  1BCC J;  4XFJ A;  3CI9 A;  1X9V A;  1WT6 A;  5E79 H;  3M9B A;  2M0B A;  1BCC D;  3GHG A;  4BWN A;  1KQG B;  1OVV A;  3N4X A;  1DH3 A;  4GOD A;  1W5C E;  5AVS B;  1GU4 A;  3T97 A;  2XKM A;  1FBM A;  3H1L G;  2BCC E;  3GW6 A;  4AQR D;  3II6 A;  1SQV J;  1VF5 C;  3IAO A;  4PV1 D;  3Q5R A;  5BVZ A;  1RHZ B;  1SQX J;  2YKO A;  3V5B A;  2KZI A;  1YQ4 C;  2FXM A;  4U3F D;  5KJ7 D;  3TSI A;  1AV1 A;  4HKZ H;  1DIP A;  3I5C A;  2WSE H;  1KIL C;  3C8V A;  2C9L Y;  2WIT A;  1A02 J;  4N3Y B;  2W8Z A;  3KDP B;  1HBW A;  1IFD A;  1KV4 A;  2A45 I;  3CCS P;  2ZT9 D;  2BCC J;  4H44 B;  3L35 A;  2ZVO B;  4I7Z B;  3KYQ A;  5CMZ A;  1G2C A;  3L75 G;  1N7S D;  2KS1 B;  1VQ7 P;  1D7M A;  1EXJ A;  2C0W A;  3UIA A;  1NU1 E;  1LT9 B;  1X0T A;  1PGJ A;  1M56 D;  4EDF A;  5KJ7 A;  2E74 D;  1PGQ A;  3BRT B;  4WY4 D;  3L73 E;  2Q3I A;  3BAS A;  4D6T E;  3HD7 D;  1GTW A;  1SQP D;  1KFM A;  5APT A;  1BCC G;  3B71 A;  4TT3 H;  3MIW A;  5AW2 B;  2L5G B;  1LWU A;  1BDC A;  3EQ2 A;  1NO4 A;  1SQQ D;  2Y0E A;  3H1J J;  1MUU A;  2Q9I A;  2A06 D;  2OYO A;  3PJS K;  1LT9 A;  1LJ2 A;  4I1L A;  3IFM A;  2QJY C;  1IC2 A;  4OGQ D;  3RK3 C;  1PPJ E;  1KTM A;  3CX5 H;  1J1D C;  2CK3 H;  4YXW H;  1T2K C;  2I1K A;  3RK2 B;  2K3R A;  1JY2 N;  1SQV G;  2WMM A;  1N86 A;  5GTI E;  4IFM A;  1SQX G;  5CBO A;  3E1R A;  2KYV A;  3FGA D;  4B86 A;  1OFC X;  1S1C X;  1IJD B;  1IFN A;  2QEX P;  1NGM B;  2FXP A;  5AW5 B;  4PD4 D;  1G1I A;  3WU2 E;  1ZR4 A;  3H6P A;  2D2C C;  2JDI H;  1JTH A;  4Y99 B;  3AEA C;  1N73 B;  2NRG A;  1L0N D;  3PH0 A;  1JY3 P;  2E5T A;  2KXP B;  3S1K A;  2BCC G;  1JMM A;  3MP7 B;  3P8M C;  2FYN C;  2QM8 A;  3TGU D;  3G3Z A;  1FZC C;  3M0D C;  1VQO P;  1KMI Z;  3BCC E;  1CI6 B;  2N1T B;  4N78 E;  1S72 P;  2PGD A;  4GKG A;  3B5N C;  2OYI B;  2RH0 A;  2NPS D;  1KB9 D;  5H2F E;  3H32 B;  2WQY C;  1CW5 A;  3L74 E;  3VMZ A;  1OX3 A;  1N73 A;  5KLV E;  2YIU C;  1EXI A;  1NHL A;  1ZOY C;  1QVF O;  3BAT A;  1K04 A;  3EFG A;  