1JY3N

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GWPFCSDEDWNTKCPSGCRMKGLIDEVDQDFTSRINKLRDSLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 13
structure length 44
sequence length 44
chains with identical sequence Q
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy3N00
1LWUC 1M1JB 3BVHA 1LT9A 2Q9IA 1JY2N 2FFDB 2FFDC 1N73A 1LTJA 2A45I 1LT9C 1JY3P 1W2EA 1LT9B 2OYIA 1N73C 1N73B 1FZBA 1LTJB 1RE4A 1LTJC 3E1IA 2OYIB 2HPCA 2HLOA 1RF1A 2OYIC 3GHGA 1T3UA 1FZAA 1RE4C 2HPCB 2Z4EA 1RF1B 1RF1C 1RE3A 3GHGB 3GHGC 1JY2O 1JY3N 3HUSA 2A45G 1FZFA 1N86A 3HUSB 3HUSC 1RE3C 1FZCA 1RF0A 2A45H 1FZEA 1JY2P 3H32A 2OYHA 2HODA 1FZCB 1LWUB 1FZCC 1RF0C 2XNXA 1LWUA 2OYHC 1M1JA 3H32B 1FZGA 2H43A 2OYHB 2HODB 2FFDA 1M1JC 1JY3O
chains in the Genus database with same CATH superfamily
1ZR4A 1OXZA 1L4AA 1OFCX 3D6ZA 3CWBJ 5KLVG 1M8OB 4A7PA 2LXCB 4TT3H 4U3FJ 2GM4A 5AVUB 1QGKB 1JOCA 3A0HE 1IK7A 1P84H 3OW2O 2Q6QA 3HE5B 3BRVB 3TNUB 2M5AA 1LT9B 5BVZA 2Y0DA 1NKZB 1NTMD 2JWAA 3NTNA 1YYCA 3TGUE 3AE6C 3FXDA 4L74A 3H1JD 1Q81Q 3CX5D 2OGUA 2AEFA 3RBZA 1LTIC 3CX5I 2KSEA 5CCHC 4PJ0E 2FXMA 1Y9BA 4WY4D 3V2NA 1PGPA 2YMYA 2QVAA 1YBKA 3AEAC 4N6JA 3GF3A 3P8CE 3AEFC 4D6TD 1HF9A 1NTKJ 2FXPA 2BCCE 3ABVC 1N2DC 2OYHC 1YQ4C 3MIWA 5CCGD 2KNCA 1ZR2A 2C0XA 3Q5PA 1RY3A 1A02J 3WUUA 4W7ZA 1X22A 1AVYA 5AVSB 5DJUB 2WZ7A 1RE3C 1KFNA 2WSEH 5CHXA 2YNYA 1R5SA 3FWNA 4WBAA 1USDA 1YJWP 3AE9C 2E75C 2O01N 2KS1B 1NU1D 4UB8H 3M9BA 1QL2A 3O6QB 3CC7P 1X9VA 2FY8A 2I1JA 5TISE 2XU6A 1EZVD 3E7KA 1GL2A 1SQXE 3PH0A 1EZVI 5GTHE 2G3AA 1W2EA 1LGHB 2AEJA 4DZOA 1VQ4P 4AUWA 1M57D 2H7HA 3HD7A 3LW5J 1FZFA 4QMAA 3CCMP 2O1JA 1JUNA 4KJMA 1YJNP 1P84E 4JYBA 4N3YB 3M0AA 2A06E 3L72J 2OYOA 3CL3D 3MUDC 3M0DC 2IBZE 3G9RA 3CX5H 1IFPA 4JQ0D 1LJ2A 5APWA 4DCKA 3M9QA 3H1HE 3P8MC 1VQ5P 1ZRTD 3CCJP 3SWFA 3AE5C 2PP6A 1HGVA 3RBXA 2OYIC 1S9KE 3L75D 2PFXA 1KTMA 3M9HA 2NPSC 2JO1A 1SQQD 1URQD 2RKLA 2KI7B 5AW2B 4EYYQ 2JJLA 2LR2A 3BVHA 1RQVA 2WSFJ 3EWKA 1S1CX 1JO5A 2W90A 3LIEA 2HG5D 5CMZA 1FJPA 1L0LK 2E76C 3V5BA 2FXOA 4PV1C 4H0LC 1E5WA 1KILA 1UIXA 4NPEA 2M3EA 1JMBA 1SFCC 1SQPJ 1ZOYC 1BE3D 1VL2A 5KAIH 3CPWO 3FX0A 4IFDK 1IK9A 3IR9A 1JTHB 3KQGA 1BSNA 2E5TA 4O9BA 1N7SC 3V4QA 3E1IA 2E74C 1KC8Q 2IZ0A 3CCRP 5CJ0A 3SFEC 2JWDA 2KB7P 2YIUC 1URQA 3LIDA 2CPBA 3JCUH 5AW9B 1SQVE 2Y0CA 2C0WA 1NAYA 2B9BA 2QJKB 2ZT9B 3AEDC 2HPCA 3G6EP 2Z4EA 1NTKK 2R5DA 3GMAA 4U3FG 4K3AA 2Z5IA 3N7NA 1XTGB 2FYUE 2O1KA 3H1LJ 1OVVA 1NTZE 2PAJA 1J1DB 1BCCJ 2ZXXA 3NXSA 1T8ZA 2I1KA 1SQBD 1PIXA 3RL0g 4D6TE 3S1KA 4K35A 2HODA 1NTMG 1PL5A 3H1KJ 1SQBJ 1VPCA 3H25A 1PP9E 4WY4C 4TLFA 3H1JG 4ZKUA 3Q5RA 2HFED 3R2PA 3OAKA 1OIPA 3TSIA 1VQ7P 3VP9A 3TGUJ 1LWUC 4JF7A 1DH3A 5CCGC 1Y47A 3VMXA 3F5HA 4C7NA 2IFNA 1Z56A 4D6TG 2XV5A 2R44A 1NHLA 1X8YA 1KV4A 2IYOA 1LTBC 2M0BA 2DW3A 3CCVP 3WMM0 1VQ9P 2GUSA 2NRGA 2QJYC 5APSA 4DOJA 5B5EH 2IDBA 2P67A 2Q1KA 2QE7H 1KB9D 3HUSA 1OWAA 2JKVA 1YTZI 1YHQP 1PV3A 4CPGA 1KB9I 2WT7A 3BASA 2FFDA 3P7KA 3WUTA 3RGUA 1NU1G 3JCUE 5BU5A 2FBWC 1KD1Q 3L70D 3V4WA 1FJKA 5APUA 1K9MQ 1EZVG 2ZYAA 4YXWH 1HH0A 2QJPC 2KYVA 3CI9A 1EDJA 4H13D 3CCLP 3BCCD 1ZXGA 4GIFA 5KLIB 2VRSA 1L0NE 2Q9IA 2AXTE 2E5YA 3IFMA 1WMKA 1AA0A 3AE4C 2E75B 1GW4A 3L75E 1G2CB 4JBZA 3CCQP 1SQQE 1MV8A 2KOGA 5AW1B 3RK3E 1L4AD 5APQA 1U57A 1IFNA 1SQPK 1N73B 2LKMA 1RF1A 2KZJA 1HVVA 4IL6X 1Y8AA 1PPJE 3KZIH 3I5CA 1URQC 2MJZA 3B5ND 2QIWA 1MFTA 3L36A 2UWJE 3L75G 1JY3P 2W27A 3AEGC 3C9IA 1VQ8P 1OZHA 1SQQG 4DT0A 5KLVE 1EC5A 1T2KD 4ASVA 3T97B 3VOPA 5KTBA 2P7JA 2ZAEB 4GOFA 1KYOD 1L0LD 2OYIB 5AW8B 1KB9H 1FZAA 1KQSO 1KYOI 3W67A 5B5EE 3VN0A 3KXDA 2NPSB 3CWBD 1LTSC 1J1EC 2B87A 1OW8A 2Q5UA 2JDIH 3HTKA 4U3FD 1DEBA 1OVRA 4KHXA 2HR3A 3NFQA 2ZJSE 2W6JH 1VDFA 1W5CE 1BE3G 5AVQB 2AEMA 2W6AA 2E76B 1R5LA 1ZMEC 4Z1MH 4PV1B 4H0LB 1SQBK 3Q2YA 1SVFA 3B5NA 1DD3A 1Q90D 2A45I 1FS0E 1IC2A 1SFCB 1Q7YQ 5APVA 4C46A 3AE1C 3JC22 3CXHE 1RF0A 3HE5A 3TNUA 1LT9A 1GL2D 