2DW3A

Solution structure of the rhodobacter sphaeroides pufx membrane protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title Solution structure of the Rhodobacter sphaeroides PufX membrane protein: implications for the quinone exchange and protein-protein interactions
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2dw3A01
2DW3A 2ITAA 2NRGA
chains in the Genus database with same CATH superfamily
1QL1A 2KK7A 2NPSC 2V7QH 2CPBA 1L4AA 1GMJA 1L2PA 1KV4A 1H89A 2KB7P 5APYA 5KLVG 2M0BA 4H13D 4PJ0H 2FXPA 4ZKUA 3ZDMA 2IBZD 1NTMG 2YKOA 2D2CC 1IFNA 2E75B 1USEA 3L73G 1VQKP 4EIJA 4JYBA 2P58A 4W7ZA 5KLVD 3A5TA 1VQLP 2K9JB 1VQ9P 1PGJA 2KXPB 4AQRD 1AVOA 2W6JH 1LTBC 4C7NB 3BCCE 5APSA 4D6TG 1KILC 1AA0A 2HODB 3L74G 2G3AA 1SQPG 1WT6A 3SWFA 2GUVA 1YJNP 2A06G 4N78D 1PP9G 2B89A 1BE3E 3D6YA 1Q90D 2JDIH 2HFED 2N1TD 2O1JA 3L74D 1OVUA 1SQPD 4YXDC 4U3FG 4YPCA 4DZOA 1SQBK 3NXSA 2YKPA 3H25A 1NU1E 3CD6P 3CCEP 1PP9D 3S1KA 2AXTH 1VQPP 4TT3H 1CSBA 1BGYD 1OX3A 4WVZA 1JY2P 1RHZB 3RK2D 2O01N 1SQBE 1NTZG 3HD7C 1M1JA 4H44D 3H1LE 3ITKA 3RBZA 5AVUB 3TGUJ 1OIPA 2K1AA 1Z56A 2QJKB 1KQSO 3M0AA 2E42A 1NTZD 3P7KA 3F89A 2W6BA 3KPEA 2XNXA 1IFDA 5H2FH 3S4RA 1QGKB 3OJAB 1BCCD 2LR2A 4UB8E 3HD7A 4RKUJ 5DJTB 5K5GB 1KB9I 2AEJA 4HH2A 1VQOP 4TLFA 1X8YA 5KAIH 1NTKG 1KB9H 4YXWH 3FWNA 1SQVE 3JC22 1NH4A 4C7NA 1SFCB 4HJGH 2VRSA 4NPEA 3WUVA 1W2BO 1P84D 2HODA 4EYYQ 1HUCA 4I6MC 5BU5A 2KZJA 3RK3E 2J5UA 2IFMA 2YIUB 1G2CB 1U57A 2ZFCA 2YXRB 1MKMA 1LTJB 4IFFA 2LXBA 2WMMA 3G3ZA 3MP7B 4O9BA 2WQYC 1N8RQ 2E75D 2O01H 4EOTA 3GG2A 2I1KA 3B5NB 1S5LX 2ZAEB 1LP1A 4PV1B 1HBWA 1NTMJ 1SQXG 2KP8A 1LNQA 1VQMP 3VN0A 2QRXA 1EXIA 3CMAP 2R44A 4LGDE 1HH0A 2BEZF 1M57D 3L73J 2G8YA 1X0TA 3AEFC 3M9HA 2JWAA 1ZP0C 2Q6QA 1J1EC 4ZMDA 3H1HD 1SQXD 3LW5H 4KT0J 4D6TJ 1EZVE 1E79H 2QG4A 3E7KA 5B66H 3H32B 1J2JB 1FJKA 5CBNA 1OW8A 3A3YB 1MV8A 3L72G 1YBKA 3AE7C 5CCHC 2BCCG 1GW4A 2QA4P 3CCRP 3CX5E 4U3FJ 3CXHD 1FOSE 2R5BA 4C46A 3L70G 1LWUC 3CI9A 3L72D 1VQNP 1KYOE 4K35A 1PPJE 1T3UA 2BCCD 1N7SD 4H0LB 5AVSB 3CMEP 3OW2O 3Q5SA 2KSJA 1YJWP 5GTIH 2IBZE 1ZOYC 1NTMK 1TU3F 3EFGA 2O3JA 3AE8C 1JCDA 1X9VA 1VF5B 5KLVE 2YO2A 1A02J 3HTKB 4N6JA 2ZYDA 1PL5A 1LWUA 4Z1MH 4DCKA 3VMYA 1G2CA 5CMZA 1ZRTD 1LTJA 4Y99B 3WUTA 2QSIA 1YYCA 1J1DB 1K04A 2AEMA 3II6A 2NRGA 2LXCB 4UB6H 1SQPK 3RGUA 2YXQB 1N73B 1W5CE 3B5NA 1L0LG 4DJGA 3RK3C 4OGQB 1RE4A 4N78E 1JTHB 4RJTA 2QJPB 1SFCD 3L74E 1GDTA 3M0DA 1SQPE 2IPPA 1QL2A 2HG5D 1JY2N 1DH3A 1NTKJ 3M91A 1AFOA 1IFPA 5L8RJ 1PP9E 3MTUE 4IFMA 3CC2P 3GLMA 1BGYE 5TISH 3H32A 4WY4B 1Y9BA 1FDOA 1T6AA 3L71G 2E5TA 1JY3P 3CWBG 2ZYAA 1GL2B 1OVVA 4MN4C 3NMDA 1FDMA 1CI6B 3BRVB 4IFDK 2WITA 1NTZE 3MUDA 3AEEC 2WVRA 