3FXDA

Crystal structure of interacting domains of icmr and icmq
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
49
structure length
49
Chain Sequence
QLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
molecule keywords Protein IcmQ
total genus 18
structure length 49
sequence length 49
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3fxdA00
2KI7B 2SPZA 4NPDA 4ZMDA 4MN4C 3PH0A 1JMBA 4GOEA 4KJMA 2P58A 1EC5A 1EDJA 2KZJA 4GOFA 4JBZA 1EDIA 5CBOA 2ZAEB 1BDCA 4CPGA 2RKLA 1EDKA 3RGUA 2UWJE 2HR3A 3FXEA 2OTKE 2KZIA 5K5GB 1H0TA 2KUBA 4BXLA 1FC2C 1BDDA 5EFWB 3ZDMA 4HB1A 3QWOC 1SS1A 2M5AA 1LP1A 2K3RA 1OVRA 2QRXA 1ZW0A 4ZNCA 5DJTB 1EDLA 1H0TB 4ASVA 4NPEA 2B89A 1OVUA 3MZWB 1ZXGA 2WMMA 1Q2NA 1OVVA 4K35A 4ASWA 5C39A 2KIKA 3FXDA 4HKZH 1LT1A 2M0BA 2LXBA 1JM0A 1NVOA 4K3AA 2B87A 2B87B 2QVAA 5DJUB 1MFTA 2Q1KA 2JWDA 2I8DA 2R44A 2LR2A 2LXCB 4HJGH 3MHVA 4WWIA 2KS1B 5CBNA 1U7JA 1U7MA 4IOIH 1DEEG 2B88A 1X0TA 3S1KA 1S3JA 1LP1B 4NPFX 4GODA 4EYYQ 2M5AB 1Y47A
chains in the Genus database with same CATH superfamily
4WY4C 3CLQA 1SQVK 2KI7B 4WY4B 2A45H 2PAJA 1VQLP 1JUNA 5E79E 3SSUA 3T97A 1PPJG 3FWNA 5KKZC 2BCCD 3R4YA 3AE8C 2ZXXA 2WPVB 1JMBA 5CJ4A 3W68A 2WTYA 3VOPA 1QL1A 1OZHA 2ZT9B 1SQQJ 3L71G 1CW5A 2Y0CA 2KLUA 1GL2B 1PP9G 1RY3A 2IFMA 4L76A 4UB6E 1SQVJ 3JCUE 2NPSD 3A0HE 3H1HJ 1SFCD 4PV1B 4EIJA 4Z1MH 1IFNA 2N1TB 5CCGD 3HE5A 2WSCH 4CPGA 4D6TE 3H25A 1M1KQ 1JMMA 1Q81Q 3L73J 1BDCA 2JDIH 1Y8AA 1Y9BA 1T8ZA 1NTKJ 2BEQD 3GMAA 2OYIA 2E76D 2GM4A 1IFPA 2OYIB 1KYOI 1JY3N 1N7SD 3M06A 3RBZA 1KYOE 2FYZA 3FXEA 1LJ2A 3SWKA 3CMEP 1K8AQ 1YITP 2D2CB 2OTKE 1RE4C 1JNMA 3H32B 3V5BA 5M1BA 5KLIC 2FYUG 1H0TA 1NTZE 3LIEA 3RBXA 2N9YB 2BCCG 2RH0A 1KV4A 3OW2O 1GW3A 3PTZA 2Y9YA 2NRGA 2HLOA 1M57D 2N1TD 5GTIE 1FZCA 2WITA 1FC2C 3SWYA 1BDDA 1IO4A 2WWWA 3MIWA 1SLQA 4W7YA 1VF5B 1YQ4C 3B5ND 2OTLP 5EFWB 4IFDK 4HH2A 4OVNF 4PD4D 3ZDMA 3H1KG 1HJBA 3QWOC 2XV5A 1JEKA 2YO3A 5AVUB 3HD7D 1SQQD 3TGUE 2YMYA 4OGQC 1NTMD 2M3EA 4C7NA 3AEFC 4OWFA 1RF0C 2JO1A 2W8ZA 2FYUJ 3IN6A 1AVYA 1L0NG 1VQ7P 3W67A 3AEBC 1HUCA 2CK3H 1UIIA 2K88A 3EWKA 4ASVA 3Q5PA 2E42A 1NTKD 4NPEA 1EDLA 5AW4B 3CCQP 1N7SA 1XTCC 1GD2E 3L72E 3MZWB 3JCUH 1NU1D 1HTLC 2WMMA 3B5NC 1L0NJ 1KILA 1NTZG 4DT0A 5CCHD 4GKGA 1LWUC 1T3UA 4R4MA 2A06E 3P8MC 3CD6P 1GW4A 1T6AA 1P84E 2KIKA 5AW9B 5BVZA 3D6ZA 2V4HA 1YBKA 1LTAC 3R2PA 2IYOA 1USEA 4PD4I 2GUSA 2LKMA 4BRYA 4ZKPA 3Q3DA 1NOHA 2QA4P 2M0BA 2CPBA 4JPZB 1JM0A 1NVOA 4K3AA 1K05A 2B87A 1T3JA 3B5NA 3II6A 3Q2YA 3HTKB 1P84I 1WMKA 3CCMP 1NYHA 5DJUB 2YO2A 1L0LD 5B5EE 5KJ7A 1M1JC 3AE6C 2E74B 2Q1KA 3M0DA 4HYTB 1G2CA 1LGHB 2HPCB 1SQQG 1L4AA 1DD3A 3L71J 1YI2P 3EFGA 1GTWA 1KILB 2HPCA 1AV1A 2LR2A 2W6BA 3FGAD 4D6TJ 3AE9C 1EZVG 2E5YA 2PFXA 2ZFCA 5CBNA 1FOSF 3F5HA 1J1DB 3M91A 5AVQB 1P84H 3P32A 4IOIH 1NTKG 1DEEG 2W6JH 1X0TA 1M1JA 3WUTA 3CCUP 3S1KA 1NJIQ 1YHQP 1N73C 1S3JA 1EZVI 1OWAA 1L0ND 1FJKA 5APUA 1PIXA 4PD4E 1S72P 1OW6A 3PHLA 3VTPC 1HF9A 4GODA 2O01H 4H44D 1KFNA 2K9YA 4L75A 1BGYE 4EYYQ 1G1JA 2C9LY 2K9JB 3KXDA 5KLVD 3NMDA 2Q9IA 3IAOA 1BGYJ 2OTJP 1BCCD 1OW7A 