2DW3A

Solution structure of the rhodobacter sphaeroides pufx membrane protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title Solution structure of the Rhodobacter sphaeroides PufX membrane protein: implications for the quinone exchange and protein-protein interactions
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2dw3A01
2ITAA 2DW3A 2NRGA
chains in the Genus database with same CATH superfamily
1S5LH 1U57A 2Q5UA 2Q7CA 2JEEA 5APVA 2I8DA 3HTKA 1T3JA 2KUBA 2YIUB 3BRTB 2RMZA 1HBWA 1G1JA 3KPEA 2JP3A 3RK3E 1SQPE 3H6PA 1VQ8P 4I7ZB 2YKOA 3M0AA 4I7ZC 2V7QJ 2Z5HA 1RF1A 1SQQJ 1IFIA 3R2PA 3M06A 3OJAB 3BCCD 2WMMA 3GLMA 2PP6A 3CCEP 3RK3C 3HD7C 5AVQB 4U3FG 3AEDC 3H1JE 1SFCD 3HUSB 3CWBG 2KS1A 2BCCG 2BASA 3II6A 1N7SC 4D6TG 5CCHC 1EQ7A 1M7LA 1M1KQ 3CC2P 1YITP 1RE4A 5E79H 1N2DC 1EZVG 1L0LJ 2D2CC 2HFED 1JCDA 3H1HG 5KLVE 4PV1B 1Q7YQ 4XFJA 5L8RJ 2OYHA 1BGYG 3HE4A 1ZV8A 2NRGA 3CMEP 1E5WA 1QEXA 3CXHE 1L0ND 2E74B 2YKQA 3CMAP 2FKWB 3KXDA 1HJBA 1NU1G 4AQRD 3A0HH 3V6IA 2ZT9D 2WTYA 2WPSA 1S72P 1FZBA 1URQD 1FZCB 1A02J 4L75A 3L72J 1BE3D 4HYTB 2C9LY 4UB6E 3KDPB 1SQXD 2QIWA 2B87A 1JTHB 4K3AA 2ZVOB 3TYYA 1M57D 2YXRB 3D6YA 3N7NA 4UB8E 2W6AA 2FY8A 3H1KJ 1DX7A 3B71A 1LT1A 2WWWA 1PZQA 1OVVA 1SQPG 3IF4A 1LTJC 3M91A 2H8PD 1K04A 2OQQA 1Y9BA 2YMKA 4RO0A 1KILE 4R4LA 2I1KA 2HYNA 1L0LE 5CCGD 3D6ZA 1NJIQ 4W7ZA 1BCCD 2IBZI 3H25A 5AW5B 1DIPA 1PGJA 1VQPP 1ZMEC 2XNXA 5GTHE 2WSEH 2C0WA 1VPCA 1S9KE 3H1IG 1X22A 2XV5A 1QL2A 2E43A 4JYBA 1KILC 2FYNB 1NTMK 4DOJA 1LTBC 4IL6X 2O1KA 3BATA 2IBZE 4NPDA 3P8CD 3Q3DA 3U1AA 3RL0C 5AVWB 1FOSF 1KQGB 1ZW0A 4N78E 1LTGC 3H1LD 2WQYC 2R3SA 1URQA 3MGNA 1VQNP 2K37A 2IX7C 4IFDK 4JF7A 3L75D 3L70J 1DD4A 2OTLP 4OH8B 3PHLA 3FXEA 1J1EB 1EXIA 2B88A 2CK3H 1Q81Q 2QM8A 1N73A 2Z5IA 2HODB 3BASA 4H0LD 3L73D 2UWJE 4GOFA 3L71J 1DEBA 3TNUB 4BXLA 3D71A 5BVZA 3ZDMA 4QMAA 3AE1C 3A2AA 1NTZD 4RESB 2CPBA 1SQQG 1NKNA 1PIXA 3CX5E 4C7NA 1HUCA 1JUNA 5CCGA 3B5NB 3I5CA 3SFEC 3M0DC 4B86A 3SWFA 3V2RA 1W2BO 2Q3EA 2OYIA 5AVRB 1PP9J 3KZIE 1LWUA 5TISH 5AVTB 4IL6H 3S9OA 2NPSD 3MZWB 4A7PA 3G9RA 5AW2B 4C46A 2A06D 1NTMJ 5TJHA 3USSA 2WPRA 3B8EB 1HH0A 1GW3A 3D70A 1L4AB 2FYUD 1KC8Q 4I2LC 1L0LG 2IYPA 4WWIA 3JCUE 2B89A 1IJDB 1YI2P 1SQBD 3H32B 1KB9H 3L74D 3HE5A 2LXBA 1JY2O 2JWAA 2N1TC 3R4YA 4WBAA 3VTPC 1NTKJ 1IO4A 1G2CA 1HJ0A 3L71E 1VQLP 1NO4A 1X0TA 5APSA 2IBZG 5GTIH 3TSIA 1HGVA 2HPCA 2YO3A 3L72G 3PJSK 3CCRP 1ZRTD 1TU3F 3Q2YA 3Q1MA 1P84H 1M1JC 4OWFA 2FFDC 3LW5J 4LC1A 1DH3A 4YTPC 2I1JA 1P84D 1PP9E 1FS0E 1T6AA 4PD4H 1IFNA 4Y28J 4OGQB 3CL3D 1S5LX 3WMM0 1KYOH 1SQVE 4WVZA 4OGQC 3H1KG 4TT3H 1NTME 4KHXA 1KYOD 4BRYA 1SQXK 3V2NA 4ZNCA 5CMZA 5KAFE 1OWAA 3BCCJ 5KAIH 3G6EP 