4LC1A 1USDA 3ABVC 2WPSA 3H1JJ 5B5EE 1AQ5A 4HKZH 2NPSB 3V4WA 3CLQA 1BCCE 1R8EA 3HE5B 3F5HA 1CW5A 1JOCA 3VYIA 1NYHA 1NJIQ 1YQ4C 2CK3H 1S5LH 2Z5HA 2FXMA 1H88A 2D2CB 2IYOA 4H13C 1ZLLA 2PFXA 2WTYA 1PGQA 1NTKK 2PAJA 3AEDC 3KDPB 2GUSA 1EQ7A 1ZN5A 3NFQA 2B87B 4L75A 3RL0C 2PRRA 1KILB 1P84E 2Q5UA 5AVWB 1EXJA 3JSVC 1N73A 2P1JA 2KSEA 2FYNC 3PP5A 3B8EB 3L70J 2L91A 4GOEA 4IL6X 1JTHA 1FJPA 4DT0A 5C39A 2Q3EA 1OXZA 1JUNA 3WU2H 5CCGD 1QVGO 2FYUG 3L75E 3MGNA 1KQGB 5AVRB 2H7HA 2M5AB 3JCUE 2E5YA 4L73A 2KLUA 1RQUA 2J58A 5KJ7D 2ZT9B 3TYYA 1LTAC 3V2RA 3AEGC 1SQXK 2N1TC 1FDIA 2JO1A 2RKLA 1Y8AA 2WSCJ 4B86A 1KB9D 4WY4A 1T2KC 1NAYA 3HD7B 2AXCA 3H1HE 1SQXE 1GL2A 1Q82Q 2HLOA 2V7QJ 2E74D 1SS1A 1CI6A 3AE2C 3V2QA 2Y0CA 2LKMA 1FZGA 4H44C 1L0LJ 2Y0DA 2XNDH 4JF7A 2XKMA 1NTMD 2YMYA 4C7RA 1URQC 3Q5PA 1OW7A 3V6IA 2QM7A 4BRYA 2NPSA 4JBZA 1L4AD 1HWTC 3L73D 1GU5A 3HE5A 1L0NJ 3CXHE 1YIJP 4ZNCA 2Y9YA 5CBOA 1GW3A 1S1CX 3L72E 3TK1A 2OTJP 2IZ0A 1QX8A 4D6TD 2BCCE 3R4YA 2Q1KA 2QJYC 1OVRA 1BDCA 3CC7P 4KJMA 1DEBA 2WZ7A 3VP9A 3L71J 1LP1B 3CWBJ 2J59M 1LTIC 2A06D 3LIEA 2OYHC 1SQQJ 3H1IG 2ZT9C 4XA4A 2B87A 1URQA 1NWQA 3CCVP 2H8PD 4K3AA 1KILA 4U3FD 3A0BH 1M1KQ 3CC4P 1ZRTE 1HJ0A 4GDOA 4OVNF 3H1KG 3KHUA 3P8CD 5AVYB 3GF7A 1WRGA 2K88A 4PD4I 3QH9A 2FKWB 3PRJA 2M5AA 2RMZA 1L0LK 2ZVOB 3AE9C 3GMAA 5KTBA 1VQ6P 4L74A 2OYHA 3GF3A 2OTKE 1XTCC 3MIWA 4PD4H 1IC2A 1SP4A 2K9YA 1FS0E 4PJ0E 3O6QB 4ASWA 3G6EP 2PP6A 1E5WA 1EDJA 4JPZB 1J1EB 3MD0A 1JY3N 3PTZA 1JMMA 3CX5I 1FZEA 2JEEA 2H43A 1KYOI 3PLNA 5KKZC 1QEXA 1QLED 1RE3C 3GW6A 3CX5H 2E76D 2SPZA 3A0HE 2E43A 2OGUA 2HPCB 3WUUA 3HRNA 1KYOH 1EDIA 1Q7YQ 2Z5IA 2FYUJ 1VQ4P 4W7YA 1YQ3C 1NTKD 5AVTB 3HD7D 1FZCC 1IFMA 1LWUB 3BATA 5M1BA 1FAVA 3KXDA 5AW1B 3V2NA 4L76A 2DW3A 3G9RA 2A45I 4IL6H 1Q86Q 1NHLA 5BVZA 1HGVA 1RE3A 1JEKA 3T97A 3M06A 3FXDA 5KAFH 3H1JG 1N7SC 2A45H 3TGUE 2KOGA 2O01J 2WSFH 3USSA 3KQGA 3V4QA 3OAKA 1LTGC 1IFIA 2ZJSE 1ZXGA 5AW5B 4M3LA 1FZCA 1D7MA 1X79B 3H1JD 1JY3O 2Q3IA 1KD1Q 3CCLP 1OZHA 3RK3B 1HJBA 3CCQP 2KS1B 2WSEH 2ZXXA 3LW5J 3KZIE 3SWYA 5H2FE 1G1JA 5CJ0A 3SWKA 1W2EA 1S3JA 1N7SA 1VPCA 2FYUK 2L5GB 3O6QA 3U1CA 3VMAA 3MHVA 1IFJA 3H1IJ 1JO5A 1R5LA 3AECC 1RF0C 1BE3G 3EWKA 5KAIE 1H0TA 2KIKA 1KB9E 3P8MC 3Q3DA 2ZVNB 3L70D 1KQFB 3HE4B 1NU1G 3GHGC 1KFNA 2OYOA 2HPCA 1IK7A 3H1KJ 5CCHA 5B5EH 1G1IA 2IFNA 1AJYA 1FOSF 1NTME 1JB0J 1GU4A 3H1LG 1S72P 3IF4A 1PGOA 3L73E 4EDFA 2R3CA 3IFMA 1NKZB 2KZIA 3D71A 2WWWA 3PH0A 2QIWA 3KYQA 1QVFO 4D6TE 3E1RA 5AW2B 1PFIA 5GTHH 1GTWA 1L0NG 4H13B 1L0LD 1RF1C 2OTLP 2A06E 2IZ1A 1ZR2A 2FYZA 1ZR4A 2NZ2A 1RH5B 3FGAD 5B66E 3AEBC 3RL0B 1LT9C 1L0ND 4U3FE 3S9OA 3I55P 2FFDB 3B5ND 2M3BA 1ZV8A 3MZWB 2KS1A 2FYNB 1JCCA 1FZBA 1SQQG 