3FGAD 4RKUJ 1N7SB 2E74B 3A2AA 1NTKD 1SQVJ 3HD7D 3B4SA 1NVOA 1QX8A 3HUSC 1ZLLA 2YIUB 1FZEA 2CK3H 3KZIE 3L74D 2O3JA 1LTTC 3H1KG 4HKZH 1FZBA 1BGYJ 1RE4A 1SQBG 2XZRA 3GG2A 4ZKPA 2FYUJ 1NTZJ 3L74J 1H0TB 4OWFA 4N78D 1JCDA 1AV1A 3OJAB 1KYOH 2W83C 3IN6A 5AVWB 1U7JA 2AXCA 1LTJC 3CLQA 2CPSA 1KB9E 2QSIA 1G1IA 2WPQA 1JMMA 4PD4D 1NAFA 2N9YB 2BEZF 4NPFX 5KAFH 1NWQA 4PD4I 4I6MC 1S3JA 3A0BH 2YXQB 3G3ZA 4GODA 2KS1A 2ZFCA 4WY4B 3L70E 2L91A 3O6QA 2D2CD 2A45H 3WU2H 5CBNA 1T6AA 3H1IJ 3L72D 1RQUA 3A3YB 2KP8A 1KILD 1LWUB 3HE4B 3CMEP 2E42A 1FE6A 5B66H 2JR8A 1LT1A 1EXIA 1OW6A 2QM7A 1FZCC 1QVFO 5KKZC 4H13C 3L71D 2IYPA 4ZMDA 3L70G 1FOSE 2QJYB 3FXEA 1VQNP 1USEA 4Y99C 4RO0A 3GHGC 3BCCG 1DEEG 3L71J 4XFJA 5AW6B 3KPEA 3PRJA 4RJTA 1YTZT 1HUCA 4OGQB 1L4AC 2O01H 2ZYGA 2QJPB 1K04A 1YJ9P 1SS1A 1ZP0C 4Y28J 1SQPD 1ZV8A 3B5NC 1XTCC 5AVXB 3D6YA 1Q86Q 3U1CA 3CMAP 1FDIA 1GDTA 1HGZA 4PD4H 3CWBE 2GA1A 3RL0D 3L73J 1LP1B 1H89A 3V2RA 1T2KC 4W7YA 3LW5H 4UB8E 3QWOC 1M1JB 1WRGA 3L37A 1S2EA 4U3FE 5KAFE 1LT9C 3G71P 3A0BE 2KZIA 2ITAA 1WT6A 1QVGO 3TF5A 1EDKA 3EFFK 1BDCA 3F89A 4YTPC 3WU2E 1HTLC 3RK2D 3MP7B 1L0LG 5KLVJ 1EXJA 4I7ZB 3RK3B 1K05A 1MFZA 1CW5A 1SQVK 1UIIA 2K3RA 3CWBG 1NTME 4KT0J 1YIJP 2HPCB 3H1LD 2K9YA 3B71A 5B66E 3JSVC 4BWNA 1BCCD 3H1JE 3CX5E 4XE5B 2J5UA 2FYUK 1NTZK 5AW3B 1VF5D 3M06A 2YXRB 2WSFH 1U7MA 2WSCJ 3H1KD 2A45G 1IFMA 2B89A 2NZ2A 1J1EB 1AQTA 3CCSP 1S72P 1OW7A 1Q82Q 3VYIA 1S5LH 1GL2C 3S4RA 2FYZA 1Q2NA 3TGUD 2K9JB 2W6BA 3D70A 3HD7C 2L5GB 3TDKA 2OTKE 3VP8A 1NTKG 1GW3A 2Q3IA 2V7QH 3G4SP 2E43A 1NU1E 4GKGA 3P8CD 1CZQA 1JNMA 3L74G 2BCCD 5E79H 5KAIE 1EZVE 3V2PA 2POHA 5KJ7D 2R3SA 3U59A 3C1LA 2BCCJ 4IL6H 3AE3C 4L73A 3HUSB 1JY2P 4DJGA 1KILE 4C7RA 2OYHB 2M3BA 2RH0A 3E1RA 1GZLA 1HBWA 5AVRB 1S5LX 2KSJA 1W2BO 5K5GB 2D2CC 3V6IA 1KILC 4BRYB 1MUUA 3L4FA 1GMJA 1ZRTE 2ZYDA 1L0NK 2N1TD 2QA4P 1LTJB 1KZUB 1RE3A 3L72G 5EFWB 1SQXJ 1FBMA 1E79H 3KYQA 4I1LA 1AFOA 3H32B 3MHVA 4RESB 5C39A 5KJ7A 2A06D 1IJDB 1G2CA 1IO4A 4H44D 2BASA 1BDDA 2H88C 1QEXA 2IBZD 3I55P 4B86A 3Q5SA 1GU5A 3L71G 2IBZI 3AEBC 4PJ0H 1CI6B 1SQPE 2GUVA 1M7LA 1J2JB 1N73A 2KLVA 1T3UA 2WVRA 4XA4A 4OH8B 3H1HJ 2Z5HA 1OMIA 1BE3E 5KLVK 2KXPB 2Q3EA 2WPSA 1FZCB 4H13B 5E79E 4MN4C 2N1TA 2QJKC 3L35A 1VQPP 3MUDA 3M0DA 4Y99B 1D7MA 3GHGB 4YXDC 4IL6E 3EFGA 1SQPG 2QEXP 3RL0C 3T97A 3L73G 1DIPA 2PRRA 3HRNA 2OYIA 1L4AB 2R3CA 1KORA 4EDFA 2H89C 2WTYA 3H1LE 1H88A 2WSEJ 1KN7A 1NKNA 2WPVB 1DD4A 2LXBA 1VQOP 4HYTB 1GTWA 2IZ1A 3B5NB 3RK2C 1KQLA 1PGJA 3ZDMA 2J58A 2I8DA 1NGMB 2M5AB 1NH4A 4GDOA 3H1KE 1YI2P 1SQBE 1OX3A 4AYCA 4HH2A 3IAOA 4NPDA 1SQVD 3SSUA 1SFCA 3H1LG 4WVZA 1AVOA 3CCEP 4HB1A 2ZXEB 1VF5C 1BCCG 5AVTB 4UB6H 1AJYA 5BU8B 2RMZA 1BGYD 1NTMJ 2FYUD 1PGQA 1FZGA 1QL1A 3M91A 2YMKA 1NTZD 2N9BA 3VMAA 1JM0A 4I2LC 1OVUA 1N7SA 2FFDC 1PFIA 2KNCB 1NJIQ 3H1JJ 1NO4A 1VQKP 2HLOA 1FDOA 1N86A 4EI2A 1G1JA 3TGUG 1JY2N 3WUVA 3B8EB 4LGDE 2H8PD 2XNDH 1M56D 1PP9D 4D6TJ 2XKMA 1VQ6P 1H0TA 4EOTA 3BRTB 4R4LA 3MTUE 1AQ5A 1X0TA 1PP9J 3GLMA 2XNXA 1IFIA 5KLIC 2O01J 5APXA 5APTA 2WPRA 1GL2B 5KJ7C 1HWTC 1SQXK 3H1ID 2P2UA 1BSHA 2V4HA 5TJHA 2BCCG 1RF1C 3D71A 2J59M 3HD7B 2QRXA 3IF4A 3PTZA 5M1BA 2W8ZA 2YKOA 2K1AA 3BCCE 1NU1J 2FYNC 4OGQD 4WY4A 1N73C 1K73Q 1ZW0A 1HJBA 3CC4P 1LWUA 3HE4A 1KQFB 5CCGA 4GOEA 2KIKA 3AE7C 1FDMA 3VTPC 2N1TC 1FOSF 3BATA 2C9LY 1GD2E 1JY3N 1K8AQ 4UB6E 3II6A 1SQXG 5AW7B 1L0ND 4YPCA 2KK7A 1HJ0A 4OVNF 5AVYB 4R4MA 3PJSK 1LNQA 1L0NJ 4H44C 3U1AA 3K5BA 2D2CB 4IOIH 1X79B 3SWKA 1NYHA 2A06G 3L75J 3RK3D 1KILB 2ZVNB 1IFDA 2ZT9D 3L73D 2IBZG 1SQQJ 1KYOE 1PZQA 2MKVA 1L0LE 2WMMA 3O8ZA 1PPJD 3H1HG 2P10A 4HJGH 1RF0C 4IFFA 4ASWA 3KHUA 3VMZA 2IX7C 1MKMA 2C9NY 1MZ9A 4GT1A 1TU3F 1JB0J 3N4XA 5KLVD 4AQRD 1CSBA 2QG4A 1LP1A 3GW6A 4WB4A 1S4XA 5H2FH 3GF7A 4L75A 3Q1MA 2V7QJ 3A5TA 1M1JA 1URQB 4U7JA 2H43A 1JTHA 1LTAC 1VQLP 3Q3DA 1BE3J 3P32A 5AVZB 3CD6P 1SP4A 1IFJA 1RE4C 1NTMK 2Y9YA 3R4YA 1JY2O 1M1KQ 2P1JA 2G8YA 