5H2FH 3AECC 2R32A 2WSSH 1ZR2A 1AVOA 1RF1C 3CC7P 1E79H 1W5CE 4O9BA 2P10A 3JSVC 1RH5B 1QX8A 3AE6C 4H44B 1K8AQ 1AQ5A 3RBXA 2R3CA 2XU6A 1AVYA 1M56D 1BDDA 1VQKP 1FZEA 2BCCD 1JM0A 1NYHA 1WMKA 2VRSA 3H1JJ 1FJPA 4GDOA 2XKMA 2ZJSE 1RHZB 1VF5C 2E75D 2E5YA 2QJYB 3G4SP 3VP8A 1S5LE 3CI9A 2E76B 1AFOA 1RE4C 1EDJA 1ZLLA 3H1HD 3KYQA 3L70G 1SP4A 4WY4A 1BGYD 2B9BA 4KJMA 1GL2C 2OYHC 5KLVJ 2H43A 1OW6A 3BRVB 3Q5RA 2M8RA 4EIJA 2WSCH 1DD3A 2IZ1A 3L71G 2Q3IA 3GHGA 3BCCE 2KZJA 1PGQA 2L91A 1YYCA 1NWQA 4WB4A 2PAJA 4GOEA 4W80A 2JJLA 2Y0DA 3QWOC 1GK6A 1LNQA 5AW6B 1PV3A 2K9JB 3AE3C 1OXZA 2R5BA 3RK3B 3HD7B 1OW8A 1MV8A 3TK1A 1PP9G 4R4MA 1RQUA 2WPQA 1OVUA 1QL1A 4Y99C 1NTZK 1N7SB 3CCUP 2DW3A 2IPPA 1FBMA 1EDKA 3K5BA 1NTMG 1N86A 1NH4A 2Y0EA 5E79E 2M5AA 2KLUA 3AEAC 4IFFA 3CXHI 2D2CB 5APUA 2ZFCA 5KJ7D 5KTBA 5CCHD 5APXA 1LP1A 1Y8AA 1FU1A 2GUSA 1H0TA 3H1ID 1GL2A 1NTKG 3AE2C 3A0HE 1SS1A 3I55P 2FYUK 1BE3E 2BEZF 3H1LJ 2KYVA 3NXSA 1IC2A 4PV1D 5APYA 4IOIH 4M3LA 1S4XA 1SQXE 2RKLA 3GF7A 5B5EE 5AW1B 1RY3A 2O1JA 1KORA 1GU4A 3L37A 1GDTA 2ZT9C 1JMBA 3VP9A 3FXDA 1URQC 2E74D 2IDBA 1NKZB 3C9IA 4GT1A 2WZ7A 1JCCA 1QVGO 2QJKC 1R5SA 2WSFJ 2M3EA 1YJWP 1EC5A 3O8ZA 2KIKA 1CI6A 5CJ0A 1FDIA 4YXDC 1N73B 4DJGA 1U7MA 2W90A 2ZAEB 2OARA 2YNYA 1NTZJ 2IYOA 3A7OA 2WPVB 2V7QH 1N73C 1BCCE 1SFCA 1LTJB 3RK2B 2AEMA 1IFPA 3BCCG 3RK2C 5KKZC 1SQQD 4IFMA 3P32A 3EWKA 4UB6H 4AYCA 1IFDA 2AXTE 3M9QA 3HUSA 3CCLP 4NPFX 2LR2A 4JBZA 5CCGC 1NAFA 2OYOA 1GW4A 2E5TA 5CBOA 5KJ7A 3P8CE 4DZOA 4I1LA 2OYIC 4UB8H 4N6JA 1LWUC 1VQ5P 2GM4A 1JB0J 3H1LE 1FJKA 1KILB 3H1JG 1JNMA 1SQVK 1H8AA 4GODA 1GMJA 3L75E 3OA7A 3RL0B 1FZAA 4YPCA 3S4RA 1LTIC 2NZ2A 1U7JA 3L74J 5AVYB 1L0LD 3V5BA 2POHA 5B66H 5GTHH 2KI7B 3M9BA 3L73E 1MFZA 1R5LA 5KLVG 2O01J 1LTSC 1OIPA 4I6MC 3GMAA 1FZCA 3CX5I 1NTZE 2YO2A 1OVRA 2H88C 3AE4C 5AW9B 1S2EA 3SFDC 2M3BA 3LIDA 2Z4EA 2WITA 1GZLA 3L72D 1RQVA 1YTZI 2KOGA 4H0LC 3VMYA 1KFNA 5AW7B 3MD0A 1VQ7P 2Q1KA 3CCVP 3VMZA 4IL6E 1T3UA 1DEEG 5M1BA 2QRXA 2W6BA 2A06E 4CPGA 4NPEA 1XTGB 3O6QA 2QJPC 4L76A 3SWYA 1BSHA 5AW0B 3A5TA 3TGUJ 3H1KD 2YXQB 2FYUE 1VQ9P 2WT7A 3RL0g 3B5ND 2NPSC 2N9BA 1SQVJ 2WVRA 3SWKA 1PL5A 4PJ0E 1SQBE 2FXMA 3L74E 3Q5SA 4EDFA 1X9VA 3A0BH 4MN4C 1YBKA 3AE8C 3I56P 2M0BA 1HF9A 4TLFA 4ASWA 1JY2P 1FOSE 2ZYDA 2N1TB 3T97B 3TDKA 1UIXA 1PPJD 2K1AA 4Z1MH 3RGUA 1QGKB 1L4AD 1KB9D 1ZRTE 3H1LG 2FBWC 2RH0A 2KZIA 1Q90D 2W27A 1RF0A 1FE6A 3AEBC 1LT9C 2LKMA 1PGOA 3VMXA 2KNCB 4RKUJ 5K5GB 1JEKA 3U59A 5CJ4A 3CCJP 1M1JB 3F89A 2FFDB 2KLVA 3L70D 4HJGH 4WY4B 2OGUA 3V4QA 1L0NK 4WY4C 1KYOE 1Q2NA 1HTLC 2J5UA 2A45I 2HODA 3CPWO 1MUUA 3HTKB 4H13B 3TGUE 1VL2A 1LJ2A 1KV4A 2H89C 2R44A 2QE7H 4BWNA 5KAIE 4H13C 4PD4D 1NTZG 5H2FE 2K3RA 