5AVQB 4YTPC 4PV1D 1SQVG 1K9MQ 3P8CE 3CCMP 1LTTC 2YO3A 3OA7A 2XU6A 1IK9A 3L71D 1RF1A 3CWBD 1UIXA 1SQQD 1OW6A 2POHA 4WBAA 5CCGC 5CJ4A 2N1TB 4BRYB 2JR8A 2JKVA 1U7MA 2OYIC 5GTIE 1KORA 1FZAA 3FX0A 1WMKA 2KYVA 1MZ9A 2BASA 2W8ZA 3HE4A 3SSUA 2CPSA 2Y9ZA 2MKVA 1HGZA 1IZNB 4JQ0D 1K05A 3AE1C 2IDBA 4H44B 3L37A 2P7JA 2E74C 1URQB 1NOHA 3BCCJ 2JWDA 1EZVG 1A02F 3PJSK 4H0LD 1NTKE 2FFDC 1LTSC 1GD2E 3TDKA 2M8RA 4PD4D 4JYCA 1BE3J 1L4AC 2QEXP 3AE3C 2QJYB 1VF5D 3V5BA 2YKQA 3Q1MA 1NU1J 2OYHB 5AW8B 3EQ2A 4I7ZC 1PPJG 1PV3A 2FYUD 5E79E 1T8ZA 1M56D 2FFDA 1YI2P 3VMXA 3D70A 3L36A 2FY8A 3W67A 4OGQD 3H1JE 1VDFA 3H1LJ 1ZMEC 2C0WA 2GM4A 3RK2C 2KNCA 1MFTA 1OMIA 1BSHA 1OFCX 4GOFA 1AVYA 4UB8H 2A45G 2N1TA 1N86A 4AYCA 3CCSP 3N4XA 3RL0D 3VTPC 1DX7A 2W83C 2FXOA 4WY4D 1S5LE 5EFWB 4NPDA 4DOJA 1YTZI 1YHQP 1GL2D 5KLIC 3A0HH 3BASA 2P10A 1M1JC 3G71P 3L70E 4CPGA 5KKZB 1AQTA 1N2DC 5AVXB 3T97B 1NU1K 1SQVJ 2WPQA 1BGYG 2NPSD 2E76C 1T2KD 1FZCB 5CHXA 3WU2E 3H1ID 2QE7H 4W80A 3TF5A 4QMAA 5BU8B 2C0XA 3BVHA 1H8AA 1KZUB 1PIXA 2D2CD 1KMIZ 4WWIA 3UIAA 1HTLC 1JNMA 4GKGA 3SFDC 4AUWA 1EZVI 1JM0A 1DD4A 1AV1A 5APVA 3H1KD 3A2AA 1URQD 1N7SB 4R4LA 1PZQA 2AEFA 1VL2A 2E75C 4IOIH 1KILD 1BCCG 1L0LE 1L0NK 4EI2A 1XTGB 3RBXA 5AW9B 1KFMA 3QWOC 3KZIH 4I2LC 3V2PA 1H0TB 2H89C 2I8DA 1L0NE 1YJ9P 2R3SA 2UWJE 1GZLA 2P2UA 3C1LA 1SQQK 3BRTB 1SQVK 2ZT9D 2H88C 2WPVB 3IAOA 2IBZI 2IYPA 1NGMB 4BWNA 2B9BA 3L71E 3CWBE 3C9IA 2K9JA 3B4SA 1SQQE 4GIFA 1FE6A 1RY3A 2K37A 1S9KD 3LIDA 1CZQA 1FZFA 4OH8B 3G4SP 2IX7C 2XDJA 3L75G 4LLHA 3B71A 2C9LY 2P67A 2AXTE 1U7JA 1Q2NA 3CPWO 2M3EA 3GHGB 3HUSB 2HYNA 2QJKC 1MUUA 3VP8A 3A0BE 2PGDA 3L75D 1T3JA 1HVVA 5AW3B 5AVVB 5KLVJ 1Y47A 3PHLA 2XV5A 3AEAC 3H1HG 3I5CA 3H6PA 1RQVA 3W68A 2WSFJ 2W27A 2GA1A 2ITAA 3Q5RA 1KN7A 3O8ZA 3U59A 4ZKPA 3C8VA 4KHXA 1JMBA 4PD4E 3FWLA 2ZYGA 1VQ8P 5TJHA 2WPRA 3BCCG 3L74J 1SQPJ 1M7LA 2MJZA 3K5BA 2WSEJ 1RF1B 1N7LA 3L35A 2N9BA 1KQLA 2OQQA 3CCUP 3Q2YA 1PP9J 3AE4C 3CL3D 1SFCC 2FBWC 3R2PA 2FYUE 3BCCD 1BGYJ 2JJLA 2KI7B 1LT1A 1LT9B 5APUA 3E1IA 3EFFK 3A7OA 1ZW0A 2YIUC 4XE5B 1LTJC 4Y28J 3HUSC 4GT1A 2B88A 1BE3D 1LGHB 1K73Q 1DD3A 3WMM0 5DJUB 3B5NC 1NTZJ 5KLVK 1SQBG 4PV1C 1RE4C 1NU1D 5APQA 3TNUB 4IL6E 3N7NA 1RF0A 1SFCA 5APXA 3M0DC 2OYIB 5AW7B 3VOPA 3P32A 4U7JA 1BCCJ 1LJ2A 1SQBD 2YNYA 5KAFE 2Z4EA 1P84I 4I1LA 5AVZB 3U1AA 1EC5A 3H1LD 1PGPA 3M9QA 3GHGA 3HUSA 3SFEC 2RN0A 3AE6C 1VQ5P 1KC8Q 5CCHD 2WT7B 2QVAA 1P84H 4HB1A 1BDDA 2Q7CA 1HF9A 2E74B 2V4HA 2BEQD 3MUDC 2W90A 1S2EA 4RESB 1YITP 3H1IE 1OWAA 2OARA 3JCUH 1M8OB 1R5SA 1DIPA 1L4AB 3AE5C 4H0LC 3L4FA 2KNCB 3L75J 1NTZK 1BSNA 5E79H 5APWA 2W6AA 3H1KE 1SQVD 4I7ZB 1MFZA 2N9YB 1VF5C 1SVFA 1KILE 1VQ7P 1LT9A 4A7PA 2ZXEB 3D6ZA 