2RN0A 3MGNA 2FKWB 1H8AA 3UIAA 1KQGB 1JCCA 2YO3A 1R8EA 3C8VA 4BXLA 3EQ2A 1NTKE 3KDPB 3MZWB 3SWYA 2JP3A 1PGOA 4WWIA 3AE2C 4M3LA 3RL0B 1BGYE 2YO2A 2YKQA 2AXTH 1A02F 2IFMA 5CCHD 2HODB 3L74E 1FC2C 2YKPA 2Y0EA 5AW4B 4LC1A 5AW5B 2Y9ZA 2P58A 2WQYC 1GK4A 3CXHD 1SQVG 2K88A 4ZNCA 2BEQD 4N78E 3CXHI 3VMYA 5APYA 3AE8C 3RK2B 3AECC 1M90Q 2K9JA 4C7NB 2XDJA 1BGYG 2FYUG 4L76A 1NTZG 1NU1K 1NOHA 1JEKA 4PD4E 2OARA 1EDLA 5CBOA 2B88A 1DX7A 1JY3O 1KFMA 1VQMP 2E75D 3H1IE 5GTIH 3H6PA 1VF5B 2KLUA 5DJTB 3CCUP 3L72E 2WT7B 5H2FE 1YITP 1PP9G 5CCHA 2PGDA 2WITA 2FFDB 3OA7A 2HYNA 3TYYA 3I56P 5L8RJ 4JPZB 2Q7CA 2OYHA 1SLQA 2WSCH 3AEEC 5CJ4A 1T3JA 3H1IG 1SQXD 3L71E 2K37A 4OGQC 3QH9A 3MD0A 3W68A 4EIJA 3PLNA 2OTLP 1FU1A 3A0HH 4JYCA 2KUBA 4BRYA 1LTGC 1SQQK 2QM8A 3L70J 1P84D 4W80A 1YQ3C 1ZN5A 1LTJA 1P84I 3SFDC 1S5LE 3BCCJ 1N8RQ 3CXHH 2NPSD 2ZVOB 3NMDA 1RF1B 3USSA 1GU4A 5AVVB 3H32A 1QLED 1M1JC 2FYNB 3H1HD 2SPZA 3L73E 2WWWA 1IZNB 2OQQA 2R5BA 1S9KD 2E76D 4LLHA 3FWLA 3PP5A 3PHLA 4PV1D 4H0LD 1L0NG 2WSSH 1N7LA 3A7OA 1CI6A 4IFMA 5KKZB 3S9OA 4I7ZC 3RK3C 1SFCD 2ZT9C 2N1TB 5GTIE 1L2PA 1EQ7A 3CC2P 3ITKA 1FZCA 1GK6A 1EDIA 2B87B 2OTJP 1RH5B 3TK1A 1N7SD 3HTKB 2E74D 1J1DC 1PPJG 3GHGA 2IPPA 5AW0B 2NPSA 2JEEA 4H44B 1FAVA 1RHZB 2M8RA 5TISH 1KMIZ 3V2QA 1BCCE 1L0LJ 2R32A 5GTHH
chains in the Genus database with same CATH topology
1ZR4A 1OXZA 1L4AA 3RK3B 4WY4A 1MFZA 1N73C 1SQVK 1CW5A 5BU5A 2HPCB 3V4WA 1FJKA 5APUA 2GM4A 1HJBA 5AVUB 1HH0A 2KYVA 3CI9A 1JOCA 1LWUA 3HE4A 4XE5B 4GIFA 2VRSA 5CCGA 3HE5B 3BRVB 2Q9IA 3TNUB 2FYUK 3IFMA 1NTZK 1LT9B 5BVZA 5AW3B 1NKZB 1FDMA 3VTPC 2N1TC 3M06A 1FOSF 3BATA 3NTNA 1YYCA 1GW4A 2WSFH 2C9LY 1G2CB 1GD2E 1JY3N 2A45G 1IFMA 1J1EB 3II6A 1MV8A 2KOGA 5AW7B 5AW1B 1LTIC 5CCHC 2FXMA 1L4AD 5APQA 3VYIA 1IFNA 1SQPK 4WY4D 1GL2C 1N73B 5AVYB 2FYZA 2LKMA 3V2NA 2YMYA 1RF1A 1HVVA 2W6BA 3U1AA 3HD7C 2L5GB 4N6JA 3P8CE 1X79B 3I5CA 1URQC 1N2DC 2OYHC 3VP8A 2MJZA 3B5ND 3RK3D 3MIWA 5CCGD 1KILB 3L36A 1GW3A 1IFDA 1ZR2A 2C0XA 1JY3P 1RY3A 2Q3IA 1A02J 2W27A 3C9IA 2E43A 4W7ZA 4GKGA 3O8ZA 5AVSB 2WZ7A 3P8CD 1CZQA 1RE3C 1T2KD 1KFNA 1JNMA 1RF0C 2WSEH 4IFFA 5CHXA 2YNYA 3VOPA 3V2PA 5KTBA 2P7JA 4WBAA 3VMZA 2POHA 5KJ7D 2IX7C 2C9NY 3U59A 1MZ9A 4GT1A 2OYIB 5AW8B 1FZAA 3N4XA 4AQRD 1CSBA 3VN0A 2NPSB 3HUSB 4WB4A 1LTSC 1J1EC 3M9BA 1QL2A 1JY2P 1X9VA 2I1JA 2Q5UA 2XU6A 3A5TA 1M1JA 1URQB 2H43A 4C7RA 2OYHB 1JTHA 2M3BA 1LTAC 3HTKA 1GL2A 1DEBA 1W2EA 1LGHB 3P32A 4KHXA 5AVZB 1GZLA 3NFQA 1VDFA 1HBWA 5AVRB 1SP4A 5AVQB 1IFJA 4DZOA 4AUWA 1RE4C 2KSJA 2W6AA 2H7HA 3HD7A 1NTMK 1JY2O 1FZFA 2P1JA 2O1JA 1JUNA 3MGNA 2FKWB 1SQBK 1H8AA 3UIAA 1SVFA 3B5NA 1JCCA 1KILC 2YO3A 1MUUA 4JYBA 4N3YB 3L4FA 2A45I 1L0NK 3EQ2A 3M0AA 2N1TD 1IC2A 1LTJB 1SFCB 3CL3D 1KZUB 3KDPB 5APVA 1RE3A 3M0DC 4C46A 3SWYA 1FBMA 1RF0A 3KYQA 4I1LA 4M3LA 5APWA 3RL0B 2YO2A 2YKQA 1AFOA 1A02F 2IFMA 3H32B 3HE5A 5CCHD 2HODB 3M9QA 3TNUA 3P8MC 4RESB 1LT9A 1GL2D 5KJ7A 2YKPA 1IJDB 1N7SB 4LC1A 5AW4B 3SWFA 5AW5B 3A2AA 2PP6A 1G2CA 1HGVA 2OYIC 1S9KE 1IO4A 2BASA 3HD7D 1GK4A 3M9HA 2NPSC 4B86A 3HUSC 1ZLLA 1GU5A 1FZEA 1URQD 4N78E 5AW2B 3VMYA 1CI6B 5APYA 2JJLA 2GUVA 1M7LA 1J2JB 3BVHA 3RK2B 1LTTC 1N73A 1JO5A 3LIEA 1FZBA 1RE4A 2XZRA 2KLVA 2HG5D 5CMZA 1T3UA 4XA4A 4ZKPA 1FJPA 4C7NB 2XDJA 4OH8B 1L0LK 2Z5HA 1NU1K 1NOHA 3V5BA 5KLVK 4N78D 1JCDA 2WPSA 2OARA 1FZCB 1E5WA 1KILA 1DX7A 1JY3O 3OJAB 1KFMA 5AVWB 2N1TA 3L35A 1LTJC 1SFCC 3MUDA 3M0DA 3H6PA 3CLQA 4Y99B 2CPSA 3GHGB 1G1IA 2WPQA 3EFGA 1JMMA 3RL0C 3T97A 1NAFA 4IFDK 2WT7B 1IK9A 1NWQA 3IR9A 5CCHA 4I6MC 1JTHB 2WITA 2FFDB 3KQGA 3OA7A 4O9BA 3HRNA 2OYIA 1L4AB 3G3ZA 2HYNA 2R3CA 1N7SC 3V4QA 3E1IA 2ZFCA 4WY4B 3TYYA 2WTYA 1H88A 1NKNA 5CJ0A 2Q7CA 2A45H 2KB7P 1URQA 4HYTB 2OYHA 1SLQA 2WSCH 3A3YB 5CJ4A 1T3JA 3LIDA 2KP8A 1KILD 2CPBA 1GTWA 1LWUB 3HE4B 5AW9B 3B5NB 3RK2C 2C0WA 1KQLA 2J58A 2E42A 3MD0A 2HPCA 4EIJA 1NH4A 2Z4EA 1NTKK 2R5DA 1FU1A 4JYCA 2QM7A 2Z5IA 1FZCC 4AYCA 3N7NA 