2G8YA 2NPSA 3GHGC 1ZN5A 3B5NA 4OGQD 1RF1B 2BCCE 1YQ3C 2W83C 3GG2A 3WU2H 1QVFO 2ZYGA 4ZKUA 2A06G 1NOHA 4U3FD 3QH9A 1Q86Q 1YHQP 4DCKA 1SQQK 4JQ0D 1EDLA 5AW3B 5CHXA 3CWBD 2KS1B 3F5HA 5BU5A 1L4AA 4D6TD 1NTMD 3E1RA 1GD2E 4HH2A 1L2PA 3H1HE 3VN0A 2OTKE 1HVVA 1VQMP 4H44D 1VF5B 3NTNA 1K73Q 1LT9A 3L74G 3ABVC 1N8RQ 2E75C 5AVVB 1X8YA 3WUTA 1T8ZA 1EZVD 2LXCB 1LGHB 5C39A 1VF5D 1T2KD 4LGDE 1H0TB 4EI2A 2PFXA 1JY2N 1GL2B 2GA1A 2OYHB 1N7LA 1L0NJ 4HKZH 1NTKD 3HE4B 2ZYAA 1LTAC 2E76D 2IFNA 2FXPA 2AEFA 3VMAA 3NFQA 1BSNA 3V4WA 2QVAA 1BE3J 1NU1D 3HRNA 1ZXGA 1XTCC 1FAVA 5AVZB 3LW5H 1SQXJ 2JR8A 2YIUC 2FYZA 2B87B 3W67A 1H89A 3AEFC 2SPZA 2ZVNB 4C7RA 2QG4A 4Y99B 1CI6B 3PH0A 3B4SA 3CLQA 3TGUG 1NAYA 3CD6P 1GTWA 1SFCB 2JDIH 4L73A 2O01N 1SQVG 3RK3D 1JY3P 1SQPD 3HD7D 1SFCC 1KMIZ 1BCCJ 2KSJA 2XZRA 3H1IE 2A45G 3U1CA 3IR9A 3UIAA 1JY3O 1OW7A 1N7SD 2N9YB 2WSEJ 3HUSC 1ZR4A 1L0NE 4HB1A 3P7KA 3P8MC 1MKMA 5KJ7C 3RBZA 1J1DB 3H1JD 2Y0CA 2ZXEB 3Q5PA 2P2UA 3MUDA 1J1DC 2MKVA 2D2CD 2RN0A 3L4FA 3FWNA 1D7MA 1RE3A 1YQ4C 1JO5A 1OX3A 1SQBK 2W8ZA 2KP8A 3L75J 4PV1C 1NHLA 3V2PA 2JO1A 2ZT9B 3JC22 1URQB 1WT6A 1Z56A 2OTJP 1KD1Q 3WUVA 2ZXXA 1A02F 5AW8B 2QEXP 3MIWA 3LIEA 2O3JA 1FDMA 2QJKB 2FXOA 5KLVD 2E74C 2PRRA 2H7HA 1AQTA 1PGPA 3L73J 1VQ6P 1SQQE 4K35A 1OMIA 3CXHH 1VQOP 1FZCC 1CSBA 2KXPB 5AW4B 3CXHD 5B5EH 3E1IA 3S1KA 2Q6QA 2K9JA 5KKZB 1NVOA 3HD7A 1S1CX 1VDFA 1H88A 5APTA 4C7NB 2JKVA 4AUWA 3FX0A 1R8EA 3RK2D 1N7SA 3O6QB 2ITAA 2CPSA 2MJZA 4GIFA 2OYIB 2XNDH 1LWUB 2C0XA 5CCHA 1UIIA 1PFIA 4ASVA 2P1JA 3IFMA 2WT7B 4XA4A 1IK9A 1X79B 3VOPA 2IZ0A 4ZKPA 1M8OB 1IFJA 1YTZT 2FYUJ 1HGZA 1KFMA 1ZOYC 5B66E 1KQFB 2P7JA 1JY3N 4KT0J 4LLHA 2AXTH 1FC2C 2KK7A 1SQBJ 5APQA 1KILD 2IFMA 2P67A 2HLOA 3G3ZA 4XE5B 2V4HA 3RL0D 2BEQD 2FYNC 1L0NG 3HE5B 2HR3A 1NGMB 3L72E 3C8VA 1S9KD 1CW5A 5DJUB 1OFCX 1KN7A 1G2CB 1FZFA 3M9HA 3MHVA 1ZP0C 2Y9YA 1Q82Q 1BE3G 2K9YA 2IBZD 3PP5A 2HPCB 1RF0C 1MFTA 1IZNB 4H0LB 1NTKK 4L74A 2GUVA 3EQ2A 1SQXG 1BDCA 5APWA 1WRGA 1JTHA 5EFWB 4N78D 1AJYA 1J1EC 1JMMA 2WSFH 3H1KE 3IN6A 3TF5A 3NMDA 3G71P 2YMYA 5TISE 2R5DA 1NU1K 2QJPB 3EFGA 3PLNA 1LTJA 3AEGC 4JYCA 1K05A 1KB9I 2XDJA 1FDOA 1SLQA 2AEJA 5AVUB 1M90Q 1AV1A 2K88A 2NPSB 3OW2O 3A0BE 4BRYB 2QSIA 1GK4A 2E42A 1BCCG 2JWDA 3B5NC 2P58A 3CX5H 1QLED 1PPJE 3MP7B 4U3FJ 1KB9E 1IFMA 3CX5D 4W7YA 1W2EA 4OVNF 2W6JH 1KILA 3CWBJ 3GW6A 2BCCJ 1SQPK 1P84I 3WUUA 4D6TJ 1EDIA 3KZIH 3PRJA 1USDA 3V2QA 1MZ9A 1G1IA 1YJNP 1S3JA 5GTIE 3MTUE 4PD4I 4EOTA 3L70E 4PJ0H 3C1LA 1L4AC 1KZUB 1LT9B 3L35A 2N1TD 1KYOI 5AVSB 1YIJP 1P84E 3H1HJ 3AE5C 1J2JB 3L75G 3OAKA 3ITKA 1BGYJ 5DJTB 1IK7A 3E7KA 3AE7C 1AA0A 3JCUH 3GF3A 2O01H 4PD4E 3CCMP 5BU8B 2Q9IA 2QM7A 3FWLA 5AVXB 2YKPA 2KB7P 