1RE3A 4I6MC 2E76C 1FOSE 1NTZD 1M7LA 1OMIA 5KAFE 2Q3EA 1JB0J 3ABVC 3OA7A 5E79H 1LWUA 3E1RA 3HUSB 4RESB 5B66E 1BGYG 3SWFA 2QJYC 2P58A 3GF3A 1EC5A 3AE2C 3JSVC 1GU4A 2KZJA 4L73A 3M9BA 3AEEC 3GG2A 3CC4P 5KTBA 3E1IA 4KT0J 5CCHC 1QVFO 2QJPB 2KNCA 1JOCA 2FYNC 3CXHI 1EDIA 5CBOA 2FYUE 1SQQK 4EDFA 1N73B 2ZAEB 2V7QJ 1NO4A 3AEGC 2OGUA 4D6TD 1KQFB 3V2NA 1GL2D 2RKLA 1J1DC 4ZKUA 1Q82Q 4C7NB 1IJDB 1URQC 5AVRB 3BRVB 3LW5H 3O6QA 2QM8A 1MKMA 1S1CX 1WT6A 5KKZB 2Q5UA 1CI6A 3H1JD 3B8EB 1LTSC 4XFJA 2WVRA 3U1CA 3RK2D 1FAVA 2E75C 2BCCE 1OW8A 4IFMA 2KZIA 3VP9A 3CCVP 1MUUA 3MUDC 2R32A 3WU2H 2E43A 3JC22 3BCCG 4IL6H 3IR9A 2KUBA 3TNUB 3A0HH 5TJHA 1SQXD 3TSIA 1L0LE 1M8OB 1NTMJ 1SQVD 1WRGA 2N1TC 1L4AD 2KXPB 4H0LD 1Z56A 4U3FG 1ZRTE 3BASA 5CJ0A 5GTIH 1BCCG 1CI6B 3S4RA 3Q5SA 3CX5E 2KOGA 5TISH 3L75G 3G71P 3USSA 1VPCA 1CZQA 1USDA 3MD0A 2P10A 2ITAA 3G3ZA 3L71E 1KORA 1RHZB 2IDBA 2OYIC 1FE6A 2CPSA 2XNDH 1AVOA 1PP9E 1QLED 1URQB 1SQBG 1PV3A 2K3RA 1W2EA 4JQ0D 3WMM0 3FWLA 3VMXA 5B66H 3L75E 2A06D 4H44B 5AW6B 1IK9A 5KJ7C 2YIUC 3L72D 1VQ8P 2IX7C 2W6AA 1AA0A 1LWUB 3HUSA 3MGNA 1NTMG 1JCCA 2YXRB 2OYOA 3OJAB 1OVUA 2YMKA 3A7OA 3KPEA 4LC1A 4RO0A 1BE3G 1Q2NA 1SQBE 4H13C 2O1JA 2BASA 1KZUB 1PFIA 1KD1Q 4U3FE 3FXDA 1KB9I 3GHGA 5CHXA 2FFDB 2KP8A 1SQQE 2FBWC 1SQPJ 5AW1B 4UB8E 3I56P 3VN0A 1SQXJ 3TDKA 1N7SB 5AVTB 3AE5C 2B9BA 2G3AA 1R8EA 1FJPA 4PJ0H 2W83C 3IF4A 3VMYA 1JY3P 3RK3E 1PGQA 3A2AA 3AECC 3PJSK 3WUVA 1K73Q 1KILD 1MZ9A 1NKNA 2WQYC 1J1EB 1RE3C 1S5LX 2IZ0A 3HD7B 1RF1B 1BE3J 2IBZG 3MP7B 2FXOA 1VQ9P 2Z5HA 2R3CA 2WSSH 4TLFA 4IL6E 2N1TA 2J59M 1NU1K 3PLNA 5APTA 1NU1G 1LTJA 1ZN5A 3C1LA 4LGDE 2KS1B 1SQBK 3I5CA 2AXTH 3L75D 1CSBA 2O3JA 3H1KJ 3CWBD 1FZGA 1OIPA 1U7MA 1GK4A 4DJGA 5TISE 1RQVA 3Q1MA 2KB7P 4EI2A 3L72G 1VF5C 4U3FJ 3V2QA 1YJWP 1S4XA 1NTMK 4RJTA 1FZCC 3T97B 1IFIA 2DW3A 2WSEJ 3D71A 1H88A 1LTJC 3CX5D 3GW6A 2M5AB 1ZRTD 2JKVA 4IFFA 1SQVE 1MV8A 1NKZB 1VL2A 2K1AA 2P2UA 1AJYA 1SQXE 3I55P 1KTMA 1URQD 1Q7YQ 3PP5A 3MTUE 2I1JA 4H0LB 2SPZA 1MFZA 5CCHA 1RF1A 1GDTA 3L73E 2WPSA 2QJKB 3SFEC 4ZMDA 4MN4C 3PH0A 1L0LK 2MJZA 4GOEA 4KJMA 2E74D 3L72J 2QM7A 1GL2A 2AXTE 3H1HG 1OXZA 2N9BA 1KB9D 3L74D 2WPQA 3H1KE 2YKQA 3BCCJ 3L70E 4JBZA 1AQTA 1K04A 1PPJD 4XE5B 1M56D 4IL6X 4YTPC 1SP4A 3BCCE 3L70J 1T2KC 1A02J 1RF0A 2XZRA 1A02F 1NAFA 1EQ7A 3FX0A 3QH9A 3RL0D 1KB9H 3RL0g 2IPPA 2KS1A 5APVA 5KAFH 5BU5A 2IBZI 1ZR4A 1N7SC 3VYIA 1J2JB 2IBZD 3CWBE 2UWJE 3N4XA 5KLVG 2M8RA 5AVYB 2O01J 3VMZA 4AYCA 4D6TG 3AEAC 3KHUA 3H1HD 3C9IA 1VQ4P 5AW2B 1VQ6P 3E7KA 2ZT9C 2KYVA 4WBAA 1DEBA 2PGDA 1HGVA 3CCLP 4N6JA 1JY2N 5APWA 1DX7A 4DZOA 1LTTC 5KJ7D 1LNQA 3RK3D 2AEMA 1NU1J 1L4AC 2H89C 2JJLA 4BXLA 2HG5D 2FYNB 1M90Q 1RH5B 3U1AA 4I1LA 3TK1A 3D70A 2WPRA 3CX5I 1L4AB 5AW5B 3M9HA 2JR8A 4HB1A 1YJNP 1L0NE 1BE3E 2C9NY 2ZVOB 5H2FH 1N2DC 2A45G 5APSA 1IK7A 4DCKA 1R5LA 3H1LE 3RK2C 2M5AA 1LP1A 1ZV8A 1VDFA 1LT9B 5AVWB 4U3FD 1JCDA 3WUUA 1FZCB 3CCSP 1ZOYC 2QRXA 1SQXG 1ZP0C 1SQXK 1GMJA 2AEJA 1ZW0A 1RQUA 2WT7B 1VQPP 3CWBJ 1X9VA 1SQPK 3M0AA 1X22A 5DJTB 4ZNCA 2JEEA 1GU5A 4BRYB 2E74C 3O8ZA 4B86A 4N78E 1S9KE 