2DW3A

Solution structure of the rhodobacter sphaeroides pufx membrane protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Intrinsic membrane protein pufX
publication title Solution structure of the Rhodobacter sphaeroides PufX membrane protein: implications for the quinone exchange and protein-protein interactions
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2dw3A01
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH superfamily
3KZIE 2JDIH 3V2RA 5APXA 1FZCA 5CJ4A 1PIXA 2QRXA 1HWTC 1L0LD 2LXBA 3H1LJ 4U7JA 1BDCA 1VQ6P 1JCDA 5K5GB 2AEFA 5CCGC 2N9YB 3VMZA 2O1JA 1KILC 1EZVI 1PV3A 1K73Q 3CWBE 3CX5I 3H1JE 3L74D 3RBZA 5B66H 2ZT9B 1P84I 3WUTA 2H8PD 1OIPA 3CCJP 4C7RA 2Q6QA 3TGUG 2N1TB 3K5BA 1NTZD 2QM7A 1Y47A 4H0LB 1IK9A 2KK7A 5AVWB 4AUWA 1DH3A 5B5EH 1KYOE 1VQOP 5KLVK 1M1KQ 3A0BH 5APQA 3AEEC 1KORA 3H1KJ 4I6MC 4YXDC 4Z1MH 2E43A 4ZKPA 5AVVB 1NTMD 1NOHA 3V5BA 1YTZI 4H13B 5CCGA 4C7NB 1KILA 1AJYA 2W6JH 1KMIZ 4TT3H 2C9NY 1SQBK 4U3FG 1OW7A 2KI7B 1L0ND 1S1CX 3PH0A 1ZP0C 4HYTB 1X8YA 3GW6A 2L91A 2WTYA 2IX7C 3HUSC 4BRYA 3CD6P 1FDOA 1CI6B 1VF5D 1S72P 2AEMA 1L0LK 1IFDA 3SWFA 2BCCE 4I2LC 1JY2P 2R32A 2IDBA 5APSA 1AVYA 1VQPP 4OH8B 2O01H 1SS1A 1KB9E 1HTLC 3M9HA 1XTCC 3AEBC 1SP4A 3HE5A 4AQRD 3RL0C 1YQ4C 1OFCX 3CC4P 2H89C 2FYNB 1BE3E 1WT6A 5BVZA 1QL1A 1BGYG 2D2CC 2E76C 2NZ2A 4HB1A 1N7SD 4EOTA 1NTZK 3H1HG 2GUSA 1NO4A 1YQ3C 2E75C 2QM8A 1Q82Q 4JYCA 3HUSA 3L75J 1ZXGA 2QJPB 4D6TE 1QGKB 2QJYB 1EQ7A 5CMZA 3V4WA 3BVHA 3D70A 2AEJA 2KOGA 1OVUA 3L70E 1L4AC 5GTIH 1NTMK 1N8RQ 4WB4A 1FJPA 1RH5B 4H44B 1MV8A 1CSBA 4N3YB 1URQD 1OXZA 1GL2D 2LR2A 1YJ9P 2K37A 1T3UA 5AVUB 2WT7B 1GZLA 1MZ9A 3VOPA 1HVVA 3RL0g 2IYPA 1NAYA 2FFDC 1L0NK 1GK4A 1PZQA 5B5EE 3CMAP 5TISE 3R4YA 1SQXD 2WVRA 1NWQA 1EDIA 4WWIA 5BU8B 2CPBA 1FZGA 1JNMA 4KJMA 3RK3D 5APUA 1SQVD 5L8RJ 1ZRTD 2M0BA 2O1KA 2K3RA 1EC5A 