1XTGB 1LTGC 1SQQK 2O1KA 4HH2A 2QM8A 2PAJA 4W80A 1ZN5A 1LTJA 1SFCA 1FOSE 1J1DB 3NXSA 2ZXEB 4Y99C 5AVTB 1T8ZA 2NPSD 3NMDA 1RF1B 5BU8B 1GU4A 3GHGC 2I1KA 5AVVB 5AW6B 3KPEA 3H32A 2HODA 1YTZT 1FZGA 1QL1A 3M91A 1M1JC 2N9BA 4I2LC 1HUCA 1N7SA 2FFDC 1VPCA 1PFIA 2WWWA 1L4AC 1NO4A 2O01H 4WY4C 2HLOA 2R5BA 1S9KD 4ZKUA 4LLHA 2HFED 1N86A 3PP5A 3R2PA 3OAKA 1N7LA 3A7OA 3TSIA 1CI6A 4IFMA 3VP9A 1G1JA 1LWUC 1ZV8A 4JF7A 1JY2N 3B5NC 3RK3C 1XTCC 1DH3A 5AVXB 5CCGC 3B8EB 1SFCD 4LGDE 3VMXA 2H8PD 2N1TB 4C7NA 2IFNA 2XKMA 3U1CA 1GDTA 1Z56A 1HGZA 2XV5A 4EOTA 1NHLA 1X8YA 1EQ7A 3RL0D 3BRTB 1FZCA 1LTBC 1GK6A 3MTUE 1H89A 1AQ5A 3V2RA 1T2KC 4W7YA 2XNXA 3LW5H 1IFIA 1M1JB 1WRGA 3L37A 5APXA 3WMM0 3TK1A 5APTA 1N7SD 2GUSA 2WPRA 1LT9C 3HTKB 1GL2B 1J1DC 5KJ7C 5APSA 1HWTC 1SQXK 4DOJA 2P2UA 3GHGA 2IPPA 1WT6A 5AW0B 1RF1C 2NPSA 2JEEA 2P67A 2J59M 3HUSA 1FAVA 1OWAA 1YTZI 3HD7B 2M8RA 3V2QA 2WT7A 2YKOA 2R32A 1HTLC 3BASA 3RK2D 2FFDA 3P7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU C;  1M1J B;  3BVH A;  1LT9 A;  2Q9I A;  1JY2 N;  2FFD B;  2FFD C;  1N73 A;  1LTJ A;  2A45 I;  1LT9 C;  1JY3 P;  1W2E A;  1LT9 B;  2OYI A;  1N73 C;  1N73 B;  1FZB A;  1LTJ B;  1RE4 A;  1LTJ C;  3E1I A;  2OYI B;  2HPC A;  2HLO A;  1RF1 A;  2OYI C;  3GHG A;  1T3U A;  1FZA A;  1RE4 C;  2HPC B;  2Z4E A;  1RF1 B;  1RF1 C;  1RE3 A;  3GHG B;  3GHG C;  1JY2 O;  1JY3 N;  3HUS A;  2A45 G;  1FZF A;  1N86 A;  3HUS B;  3HUS C;  1RE3 C;  1FZC A;  1RF0 A;  2A45 H;  1FZE A;  1JY2 P;  3H32 A;  2OYH A;  2HOD A;  1FZC B;  1LWU B;  1FZC C;  1RF0 C;  2XNX A;  1LWU A;  2OYH C;  1M1J A;  3H32 B;  1FZG A;  2H43 A;  2OYH B;  2HOD B;  2FFD A;  1M1J C;  1JY3 O; 
#chains in the Genus database with same CATH topology
 1ZR4 A;  1OXZ A;  1L4A A;  1OFC X;  3D6Z A;  3CWB J;  5KLV G;  1M8O B;  4A7P A;  2LXC B;  4TT3 H;  4U3F J;  2GM4 A;  5AVU B;  1QGK B;  1JOC A;  3A0H E;  1IK7 A;  1P84 H;  3OW2 O;  2Q6Q A;  3HE5 B;  3BRV B;  3TNU B;  2M5A A;  1LT9 B;  5BVZ A;  2Y0D A;  1NKZ B;  1NTM D;  2JWA A;  3NTN A;  1YYC A;  3TGU E;  3AE6 C;  3FXD A;  4L74 A;  3H1J D;  1Q81 Q;  3CX5 D;  2OGU A;  2AEF A;  3RBZ A;  1LTI C;  3CX5 I;  2KSE A;  5CCH C;  4PJ0 E;  2FXM A;  1Y9B A;  4WY4 D;  3V2N A;  1PGP A;  2YMY A;  2QVA A;  1YBK A;  3AEA C;  4N6J A;  3GF3 A;  3P8C E;  3AEF C;  4D6T D;  1HF9 A;  1NTK J;  2FXP A;  2BCC E;  3ABV C;  1N2D C;  2OYH C;  1YQ4 C;  3MIW A;  5CCG D;  2KNC A;  1ZR2 A;  2C0X A;  3Q5P A;  1RY3 A;  1A02 J;  3WUU A;  4W7Z A;  1X22 A;  1AVY A;  5AVS B;  5DJU B;  2WZ7 A;  1RE3 C;  1KFN A;  2WSE H;  5CHX A;  2YNY A;  1R5S A;  3FWN A;  4WBA A;  1USD A;  1YJW P;  3AE9 C;  2E75 C;  2O01 N;  2KS1 B;  1NU1 D;  4UB8 H;  3M9B A;  1QL2 A;  3O6Q B;  3CC7 P;  1X9V A;  2FY8 A;  2I1J A;  5TIS E;  2XU6 A;  1EZV D;  3E7K A;  1GL2 A;  1SQX E;  3PH0 A;  1EZV I;  5GTH E;  2G3A A;  1W2E A;  1LGH B;  2AEJ A;  4DZO A;  1VQ4 P;  4AUW A;  1M57 D;  2H7H A;  3HD7 A;  3LW5 J;  1FZF A;  4QMA A;  3CCM P;  2O1J A;  1JUN A;  4KJM A;  1YJN P;  1P84 E;  4JYB A;  4N3Y B;  3M0A A;  2A06 E;  3L72 J;  2OYO A;  3CL3 D;  3MUD C;  3M0D C;  2IBZ E;  3G9R A;  3CX5 H;  1IFP A;  4JQ0 D;  1LJ2 A;  5APW A;  4DCK A;  3M9Q A;  3H1H E;  3P8M C;  1VQ5 P;  1ZRT D;  3CCJ P;  3SWF A;  3AE5 C;  2PP6 A;  1HGV A;  3RBX A;  2OYI C;  1S9K E;  3L75 D;  2PFX A;  1KTM A;  3M9H A;  2NPS C;  2JO1 A;  1SQQ D;  1URQ D;  2RKL A;  2KI7 B;  5AW2 B;  4EYY Q;  2JJL A;  2LR2 A;  3BVH A;  1RQV A;  2WSF J;  3EWK A;  1S1C X;  1JO5 A;  2W90 A;  3LIE A;  2HG5 D;  5CMZ A;  1FJP A;  1L0L K;  2E76 C;  3V5B A;  2FXO A;  4PV1 C;  4H0L C;  1E5W A;  1KIL A;  1UIX A;  4NPE A;  2M3E A;  1JMB A;  1SFC C;  1SQP J;  1ZOY C;  1BE3 D;  1VL2 A;  5KAI H;  3CPW O;  3FX0 A;  4IFD K;  1IK9 A;  3IR9 A;  1JTH B;  3KQG A;  1BSN A;  2E5T A;  4O9B A;  1N7S C;  3V4Q A;  3E1I A;  2E74 C;  1KC8 Q;  2IZ0 A;  3CCR P;  5CJ0 A;  3SFE C;  2JWD A;  