3VYIA 1NU1J 5KLIB 3L73G 3TNUA 1Y47A 2WSCJ 5KLIC 4WY4D 3FGAD 3CCQP 3KHUA 3L71D 3GHGB 3AE9C 1GU5A 3M0DA 5KLVK 1KTMA 3WU2E 4U7JA 4H13D 4U3FE 3CC4P 1SVFA 3SSUA 2KSEA 1EZVI 1HWTC 1CZQA 3CWBE 4N3YB 4DT0A 2Y9ZA 2L5GB 3PTZA 4D6TE 1USEA 2G3AA 1PP9D 1SQPJ 3IAOA 3TGUD 3A3YB 2QA4P 1SQVD 1EZVE 3L36A 2A45H 2FYUG 4ZMDA 5KAFH 5CBNA 1KQLA 2AXCA 3CCSP 2J59M 1YJ9P 1BGYE 2M5AB 1NTKE 2N1TA 3T97A 1SQBG 3H32A 4H44C 2E75B 2HG5D 1PPJG 2J58A 4EYYQ 3H1IJ 4RJTA 3BVHA 1LTTC 4YXWH 2C9NY 1LP1B 4JPZB 2PGDA 3EFFK 3N4XA 1EXJA 1NU1E 1FZGA 1T2KC 1K9MQ 1JOCA 3W68A 4GKGA 2KNCA 3AEEC 2QJYC 3MUDC 1KQSO 1L0LK 1VQ4P 1M1JA 2FFDA 2E76C 1RE3C 3KQGA 1OZHA 1GL2D
chains in the Genus database with same CATH topology
2ITAA 2DW3A 2NRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITA A;  2DW3 A;  2NRG A; 
#chains in the Genus database with same CATH topology
 1S5L H;  1U57 A;  2Q5U A;  2Q7C A;  2JEE A;  5APV A;  2I8D A;  3HTK A;  1T3J A;  2KUB A;  2YIU B;  3BRT B;  2RMZ A;  1HBW A;  1G1J A;  3KPE A;  2JP3 A;  3RK3 E;  1SQP E;  3H6P A;  1VQ8 P;  4I7Z B;  2YKO A;  3M0A A;  4I7Z C;  2V7Q J;  2Z5H A;  1RF1 A;  1SQQ J;  1IFI A;  3R2P A;  3M06 A;  3OJA B;  3BCC D;  2WMM A;  3GLM A;  2PP6 A;  3CCE P;  3RK3 C;  3HD7 C;  5AVQ B;  4U3F G;  3AED C;  3H1J E;  1SFC D;  3HUS B;  3CWB G;  2KS1 A;  2BCC G;  2BAS A;  3II6 A;  1N7S C;  4D6T G;  5CCH C;  1EQ7 A;  1M7L A;  1M1K Q;  3CC2 P;  1YIT P;  1RE4 A;  5E79 H;  1N2D C;  1EZV G;  1L0L J;  2D2C C;  2HFE D;  1JCD A;  3H1H G;  5KLV E;  4PV1 B;  1Q7Y Q;  4XFJ A;  5L8R J;  2OYH A;  1BGY G;  3HE4 A;  1ZV8 A;  2NRG A;  3CME P;  1E5W A;  1QEX A;  3CXH E;  1L0N D;  2E74 B;  2YKQ A;  3CMA P;  2FKW B;  3KXD A;  1HJB A;  1NU1 G;  4AQR D;  3A0H H;  3V6I A;  2ZT9 D;  2WTY A;  2WPS A;  1S72 P;  1FZB A;  1URQ D;  1FZC B;  1A02 J;  4L75 A;  3L72 J;  1BE3 D;  4HYT B;  2C9L Y;  4UB6 E;  3KDP B;  1SQX D;  2QIW A;  2B87 A;  1JTH B;  4K3A A;  2ZVO B;  3TYY A;  1M57 D;  2YXR B;  3D6Y A;  3N7N A;  4UB8 E;  2W6A A;  2FY8 A;  3H1K J;  1DX7 A;  3B71 A;  1LT1 A;  2WWW A;  1PZQ A;  1OVV A;  1SQP G;  3IF4 A;  1LTJ C;  3M91 A;  2H8P D;  1K04 A;  2OQQ A;  1Y9B A;  2YMK A;  4RO0 A;  1KIL E;  4R4L A;  2I1K A;  2HYN A;  1L0L E;  5CCG D;  3D6Z A;  1NJI Q;  4W7Z A;  1BCC D;  2IBZ I;  3H25 A;  5AW5 B;  1DIP A;  1PGJ A;  1VQP P;  1ZME C;  2XNX A;  5GTH E;  2WSE H;  2C0W A;  1VPC A;  1S9K E;  3H1I G;  1X22 A;  2XV5 A;  1QL2 A;  2E43 A;  4JYB A;  1KIL C;  2FYN B;  1NTM K;  4DOJ A;  1LTB C;  4IL6 X;  2O1K A;  3BAT A;  2IBZ E;  4NPD A;  3P8C D;  3Q3D A;  3U1A A;  3RL0 C;  5AVW B;  1FOS F;  1KQG B;  1ZW0 A;  4N78 E;  1LTG C;  3H1L D;  2WQY C;  2R3S A;  1URQ A;  