1L4AA 1DD4A 1SQQD 3H6PA 1M8OB 2K9JA 3VN0A 5KAFH 2WSFH 1MFZA 2YKOA 4EYYQ 1EXIA 3L71G 1H0TA 1SQBG 2FXPA 1SQPD 1K05A 3B71A 2WPSA 1LT9C 3KXDA 3H32A 3HE4B 1KQSO 1WMKA 2FFDA 2V7QH 2L5GB 3PJSK 3B5ND 1FE6A 2J58A 3HTKA 2JWDA 2A45H 3O8ZA 1CW5A 2I1KA 1L0LG 2Z5IA 2IBZD 1SQVE 1OWAA 1SQQE 2WMMA 1WRGA 2NPSC 2W90A 1JMMA 2FYUD 3WUUA 1R5SA 5APYA 4PV1D 1NJIQ 3Q2YA 5APTA 5AW9B 5BU5A 1YYCA 3L74G 1X0TA 1PPJD 1LT9A 1T8ZA 5CJ0A 2H88C 1NTZG 2LKMA 1ZR2A 3G71P 1BCCJ 2WSEJ 3H1IJ 4GOEA 2ZT9D 1T3JA 1G2CA 5C39A 3Q5PA 1AQTA 3BCCJ 1SQXK 1KN7A 1VF5B 3FGAD 4H0LD 1VDFA 3KZIH 4CPGA 2XNDH 4R4MA 1NTMG 5KLIC 1M1JC 2NPSA 2OYHB 1LTJB 1SQVK 1RQUA 2K88A 2B87B 1SQQK 2R5DA 5CBNA 2XDJA 3CLQA 2FKWB 2E5YA 3D71A 1SQPK 3L36A 1L0NG 5KJ7C 1W2BO 1JUNA 2HPCB 1JY3N 2Y9YA 3AE4C 1JM0A 2Z4EA 1N7SB 5CCHC 4LGDE 1FOSE 3H1KE 2KXPB 2QE7H 1ZR4A 1KFMA 2IZ0A 1KYOH 1FBMA 4N78E 1M1JA 2FYZA 1KC8Q 1PP9J 3VP9A 3ZDMA 1DIPA 3A3YB 1GU4A 3LIEA 1IFIA 2FY8A 1NU1J 1SFCD 1RF0C 3HD7C 2XNXA 3L73D 1VQKP 1N73C 1K9MQ 3VYIA 2FBWC 3CXHI 2PAJA 3Q5SA 5KJ7A 1Q81Q 1IJDB 1GDTA 3MGNA 3L72D 1J1DB 5CCHA 5CBOA 4OVNF 1JCCA 2K1AA 5KKZC 4YPCA 2ITAA 1JTHA 1NTKD 3MZWB 3CCMP 3AE6C 4A7PA 3II6A 3TDKA 2Q5UA 2HODB 1AVOA 3O6QB 2RKLA 2I8DA 1OVVA 1LTIC 1RF0A 3HD7A 1DEBA 1S4XA 3M0AA 1N73A 3GMAA 4NPEA 1MKMA 1S3JA 4H44D 1LT1A 2YNYA 1KB9H 3S9OA 1VQLP 2IFMA 4BXLA 3KDPB 4LC1A 1CI6A 3USSA 3CCVP 2KUBA 3B5NB 1SQXG 1YHQP 3CWBD 3H1JD 2ZYGA 3HRNA 1SQVG 5AW5B 3RGUA 1M7LA 1SQQG 4L74A 3QH9A 4EIJA 4Y28J 4RO0A 2KZIA 2O01N 1KYOD 1JEKA 1J1EB 4PV1B 3CI9A 5H2FE 1SQPG 1JB0J 2AXCA 4WY4C 1U57A 3AE8C 3TNUA 1RF1B 2OYIC 1MFTA 3TGUJ 3FWNA 5M1BA 4DT0A 3CCUP 1VQ5P 3M9QA 3P8CE 1UIXA 4AYCA 3CCSP 2IBZG 1USDA 2N9BA 2W8ZA 1NTKK 2KS1A 2FYUG 2OTKE 3FWLA 5TISH 3PLNA 3T97A 1LNQA 1M57D 1JY3P 1M56D 1VQ4P 2WZ7A 1PPJG 1KILE 4L73A 2WPQA 3BRVB 3NTNA 3GLMA 4WY4A 2BCCD 3AEFC 2GM4A 4U3FJ 2KB7P 3KQGA 3AEDC 