1EZVE 1E79H 2B89A 3CX5H 2JP3A 2OQQA 3H1LG 1YIJP 1ZXGA 1KILC 1OVVA 1JTHA 1URQA 3H1JG 3P7KA 3P8CE 4K35A 4WY4D 2V7QH 3KYQA 2BEZF 1S9KD 3U59A 3HUSC 5KLVK 4PV1C 3CPWO 1H8AA 3H6PA 4BWNA 3WU2E 1Q86Q 2OARA 3CXHE 3HD7A 2ZT9D 1VQOP 1DIPA 1EXIA 1ZMEC 2L91A 4O9BA 2NPSA 3TYYA 4TT3H 1L0NK 4OGQB 2P7JA 2WSFH 1JTHB 4C7RA 3CXHD 1NGMB 2NPSB 1FU1A 3H1ID 1SFCB 2KSEA 4AQRD 3V2PA 1XTGB 2QVAA 2QJKC 1D7MA 3RK3C 1P84D 3V2RA 3V4WA 1KQSO 1HJ0A 1MFTA 2ZXEB 3RL0C 4H13D 1YTZT 2AXCA 2D2CC 2P67A 2E75B 4H44C 5L8RJ 2Y9ZA 1KN7A 2Q3IA 2R44A 3KQGA 1GZLA 4N78D 1E5WA 1BCCJ 1G1IA 1YJ9P 1VQNP 1AQ5A 2LXCB 1FZBA 3GLMA 2IYPA 1JY3O 4WWIA 3PRJA 5APQA 1IZNB 1FDIA 2KK7A 2XNXA 3O6QB 1SQVG 1HH0A 3H1JE 3MUDA 4N3YB 2NZ2A 4WB4A 3B71A 2POHA 1FS0E 3KDPB 3Q5RA 1AFOA 1NTME 2B88A 2A06G 1N73A 2YKOA 3L73G 2GA1A 3L36A 1HVVA 3TGUD 2W27A 3CXHH 1FZFA 1EXJA 3CC2P 3HE4A 3TF5A 1KFMA 1S5LH 1LP1B 2FYUD 1SFCA 3SFDC 4A7PA 5CCGA 3CCRP 3BVHA 4AUWA 1R5SA 4I7ZC 4NPFX 4I7ZB 2HODB 2NPSC 2IFNA 3BATA 4H0LC 3GF7A 2J5UA 3CI9A 1N7LA 4EOTA 3HD7C 1Y47A 3LW5J 3RL0B 4PD4H 1JO5A 1BSHA 2KNCB 1NTZK 3A5TA 1FZAA 1W2BO 4NPDA 2Z5IA 1LTGC 1JY2O 1KMIZ 2YNYA 2ZVNB 3H1IJ 3HE4B 4I2LC 1NTKK 4L74A 5GTHH 2YKPA 1KYOH 1BCCE 1X79B 2GUVA 3AE7C 2O01N 2Z4EA 3TNUA 5KLVE 1EDJA 1QEXA 3TGUG 2IBZE 4XA4A 3H1IG 4GOFA 1BGYD 1PGOA 3OAKA 3H1JJ 4UB6H 2KSJA 2QG4A 1LTBC 3CL3D 3S9OA 1NTZJ 5APXA 2Q6QA 3CCEP 1GL2C 3H32A 4W80A 2R5DA 1L0LJ 1EDKA 1LT9A 1LTJB 3C8VA 3CWBG 3N7NA 1QVGO 2FY8A 1IFJA 2D2CD 2Y0DA 3NXSA 1NHLA 4GIFA 2RN0A 3AE3C 3RGUA 2QIWA 2HR3A 1YYCA 4Y28J 1RF1C 1ZR2A 1L0LG 2IZ1A 1PGJA 2E76B 2QSIA 1YTZI 1HGZA 2A45I 4JF7A 5AVVB 5KLVJ 1HWTC 2FXPA 3HE5B 4JYCA 5K5GB 4JYBA 3L73D 3KZIH 5KAIE 1PP9J 2M3BA 4GT1A 1YQ3C 1VQ5P 2VRSA 3HTKA 3UIAA 2H88C 4W7ZA 1VF5D 2RMZA 3B5NB 2Y0EA 1PL5A 1FBMA 5APYA 1FDMA 3ITKA 3M0DC 3H1IE 2QE7H 3V6IA 2XU6A 1L2PA 3AE4C 3AEDC 4RKUJ 1S5LE 4R4LA 3RK3B 4M3LA 2FFDC 3CC7P 4DOJA 2I1KA 1SQBJ 2E5TA 4UB8H 4C46A 4LLHA 1SS1A 3HRNA 3G6EP 2XKMA 2FXMA 5H2FE 3AE1C 1K9MQ 3L70G 1KQGB 3EFFK 1VQMP 1OVRA 4KHXA 1S2EA 1OFCX 3L74G 1QL2A 4WVZA 1N86A 5GTHE 2WSCJ 2BCCJ 1RE4A 2ZJSE 2R3SA 3P8CD 4Y99B 3L4FA 1NU1E 1M1JB 3B4SA 1H0TB 5AVXB 1UIXA 1SQPD 1T2KD 1EZVD 2P1JA 3V4QA 1NTKE 2PP6A 5AW3B 1NH4A 2H7HA 3A0BE 3A3YB 2QJYB 5B5EH 2W90A 1KILE 1IFMA 2R5BA 2ZYAA 3LIDA 5C39A 4ASWA 4PV1D 2XDJA 4OH8B 1KC8Q 5AW7B 1X8YA 4YXWH 2QJPC 2YXQB 5CMZA 1G2CB 3H1LD 3GHGB 4HKZH 3GHGC 1LT1A 4YXDC 3G4SP 1BE3D 1IFDA 2FYUK 3BRTB 1FZEA 3NTNA 1DH3A 2LXBA 3D6YA 3L74J 1GK6A 1SQPG 1ZLLA 2AEFA 2O1KA 1SFCC 5CCGC 1U57A 2B87B 1PZQA 2K37A 2L5GB 2WSEH 1BSNA 1NWQA 2FFDA 5AVSB 3M9QA 4WY4A 5KLIB 1VQKP 1SQBD 1TU3F 2C0WA 2QEXP 2ZYDA 1H89A 1OX3A 4PJ0E 4Y99C 2JWDA 1PGPA 2I8DA 3K5BA 3KZIE 3TGUJ 5KAIH 1SQPE 3L35A 4H13B 3CMAP 3H1HE 4HJGH 1QX8A 1JY2P 2E75D 3MHVA 4U7JA 5AVZB 2WT7A 1W5CE 1KYOD 2HODA 4QMAA 1U7JA 2ZYGA 3IFMA 2HYNA 4GDOA 1PP9D 2OYHC 2OYHB 2Q7CA 2HFED 1KQLA 3NFQA 3L71D 5AW8B 1NAYA 2JWAA 5BU8B 4YPCA 2OYHA 1HBWA 2FKWB 2J58A 3BCCD 5AW0B 3G9RA 1QGKB 1SVFA 1FDOA 3RK2B 1PPJE 2H8PD 3VP8A 2WZ7A 3F89A 3L70D 3L75J 1LT9C 3H1KD 3L74E 1KB9E 1Q90D 2KLVA 2WSFJ 3H1LJ 2PRRA 2G8YA 2YIUB 3A0BH 1J1EC 2C0XA 3EQ2A 3VMAA 3CCJP 1N8RQ 1DD4A 2MKVA 1IC2A 4OGQD 2H43A 2K9JA 3L37A 1LTIC