1MFT A;  1Y47 A;  1MV8 A;  4YXD C;  1BSN A;  1CI6 A;  3V2Q A;  1SP4 A;  4NPE A;  3F89 A;  2V7Q J;  1DX7 A;  3H1J G;  4H13 D;  1EZV E;  1AQT A;  1PGO A;  4MN4 C;  3KHU A;  1Q81 Q;  3H32 A;  1LNQ A;  1RE4 C;  2P58 A;  2QJP C;  1LP1 B;  2POH A;  1VQN P;  1SQB E;  3C1L A;  3L70 D;  1HWT C;  1NTM E;  3JSV C;  1L4A C;  2OYH B;  2P1J A;  1YJN P;  3V4W A;  1T8Z A;  1JO5 A;  1Q86 Q;  1RF1 B;  4PV1 C;  3G71 P;  1SFC C;  1FS0 E;  5B5E H;  2Z5I A;  5AVZ B;  2WT7 B;  2K9Y A;  3USS A;  4K3A A;  1JNM A;  4DOJ A;  1QLE D;  2QA4 P;  2J59 M;  2K9J B;  1CSB A;  2E75 D;  2Q3E A;  2OYH A;  1T6A A;  3WMM 0;  1SQB J;  1PPJ G;  2ZFC A;  1KQF B;  2JR8 A;  3O6Q A;  1Q82 Q;  1NTM J;  1FJP A;  1N7L A;  2FYU K;  5AW0 B;  1YBK A;  1VF5 B;  2J58 A;  2K37 A;  5AVR B;  2M3E A;  2OAR A;  3PP5 A;  2K9J A;  3ABV C;  1NAY A;  3CWB E;  1EDL A;  3JC2 2;  1NAF A;  2YNY A;  3FX0 A;  4HB1 A;  1YIJ P;  3WUT A;  1H89 A;  1AA0 A;  3H1K E;  2W6B A;  5KKZ C;  2E74 C;  2QJK B;  3S9O A;  1RH5 B;  4RO0 A;  2IZ1 A;  5EFW B;  1WRG A;  2HR3 A;  3HD7 C;  2Q6Q A;  2IBZ E;  1AVO A;  1JY2 P;  2JWD A;  2W6J H;  3QH9 A;  2YXR B;  3SFD C;  2KK7 A;  3HUS C;  3CCR P;  3L72 J;  3H1L E;  1KIL A;  2LXC B;  2FYZ A;  3L74 G;  3KQG A;  4OGQ C;  2WTY A;  2MKV A;  2QE7 H;  2Y9Y A;  3H1H J;  2A45 G;  1SQX K;  2KSE A;  4N6J A;  4NPF X;  4KT0 J;  4PJ0 H;  3TNU B;  1PGP A;  1LT1 A;  1X79 B;  2KIK A;  5AVV B;  3L36 A;  1P84 I;  1LTJ C;  3RK3 D;  1KYO H;  3F5H A;  1NTK D;  3Q5S A;  2FKW B;  5CBN A;  1T2K D;  1FU1 A;  2P10 A;  3FWL A;  2O1J A;  4L74 A;  1PIX A;  1SQB G;  1W2E A;  1ZV8 A;  1NTM G;  1BDD A;  3AE9 C;  1AFO A;  3L4F A;  2R3C A;  2XV5 A;  3L75 E;  1PP9 J;  3CCU P;  1OVU A;  3IN6 A;  1IK9 A;  1Y9B A;  1FDO A;  3TYY A;  2YO3 A;  3R4Y A;  2R5B A;  3VMY A;  2HLO A;  2QM7 A;  4K35 A;  5CJ4 A;  4JPZ B;  1G1J A;  2N9B A;  2NPS C;  1KFN A;  3H1I D;  2V7Q H;  1URQ C;  4IFD K;  1BCC E;  3P8C E;  2D2C B;  2B9B A;  1WMK A;  2M5A B;  3Q1M A;  4JF7 A;  4DZO A;  