3N7NA 2E74B 2OYIA 1FDMA 1PGJA 3RBXA 3OAKA 1KB9D 4PD4E 1X9VA 2QA4P 4WVZA 3E1IA 4OGQB 1RHZB 2J59M 2ZJSE 1BE3D 3F5HA 3RK2B 2AXTE 5DJUB 1ZOYC 2JWAA 5AVQB 1Q7YQ 1SFCB 3U1AA 4D6TD 1LWUC 1L2PA 3AE7C 1OMIA 2IBZI 2OYOA 3I5CA 1BCCE 3L70D 3H1IE 5AVZB 3TSIA 5APWA 1AA0A 3IR9A 1BGYJ 3TYYA 2P2UA 3BCCE 2A06E 3H1HJ 3KPEA 1QVFO 5AVXB 1JMBA 1BSNA 2HLOA 2A45G 1IFPA 1USEA 1GTWA 3Q3DA 1VQ9P 4GKGA 3PP5A 1L4AD 2OQQA 4I7ZB 3L73G 1SLQA 1R8EA 1EXJA 3OA7A 2QVAA 1LWUA 2YIUC 4ZKUA 1N7SC 3WUVA 2ZAEB 3V2QA 1FAVA 1XTGB 2QJKC 2PGDA 3L72G 3PRJA 1QL2A 2M5AA 5AW3B 1A02J 5KLVJ 3S1KA 2ZXEB 3EFFK 2WPVB 2XZRA 2Y0EA 1AV1A 2KSEA 1NTKG 1HUCA 2WQYC 1YIJP 2OTJP 5KLVG 1PP9E 1EDKA 2Z5HA 3VMYA 1FU1A 1URQC 1GL2C 1NU1E 3CCLP 1DX7A 4Y99C 3CC7P 1T2KD 2KYVA 1KQGB 1VL2A 3CCEP 1G1JA 3L71J 1SQBJ 5CHXA 1N7SA 1NKZB 1KILB 5KAIE 3CWBJ 1FS0E 3LIDA 1EZVE 1YTZT 2KIKA 1E5WA 3CX5E 1FZBA 2Y0CA 3MUDC 3CWBG 3H1JG 3RK3C 1P84E 1Z56A 5AW8B 1L0LJ 3JC22 1W2EA 1E79H 3LW5J 1EDJA 1OW6A 1SVFA 4BRYB 2WSCJ 1FJKA 1URQA 3JCUE 1GL2A 3C8VA 3H1LD 3V6IA 4ZNCA 3B8EB 1LTBC 3GHGC 3D6YA 3VMXA 4W7ZA 3QWOC 1LGHB 1LTSC 3L74J 1J2JB 1UIIA 2I1JA 1NH4A 2K9YA 2MKVA 3HE5B 1H8AA 1NTZJ 2GUVA 3SFEC 3A0HE 1KFNA 2BASA 2IPPA 2KNCA 3KYQA 2IFNA 3MUDA 3EQ2A 1DD3A 3I56P 1LP1A 1KV4A 3H25A 1J1EC 1GMJA 3E7KA 3HUSB 2ZFCA 3H1LE 1NTMJ 5APVA 1YBKA 1Q90D 5GTHH 3NMDA 3H1KD 4YXWH 3GHGA 2HR3A 2YXQB 2BCCG 3TGUE 4N78D 3TF5A 1W5CE 2ZT9C 3RL0B 4TLFA 5H2FH 1L0NJ 3KHUA 2JP3A 3CC2P 4JF7A 2N1TC 4M3LA 1KYOI 3NXSA 4H0LC 2LXCB 1JY2O 3P32A 2E74D 2D2CB 2E76B 2YO2A 3AE3C 1FOSF 3AECC 2ZYDA 3AE9C 1BE3G 2C9LY 2HYNA 3CCQP 2E75B 1N2DC 2KSJA 2W83C 5AW0B 1M90Q 2R5BA 4OGQD 2KP8A 2P58A 4H13C 4K35A 4D6TG 1L4AB 1RF1A 4R4LA 1QEXA 2PP6A 3WMM0 5AVRB 3RK2D 3L70G 4PJ0E 2ZVNB 1H0TB 5KTBA 1IFJA 1LTTC 1HJBA 2N1TA 3UIAA 2WITA 1U7MA 2QSIA 2M3BA 2FFDB 3V4QA 4LLHA 2H43A 4PD4H 3L75D 2G3AA 5AW6B 4C7NA 