2KB7 P;  2YIU C;  1URQ A;  3LID A;  2CPB A;  3JCU H;  5AW9 B;  1SQV E;  2Y0C A;  2C0W A;  1NAY A;  2B9B A;  2QJK B;  2ZT9 B;  3AED C;  2HPC A;  3G6E P;  2Z4E A;  1NTK K;  2R5D A;  3GMA A;  4U3F G;  4K3A A;  2Z5I A;  3N7N A;  1XTG B;  2FYU E;  2O1K A;  3H1L J;  1OVV A;  1NTZ E;  2PAJ A;  1J1D B;  1BCC J;  2ZXX A;  3NXS A;  1T8Z A;  2I1K A;  1SQB D;  1PIX A;  3RL0 g;  4D6T E;  3S1K A;  4K35 A;  2HOD A;  1NTM G;  1PL5 A;  3H1K J;  1SQB J;  1VPC A;  3H25 A;  1PP9 E;  4WY4 C;  4TLF A;  3H1J G;  4ZKU A;  3Q5R A;  2HFE D;  3R2P A;  3OAK A;  1OIP A;  3TSI A;  1VQ7 P;  3VP9 A;  3TGU J;  1LWU C;  4JF7 A;  1DH3 A;  5CCG C;  1Y47 A;  3VMX A;  3F5H A;  4C7N A;  2IFN A;  1Z56 A;  4D6T G;  2XV5 A;  2R44 A;  1NHL A;  1X8Y A;  1KV4 A;  2IYO A;  1LTB C;  2M0B A;  2DW3 A;  3CCV P;  3WMM 0;  1VQ9 P;  2GUS A;  2NRG A;  2QJY C;  5APS A;  4DOJ A;  5B5E H;  2IDB A;  2P67 A;  2Q1K A;  2QE7 H;  1KB9 D;  3HUS A;  1OWA A;  2JKV A;  1YTZ I;  1YHQ P;  1PV3 A;  4CPG A;  1KB9 I;  2WT7 A;  3BAS A;  2FFD A;  3P7K A;  3WUT A;  3RGU A;  1NU1 G;  3JCU E;  5BU5 A;  2FBW C;  1KD1 Q;  3L70 D;  3V4W A;  1FJK A;  5APU A;  1K9M Q;  1EZV G;  2ZYA A;  4YXW H;  1HH0 A;  2QJP C;  2KYV A;  3CI9 A;  1EDJ A;  4H13 D;  3CCL P;  3BCC D;  1ZXG A;  4GIF A;  5KLI B;  2VRS A;  1L0N E;  2Q9I A;  2AXT E;  2E5Y A;  3IFM A;  1WMK A;  1AA0 A;  3AE4 C;  2E75 B;  1GW4 A;  3L75 E;  1G2C B;  4JBZ A;  3CCQ P;  1SQQ E;  1MV8 A;  2KOG A;  5AW1 B;  3RK3 E;  1L4A D;  5APQ A;  1U57 A;  1IFN A;  1SQP K;  1N73 B;  2LKM A;  1RF1 A;  2KZJ A;  1HVV A;  4IL6 X;  1Y8A A;  1PPJ E;  3KZI H;  3I5C A;  1URQ C;  2MJZ A;  3B5N D;  2QIW A;  1MFT A;  3L36 A;  2UWJ E;  3L75 G;  1JY3 P;  2W27 A;  3AEG C;  3C9I A;  1VQ8 P;  1OZH A;  1SQQ G;  4DT0 A;  5KLV E;  1EC5 A;  1T2K D;  4ASV A;  3T97 B;  3VOP A;  5KTB A;  2P7J A;  2ZAE B;  4GOF A;  1KYO D;  1L0L D;  2OYI B;  5AW8 B;  1KB9 H;  1FZA A;  1KQS O;  1KYO I;  3W67 A;  5B5E E;  3VN0 A;  3KXD A;  2NPS B;  3CWB D;  1LTS C;  1J1E C;  2B87 A;  1OW8 A;  2Q5U A;  2JDI H;  3HTK A;  4U3F D;  1DEB A;  1OVR A;  4KHX A;  2HR3 A;  3NFQ A;  2ZJS E;  2W6J H;  1VDF A;  1W5C E;  1BE3 G;  5AVQ B;  2AEM A;  2W6A A;  2E76 B;  1R5L A;  1ZME C;  4Z1M H;  4PV1 B;  4H0L B;  1SQB K;  3Q2Y A;  1SVF A;  3B5N A;  1DD3 A;  1Q90 D;  2A45 I;  1FS0 E;  1IC2 A;  1SFC B;  1Q7Y Q;  5APV A;  4C46 A;  3AE1 C;  3JC2 2;  3CXH E;  1RF0 A;  3HE5 A;  3TNU A;  1LT9 A;  1GL2 D;  3FGA D;  4RKU J;  1N7S B;  2E74 B;  3A2A A;  1NTK D;  1SQV J;  3HD7 D;  3B4S A;  1NVO A;  1QX8 A;  3HUS C;  1ZLL A;  2YIU B;  1FZE A;  2CK3 H;  3KZI E;  3L74 D;  2O3J A;  1LTT C;  3H1K G;  4HKZ H;  1FZB A;  1BGY J;  1RE4 A;  1SQB G;  2XZR A;  3GG2 A;  4ZKP A;  2FYU J;  1NTZ J;  3L74 J;  1H0T B;  4OWF A;  4N78 D;  1JCD A;  1AV1 A;  3OJA B;  1KYO H;  2W83 C;  3IN6 A;  5AVW B;  1U7J A;  2AXC A;  1LTJ C;  3CLQ A;  2CPS A;  1KB9 E;  2QSI A;  1G1I A;  2WPQ A;  1JMM A;  4PD4 D;  1NAF A;  2N9Y B;  2BEZ F;  4NPF X;  5KAF H;  1NWQ A;  4PD4 I;  4I6M C;  1S3J A;  3A0B H;  2YXQ B;  3G3Z A;  4GOD A;  2KS1 A;  2ZFC A;  4WY4 B;  3L70 E;  2L91 A;  3O6Q A;  2D2C D;  2A45 H;  3WU2 H;  5CBN A;  1T6A A;  3H1I J;  3L72 D;  1RQU A;  3A3Y B;  2KP8 A;  1KIL D;  1LWU B;  3HE4 B;  3CME P;  2E42 A;  1FE6 A;  5B66 H;  2JR8 A;  1LT1 A;  1EXI A;  1OW6 A;  2QM7 A;  1FZC C;  1QVF O;  5KKZ C;  4H13 C;  3L71 D;  2IYP A;  4ZMD A;  3L70 G;  1FOS E;  2QJY B;  3FXE A;  1VQN P;  1USE A;  4Y99 C;  4RO0 A;  3GHG C;  3BCC G;  1DEE G;  3L71 J;  4XFJ A;  5AW6 B;  3KPE A;  3PRJ A;  4RJT A;  1YTZ T;  1HUC A;  4OGQ B;  1L4A C;  2O01 H;  2ZYG A;  2QJP B;  1K04 A;  1YJ9 P;  1SS1 A;  1ZP0 C;  4Y28 J;  1SQP D;  1ZV8 A;  3B5N C;  1XTC C;  5AVX B;  3D6Y A;  1Q86 Q;  3U1C A;  3CMA P;  1FDI A;  1GDT A;  1HGZ A;  4PD4 H;  3CWB E;  2GA1 A;  3RL0 D;  3L73 J;  1LP1 B;  1H89 A;  3V2R A;  1T2K C;  4W7Y A;  3LW5 