chains in the Genus database with same CATH topology
2KI7B 2SPZA 4NPDA 4ZMDA 4MN4C 3PH0A 1JMBA 4GOEA 4KJMA 2P58A 1EC5A 1EDJA 2KZJA 4GOFA 4JBZA 1EDIA 5CBOA 2ZAEB 1BDCA 4CPGA 2RKLA 1EDKA 3RGUA 2UWJE 2HR3A 3FXEA 2OTKE 2KZIA 5K5GB 1H0TA 2KUBA 4BXLA 1FC2C 1BDDA 5EFWB 3ZDMA 4HB1A 3QWOC 1SS1A 2M5AA 1LP1A 2K3RA 1OVRA 2QRXA 1ZW0A 4ZNCA 5DJTB 1EDLA 1H0TB 4ASVA 4NPEA 2B89A 1OVUA 3MZWB 1ZXGA 2WMMA 1Q2NA 1OVVA 4K35A 4ASWA 5C39A 2KIKA 3FXDA 4HKZH 1LT1A 2M0BA 2LXBA 1JM0A 1NVOA 4K3AA 2B87A 2B87B 2QVAA 5DJUB 1MFTA 2Q1KA 2JWDA 2I8DA 2R44A 2LR2A 2LXCB 4HJGH 3MHVA 4WWIA 2KS1B 5CBNA 1U7JA 1U7MA 4IOIH 1DEEG 2B88A 1X0TA 3S1KA 1S3JA 1LP1B 4NPFX 4GODA 4EYYQ 2M5AB 1Y47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 B;  2SPZ A;  4NPD A;  4ZMD A;  4MN4 C;  3PH0 A;  1JMB A;  4GOE A;  4KJM A;  2P58 A;  1EC5 A;  1EDJ A;  2KZJ A;  4GOF A;  4JBZ A;  1EDI A;  5CBO A;  2ZAE B;  1BDC A;  4CPG A;  2RKL A;  1EDK A;  3RGU A;  2UWJ E;  2HR3 A;  3FXE A;  2OTK E;  2KZI A;  5K5G B;  1H0T A;  2KUB A;  4BXL A;  1FC2 C;  1BDD A;  5EFW B;  3ZDM A;  4HB1 A;  3QWO C;  1SS1 A;  2M5A A;  1LP1 A;  2K3R A;  1OVR A;  2QRX A;  1ZW0 A;  4ZNC A;  5DJT B;  1EDL A;  1H0T B;  4ASV A;  4NPE A;  2B89 A;  1OVU A;  3MZW B;  1ZXG A;  2WMM A;  1Q2N A;  1OVV A;  4K35 A;  4ASW A;  5C39 A;  2KIK A;  3FXD A;  4HKZ H;  1LT1 A;  2M0B A;  2LXB A;  1JM0 A;  1NVO A;  4K3A A;  2B87 A;  2B87 B;  2QVA A;  5DJU B;  1MFT A;  2Q1K A;  2JWD A;  2I8D A;  2R44 A;  2LR2 A;  2LXC B;  4HJG H;  3MHV A;  4WWI A;  2KS1 B;  5CBN A;  1U7J A;  1U7M A;  4IOI H;  1DEE G;  2B88 A;  1X0T A;  3S1K A;  1S3J A;  1LP1 B;  4NPF X;  4GOD A;  4EYY Q;  2M5A B;  1Y47 A; 
#chains in the Genus database with same CATH topology
 4WY4 C;  3CLQ A;  1SQV K;  2KI7 B;  4WY4 B;  2A45 H;  2PAJ A;  1VQL P;  1JUN A;  5E79 E;  3SSU A;  3T97 A;  1PPJ G;  3FWN A;  5KKZ C;  2BCC D;  3R4Y A;  3AE8 C;  2ZXX A;  2WPV B;  1JMB A;  5CJ4 A;  3W68 A;  2WTY A;  3VOP A;  1QL1 A;  1OZH A;  2ZT9 B;  1SQQ J;  3L71 G;  1CW5 A;  2Y0C A;  2KLU A;  1GL2 B;  1PP9 G;  1RY3 A;  2IFM A;  4L76 A;  4UB6 E;  1SQV J;  3JCU E;  2NPS D;  3A0H E;  3H1H J;  1SFC D;  4PV1 B;  4EIJ A;  4Z1M H;  1IFN A;  2N1T B;  5CCG D;  3HE5 A;  2WSC H;  4CPG A;  4D6T E;  3H25 A;  1M1K Q;  1JMM A;  1Q81 Q;  3L73 J;  1BDC A;  2JDI H;  1Y8A A;  1Y9B A;  1T8Z A;  1NTK J;  2BEQ D;  3GMA A;  2OYI A;  2E76 D;  2GM4 A;  1IFP A;  2OYI B;  1KYO I;  1JY3 N;  1N7S D;  3M06 A;  3RBZ A;  1KYO E;  2FYZ A;  3FXE A;  1LJ2 A;  3SWK A;  3CME P;  1K8A Q;  1YIT P;  2D2C B;  2OTK E;  1RE4 C;  1JNM A;  3H32 B;  3V5B A;  5M1B A;  5KLI C;  2FYU G;  1H0T A;  1NTZ E;  3LIE A;  3RBX A;  2N9Y B;  2BCC G;  2RH0 A;  1KV4 A;  3OW2 O;  1GW3 A;  3PTZ A;  2Y9Y A;  2NRG A;  2HLO A;  1M57 D;  2N1T D;  5GTI E;  1FZC A;  2WIT A;  1FC2 C;  3SWY A;  1BDD A;  1IO4 A;  2WWW A;  3MIW A;  1SLQ A;  4W7Y A;  1VF5 B;  1YQ4 C;  3B5N D;  2OTL P;  5EFW