1Q81Q 1UIIA 5KJ7C 2Y0EA 1SLQA 3RK3D 3TSIA 2KLVA 3FXEA 1IO4A 1NVOA 3H1HJ 1FU1A 1SQXJ 4Y99C 3CXHI 1J1DC 4XFJA 3I56P 2JP3A 3TGUG 3RK2B 1N73C 2RH0A 4OGQC 1NO4A 3CXHH 1YTZT 3TNUA 2C9NY 1X22A 2QJPC 5CCGA 4UB6E 3TGUD 2HR3A 3RL0g 2OYIA 1S4XA 2O1KA 1KTMA 5AW6B 1EDLA 4RO0A 3HTKA 2WSSH 1DEEG 5KJ7A 3NTNA 1JY2O 1GK6A 4WB4A 3L72J 2Q9IA 2R5DA 3VMZA 1IJDB 5GTHE 2QM8A 1S9KE 5KLIB 2R32A 2XZRA 1GK4A 1NAFA 1EZVD 2BCCJ 3IR9A 4ASVA 4WY4C 2WT7A 2YMKA 1M1JB 1NKNA 4GODA 1GL2C 4R4MA 5AW4B 1M90Q 5AW0B 3M9BA 5TISE 5APTA 1EDKA 2K3RA 2I1JA 3IN6A 2WSCH 1FBMA 2KUBA 1FC2C 3CX5D 1SQBJ 2E76B 4HYTB 4BXLA 1K8AQ 4NPFX 2IBZG 1KYOD 4N3YB 3CCJP 1PPJD 4OWFA
chains in the Genus database with same CATH topology
2DW3A 2ITAA 2NRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW3 A;  2ITA A;  2NRG A; 
#chains in the Genus database with same CATH topology
 1QL1 A;  2KK7 A;  2NPS C;  2V7Q H;  2CPB A;  1L4A A;  1GMJ A;  1L2P A;  1KV4 A;  1H89 A;  2KB7 P;  5APY A;  5KLV G;  2M0B A;  4H13 D;  4PJ0 H;  2FXP A;  4ZKU A;  3ZDM A;  2IBZ D;  1NTM G;  2YKO A;  2D2C C;  1IFN A;  2E75 B;  1USE A;  3L73 G;  1VQK P;  4EIJ A;  4JYB A;  2P58 A;  4W7Z A;  5KLV D;  3A5T A;  1VQL P;  2K9J B;  1VQ9 P;  1PGJ A;  2KXP B;  4AQR D;  1AVO A;  2W6J H;  1LTB C;  4C7N B;  3BCC E;  5APS A;  4D6T G;  1KIL C;  1AA0 A;  2HOD B;  3L74 G;  2G3A A;  1SQP G;  1WT6 A;  3SWF A;  2GUV A;  1YJN P;  2A06 G;  4N78 D;  1PP9 G;  2B89 A;  1BE3 E;  3D6Y A;  1Q90 D;  2JDI H;  2HFE D;  2N1T D;  2O1J A;  3L74 D;  1OVU A;  1SQP D;  4YXD C;  4U3F G;  4YPC A;  4DZO A;  1SQB K;  3NXS A;  2YKP A;  3H25 A;  1NU1 E;  3CD6 P;  3CCE P;  1PP9 D;  3S1K A;  2AXT H;  1VQP P;  4TT3 H;  1CSB A;  1BGY D;  1OX3 A;  4WVZ A;  1JY2 P;  1RHZ B;  3RK2 D;  2O01 N;  1SQB E;  1NTZ G;  3HD7 C;  1M1J A;  4H44 D;  3H1L E;  3ITK A;  3RBZ A;  5AVU B;  3TGU J;  1OIP A;  2K1A A;  1Z56 A;  2QJK B;  1KQS O;  3M0A A;  2E42 A;  1NTZ D;  3P7K A;  3F89 A;  2W6B A;  3KPE A;  2XNX A;  1IFD A;  5H2F H;  3S4R A;  1QGK B;  3OJA B;  1BCC D;  2LR2 A;  4UB8 E;  3HD7 A;  4RKU J;  5DJT B;  5K5G B;  1KB9 I;  2AEJ A;  4HH2 A;  1VQO P;  4TLF A;  1X8Y A;  5KAI H;  1NTK G;  1KB9 H;  4YXW H;  3FWN A;  1SQV E;  3JC2 2;  1NH4 A;  4C7N A;  1SFC B;  4HJG H;  2VRS A;  4NPE A;  3WUV A;  1W2B O;  1P84 D;  2HOD A;  4EYY Q;  1HUC A;  4I6M C;  5BU5 A;  2KZJ A;  3RK3 E;  2J5U A;  2IFM A;  2YIU B;  1G2C B;  1U57 A;  2ZFC A;  2YXR B;  1MKM A;  1LTJ B;  4IFF A;  2LXB A;  2WMM A;  3G3Z A;  3MP7 B;  4O9B A;  2WQY C;  1N8R Q;  2E75 D;  2O01 H;  4EOT A;  3GG2 A;  2I1K A;  3B5N B;  1S5L X;  2ZAE B;  1LP1 A;  4PV1 B;  1HBW A;  1NTM J;  1SQX G;  2KP8 A;  1LNQ A;  1VQM P;  