1OWA A;  3L71 D;  4C7N A;  4H0L D;  2WSS H;  1ZLL A;  3GHG B;  2A45 H;  1HH0 A;  3G6E P;  4H13 C;  4LLH A;  3B5N B;  3L72 G;  1RY3 A;  2W90 A;  2R44 A;  1M1J C;  1SQV E;  5APS A;  3T97 B;  1Q90 D;  2RMZ A;  3A0H H;  5TJH A;  2M5A A;  3H1H G;  1KB9 I;  3TDK A;  2YIU B;  3M06 A;  3CD6 P;  4OWF A;  2FFD C;  2B88 A;  1FZC A;  3M0D A;  1AJY A;  1ZRT E;  2IBZ G;  4Y28 J;  3B5N A;  3EFF K;  3M9H A;  1NTZ D;  1L4A D;  2LKM A;  5B5E E;  1DEB A;  4C7R A;  5AVY B;  3CCE P;  2QJP B;  1LTB C;  2JO1 A;  2E75 C;  1S9K D;  4U3F J;  3WUU A;  1SFC D;  1PP9 G;  5DJU B;  3AE3 C;  3V6I A;  1X8Y A;  1GK4 A;  3N7N A;  3A5T A;  1BGY D;  1G2C B;  2IPP A;  5GTH H;  1J1E C;  1VDF A;  2CPB A;  2H8P D;  3MZW B;  1RE4 A;  2E43 A;  2HG5 D;  2A06 E;  2HPC B;  1BE3 D;  3GF7 A;  3FXE A;  4UB8 H;  1L4A A;  1VQ8 P;  5AW4 B;  3FWN A;  3CMA P;  3CXH I;  3H1J E;  4WVZ A;  4OH8 B;  2B89 A;  1IFP A;  1GDT A;  2H43 A;  2J5U A;  3E1I A;  1LWU B;  3VMX A;  2R5D A;  2QRX A;  1BSH A;  2KLV A;  2E42 A;  3K5B A;  2ZT9 B;  1JCD A;  1E79 H;  1SQP J;  4RKU J;  1L0L J;  3NTN A;  4ZNC A;  3G4S P;  2E76 C;  4GIF A;  5AW7 B;  2YMK A;  2HPC A;  4LC1 A;  4DJG A;  1N7S B;  5KLV K;  4PD4 E;  1L0L D;  1P84 D;  1SQQ J;  5TIS H;  4A7P A;  1UII A;  5KKZ B;  2E74 B;  2YO2 A;  2C9N Y;  4WY4 B;  3MTU E;  1GL2 D;  5KAI H;  4L76 A;  2G8Y A;  2WPQ A;  3HE5 A;  4PJ0 E;  2GM4 A;  3AEF C;  3OAK A;  3HUS B;  3LW5 J;  1N7S A;  1SQB K;  1JTH B;  1KYO E;  4U3F G;  1NTM K;  3RK2 D;  3AEG C;  4OGQ B;  2GA1 A;  4WY4 A;  5CJ0 A;  3HD7 A;  2ITA A;  1U7M A;  2PP6 A;  3CCV P;  1USE A;  1L0N J;  1NU1 D;  3HUS A;  3G9R A;  2V4H A;  3TGU J;  5KAF H;  3L73 D;  2L91 A;  2IFM A;  2KLU A;  1SLQ A;  1JM0 A;  2AXT H;  3RL0 g;  3O8Z A;  1IK7 A;  4JQ0 D;  2LR2 A;  3RBX A;  3D70 A;  1CZQ A;  3L70 E;  2IZ0 A;  1S2E A;  2E5Y A;  4H0L C;  2I1J A;  1SQP G;  1URQ D;  1LTG C;  1L0L G;  1M8O B;  1ZW0 A;  1LTJ A;  5BU8 B;  1DD3 A;  3CCJ P;  3MGN A;  1DD4 A;  1NWQ A;  2NPS B;  3EWK A;  5AW6 