B;  4IFD K;  4HH2 A;  4OVN F;  4PD4 D;  3ZDM A;  3H1K G;  1HJB A;  3QWO C;  2XV5 A;  1JEK A;  2YO3 A;  5AVU B;  3HD7 D;  1SQQ D;  3TGU E;  2YMY A;  4OGQ C;  1NTM D;  2M3E A;  4C7N A;  3AEF C;  4OWF A;  1RF0 C;  2JO1 A;  2W8Z A;  2FYU J;  3IN6 A;  1AVY A;  1L0N G;  1VQ7 P;  3W67 A;  3AEB C;  1HUC A;  2CK3 H;  1UII A;  2K88 A;  3EWK A;  4ASV A;  3Q5P A;  2E42 A;  1NTK D;  4NPE A;  1EDL A;  5AW4 B;  3CCQ P;  1N7S A;  1XTC C;  1GD2 E;  3L72 E;  3MZW B;  3JCU H;  1NU1 D;  1HTL C;  2WMM A;  3B5N C;  1L0N J;  1KIL A;  1NTZ G;  4DT0 A;  5CCH D;  4GKG A;  1LWU C;  1T3U A;  4R4M A;  2A06 E;  3P8M C;  3CD6 P;  1GW4 A;  1T6A A;  1P84 E;  2KIK A;  5AW9 B;  5BVZ A;  3D6Z A;  2V4H A;  1YBK A;  1LTA C;  3R2P A;  2IYO A;  1USE A;  4PD4 I;  2GUS A;  2LKM A;  4BRY A;  4ZKP A;  3Q3D A;  1NOH A;  2QA4 P;  2M0B A;  2CPB A;  4JPZ B;  1JM0 A;  1NVO A;  4K3A A;  1K05 A;  2B87 A;  1T3J A;  3B5N A;  3II6 A;  3Q2Y A;  3HTK B;  1P84 I;  1WMK A;  3CCM P;  1NYH A;  5DJU B;  2YO2 A;  1L0L D;  5B5E E;  5KJ7 A;  1M1J C;  3AE6 C;  2E74 B;  2Q1K A;  3M0D A;  4HYT B;  1G2C A;  1LGH B;  2HPC B;  1SQQ G;  1L4A A;  1DD3 A;  3L71 J;  1YI2 P;  3EFG A;  1GTW A;  1KIL B;  2HPC A;  1AV1 A;  2LR2 A;  2W6B A;  3FGA D;  4D6T J;  3AE9 C;  1EZV G;  2E5Y A;  2PFX A;  2ZFC A;  5CBN A;  1FOS F;  3F5H A;  1J1D B;  3M91 A;  5AVQ B;  1P84 H;  3P32 A;  4IOI H;  1NTK G;  1DEE G;  2W6J H;  1X0T A;  1M1J A;  3WUT A;  3CCU P;  3S1K A;  1NJI Q;  1YHQ P;  1N73 C;  1S3J A;  1EZV I;  1OWA A;  1L0N D;  1FJK A;  5APU A;  1PIX A;  4PD4 E;  1S72 P;  1OW6 A;  3PHL A;  3VTP C;  1HF9 A;  4GOD A;  2O01 H;  4H44 D;  1KFN A;  2K9Y A;  4L75 A;  1BGY E;  4EYY Q;  1G1J A;  2C9L Y;  2K9J B;  3KXD A;  5KLV D;  3NMD A;  2Q9I A;  3IAO A;  1BGY J;  2OTJ P;  1BCC D;  1OW7 A;  1RE3 A;  4I6M C;  2E76 C;  1FOS E;  1NTZ D;  1M7L A;  1OMI A;  5KAF E;  2Q3E A;  1JB0 J;  3ABV C;  3OA7 A;  5E79 H;  1LWU A;  3E1R A;  3HUS B;  4RES B;  5B66 E;  1BGY G;  3SWF A;  2QJY C;  2P58 A;  3GF3 A;  1EC5 A;  3AE2 C;  3JSV C;  1GU4 A;  2KZJ A;  4L73 A;  3M9B A;  3AEE C;  3GG2 A;  3CC4 P;  5KTB A;  3E1I A;  4KT0 J;  5CCH C;  1QVF O;  2QJP B;  2KNC A;  1JOC A;  2FYN C;  3CXH I;  1EDI A;  5CBO A;  2FYU E;  1SQQ K;  4EDF A;  1N73 B;  2ZAE B;  2V7Q J;  1NO4 A;  3AEG C;  2OGU A;  4D6T D;  1KQF B;  3V2N A;  1GL2 D;  2RKL A;  1J1D C;  4ZKU A;  1Q82 Q;  4C7N B;  1IJD B;  1URQ C;  5AVR B;  3BRV B;  3LW5 H;  3O6Q A;  2QM8 A;  1MKM A;  1S1C X;  1WT6 A;  5KKZ B;  2Q5U A;  1CI6 A;  3H1J D;  3B8E B;  1LTS C;  4XFJ A;  2WVR A;  3U1C A;  3RK2 D;  1FAV A;  2E75 C;  2BCC E;  1OW8 A;  4IFM A;  2KZI A;  3VP9 A;  3CCV P;  1MUU A;  3MUD C;  2R32 A;  3WU2 H;  2E43 A;  3JC2 2;  3BCC G;  4IL6 H;  3IR9 A;  2KUB A;  3TNU B;  3A0H H;  5TJH A;  1SQX D;  3TSI A;  1L0L E;  1M8O B;  1NTM J;  1SQV D;  1WRG A;  2N1T C;  1L4A D;  2KXP B;  4H0L D;  1Z56 A;  4U3F G;  1ZRT E;  3BAS A;  5CJ0 A;  5GTI H;  1BCC G;  1CI6 B;  3S4R A;  3Q5S A;  3CX5 E;  2KOG A;  5TIS H;  3L75 G;  3G71 P;  3USS A;  1VPC A;  1CZQ A;  