3VN0 A;  2QRX A;  1EXI A;  3CMA P;  2R44 A;  4LGD E;  1HH0 A;  2BEZ F;  1M57 D;  3L73 J;  2G8Y A;  1X0T A;  3AEF C;  3M9H A;  2JWA A;  1ZP0 C;  2Q6Q A;  1J1E C;  4ZMD A;  3H1H D;  1SQX D;  3LW5 H;  4KT0 J;  4D6T J;  1EZV E;  1E79 H;  2QG4 A;  3E7K A;  5B66 H;  3H32 B;  1J2J B;  1FJK A;  5CBN A;  1OW8 A;  3A3Y B;  1MV8 A;  3L72 G;  1YBK A;  3AE7 C;  5CCH C;  2BCC G;  1GW4 A;  2QA4 P;  3CCR P;  3CX5 E;  4U3F J;  3CXH D;  1FOS E;  2R5B A;  4C46 A;  3L70 G;  1LWU C;  3CI9 A;  3L72 D;  1VQN P;  1KYO E;  4K35 A;  1PPJ E;  1T3U A;  2BCC D;  1N7S D;  4H0L B;  5AVS B;  3CME P;  3OW2 O;  3Q5S A;  2KSJ A;  1YJW P;  5GTI H;  2IBZ E;  1ZOY C;  1NTM K;  1TU3 F;  3EFG A;  2O3J A;  3AE8 C;  1JCD A;  1X9V A;  1VF5 B;  5KLV E;  2YO2 A;  1A02 J;  3HTK B;  4N6J A;  2ZYD A;  1PL5 A;  1LWU A;  4Z1M H;  4DCK A;  3VMY A;  1G2C A;  5CMZ A;  1ZRT D;  1LTJ A;  4Y99 B;  3WUT A;  2QSI A;  1YYC A;  1J1D B;  1K04 A;  2AEM A;  3II6 A;  2NRG A;  2LXC B;  4UB6 H;  1SQP K;  3RGU A;  2YXQ B;  1N73 B;  1W5C E;  3B5N A;  1L0L G;  4DJG A;  3RK3 C;  4OGQ B;  1RE4 A;  4N78 E;  1JTH B;  4RJT A;  2QJP B;  1SFC D;  3L74 E;  1GDT A;  3M0D A;  1SQP E;  2IPP A;  1QL2 A;  2HG5 D;  1JY2 N;  1DH3 A;  1NTK J;  3M91 A;  1AFO A;  1IFP A;  5L8R J;  1PP9 E;  3MTU E;  4IFM A;  3CC2 P;  3GLM A;  1BGY E;  5TIS H;  3H32 A;  4WY4 B;  1Y9B A;  1FDO A;  1T6A A;  3L71 G;  2E5T A;  1JY3 P;  3CWB G;  2ZYA A;  1GL2 B;  1OVV A;  4MN4 C;  3NMD A;  1FDM A;  1CI6 B;  3BRV B;  4IFD K;  2WIT A;  1NTZ E;  3MUD A;  3AEE C;  2WVR A;  4LC1 A;  1USD A;  3ABV C;  2WPS A;  3H1J J;  5B5E E;  1AQ5 A;  4HKZ H;  2NPS B;  3V4W A;  3CLQ A;  1BCC E;  1R8E A;  3HE5 B;  3F5H A;  1CW5 A;  1JOC A;  3VYI A;  1NYH A;  1NJI Q;  1YQ4 C;  2CK3 H;  1S5L H;  2Z5H A;  2FXM A;  1H88 A;  2D2C B;  2IYO A;  4H13 C;  1ZLL A;  2PFX A;  2WTY A;  1PGQ A;  1NTK K;  2PAJ A;  3AED C;  3KDP B;  2GUS A;  1EQ7 A;  1ZN5 A;  3NFQ A;  2B87 B;  4L75 A;  3RL0 C;  2PRR A;  1KIL B;  1P84 E;  2Q5U A;  5AVW B;  1EXJ A;  3JSV C;  1N73 A;  2P1J A;  2KSE A;  2FYN C;  3PP5 A;  3B8E B;  3L70 J;  2L91 A;  4GOE A;  4IL6 X;  1JTH A;  1FJP A;  4DT0 A;  5C39 A;  2Q3E A;  1OXZ A;  1JUN A;  3WU2 H;  5CCG D;  1QVG O;  2FYU G;  3L75 E;  3MGN A;  1KQG B;  5AVR B;  2H7H A;  2M5A B;  3JCU E;  2E5Y A;  4L73 A;  2KLU A;  1RQU A;  2J58 A;  5KJ7 D;  2ZT9 B;  3TYY A;  1LTA C;  3V2R A;  3AEG C;  1SQX K;  2N1T C;  1FDI A;  2JO1 A;  2RKL A;  1Y8A A;  2WSC J;  4B86 A;  1KB9 D;  4WY4 A;  1T2K C;  1NAY A;  3HD7 B;  2AXC A;  3H1H E;  1SQX E;  1GL2 A;  1Q82 Q;  2HLO A;  2V7Q J;  2E74 D;  1SS1 A;  1CI6 A;  3AE2 C;  3V2Q A;  2Y0C A;  2LKM A;  1FZG A;  4H44 C;  