3MGN A;  1VQN P;  2K37 A;  2IX7 C;  4IFD K;  4JF7 A;  3L75 D;  3L70 J;  1DD4 A;  2OTL P;  4OH8 B;  3PHL A;  3FXE A;  1J1E B;  1EXI A;  2B88 A;  2CK3 H;  1Q81 Q;  2QM8 A;  1N73 A;  2Z5I A;  2HOD B;  3BAS A;  4H0L D;  3L73 D;  2UWJ E;  4GOF A;  3L71 J;  1DEB A;  3TNU B;  4BXL A;  3D71 A;  5BVZ A;  3ZDM A;  4QMA A;  3AE1 C;  3A2A A;  1NTZ D;  4RES B;  2CPB A;  1SQQ G;  1NKN A;  1PIX A;  3CX5 E;  4C7N A;  1HUC A;  1JUN A;  5CCG A;  3B5N B;  3I5C A;  3SFE C;  3M0D C;  4B86 A;  3SWF A;  3V2R A;  1W2B O;  2Q3E A;  2OYI A;  5AVR B;  1PP9 J;  3KZI E;  1LWU A;  5TIS H;  5AVT B;  4IL6 H;  3S9O A;  2NPS D;  3MZW B;  4A7P A;  3G9R A;  5AW2 B;  4C46 A;  2A06 D;  1NTM J;  5TJH A;  3USS A;  2WPR A;  3B8E B;  1HH0 A;  1GW3 A;  3D70 A;  1L4A B;  2FYU D;  1KC8 Q;  4I2L C;  1L0L G;  2IYP A;  4WWI A;  3JCU E;  2B89 A;  1IJD B;  1YI2 P;  1SQB D;  3H32 B;  1KB9 H;  3L74 D;  3HE5 A;  2LXB A;  1JY2 O;  2JWA A;  2N1T C;  3R4Y A;  4WBA A;  3VTP C;  1NTK J;  1IO4 A;  1G2C A;  1HJ0 A;  3L71 E;  1VQL P;  1NO4 A;  1X0T A;  5APS A;  2IBZ G;  5GTI H;  3TSI A;  1HGV A;  2HPC A;  2YO3 A;  3L72 G;  3PJS K;  3CCR P;  1ZRT D;  1TU3 F;  3Q2Y A;  3Q1M A;  1P84 H;  1M1J C;  4OWF A;  2FFD C;  3LW5 J;  4LC1 A;  1DH3 A;  4YTP C;  2I1J A;  1P84 D;  1PP9 E;  1FS0 E;  1T6A A;  4PD4 H;  1IFN A;  4Y28 J;  4OGQ B;  3CL3 D;  1S5L X;  3WMM 0;  1KYO H;  1SQV E;  4WVZ A;  4OGQ C;  3H1K G;  4TT3 H;  1NTM E;  4KHX A;  1KYO D;  4BRY A;  1SQX K;  3V2N A;  4ZNC A;  5CMZ A;  5KAF E;  1OWA A;  3BCC J;  5KAI H;  3G6E P;  5H2F H;  3AEC C;  2R32 A;  2WSS H;  1ZR2 A;  1AVO A;  1RF1 C;  3CC7 P;  1E79 H;  1W5C E;  4O9B A;  2P10 A;  3JSV C;  1RH5 B;  1QX8 A;  3AE6 C;  4H44 B;  1K8A Q;  1AQ5 A;  3RBX A;  2R3C A;  2XU6 A;  1AVY A;  1M56 D;  1BDD A;  1VQK P;  1FZE A;  2BCC D;  1JM0 A;  1NYH A;  1WMK A;  2VRS A;  3H1J J;  1FJP A;  4GDO A;  2XKM A;  2ZJS E;  1RHZ B;  1VF5 C;  2E75 D;  2E5Y A;  2QJY B;  3G4S P;  3VP8 A;  1S5L E;  3CI9 A;  2E76 B;  1AFO A;  1RE4 C;  1EDJ A;  1ZLL A;  3H1H D;  3KYQ A;  3L70 G;  1SP4 A;  4WY4 A;  1BGY D;  2B9B A;  4KJM A;  1GL2 C;  2OYH C;  5KLV J;  2H43 A;  1OW6 A;  3BRV B;  3Q5R A;  2M8R A;  4EIJ A;  2WSC H;  1DD3 A;  2IZ1 A;  3L71 G;  2Q3I A;  3GHG A;  3BCC E;  2KZJ A;  1PGQ A;  2L91 A;  1YYC A;  1NWQ A;  4WB4 A;  2PAJ A;  4GOE A;  4W80 A;  2JJL A;  2Y0D A;  3QWO C;  1GK6 A;  1LNQ A;  5AW6 B;  1PV3 A;  2K9J B;  3AE3 C;  1OXZ A;  2R5B A;  3RK3 B;  3HD7 B;  1OW8 A;  1MV8 A;  3TK1 A;  1PP9 G;  4R4M A;  1RQU A;  2WPQ A;  1OVU A;  1QL1 A;  4Y99 C;  1NTZ K;  1N7S B;  3CCU P;  2DW3 A;  2IPP A;  1FBM A;  1EDK A;  3K5B A;  1NTM G;  1N86 A;  1NH4 A;  2Y0E A;  