1USD A;  3MD0 A;  2P10 A;  2ITA A;  3G3Z A;  3L71 E;  1KOR A;  1RHZ B;  2IDB A;  2OYI C;  1FE6 A;  2CPS A;  2XND H;  1AVO A;  1PP9 E;  1QLE D;  1URQ B;  1SQB G;  1PV3 A;  2K3R A;  1W2E A;  4JQ0 D;  3WMM 0;  3FWL A;  3VMX A;  5B66 H;  3L75 E;  2A06 D;  4H44 B;  5AW6 B;  1IK9 A;  5KJ7 C;  2YIU C;  3L72 D;  1VQ8 P;  2IX7 C;  2W6A A;  1AA0 A;  1LWU B;  3HUS A;  3MGN A;  1NTM G;  1JCC A;  2YXR B;  2OYO A;  3OJA B;  1OVU A;  2YMK A;  3A7O A;  3KPE A;  4LC1 A;  4RO0 A;  1BE3 G;  1Q2N A;  1SQB E;  4H13 C;  2O1J A;  2BAS A;  1KZU B;  1PFI A;  1KD1 Q;  4U3F E;  3FXD A;  1KB9 I;  3GHG A;  5CHX A;  2FFD B;  2KP8 A;  1SQQ E;  2FBW C;  1SQP J;  5AW1 B;  4UB8 E;  3I56 P;  3VN0 A;  1SQX J;  3TDK A;  1N7S B;  5AVT B;  3AE5 C;  2B9B A;  2G3A A;  1R8E A;  1FJP A;  4PJ0 H;  2W83 C;  3IF4 A;  3VMY A;  1JY3 P;  3RK3 E;  1PGQ A;  3A2A A;  3AEC C;  3PJS K;  3WUV A;  1K73 Q;  1KIL D;  1MZ9 A;  1NKN A;  2WQY C;  1J1E B;  1RE3 C;  1S5L X;  2IZ0 A;  3HD7 B;  1RF1 B;  1BE3 J;  2IBZ G;  3MP7 B;  2FXO A;  1VQ9 P;  2Z5H A;  2R3C A;  2WSS H;  4TLF A;  4IL6 E;  2N1T A;  2J59 M;  1NU1 K;  3PLN A;  5APT A;  1NU1 G;  1LTJ A;  1ZN5 A;  3C1L A;  4LGD E;  2KS1 B;  1SQB K;  3I5C A;  2AXT H;  3L75 D;  1CSB A;  2O3J A;  3H1K J;  3CWB D;  1FZG A;  1OIP A;  1U7M A;  1GK4 A;  4DJG A;  5TIS E;  1RQV A;  3Q1M A;  2KB7 P;  4EI2 A;  3L72 G;  1VF5 C;  4U3F J;  3V2Q A;  1YJW P;  1S4X A;  1NTM K;  4RJT A;  1FZC C;  3T97 B;  1IFI A;  2DW3 A;  2WSE J;  3D71 A;  1H88 A;  1LTJ C;  3CX5 D;  3GW6 A;  2M5A B;  1ZRT D;  2JKV A;  4IFF A;  1SQV E;  1MV8 A;  1NKZ B;  1VL2 A;  2K1A A;  2P2U A;  1AJY A;  1SQX E;  3I55 P;  1KTM A;  1URQ D;  1Q7Y Q;  3PP5 A;  3MTU E;  2I1J A;  4H0L B;  2SPZ A;  1MFZ A;  5CCH A;  1RF1 A;  1GDT A;  3L73 E;  2WPS A;  2QJK B;  3SFE C;  4ZMD A;  4MN4 C;  3PH0 A;  1L0L K;  2MJZ A;  4GOE A;  4KJM A;  2E74 D;  3L72 J;  2QM7 A;  1GL2 A;  2AXT E;  3H1H G;  1OXZ A;  2N9B A;  1KB9 D;  3L74 D;  2WPQ A;  3H1K E;  2YKQ A;  3BCC J;  3L70 E;  4JBZ A;  1AQT A;  1K04 A;  1PPJ D;  4XE5 B;  1M56 D;  4IL6 X;  4YTP C;  1SP4 A;  3BCC E;  3L70 J;  1T2K C;  1A02 J;  1RF0 A;  2XZR A;  1A02 F;  1NAF A;  1EQ7 A;  3FX0 A;  3QH9 A;  3RL0 D;  1KB9 H;  3RL0 g;  2IPP A;  2KS1 A;  5APV A;  5KAF H;  5BU5 A;  2IBZ I;  1ZR4 A;  1N7S C;  3VYI A;  1J2J B;  2IBZ D;  3CWB E;  2UWJ E;  3N4X A;  5KLV G;  2M8R A;  5AVY B;  2O01 J;  3VMZ A;  4AYC A;  4D6T G;  3AEA C;  3KHU A;  3H1H D;  3C9I A;  1VQ4 P;  5AW2 B;  1VQ6 P;  3E7K A;  2ZT9 C;  2KYV A;  4WBA A;  1DEB A;  2PGD A;  1HGV A;  3CCL P;  4N6J A;  1JY2 N;  5APW A;  1DX7 A;  4DZO A;  1LTT C;  5KJ7 D;  1LNQ A;  3RK3 D;  2AEM A;  1NU1 J;  1L4A C;  2H89 C;  2JJL A;  4BXL A;  2HG5 D;  2FYN B;  1M90 Q;  1RH5 B;  3U1A A;  4I1L A;  3TK1 A;  3D70 A;  2WPR A;  3CX5 I;  1L4A B;  5AW5 B;  3M9H A;  2JR8 A;  4HB1 A;  1YJN P;  1L0N E;  1BE3 E;  2C9N Y;  2ZVO B;  5H2F H;  1N2D C;  2A45 G;  5APS A;  1IK7 A;  4DCK A;  1R5L A;  3H1L E;  3RK2 C;  2M5A A;  1LP1 A;  1ZV8 A;  1VDF A;  1LT9 B;  5AVW B;  4U3F D;  1JCD