1L0L J;  2Y0D A;  2XND H;  4JF7 A;  2XKM A;  1NTM D;  2YMY A;  4C7R A;  1URQ C;  3Q5P A;  1OW7 A;  3V6I A;  2QM7 A;  4BRY A;  2NPS A;  4JBZ A;  1L4A D;  1HWT C;  3L73 D;  1GU5 A;  3HE5 A;  1L0N J;  3CXH E;  1YIJ P;  4ZNC A;  2Y9Y A;  5CBO A;  1GW3 A;  1S1C X;  3L72 E;  3TK1 A;  2OTJ P;  2IZ0 A;  1QX8 A;  4D6T D;  2BCC E;  3R4Y A;  2Q1K A;  2QJY C;  1OVR A;  1BDC A;  3CC7 P;  4KJM A;  1DEB A;  2WZ7 A;  3VP9 A;  3L71 J;  1LP1 B;  3CWB J;  2J59 M;  1LTI C;  2A06 D;  3LIE A;  2OYH C;  1SQQ J;  3H1I G;  2ZT9 C;  4XA4 A;  2B87 A;  1URQ A;  1NWQ A;  3CCV P;  2H8P D;  4K3A A;  1KIL A;  4U3F D;  3A0B H;  1M1K Q;  3CC4 P;  1ZRT E;  1HJ0 A;  4GDO A;  4OVN F;  3H1K G;  3KHU A;  3P8C D;  5AVY B;  3GF7 A;  1WRG A;  2K88 A;  4PD4 I;  3QH9 A;  2FKW B;  3PRJ A;  2M5A A;  2RMZ A;  1L0L K;  2ZVO B;  3AE9 C;  3GMA A;  5KTB A;  1VQ6 P;  4L74 A;  2OYH A;  3GF3 A;  2OTK E;  1XTC C;  3MIW A;  4PD4 H;  1IC2 A;  1SP4 A;  2K9Y A;  1FS0 E;  4PJ0 E;  3O6Q B;  4ASW A;  3G6E P;  2PP6 A;  1E5W A;  1EDJ A;  4JPZ B;  1J1E B;  3MD0 A;  1JY3 N;  3PTZ A;  1JMM A;  3CX5 I;  1FZE A;  2JEE A;  2H43 A;  1KYO I;  3PLN A;  5KKZ C;  1QEX A;  1QLE D;  1RE3 C;  3GW6 A;  3CX5 H;  2E76 D;  2SPZ A;  3A0H E;  2E43 A;  2OGU A;  2HPC B;  3WUU A;  3HRN A;  1KYO H;  1EDI A;  1Q7Y Q;  2Z5I A;  2FYU J;  1VQ4 P;  4W7Y A;  1YQ3 C;  1NTK D;  5AVT B;  3HD7 D;  1FZC C;  1IFM A;  1LWU B;  3BAT A;  5M1B A;  1FAV A;  3KXD A;  5AW1 B;  3V2N A;  4L76 A;  2DW3 A;  3G9R A;  2A45 I;  4IL6 H;  1Q86 Q;  1NHL A;  5BVZ A;  1HGV A;  1RE3 A;  1JEK A;  3T97 A;  3M06 A;  3FXD A;  5KAF H;  3H1J G;  1N7S C;  2A45 H;  3TGU E;  2KOG A;  2O01 J;  2WSF H;  3USS A;  3KQG A;  3V4Q A;  3OAK A;  1LTG C;  1IFI A;  2ZJS E;  1ZXG A;  5AW5 B;  4M3L A;  1FZC A;  1D7M A;  1X79 B;  3H1J D;  1JY3 O;  2Q3I A;  1KD1 Q;  3CCL P;  1OZH A;  3RK3 B;  1HJB A;  3CCQ P;  2KS1 B;  2WSE H;  2ZXX A;  3LW5 J;  3KZI E;  3SWY A;  5H2F E;  1G1J A;  5CJ0 A;  3SWK A;  1W2E A;  1S3J A;  1N7S A;  1VPC A;  2FYU K;  2L5G B;  3O6Q A;  3U1C A;  3VMA A;  3MHV A;  1IFJ A;  3H1I J;  1JO5 A;  1R5L A;  3AEC C;  1RF0 C;  1BE3 G;  3EWK A;  5KAI E;  1H0T A;  2KIK A;  1KB9 E;  3P8M C;  3Q3D A;  2ZVN B;  3L70 D;  1KQF B;  3HE4 B;  1NU1 G;  3GHG C;  1KFN A;  2OYO A;  2HPC A;  1IK7 A;  3H1K J;  5CCH A;  5B5E H;  1G1I A;  2IFN A;  1AJY A;  1FOS F;  1NTM E;  1JB0 J;  1GU4 A;  3H1L G;  1S72 P;  3IF4 A;  1PGO A;  3L73 E;  4EDF A;  2R3C A;  3IFM A;  1NKZ B;  2KZI A;  3D71 A;  2WWW A;  3PH0 A;  2QIW A;  3KYQ A;  1QVF O;  4D6T E;  3E1R A;  5AW2 B;  1PFI A;  5GTH H;  1GTW A;  1L0N G;  4H13 B;  1L0L D;  1RF1 C;  2OTL P;  2A06 E;  2IZ1 A;  1ZR2 A;  