B;  1SQQ G;  2QIW A;  1KQS O;  1EDJ A;  1LTT C;  2A06 G;  1FOS E;  2KNC A;  3A0H E;  2W6A A;  2QG4 A;  1NYH A;  3L70 J;  2FXO A;  2K1A A;  3H25 A;  4ASW A;  3RGU A;  4XA4 A;  4IL6 H;  2JWA A;  3VP8 A;  3HRN A;  1YYC A;  3CX5 I;  4H13 B;  2NPS A;  1KIL E;  1QL1 A;  3VN0 A;  1URQ A;  1VQL P;  3SWK A;  3HE4 A;  2P67 A;  2WSC J;  3O6Q B;  1MZ9 A;  3OW2 O;  4DT0 A;  2ZYG A;  2YXQ B;  5APU A;  1IFM A;  1L0N G;  1KD1 Q;  3CCL P;  1R5S A;  2WWW A;  2AEM A;  3CXH D;  1VQ9 P;  3TGU G;  1M90 Q;  2WSF J;  5KLV D;  5GTH E;  1KC8 Q;  2HOD A;  1A02 F;  1M1J A;  3V2R A;  1K9M Q;  4W7Y A;  2E75 B;  2PRR A;  1KN7 A;  4WWI A;  4UB8 E;  4H44 C;  2FFD A;  2ZXE B;  2BEZ F;  3L72 E;  3CC2 P;  2GUV A;  2OTL P;  3A2A A;  4I7Z C;  3IR9 A;  4YTP C;  3JCU E;  4I2L C;  2B87 B;  2RKL A;  3RL0 D;  1J1E B;  1S5L E;  1KIL B;  3H1H E;  4KJM A;  1LT9 C;  1HF9 A;  3P7K A;  3RK3 E;  1NTK E;  1MKM A;  4LGD E;  4IFF A;  3I55 P;  5AVX B;  3LW5 H;  2DW3 A;  1H8A A;  3VMA A;  1NOH A;  5TIS E;  2K88 A;  2ZJS E;  3L70 G;  3IF4 A;  1N8R Q;  2Y0D A;  1GL2 C;  4PD4 H;  2E76 D;  3M91 A;  2R32 A;  2B87 A;  1Q7Y Q;  5KAI E;  3B4S A;  3CPW O;  1SQV K;  1FJK A;  1ZME C;  1PP9 E;  2WPR A;  2O1K A;  5L8R J;  3RK2 C;  1NTK J;  3KZI H;  4EIJ A;  3V2N A;  1JMB A;  1XTC C;  5AW1 B;  4BXL A;  1ZXG A;  1KB9 H;  3L71 E;  1VL2 A;  1VQP P;  4WBA A;  3ZDM A;  3CWB D;  1OMI A;  3R2P A;  1M7L A;  2IYO A;  2QJY B;  3AE8 C;  3C9I A;  2LXB A;  3H1K D;  5M1B A;  4XE5 B;  2FY8 A;  1YJW P;  4HH2 A;  3RK3 B;  1HGZ A;  1J1D B;  5CCH D;  4JYB A;  1N73 C;  1OW7 A;  5KAF E;  1NKN A;  4C7N B;  1K73 Q;  3H1I J;  1VQM P;  2AXT E;  2WVR A;  1W2B O;  2N1T C;  5B66 H;  1KOR A;  4DCK A;  2OYI C;  1GZL A;  2FBW C;  4HYT B;  3H1L D;  3LIE A;  3L71 J;  2PAJ A;  5KLI C;  3M0A A;  1S4X A;  1RF0 C;  2IFN A;  2H88 C;  3CX5 D;  3WUV A;  1T3J A;  2SPZ A;  2FYN B;  1FZC B;  1U7J A;  2OQQ A;  4JYC A;  3GLM A;  2WSC H;  1OIP A;  3Q2Y A;  4H0L B;  1HJ0 A;  4U3F E;  2FYU J;  3AE7 