A;  3WUU A;  1FZC B;  3CCS P;  1ZOY C;  2QRX A;  1SQX G;  1ZP0 C;  1SQX K;  1GMJ A;  2AEJ A;  1ZW0 A;  1RQU A;  2WT7 B;  1VQP P;  3CWB J;  1X9V A;  1SQP K;  3M0A A;  1X22 A;  5DJT B;  4ZNC A;  2JEE A;  1GU5 A;  4BRY B;  2E74 C;  3O8Z A;  4B86 A;  4N78 E;  1S9K E;  1EZV E;  1E79 H;  2B89 A;  3CX5 H;  2JP3 A;  2OQQ A;  3H1L G;  1YIJ P;  1ZXG A;  1KIL C;  1OVV A;  1JTH A;  1URQ A;  3H1J G;  3P7K A;  3P8C E;  4K35 A;  4WY4 D;  2V7Q H;  3KYQ A;  2BEZ F;  1S9K D;  3U59 A;  3HUS C;  5KLV K;  4PV1 C;  3CPW O;  1H8A A;  3H6P A;  4BWN A;  3WU2 E;  1Q86 Q;  2OAR A;  3CXH E;  3HD7 A;  2ZT9 D;  1VQO P;  1DIP A;  1EXI A;  1ZME C;  2L91 A;  4O9B A;  2NPS A;  3TYY A;  4TT3 H;  1L0N K;  4OGQ B;  2P7J A;  2WSF H;  1JTH B;  4C7R A;  3CXH D;  1NGM B;  2NPS B;  1FU1 A;  3H1I D;  1SFC B;  2KSE A;  4AQR D;  3V2P A;  1XTG B;  2QVA A;  2QJK C;  1D7M A;  3RK3 C;  1P84 D;  3V2R A;  3V4W A;  1KQS O;  1HJ0 A;  1MFT A;  2ZXE B;  3RL0 C;  4H13 D;  1YTZ T;  2AXC A;  2D2C C;  2P67 A;  2E75 B;  4H44 C;  5L8R J;  2Y9Z A;  1KN7 A;  2Q3I A;  2R44 A;  3KQG A;  1GZL A;  4N78 D;  1E5W A;  1BCC J;  1G1I A;  1YJ9 P;  1VQN P;  1AQ5 A;  2LXC B;  1FZB A;  3GLM A;  2IYP A;  1JY3 O;  4WWI A;  3PRJ A;  5APQ A;  1IZN B;  1FDI A;  2KK7 A;  2XNX A;  3O6Q B;  1SQV G;  1HH0 A;  3H1J E;  3MUD A;  4N3Y B;  2NZ2 A;  4WB4 A;  3B71 A;  2POH A;  1FS0 E;  3KDP B;  3Q5R A;  1AFO A;  1NTM E;  2B88 A;  2A06 G;  1N73 A;  2YKO A;  3L73 G;  2GA1 A;  3L36 A;  1HVV A;  3TGU D;  2W27 A;  3CXH H;  1FZF A;  1EXJ A;  3CC2 P;  3HE4 A;  3TF5 A;  1KFM A;  1S5L H;  1LP1 B;  2FYU D;  1SFC A;  3SFD C;  4A7P A;  5CCG A;  3CCR P;  3BVH A;  4AUW A;  1R5S A;  4I7Z C;  4NPF X;  4I7Z B;  2HOD B;  2NPS C;  2IFN A;  3BAT A;  4H0L C;  3GF7 A;  2J5U A;  3CI9 A;  1N7L A;  4EOT A;  3HD7 C;  1Y47 A;  3LW5 J;  3RL0 B;  4PD4 H;  1JO5 A;  1BSH A;  2KNC B;  1NTZ K;  3A5T A;  1FZA A;  1W2B O;  4NPD A;  2Z5I A;  1LTG C;  1JY2 O;  1KMI Z;  2YNY A;  2ZVN B;  3H1I J;  3HE4 B;  4I2L C;  1NTK K;  4L74 A;  5GTH H;  2YKP A;  1KYO H;  1BCC E;  1X79 B;  2GUV A;  3AE7 C;  2O01 N;  2Z4E A;  3TNU A;  5KLV E;  1EDJ A;  1QEX A;  3TGU G;  2IBZ E;  4XA4 A;  3H1I G;  4GOF A;  1BGY D;  1PGO A;  3OAK A;  3H1J J;  4UB6 H;  2KSJ A;  2QG4 A;  1LTB C;  3CL3 D;  3S9O A;  1NTZ J;  5APX A;  2Q6Q A;  3CCE P;  1GL2 C;  3H32 A;  4W80 A;  2R5D A;  1L0L J;  1EDK A;  1LT9 A;  1LTJ B;  3C8V A;  3CWB G;  3N7N A;  1QVG O;  2FY8 A;  1IFJ A;  2D2C D;  2Y0D A;  3NXS A;  1NHL A;  4GIF A;  2RN0 A;  3AE3 C;  3RGU A;  2QIW A;  2HR3 A;  1YYC A;  4Y28 J;  1RF1 C;  1ZR2 A;  1L0L G;  2IZ1 A;  1PGJ A;  2E76 B;  2QSI A;  1YTZ I;  1HGZ A;  2A45 I;  4JF7 A;  5AVV B;  5KLV J;  1HWT C;  2FXP A;  3HE5 B;  4JYC A;  5K5G B;  4JYB A;  3L73 D;  3KZI H;  5KAI E;  1PP9 J;  2M3B A;  4GT1 A;  1YQ3 C;  1VQ5 P;  2VRS A;  3HTK A;  3UIA A;  2H88 C;  4W7Z A;  1VF5 D;  2RMZ A;  3B5N B;  2Y0E A;  1PL5 A;  1FBM A;  5APY A;  1FDM A;  3ITK A;  3M0D C;  3H1I E;  2QE7 H;  3V6I A;  2XU6 A;  1L2P A;  3AE4 C;  3AED C;  4RKU J;  1S5L E;  