5E79 E;  2M5A A;  2KLU A;  3AEA C;  4IFF A;  3CXH I;  2D2C B;  5APU A;  2ZFC A;  5KJ7 D;  5KTB A;  5CCH D;  5APX A;  1LP1 A;  1Y8A A;  1FU1 A;  2GUS A;  1H0T A;  3H1I D;  1GL2 A;  1NTK G;  3AE2 C;  3A0H E;  1SS1 A;  3I55 P;  2FYU K;  1BE3 E;  2BEZ F;  3H1L J;  2KYV A;  3NXS A;  1IC2 A;  4PV1 D;  5APY A;  4IOI H;  4M3L A;  1S4X A;  1SQX E;  2RKL A;  3GF7 A;  5B5E E;  5AW1 B;  1RY3 A;  2O1J A;  1KOR A;  1GU4 A;  3L37 A;  1GDT A;  2ZT9 C;  1JMB A;  3VP9 A;  3FXD A;  1URQ C;  2E74 D;  2IDB A;  1NKZ B;  3C9I A;  4GT1 A;  2WZ7 A;  1JCC A;  1QVG O;  2QJK C;  1R5S A;  2WSF J;  2M3E A;  1YJW P;  1EC5 A;  3O8Z A;  2KIK A;  1CI6 A;  5CJ0 A;  1FDI A;  4YXD C;  1N73 B;  4DJG A;  1U7M A;  2W90 A;  2ZAE B;  2OAR A;  2YNY A;  1NTZ J;  2IYO A;  3A7O A;  2WPV B;  2V7Q H;  1N73 C;  1BCC E;  1SFC A;  1LTJ B;  3RK2 B;  2AEM A;  1IFP A;  3BCC G;  3RK2 C;  5KKZ C;  1SQQ D;  4IFM A;  3P32 A;  3EWK A;  4UB6 H;  4AYC A;  1IFD A;  2AXT E;  3M9Q A;  3HUS A;  3CCL P;  4NPF X;  2LR2 A;  4JBZ A;  5CCG C;  1NAF A;  2OYO A;  1GW4 A;  2E5T A;  5CBO A;  5KJ7 A;  3P8C E;  4DZO A;  4I1L A;  2OYI C;  4UB8 H;  4N6J A;  1LWU C;  1VQ5 P;  2GM4 A;  1JB0 J;  3H1L E;  1FJK A;  1KIL B;  3H1J G;  1JNM A;  1SQV K;  1H8A A;  4GOD A;  1GMJ A;  3L75 E;  3OA7 A;  3RL0 B;  1FZA A;  4YPC A;  3S4R A;  1LTI C;  2NZ2 A;  1U7J A;  3L74 J;  5AVY B;  1L0L D;  3V5B A;  2POH A;  5B66 H;  5GTH H;  2KI7 B;  3M9B A;  3L73 E;  1MFZ A;  1R5L A;  5KLV G;  2O01 J;  1LTS C;  1OIP A;  4I6M C;  3GMA A;  1FZC A;  3CX5 I;  1NTZ E;  2YO2 A;  1OVR A;  2H88 C;  3AE4 C;  5AW9 B;  1S2E A;  3SFD C;  2M3B A;  3LID A;  2Z4E A;  2WIT A;  1GZL A;  3L72 D;  1RQV A;  1YTZ I;  2KOG A;  4H0L C;  3VMY A;  1KFN A;  5AW7 B;  3MD0 A;  1VQ7 P;  2Q1K A;  3CCV P;  3VMZ A;  4IL6 E;  1T3U A;  1DEE G;  5M1B A;  2QRX A;  2W6B A;  2A06 E;  4CPG A;  4NPE A;  1XTG B;  3O6Q A;  2QJP C;  4L76 A;  3SWY A;  1BSH A;  5AW0 B;  3A5T A;  3TGU J;  3H1K D;  2YXQ B;  2FYU E;  1VQ9 P;  2WT7 A;  3RL0 g;  3B5N D;  2NPS C;  2N9B A;  1SQV J;  2WVR A;  3SWK A;  1PL5 A;  4PJ0 E;  1SQB E;  2FXM A;  3L74 E;  3Q5S A;  4EDF A;  1X9V A;  3A0B H;  4MN4 C;  1YBK A;  3AE8 C;  3I56 P;  2M0B A;  1HF9 A;  4TLF A;  4ASW A;  1JY2 P;  1FOS E;  2ZYD A;  2N1T B;  3T97 B;  3TDK A;  1UIX A;  1PPJ D;  2K1A A;  4Z1M H;  3RGU A;  1QGK B;  1L4A D;  1KB9 D;  1ZRT E;  3H1L G;  2FBW C;  2RH0 A;  2KZI A;  1Q90 D;  2W27 A;  1RF0 A;  1FE6 A;  3AEB C;  1LT9 C;  2LKM A;  1PGO A;  3VMX A;  2KNC B;  4RKU J;  5K5G B;  1JEK A;  3U59 A;  5CJ4 A;  3CCJ P;  1M1J B;  3F89 A;  2FFD B;  2KLV A;  3L70 D;  4HJG H;  4WY4 B;  2OGU A;  3V4Q A;  1L0N K;  4WY4 C;  1KYO E;  