H;  4UB8 E;  3QWO C;  1M1J B;  1WRG A;  3L37 A;  1S2E A;  4U3F E;  5KAF E;  1LT9 C;  3G71 P;  3A0B E;  2KZI A;  2ITA A;  1WT6 A;  1QVG O;  3TF5 A;  1EDK A;  3EFF K;  1BDC A;  3F89 A;  4YTP C;  3WU2 E;  1HTL C;  3RK2 D;  3MP7 B;  1L0L G;  5KLV J;  1EXJ A;  4I7Z B;  3RK3 B;  1K05 A;  1MFZ A;  1CW5 A;  1SQV K;  1UII A;  2K3R A;  3CWB G;  1NTM E;  4KT0 J;  1YIJ P;  2HPC B;  3H1L D;  2K9Y A;  3B71 A;  5B66 E;  3JSV C;  4BWN A;  1BCC D;  3H1J E;  3CX5 E;  4XE5 B;  2J5U A;  2FYU K;  1NTZ K;  5AW3 B;  1VF5 D;  3M06 A;  2YXR B;  2WSF H;  1U7M A;  2WSC J;  3H1K D;  2A45 G;  1IFM A;  2B89 A;  2NZ2 A;  1J1E B;  1AQT A;  3CCS P;  1S72 P;  1OW7 A;  1Q82 Q;  3VYI A;  1S5L H;  1GL2 C;  3S4R A;  2FYZ A;  1Q2N A;  3TGU D;  2K9J B;  2W6B A;  3D70 A;  3HD7 C;  2L5G B;  3TDK A;  2OTK E;  3VP8 A;  1NTK G;  1GW3 A;  2Q3I A;  2V7Q H;  3G4S P;  2E43 A;  1NU1 E;  4GKG A;  3P8C D;  1CZQ A;  1JNM A;  3L74 G;  2BCC D;  5E79 H;  5KAI E;  1EZV E;  3V2P A;  2POH A;  5KJ7 D;  2R3S A;  3U59 A;  3C1L A;  2BCC J;  4IL6 H;  3AE3 C;  4L73 A;  3HUS B;  1JY2 P;  4DJG A;  1KIL E;  4C7R A;  2OYH B;  2M3B A;  2RH0 A;  3E1R A;  1GZL A;  1HBW A;  5AVR B;  1S5L X;  2KSJ A;  1W2B O;  5K5G B;  2D2C C;  3V6I A;  1KIL C;  4BRY B;  1MUU A;  3L4F A;  1GMJ A;  1ZRT E;  2ZYD A;  1L0N K;  2N1T D;  2QA4 P;  1LTJ B;  1KZU B;  1RE3 A;  3L72 G;  5EFW B;  1SQX J;  1FBM A;  1E79 H;  3KYQ A;  4I1L A;  1AFO A;  3H32 B;  3MHV A;  4RES B;  5C39 A;  5KJ7 A;  2A06 D;  1IJD B;  1G2C A;  1IO4 A;  4H44 D;  2BAS A;  1BDD A;  2H88 C;  1QEX A;  2IBZ D;  3I55 P;  4B86 A;  3Q5S A;  1GU5 A;  3L71 G;  2IBZ I;  3AEB C;  4PJ0 H;  1CI6 B;  1SQP E;  2GUV A;  1M7L A;  1J2J B;  1N73 A;  2KLV A;  1T3U A;  2WVR A;  4XA4 A;  4OH8 B;  3H1H J;  2Z5H A;  1OMI A;  1BE3 E;  5KLV K;  2KXP B;  2Q3E A;  2WPS A;  1FZC B;  4H13 B;  5E79 E;  4MN4 C;  2N1T A;  2QJK C;  3L35 A;  1VQP P;  3MUD A;  3M0D A;  4Y99 B;  1D7M A;  3GHG B;  4YXD C;  4IL6 E;  3EFG A;  1SQP G;  2QEX P;  3RL0 C;  3T97 A;  3L73 G;  1DIP A;  2PRR A;  3HRN A;  2OYI A;  1L4A B;  2R3C A;  1KOR A;  4EDF A;  2H89 C;  2WTY A;  3H1L E;  1H88 A;  2WSE J;  1KN7 A;  1NKN A;  2WPV B;  1DD4 A;  2LXB A;  1VQO P;  4HYT B;  1GTW A;  2IZ1 A;  3B5N B;  3RK2 C;  1KQL A;  1PGJ A;  3ZDM A;  2J58 A;  2I8D A;  1NGM B;  2M5A B;  1NH4 A;  4GDO A;  3H1K E;  1YI2 P;  1SQB E;  1OX3 A;  4AYC A;  4HH2 A;  3IAO A;  4NPD A;  1SQV D;  3SSU A;  1SFC A;  3H1L G;  4WVZ A;  1AVO A;  3CCE P;  4HB1 A;  2ZXE B;  1VF5 C;  1BCC G;  5AVT B;  4UB6 H;  1AJY A;  5BU8 B;  2RMZ A;  1BGY D;  1NTM J;  2FYU D;  1PGQ A;  1FZG A;  1QL1 A;  3M91 A;  2YMK A;  1NTZ D;  2N9B A;  3VMA A;  1JM0 A;  4I2L C;  1OVU A;  1N7S A;  2FFD C;  1PFI A;  2KNC B;  1NJI Q;  3H1J J;  1NO4 A;  1VQK P;  2HLO A;  1FDO A;  1N86 A;  4EI2 A;  1G1J A;  3TGU G;  1JY2 N;  3WUV A;  3B8E B;  4LGD E;  2H8P D;  2XND H;  1M56 D;  1PP9 D;  4D6T J;  2XKM A;  1VQ6 P;  1H0T A;  4EOT A;  3BRT B;  4R4L A;  3MTU E;  1AQ5 A;  1X0T A;  1PP9 J;  3GLM A;  2XNX A;  1IFI A;  5KLI C;  2O01 J;  5APX A;  5APT A;  2WPR A;  1GL2 B;  5KJ7 C;  1HWT C;  1SQX K;  3H1I D;  2P2U A;  1BSH A;  2V4H A;  5TJH A;  2BCC G;  1RF1 C;  3D71 A;  2J59 M;  3HD7 B;  2QRX A;  3IF4 A;  3PTZ A;  5M1B A;  2W8Z A;  2YKO A;  2K1A A;  3BCC E;  1NU1 J;  2FYN C;  4OGQ D;  4WY4 A;  1N73 C;  1K73 Q;  1ZW0 A;  1HJB A;  3CC4 P;  1LWU A;  3HE4 A;  1KQF B;  5CCG A;  4GOE A;  2KIK A;  3AE7 C;  1FDM A;  3VTP C;  2N1T C;  1FOS F;  3BAT A;  2C9L Y;  1GD2 E;  1JY3 N;  1K8A Q;  4UB6 E;  3II6 A;  1SQX G;  5AW7 B;  1L0N D;  4YPC A;  2KK7 A;  1HJ0 A;  4OVN F;  5AVY B;  4R4M A;  3PJS K;  1LNQ A;  1L0N J;  4H44 C;  3U1A A;  3K5B A;  2D2C B;  4IOI H;  1X79 B;  3SWK A;  1NYH A;  2A06 G;  3L75 J;  3RK3 D;  1KIL B;  2ZVN B;  1IFD A;  2ZT9 D;  3L73 D;  2IBZ G;  1SQQ J;  1KYO E;  1PZQ A;  2MKV A;  1L0L E;  2WMM A;  3O8Z A;  