C;  4GT1 A;  2R3S A;  5APY A;  4IL6 E;  1H0T B;  1X22 A;  1HUC A;  3AE1 C;  1JB0 J;  2FYU D;  2OYH C;  1NTK G;  1EDI A;  2WSF H;  3L75 D;  3CCQ P;  1NTZ J;  1HTL C;  3NMD A;  1BE3 E;  3CLQ A;  1OW8 A;  2KUB A;  4RJT A;  1L0N K;  2P2U A;  1RF1 C;  1FOS F;  2W83 C;  3CC4 P;  1IZN B;  2KP8 A;  3OJA B;  1QX8 A;  1AVY A;  1PV3 A;  2XND H;  1L2P A;  3P8C D;  1OVR A;  1H0T A;  1FZF A;  2BAS A;  1BGY J;  2M8R A;  3VYI A;  1L4A B;  2HYN A;  3A3Y B;  2JP3 A;  4RES B;  3H1I G;  1GW3 A;  1SQP E;  2ZXX A;  5APV A;  3AE2 C;  1L0L E;  1P84 E;  5AVT B;  4PV1 B;  4GOF A;  2ZYA A;  1SFC B;  1BE3 J;  3SSU A;  1USD A;  3L71 G;  5K5G B;  1SQQ E;  1SQV D;  1PZQ A;  3RL0 C;  2XDJ A;  1VQ6 P;  2JKV A;  3ITK A;  1MFZ A;  1SQX D;  3Q3D A;  1OZH A;  2AEJ A;  1PL5 A;  4W7Z A;  5CHX A;  2QJK C;  4H44 D;  1NJI Q;  3JCU H;  5AVW B;  2W27 A;  1OW6 A;  2M3B A;  1S5L H;  1ZRT D;  1SFC A;  3S4R A;  3HE5 B;  4YPC A;  2FYU G;  1HJB A; 
#chains in the Genus database with same CATH homology
 2P58 A;  1Q2N A;  2HR3 A;  4NPD A;  2LXB A;  5CBO A;  1DEE G;  1EDJ A;  2KUB A;  5C39 A;  1LP1 B;  4K35 A;  4CPG A;  1EC5 A;  5DJU B;  1EDK A;  4GOE A;  2B87 B;  2RKL A;  2Q1K A;  1LP1 A;  2JWD A;  2ZAE B;  4KJM A;  4HJG H;  4JBZ A;  2M5A B;  4ASW A;  3RGU A;  1H0T A;  1OVR A;  3MZW B;  2LXC B;  2KS1 B;  2KI7 B;  3PH0 A;  5DJT B;  2I8D A;  3S1K A;  4K3A A;  1X0T A;  1U7M A;  4ZMD A;  3FXE A;  4NPF X;  4GOF A;  3FXD A;  2R44 A;  2B87 A;  2M0B A;  2B89 A;  1LT1 A;  2OTK E;  2KIK A;  1OVV A;  2QRX A;  2QVA A;  4ASV A;  5K5G B;  4GOD A;  2SPZ A;  2M5A A;  1JM0 A;  1U7J A;  4IOI H;  4EYY Q;  5CBN A;  1BDC A;  4ZNC A;  2LR2 A;  2B88 A;  3QWO C;  1MFT A;  1Y47 A;  1BDD A;  1JMB A;  1EDL A;  3MHV A;  2KZI A;  4NPE A;  4HB1 A;  4BXL A;  1H0T B;  1SS1 A;  1ZXG A;  1ZW0 A;  1S3J A;  1OVU A;  3ZDM A;  2K3R A;  4MN4 C;  4HKZ H;  2KZJ A;  1EDI A;  1NVO A;  2WMM A;  2UWJ E;  1FC2 C;  4WWI A;  5EFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...