1Q2N A;  1HTL C;  2J5U A;  2A45 I;  2HOD A;  3CPW O;  1MUU A;  3HTK B;  4H13 B;  3TGU E;  1VL2 A;  1LJ2 A;  1KV4 A;  2H89 C;  2R44 A;  2QE7 H;  4BWN A;  5KAI E;  4H13 C;  4PD4 D;  1NTZ G;  5H2F E;  2K3R A;  2G8Y A;  2NPS A;  3GHG C;  1ZN5 A;  3B5N A;  4OGQ D;  1RF1 B;  2BCC E;  1YQ3 C;  2W83 C;  3GG2 A;  3WU2 H;  1QVF O;  2ZYG A;  4ZKU A;  2A06 G;  1NOH A;  4U3F D;  3QH9 A;  1Q86 Q;  1YHQ P;  4DCK A;  1SQQ K;  4JQ0 D;  1EDL A;  5AW3 B;  5CHX A;  3CWB D;  2KS1 B;  3F5H A;  5BU5 A;  1L4A A;  4D6T D;  1NTM D;  3E1R A;  1GD2 E;  4HH2 A;  1L2P A;  3H1H E;  3VN0 A;  2OTK E;  1HVV A;  1VQM P;  4H44 D;  1VF5 B;  3NTN A;  1K73 Q;  1LT9 A;  3L74 G;  3ABV C;  1N8R Q;  2E75 C;  5AVV B;  1X8Y A;  3WUT A;  1T8Z A;  1EZV D;  2LXC B;  1LGH B;  5C39 A;  1VF5 D;  1T2K D;  4LGD E;  1H0T B;  4EI2 A;  2PFX A;  1JY2 N;  1GL2 B;  2GA1 A;  2OYH B;  1N7L A;  1L0N J;  4HKZ H;  1NTK D;  3HE4 B;  2ZYA A;  1LTA C;  2E76 D;  2IFN A;  2FXP A;  2AEF A;  3VMA A;  3NFQ A;  1BSN A;  3V4W A;  2QVA A;  1BE3 J;  1NU1 D;  3HRN A;  1ZXG A;  1XTC C;  1FAV A;  5AVZ B;  3LW5 H;  1SQX J;  2JR8 A;  2YIU C;  2FYZ A;  2B87 B;  3W67 A;  1H89 A;  3AEF C;  2SPZ A;  2ZVN B;  4C7R A;  2QG4 A;  4Y99 B;  1CI6 B;  3PH0 A;  3B4S A;  3CLQ A;  3TGU G;  1NAY A;  3CD6 P;  1GTW A;  1SFC B;  2JDI H;  4L73 A;  2O01 N;  1SQV G;  3RK3 D;  1JY3 P;  1SQP D;  3HD7 D;  1SFC C;  1KMI Z;  1BCC J;  2KSJ A;  2XZR A;  3H1I E;  2A45 G;  3U1C A;  3IR9 A;  3UIA A;  1JY3 O;  1OW7 A;  1N7S D;  2N9Y B;  2WSE J;  3HUS C;  1ZR4 A;  1L0N E;  4HB1 A;  3P7K A;  3P8M C;  1MKM A;  5KJ7 C;  3RBZ A;  1J1D B;  3H1J D;  2Y0C A;  2ZXE B;  3Q5P A;  2P2U A;  3MUD A;  1J1D C;  2MKV A;  2D2C D;  2RN0 A;  3L4F A;  3FWN A;  1D7M A;  1RE3 A;  1YQ4 C;  1JO5 A;  1OX3 A;  1SQB K;  2W8Z A;  2KP8 A;  3L75 J;  4PV1 C;  1NHL A;  3V2P A;  2JO1 A;  2ZT9 B;  3JC2 2;  1URQ B;  1WT6 A;  1Z56 A;  2OTJ P;  1KD1 Q;  3WUV A;  2ZXX A;  1A02 F;  5AW8 B;  2QEX P;  3MIW A;  3LIE A;  2O3J A;  1FDM A;  2QJK B;  2FXO A;  5KLV D;  2E74 C;  2PRR A;  2H7H A;  1AQT A;  1PGP A;  3L73 J;  1VQ6 P;  1SQQ E;  4K35 A;  1OMI A;  3CXH H;  1VQO P;  1FZC C;  1CSB A;  2KXP B;  5AW4 B;  3CXH D;  5B5E H;  3E1I A;  3S1K A;  2Q6Q A;  2K9J A;  5KKZ B;  1NVO A;  3HD7 A;  1S1C X;  1VDF A;  1H88 A;  5APT A;  4C7N B;  2JKV A;  4AUW A;  3FX0 A;  1R8E A;  3RK2 D;  1N7S A;  3O6Q B;  2ITA A;  2CPS A;  2MJZ A;  4GIF A;  2OYI B;  2XND H;  1LWU B;  2C0X A;  5CCH A;  1UII A;  1PFI A;  4ASV A;  2P1J A;  3IFM A;  2WT7 B;  4XA4 A;  1IK9 A;  1X79 B;  3VOP A;  2IZ0 A;  4ZKP A;  1M8O B;  1IFJ A;  1YTZ T;  2FYU J;  1HGZ A;  1KFM A;  1ZOY C;  5B66 E;  1KQF B;  2P7J