2FYZ A;  1ZR4 A;  2NZ2 A;  1RH5 B;  3FGA D;  5B66 E;  3AEB C;  3RL0 B;  1LT9 C;  1L0N D;  4U3F E;  3S9O A;  3I55 P;  2FFD B;  3B5N D;  2M3B A;  1ZV8 A;  3MZW B;  2KS1 A;  2FYN B;  1JCC A;  1FZB A;  1SQQ G;  5AVQ B;  4YTP C;  4PV1 D;  1SQV G;  1K9M Q;  3P8C E;  3CCM P;  1LTT C;  2YO3 A;  3OA7 A;  2XU6 A;  1IK9 A;  3L71 D;  1RF1 A;  3CWB D;  1UIX A;  1SQQ D;  1OW6 A;  2POH A;  4WBA A;  5CCG C;  5CJ4 A;  2N1T B;  4BRY B;  2JR8 A;  2JKV A;  1U7M A;  2OYI C;  5GTI E;  1KOR A;  1FZA A;  3FX0 A;  1WMK A;  2KYV A;  1MZ9 A;  2BAS A;  2W8Z A;  3HE4 A;  3SSU A;  2CPS A;  2Y9Z A;  2MKV A;  1HGZ A;  1IZN B;  4JQ0 D;  1K05 A;  3AE1 C;  2IDB A;  4H44 B;  3L37 A;  2P7J A;  2E74 C;  1URQ B;  1NOH A;  3BCC J;  2JWD A;  1EZV G;  1A02 F;  3PJS K;  4H0L D;  1NTK E;  2FFD C;  1LTS C;  1GD2 E;  3TDK A;  2M8R A;  4PD4 D;  4JYC A;  1BE3 J;  1L4A C;  2QEX P;  3AE3 C;  2QJY B;  1VF5 D;  3V5B A;  2YKQ A;  3Q1M A;  1NU1 J;  2OYH B;  5AW8 B;  3EQ2 A;  4I7Z C;  1PPJ G;  1PV3 A;  2FYU D;  5E79 E;  1T8Z A;  1M56 D;  2FFD A;  1YI2 P;  3VMX A;  3D70 A;  3L36 A;  2FY8 A;  3W67 A;  4OGQ D;  3H1J E;  1VDF A;  3H1L J;  1ZME C;  2C0W A;  2GM4 A;  3RK2 C;  2KNC A;  1MFT A;  1OMI A;  1BSH A;  1OFC X;  4GOF A;  1AVY A;  4UB8 H;  2A45 G;  2N1T A;  1N86 A;  4AYC A;  3CCS P;  3N4X A;  3RL0 D;  3VTP C;  1DX7 A;  2W83 C;  2FXO A;  4WY4 D;  1S5L E;  5EFW B;  4NPD A;  4DOJ A;  1YTZ I;  1YHQ P;  1GL2 D;  5KLI C;  3A0H H;  3BAS A;  2P10 A;  1M1J C;  3G71 P;  3L70 E;  4CPG A;  5KKZ B;  1AQT A;  1N2D C;  5AVX B;  3T97 B;  1NU1 K;  1SQV J;  2WPQ A;  1BGY G;  2NPS D;  2E76 C;  1T2K D;  1FZC B;  5CHX A;  3WU2 E;  3H1I D;  2QE7 H;  4W80 A;  3TF5 A;  4QMA A;  5BU8 B;  2C0X A;  3BVH A;  1H8A A;  1KZU B;  1PIX A;  2D2C D;  1KMI Z;  4WWI A;  3UIA A;  1HTL C;  1JNM A;  4GKG A;  3SFD C;  4AUW A;  1EZV I;  1JM0 A;  1DD4 A;  1AV1 A;  5APV A;  3H1K D;  3A2A A;  1URQ D;  1N7S B;  4R4L A;  1PZQ A;  2AEF A;  1VL2 A;  2E75 C;  4IOI H;  1KIL D;  1BCC G;  1L0L E;  1L0N K;  4EI2 A;  1XTG B;  3RBX A;  5AW9 B;  1KFM A;  3QWO C;  3KZI H;  4I2L C;  3V2P A;  1H0T B;  2H89 C;  2I8D A;  1L0N E;  1YJ9 P;  2R3S A;  2UWJ E;  1GZL A;  2P2U A;  3C1L A;  1SQQ K;  3BRT B;  1SQV K;  2ZT9 D;  2H88 C;  2WPV B;  3IAO A;  2IBZ I;  2IYP A;  1NGM B;  4BWN A;  2B9B A;  3L71 E;  3CWB E;  3C9I A;  2K9J A;  3B4S A;  1SQQ E;  4GIF A;  1FE6 A;  1RY3 A;  2K37 A;  1S9K D;  3LID A;  1CZQ A;  1FZF A;  4OH8 B;  3G4S P;  2IX7 C;  2XDJ A;  3L75 G;  4LLH A;  3B71 A;  2C9L Y;  2P67 A;  2AXT E;  1U7J A;  1Q2N A;  3CPW O;  2M3E A;  3GHG B;  3HUS B;  2HYN A;  2QJK C;  1MUU A;  3VP8 A;  3A0B E;  2PGD A;  3L75 D;  1T3J