1PPJ D;  3H1H G;  2P10 A;  4HJG H;  1RF0 C;  4IFF A;  4ASW A;  3KHU A;  3VMZ A;  2IX7 C;  1MKM A;  2C9N Y;  1MZ9 A;  4GT1 A;  1TU3 F;  1JB0 J;  3N4X A;  5KLV D;  4AQR D;  1CSB A;  2QG4 A;  1LP1 A;  3GW6 A;  4WB4 A;  1S4X A;  5H2F H;  3GF7 A;  4L75 A;  3Q1M A;  2V7Q J;  3A5T A;  1M1J A;  1URQ B;  4U7J A;  2H43 A;  1JTH A;  1LTA C;  1VQL P;  3Q3D A;  1BE3 J;  3P32 A;  5AVZ B;  3CD6 P;  1SP4 A;  1IFJ A;  1RE4 C;  1NTM K;  2Y9Y A;  3R4Y A;  1JY2 O;  1M1K Q;  2P1J A;  2G8Y A;  2RN0 A;  3MGN A;  2FKW B;  1H8A A;  3UIA A;  1KQG B;  1JCC A;  2YO3 A;  1R8E A;  3C8V A;  4BXL A;  3EQ2 A;  1NTK E;  3KDP B;  3MZW B;  3SWY A;  2JP3 A;  1PGO A;  4WWI A;  3AE2 C;  4M3L A;  3RL0 B;  1BGY E;  2YO2 A;  2YKQ A;  2AXT H;  1A02 F;  2IFM A;  5CCH D;  2HOD B;  3L74 E;  1FC2 C;  2YKP A;  2Y0E A;  5AW4 B;  4LC1 A;  5AW5 B;  2Y9Z A;  2P58 A;  2WQY C;  1GK4 A;  3CXH D;  1SQV G;  2K88 A;  4ZNC A;  2BEQ D;  4N78 E;  3CXH I;  3VMY A;  5APY A;  3AE8 C;  3RK2 B;  3AEC C;  1M90 Q;  2K9J A;  4C7N B;  2XDJ A;  1BGY G;  2FYU G;  4L76 A;  1NTZ G;  1NU1 K;  1NOH A;  1JEK A;  4PD4 E;  2OAR A;  1EDL A;  5CBO A;  2B88 A;  1DX7 A;  1JY3 O;  1KFM A;  1VQM P;  2E75 D;  3H1I E;  5GTI H;  3H6P A;  1VF5 B;  2KLU A;  5DJT B;  3CCU P;  3L72 E;  2WT7 B;  5H2F E;  1YIT P;  1PP9 G;  5CCH A;  2PGD A;  2WIT A;  2FFD B;  3OA7 A;  2HYN A;  3TYY A;  3I56 P;  5L8R J;  4JPZ B;  2Q7C A;  2OYH A;  1SLQ A;  2WSC H;  3AEE C;  5CJ4 A;  1T3J A;  3H1I G;  1SQX D;  3L71 E;  2K37 A;  4OGQ C;  3QH9 A;  3MD0 A;  3W68 A;  4EIJ A;  3PLN A;  2OTL P;  1FU1 A;  3A0H H;  4JYC A;  2KUB A;  4BRY A;  1LTG C;  1SQQ K;  2QM8 A;  3L70 J;  1P84 D;  4W80 A;  1YQ3 C;  1ZN5 A;  1LTJ A;  1P84 I;  3SFD C;  1S5L E;  3BCC J;  1N8R Q;  3CXH H;  2NPS D;  2ZVO B;  3NMD A;  1RF1 B;  3USS A;  1GU4 A;  5AVV B;  3H32 A;  1QLE D;  1M1J C;  2FYN B;  3H1H D;  2SPZ A;  3L73 E;  2WWW A;  1IZN B;  2OQQ A;  2R5B A;  1S9K D;  2E76 D;  4LLH A;  3FWL A;  3PP5 A;  3PHL A;  4PV1 D;  4H0L D;  1L0N G;  2WSS H;  1N7L A;  3A7O A;  1CI6 A;  4IFM A;  5KKZ B;  3S9O A;  4I7Z C;  3RK3 C;  1SFC D;  2ZT9 C;  2N1T B;  5GTI E;  1L2P A;  1EQ7 A;  3CC2 P;  3ITK A;  1FZC A;  1GK6 A;  1EDI A;  2B87 B;  2OTJ P;  1RH5 B;  3TK1 A;  1N7S D;  3HTK B;  2E74 D;  1J1D C;  1PPJ G;  3GHG A;  2IPP A;  5AW0 B;  2NPS A;  2JEE A;  4H44 B;  1FAV A;  1RHZ B;  2M8R A;  5TIS H;  1KMI Z;  3V2Q A;  1BCC E;  1L0L J;  2R32 A;  5GTH H; 
#chains in the Genus database with same CATH homology
 1ZR4 A;  1OXZ A;  1L4A A;  3RK3 B;  4WY4 A;  1MFZ A;  1N73 C;  1SQV K;  1CW5 A;  5BU5 A;  2HPC B;  3V4W A;  1FJK A;  5APU A;  2GM4 A;  1HJB A;  5AVU B;  1HH0 A;  2KYV A;  3CI9 A;  1JOC A;  1LWU A;  3HE4 A;  4XE5 B;  4GIF A;  2VRS A;  5CCG A;  3HE5 B;  3BRV B;  2Q9I A;  3TNU B;  2FYU K;  3IFM A;  1NTZ K;  1LT9 B;  5BVZ A;  5AW3 B;  1NKZ B;  1FDM A;  3VTP C;  2N1T C;  3M06 A;  1FOS F;  3BAT A;  3NTN A;  1YYC A;  1GW4 A;  2WSF H;  2C9L Y;  1G2C B;  1GD2 E;  1JY3 N;  2A45 G;  1IFM A;  1J1E B;  3II6 A;  1MV8 A;  2KOG A;  5AW7 B;  5AW1 B;  1LTI C;  5CCH C;  2FXM A;  1L4A D;  5APQ A;  3VYI A;  1IFN A;  1SQP K;  4WY4 D;  1GL2 C;  1N73 B;  5AVY B;  2FYZ A;  2LKM A;  3V2N A;  2YMY A;  1RF1 A;  1HVV A;  2W6B A;  3U1A A;  3HD7 C;  2L5G B;  4N6J A;  3P8C E;  1X79 B;  3I5C A;  1URQ C;  1N2D C;  2OYH C;  3VP8 A;  2MJZ A;  3B5N D;  3RK3 D;  3MIW A;  5CCG D;  1KIL B;  3L36 A;  1GW3 A;  1IFD A;  1ZR2 A;  2C0X A;  1JY3 P;  1RY3 A;  2Q3I A;  1A02 J;  2W27 A;  3C9I A;  2E43 A;  4W7Z A;  4GKG A;  3O8Z A;  5AVS B;  2WZ7 A;  3P8C D;  1CZQ A;  1RE3 C;  1T2K D;  1KFN A;  1JNM A;  1RF0 C;  2WSE H;  4IFF A;  5CHX A;  2YNY A;  3VOP A;  3V2P A;  5KTB A;  2P7J A;  4WBA A;  3VMZ A;  2POH A;  5KJ7 D;  2IX7 C;  2C9N Y;  3U59 A;  1MZ9 A;  4GT1 A;  2OYI B;  5AW8 B;  1FZA A;  3N4X A;  4AQR D;  1CSB A;  3VN0 A;  2NPS B;  3HUS B;  4WB4 A;  