4R4L A;  3RK3 B;  4M3L A;  2FFD C;  3CC7 P;  4DOJ A;  2I1K A;  1SQB J;  2E5T A;  4UB8 H;  4C46 A;  4LLH A;  1SS1 A;  3HRN A;  3G6E P;  2XKM A;  2FXM A;  5H2F E;  3AE1 C;  1K9M Q;  3L70 G;  1KQG B;  3EFF K;  1VQM P;  1OVR A;  4KHX A;  1S2E A;  1OFC X;  3L74 G;  1QL2 A;  4WVZ A;  1N86 A;  5GTH E;  2WSC J;  2BCC J;  1RE4 A;  2ZJS E;  2R3S A;  3P8C D;  4Y99 B;  3L4F A;  1NU1 E;  1M1J B;  3B4S A;  1H0T B;  5AVX B;  1UIX A;  1SQP D;  1T2K D;  1EZV D;  2P1J A;  3V4Q A;  1NTK E;  2PP6 A;  5AW3 B;  1NH4 A;  2H7H A;  3A0B E;  3A3Y B;  2QJY B;  5B5E H;  2W90 A;  1KIL E;  1IFM A;  2R5B A;  2ZYA A;  3LID A;  5C39 A;  4ASW A;  4PV1 D;  2XDJ A;  4OH8 B;  1KC8 Q;  5AW7 B;  1X8Y A;  4YXW H;  2QJP C;  2YXQ B;  5CMZ A;  1G2C B;  3H1L D;  3GHG B;  4HKZ H;  3GHG C;  1LT1 A;  4YXD C;  3G4S P;  1BE3 D;  1IFD A;  2FYU K;  3BRT B;  1FZE A;  3NTN A;  1DH3 A;  2LXB A;  3D6Y A;  3L74 J;  1GK6 A;  1SQP G;  1ZLL A;  2AEF A;  2O1K A;  1SFC C;  5CCG C;  1U57 A;  2B87 B;  1PZQ A;  2K37 A;  2L5G B;  2WSE H;  1BSN A;  1NWQ A;  2FFD A;  5AVS B;  3M9Q A;  4WY4 A;  5KLI B;  1VQK P;  1SQB D;  1TU3 F;  2C0W A;  2QEX P;  2ZYD A;  1H89 A;  1OX3 A;  4PJ0 E;  4Y99 C;  2JWD A;  1PGP A;  2I8D A;  3K5B A;  3KZI E;  3TGU J;  5KAI H;  1SQP E;  3L35 A;  4H13 B;  3CMA P;  3H1H E;  4HJG H;  1QX8 A;  1JY2 P;  2E75 D;  3MHV A;  4U7J A;  5AVZ B;  2WT7 A;  1W5C E;  1KYO D;  2HOD A;  4QMA A;  1U7J A;  2ZYG A;  3IFM A;  2HYN A;  4GDO A;  1PP9 D;  2OYH C;  2OYH B;  2Q7C A;  2HFE D;  1KQL A;  3NFQ A;  3L71 D;  5AW8 B;  1NAY A;  2JWA A;  5BU8 B;  4YPC A;  2OYH A;  1HBW A;  2FKW B;  2J58 A;  3BCC D;  5AW0 B;  3G9R A;  1QGK B;  1SVF A;  1FDO A;  3RK2 B;  1PPJ E;  2H8P D;  3VP8 A;  2WZ7 A;  3F89 A;  3L70 D;  3L75 J;  1LT9 C;  3H1K D;  3L74 E;  1KB9 E;  1Q90 D;  2KLV A;  2WSF J;  3H1L J;  2PRR A;  2G8Y A;  2YIU B;  3A0B H;  1J1E C;  2C0X A;  3EQ2 A;  3VMA A;  3CCJ P;  1N8R Q;  1DD4 A;  2MKV A;  1IC2 A;  4OGQ D;  2H43 A;  2K9J A;  3L37 A;  1LTI C; 
#chains in the Genus database with same CATH homology
 2KI7 B;  2SPZ A;  4NPD A;  4ZMD A;  4MN4 C;  3PH0 A;  1JMB A;  4GOE A;  4KJM A;  2P58 A;  1EC5 A;  1EDJ A;  2KZJ A;  4GOF A;  4JBZ A;  1EDI A;  5CBO A;  2ZAE B;  1BDC A;  4CPG A;  2RKL A;  1EDK A;  3RGU A;  2UWJ E;  2HR3 A;  3FXE A;  2OTK E;  2KZI A;  5K5G B;  1H0T A;  2KUB A;  4BXL A;  1FC2 C;  1BDD A;  5EFW B;  3ZDM A;  4HB1 A;  3QWO C;  1SS1 A;  2M5A A;  1LP1 A;  2K3R A;  1OVR A;  2QRX A;  1ZW0 A;  4ZNC A;  5DJT B;  1EDL A;  1H0T B;  4ASV A;  4NPE A;  2B89 A;  1OVU A;  3MZW B;  1ZXG A;  2WMM A;  1Q2N A;  1OVV A;  4K35 A;  4ASW A;  5C39 A;  2KIK A;  3FXD A;  4HKZ H;  1LT1 A;  2M0B A;  2LXB A;  1JM0 A;  1NVO A;  4K3A A;  2B87 A;  2B87 B;  2QVA A;  5DJU B;  1MFT A;  2Q1K A;  2JWD A;  2I8D A;  2R44 A;  2LR2 A;  2LXC B;  4HJG H;  3MHV A;  4WWI A;  2KS1 B;  5CBN A;  1U7J A;  1U7M A;  4IOI H;  1DEE G;  2B88 A;  1X0T A;  3S1K A;  1S3J A;  1LP1 B;  4NPF X;  4GOD A;  4EYY Q;  2M5A B;  1Y47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...