A;  1HVV A;  5AW3 B;  5AVV B;  5KLV J;  1Y47 A;  3PHL A;  2XV5 A;  3AEA C;  3H1H G;  3I5C A;  3H6P A;  1RQV A;  3W68 A;  2WSF J;  2W27 A;  2GA1 A;  2ITA A;  3Q5R A;  1KN7 A;  3O8Z A;  3U59 A;  4ZKP A;  3C8V A;  4KHX A;  1JMB A;  4PD4 E;  3FWL A;  2ZYG A;  1VQ8 P;  5TJH A;  2WPR A;  3BCC G;  3L74 J;  1SQP J;  1M7L A;  2MJZ A;  3K5B A;  2WSE J;  1RF1 B;  1N7L A;  3L35 A;  2N9B A;  1KQL A;  2OQQ A;  3CCU P;  3Q2Y A;  1PP9 J;  3AE4 C;  3CL3 D;  1SFC C;  2FBW C;  3R2P A;  2FYU E;  3BCC D;  1BGY J;  2JJL A;  2KI7 B;  1LT1 A;  1LT9 B;  5APU A;  3E1I A;  3EFF K;  3A7O A;  1ZW0 A;  2YIU C;  4XE5 B;  1LTJ C;  4Y28 J;  3HUS C;  4GT1 A;  2B88 A;  1BE3 D;  1LGH B;  1K73 Q;  1DD3 A;  3WMM 0;  5DJU B;  3B5N C;  1NTZ J;  5KLV K;  1SQB G;  4PV1 C;  1RE4 C;  1NU1 D;  5APQ A;  3TNU B;  4IL6 E;  3N7N A;  1RF0 A;  1SFC A;  5APX A;  3M0D C;  2OYI B;  5AW7 B;  3VOP A;  3P32 A;  4U7J A;  1BCC J;  1LJ2 A;  1SQB D;  2YNY A;  5KAF E;  2Z4E A;  1P84 I;  4I1L A;  5AVZ B;  3U1A A;  1EC5 A;  3H1L D;  1PGP A;  3M9Q A;  3GHG A;  3HUS A;  3SFE C;  2RN0 A;  3AE6 C;  1VQ5 P;  1KC8 Q;  5CCH D;  2WT7 B;  2QVA A;  1P84 H;  4HB1 A;  1BDD A;  2Q7C A;  1HF9 A;  2E74 B;  2V4H A;  2BEQ D;  3MUD C;  2W90 A;  1S2E A;  4RES B;  1YIT P;  3H1I E;  1OWA A;  2OAR A;  3JCU H;  1M8O B;  1R5S A;  1DIP A;  1L4A B;  3AE5 C;  4H0L C;  3L4F A;  2KNC B;  3L75 J;  1NTZ K;  1BSN A;  5E79 H;  5APW A;  2W6A A;  3H1K E;  1SQV D;  4I7Z B;  1MFZ A;  2N9Y B;  1VF5 C;  1SVF A;  1KIL E;  1VQ7 P;  1LT9 A;  4A7P A;  2ZXE B;  3D6Z A;  1Q81 Q;  1UII A;  5KJ7 C;  2Y0E A;  1SLQ A;  3RK3 D;  3TSI A;  2KLV A;  3FXE A;  1IO4 A;  1NVO A;  3H1H J;  1FU1 A;  1SQX J;  4Y99 C;  3CXH I;  1J1D C;  4XFJ A;  3I56 P;  2JP3 A;  3TGU G;  3RK2 B;  1N73 C;  2RH0 A;  4OGQ C;  1NO4 A;  3CXH H;  1YTZ T;  3TNU A;  2C9N Y;  1X22 A;  2QJP C;  5CCG A;  4UB6 E;  3TGU D;  2HR3 A;  3RL0 g;  2OYI A;  1S4X A;  2O1K A;  1KTM A;  5AW6 B;  1EDL A;  4RO0 A;  3HTK A;  2WSS H;  1DEE G;  5KJ7 A;  3NTN A;  1JY2 O;  1GK6 A;  4WB4 A;  3L72 J;  2Q9I A;  2R5D A;  3VMZ A;  1IJD B;  5GTH E;  2QM8 A;  1S9K E;  5KLI B;  2R32 A;  2XZR A;  1GK4 A;  1NAF A;  1EZV D;  2BCC J;  3IR9 A;  4ASV A;  4WY4 C;  2WT7 A;  2YMK A;  1M1J B;  1NKN A;  4GOD A;  1GL2 C;  4R4M A;  5AW4 B;  1M90 Q;  5AW0 B;  3M9B A;  5TIS E;  5APT A;  1EDK A;  2K3R A;  2I1J A;  3IN6 A;  2WSC H;  1FBM A;  2KUB A;  1FC2 C;  3CX5 D;  1SQB J;  2E76 B;  4HYT B;  4BXL A;  1K8A Q;  4NPF X;  2IBZ G;  1KYO D;  4N3Y B;  3CCJ P;  1PPJ D;  4OWF A; 
#chains in the Genus database with same CATH homology
 2DW3 A;  2ITA A;  2NRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...