1LTS C;  1J1E C;  3M9B A;  1QL2 A;  1JY2 P;  1X9V A;  2I1J A;  2Q5U A;  2XU6 A;  3A5T A;  1M1J A;  1URQ B;  2H43 A;  4C7R A;  2OYH B;  1JTH A;  2M3B A;  1LTA C;  3HTK A;  1GL2 A;  1DEB A;  1W2E A;  1LGH B;  3P32 A;  4KHX A;  5AVZ B;  1GZL A;  3NFQ A;  1VDF A;  1HBW A;  5AVR B;  1SP4 A;  5AVQ B;  1IFJ A;  4DZO A;  4AUW A;  1RE4 C;  2KSJ A;  2W6A A;  2H7H A;  3HD7 A;  1NTM K;  1JY2 O;  1FZF A;  2P1J A;  2O1J A;  1JUN A;  3MGN A;  2FKW B;  1SQB K;  1H8A A;  3UIA A;  1SVF A;  3B5N A;  1JCC A;  1KIL C;  2YO3 A;  1MUU A;  4JYB A;  4N3Y B;  3L4F A;  2A45 I;  1L0N K;  3EQ2 A;  3M0A A;  2N1T D;  1IC2 A;  1LTJ B;  1SFC B;  3CL3 D;  1KZU B;  3KDP B;  5APV A;  1RE3 A;  3M0D C;  4C46 A;  3SWY A;  1FBM A;  1RF0 A;  3KYQ A;  4I1L A;  4M3L A;  5APW A;  3RL0 B;  2YO2 A;  2YKQ A;  1AFO A;  1A02 F;  2IFM A;  3H32 B;  3HE5 A;  5CCH D;  2HOD B;  3M9Q A;  3TNU A;  3P8M C;  4RES B;  1LT9 A;  1GL2 D;  5KJ7 A;  2YKP A;  1IJD B;  1N7S B;  4LC1 A;  5AW4 B;  3SWF A;  5AW5 B;  3A2A A;  2PP6 A;  1G2C A;  1HGV A;  2OYI C;  1S9K E;  1IO4 A;  2BAS A;  3HD7 D;  1GK4 A;  3M9H A;  2NPS C;  4B86 A;  3HUS C;  1ZLL A;  1GU5 A;  1FZE A;  1URQ D;  4N78 E;  5AW2 B;  3VMY A;  1CI6 B;  5APY A;  2JJL A;  2GUV A;  1M7L A;  1J2J B;  3BVH A;  3RK2 B;  1LTT C;  1N73 A;  1JO5 A;  3LIE A;  1FZB A;  1RE4 A;  2XZR A;  2KLV A;  2HG5 D;  5CMZ A;  1T3U A;  4XA4 A;  4ZKP A;  1FJP A;  4C7N B;  2XDJ A;  4OH8 B;  1L0L K;  2Z5H A;  1NU1 K;  1NOH A;  3V5B A;  5KLV K;  4N78 D;  1JCD A;  2WPS A;  2OAR A;  1FZC B;  1E5W A;  1KIL A;  1DX7 A;  1JY3 O;  3OJA B;  1KFM A;  5AVW B;  2N1T A;  3L35 A;  1LTJ C;  1SFC C;  3MUD A;  3M0D A;  3H6P A;  3CLQ A;  4Y99 B;  2CPS A;  3GHG B;  1G1I A;  2WPQ A;  3EFG A;  1JMM A;  3RL0 C;  3T97 A;  1NAF A;  4IFD K;  2WT7 B;  1IK9 A;  1NWQ A;  3IR9 A;  5CCH A;  4I6M C;  1JTH B;  2WIT A;  2FFD B;  3KQG A;  3OA7 A;  4O9B A;  3HRN A;  2OYI A;  1L4A B;  3G3Z A;  2HYN A;  2R3C A;  1N7S C;  3V4Q A;  3E1I A;  2ZFC A;  4WY4 B;  3TYY A;  2WTY A;  1H88 A;  1NKN A;  5CJ0 A;  2Q7C A;  2A45 H;  2KB7 P;  1URQ A;  4HYT B;  2OYH A;  1SLQ A;  2WSC H;  3A3Y B;  5CJ4 A;  1T3J A;  3LID A;  2KP8 A;  1KIL D;  2CPB A;  1GTW A;  1LWU B;  3HE4 B;  5AW9 B;  3B5N B;  3RK2 C;  2C0W A;  1KQL A;  2J58 A;  2E42 A;  3MD0 A;  2HPC A;  4EIJ A;  1NH4 A;  2Z4E A;  1NTK K;  2R5D A;  1FU1 A;  4JYC A;  2QM7 A;  2Z5I A;  1FZC C;  4AYC A;  3N7N A;  1XTG B;  1LTG C;  1SQQ K;  2O1K A;  4HH2 A;  2QM8 A;  2PAJ A;  4W80 A;  1ZN5 A;  1LTJ A;  1SFC A;  1FOS E;  1J1D B;  3NXS A;  2ZXE B;  4Y99 C;  5AVT B;  1T8Z A;  2NPS D;  3NMD A;  1RF1 B;  5BU8 B;  1GU4 A;  3GHG C;  2I1K A;  5AVV B;  5AW6 B;  3KPE A;  3H32 A;  2HOD A;  1YTZ T;  1FZG A;  1QL1 A;  3M91 A;  1M1J C;  2N9B A;  4I2L C;  1HUC A;  1N7S A;  2FFD C;  1VPC A;  1PFI A;  2WWW A;  1L4A C;  1NO4 A;  2O01 H;  4WY4 C;  2HLO A;  2R5B A;  1S9K D;  4ZKU A;  4LLH A;  2HFE D;  1N86 A;  3PP5 A;  3R2P A;  3OAK A;  1N7L A;  3A7O A;  3TSI A;  1CI6 A;  4IFM A;  3VP9 A;  1G1J A;  1LWU C;  1ZV8 A;  4JF7 A;  1JY2 N;  3B5N C;  3RK3 C;  1XTC C;  1DH3 A;  5AVX B;  5CCG C;  3B8E B;  1SFC D;  4LGD E;  3VMX A;  2H8P D;  2N1T B;  4C7N A;  2IFN A;  2XKM A;  3U1C A;  1GDT A;  1Z56 A;  1HGZ A;  2XV5 A;  4EOT A;  1NHL A;  1X8Y A;  1EQ7 A;  3RL0 D;  3BRT B;  1FZC A;  1LTB C;  1GK6 A;  3MTU E;  1H89 A;  1AQ5 A;  3V2R A;  1T2K C;  4W7Y A;  2XNX A;  3LW5 H;  1IFI A;  1M1J B;  1WRG A;  3L37 A;  5APX A;  3WMM 0;  3TK1 A;  5APT A;  1N7S D;  2GUS A;  2WPR A;  1LT9 C;  3HTK B;  1GL2 B;  1J1D C;  5KJ7 C;  5APS A;  1HWT C;  1SQX K;  4DOJ A;  2P2U A;  3GHG A;  2IPP A;  1WT6 A;  5AW0 B;  1RF1 C;  2NPS A;  2JEE A;  2P67 A;  2J59 M;  3HUS A;  1FAV A;  1OWA A;  1YTZ I;  3HD7 B;  2M8R A;  3V2Q A;  2WT7 A;  2YKO A;  2R32 A;  1HTL C;  3BAS A;  3RK2 D;  2FFD A;  3P7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...