A;  1JY3 N;  4KT0 J;  4LLH A;  2AXT H;  1FC2 C;  2KK7 A;  1SQB J;  5APQ A;  1KIL D;  2IFM A;  2P67 A;  2HLO A;  3G3Z A;  4XE5 B;  2V4H A;  3RL0 D;  2BEQ D;  2FYN C;  1L0N G;  3HE5 B;  2HR3 A;  1NGM B;  3L72 E;  3C8V A;  1S9K D;  1CW5 A;  5DJU B;  1OFC X;  1KN7 A;  1G2C B;  1FZF A;  3M9H A;  3MHV A;  1ZP0 C;  2Y9Y A;  1Q82 Q;  1BE3 G;  2K9Y A;  2IBZ D;  3PP5 A;  2HPC B;  1RF0 C;  1MFT A;  1IZN B;  4H0L B;  1NTK K;  4L74 A;  2GUV A;  3EQ2 A;  1SQX G;  1BDC A;  5APW A;  1WRG A;  1JTH A;  5EFW B;  4N78 D;  1AJY A;  1J1E C;  1JMM A;  2WSF H;  3H1K E;  3IN6 A;  3TF5 A;  3NMD A;  3G71 P;  2YMY A;  5TIS E;  2R5D A;  1NU1 K;  2QJP B;  3EFG A;  3PLN A;  1LTJ A;  3AEG C;  4JYC A;  1K05 A;  1KB9 I;  2XDJ A;  1FDO A;  1SLQ A;  2AEJ A;  5AVU B;  1M90 Q;  1AV1 A;  2K88 A;  2NPS B;  3OW2 O;  3A0B E;  4BRY B;  2QSI A;  1GK4 A;  2E42 A;  1BCC G;  2JWD A;  3B5N C;  2P58 A;  3CX5 H;  1QLE D;  1PPJ E;  3MP7 B;  4U3F J;  1KB9 E;  1IFM A;  3CX5 D;  4W7Y A;  1W2E A;  4OVN F;  2W6J H;  1KIL A;  3CWB J;  3GW6 A;  2BCC J;  1SQP K;  1P84 I;  3WUU A;  4D6T J;  1EDI A;  3KZI H;  3PRJ A;  1USD A;  3V2Q A;  1MZ9 A;  1G1I A;  1YJN P;  1S3J A;  5GTI E;  3MTU E;  4PD4 I;  4EOT A;  3L70 E;  4PJ0 H;  3C1L A;  1L4A C;  1KZU B;  1LT9 B;  3L35 A;  2N1T D;  1KYO I;  5AVS B;  1YIJ P;  1P84 E;  3H1H J;  3AE5 C;  1J2J B;  3L75 G;  3OAK A;  3ITK A;  1BGY J;  5DJT B;  1IK7 A;  3E7K A;  3AE7 C;  1AA0 A;  3JCU H;  3GF3 A;  2O01 H;  4PD4 E;  3CCM P;  5BU8 B;  2Q9I A;  2QM7 A;  3FWL A;  5AVX B;  2YKP A;  2KB7 P;  3VYI A;  1NU1 J;  5KLI B;  3L73 G;  3TNU A;  1Y47 A;  2WSC J;  5KLI C;  4WY4 D;  3FGA D;  3CCQ P;  3KHU A;  3L71 D;  3GHG B;  3AE9 C;  1GU5 A;  3M0D A;  5KLV K;  1KTM A;  3WU2 E;  4U7J A;  4H13 D;  4U3F E;  3CC4 P;  1SVF A;  3SSU A;  2KSE A;  1EZV I;  1HWT C;  1CZQ A;  3CWB E;  4N3Y B;  4DT0 A;  2Y9Z A;  2L5G B;  3PTZ A;  4D6T E;  1USE A;  2G3A A;  1PP9 D;  1SQP J;  3IAO A;  3TGU D;  3A3Y B;  2QA4 P;  1SQV D;  1EZV E;  3L36 A;  2A45 H;  2FYU G;  4ZMD A;  5KAF H;  5CBN A;  1KQL A;  2AXC A;  3CCS P;  2J59 M;  1YJ9 P;  1BGY E;  2M5A B;  1NTK E;  2N1T A;  3T97 A;  1SQB G;  3H32 A;  4H44 C;  2E75 B;  2HG5 D;  1PPJ G;  2J58 A;  4EYY Q;  3H1I J;  4RJT A;  3BVH A;  1LTT C;  4YXW H;  2C9N Y;  1LP1 B;  4JPZ B;  2PGD A;  3EFF K;  3N4X A;  1EXJ A;  1NU1 E;  1FZG A;  1T2K C;  1K9M Q;  1JOC A;  3W68 A;  4GKG A;  2KNC A;  3AEE C;  2QJY C;  3MUD C;  1KQS O;  1L0L K;  1VQ4 P;  1M1J A;  2FFD A;  2E76 C;  1RE3 C;  3KQG A;  1OZH A;  1GL2 D; 
#chains in the Genus database with same CATH homology
 2ITA A;  2DW3 A;  2NRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...