1VQ8P 2WWWA 2AXTH 2FXOA 1BGYE 3GF3A 2QG4A 3F89A 3V2NA 2FYNC 3VP8A 2QEXP 1RQVA 4GT1A 2MJZA 1RY3A 1MUUA 1LT9B 1IC2A 1NAFA 4GIFA 3CXHH 1SQXJ 2KLUA 3GG2A 2WSEH 1KTMA 1N7LA 1S2EA 4UB8E 2HFED 2KLVA 3BASA 2QJPC 3L75E 1IO4A 1RE4C 1G2CB 1SQVJ 2QJYC 4I7ZC 2Q1KA 3OJAB 1R5LA 1S5LE 1SFCA 2IYOA 4L76A 1SQQJ 2P1JA 5GTHE 3P8CD 1S5LX 4MN4C 2NPSB 1Q2NA 4C46A 1IZNB 2Q3IA 2JEEA 4H44C 3CMEP 1LJ2A 4UB6E 1RE3C 5E79E 1SQPJ 2O01J 1GD2E 4GOFA 2PFXA 1TU3F 5CCGD 1OX3A 1KILD 2C0WA 3PTZA 2B89A 3M91A 1LTGC 4N6JA 2R3SA 2Y0DA 1RE4A 4HH2A 2FYUJ 2QIWA 1Q86Q 1YJWP 3BATA 3H1LG 4PD4D 3L71E 1SQBE 3GF7A 1QVGO 3C1LA 5KLIB 1M1JB 2DW3A 3BRTB 4IFFA 1RE3A 4DOJA 3FX0A 3SWYA 4NPFX 2WT7A 3IN6A 4XFJA 4HKZH 4IFDK 1NHLA 4GODA 2OARA 4IL6H 3CL3D 3G9RA 1L0LE 2O3JA 4W80A 2J5UA 5KAIH 2ZVOB 3M9BA 4RESB 1S9KD 3CXHD 1VQNP 1BCCD 2P7JA 3H1ID 3M06A 3CX5H 1P84H 1JTHB 1OW8A 1OZHA 2C0XA 3H1KG 3BCCD 2A06D 1HJ0A 3L74E 3EFGA 1IK7A 2YMYA 2WSFJ 3JCUH 1NTZE 3WU2E 3HD7B 2P10A 1N73B 4YTPC 3HE4A 1AQ5A 1S9KE 3M0DC 2V7QJ 3CXHE 3RL0D 3L37A 1AFOA 5DJTB 1NTME 1HH0A 3ABVC 3A0HH 1VF5C 5AW2B 3S4RA 1YI2P 2OTLP 2BEZF 3A2AA 3IFMA 5KKZB 1D7MA 2D2CD 2E76D 4EI2A 2OYHC 5EFWB 1LTJC 4HJGH 1HGZA 2OGUA 1FZCB 1QX8A 2E75D 4ZMDA 2PRRA 3L73J 3MD0A 1PP9D 1H89A 1L0NE 4RJTA 1Y9BA 1FZFA 1FC2C 4OWFA 1NU1D 3MTUE 1HGVA 3L72J 4WBAA 3TNUB 1GK6A 3L35A 1IFNA 2RN0A 1N86A 2WPRA 3M0DA 3IF4A 1VQ7P 2NRGA 1FZEA 4JBZA 1NTKJ 4BWNA 2JO1A 3G4SP 3L75G 1EZVD 2ZXXA 2Q9IA 1HF9A 1PL5A 4QMAA 3CCRP 3SSUA 2OYHA 3CX5D 1Y8AA 4DCKA 1GW3A 1LTJA 2KS1B 1P84D 2B87A 1X79B 3T97B 4L75A 4ASWA 2XU6A 5B66E 3ITKA 1YJNP 3IAOA 1OVRA 1ZMEC 2R44A 3A7OA 2G8YA 2HPCA 4IL6E 4WY4B 3W67A 2BEQD 1JO5A 4IL6X 1J1DC 4PJ0H 2OYIB 3A0BE 4XE5B 2A45I 2JR8A 2YKPA 3H1JJ 3L4FA 1PGOA 1KZUB 3C9IA 1T2KC 2H7HA 3N4XA 1CZQA 2Y9ZA 4IFMA 2R3CA 3EWKA 3AE1C 2YXRB 3U59A 2ZYAA 4I1LA 5AW1B 4O9BA 2RMZA 3MHVA 3OW2O 5AVSB 2NPSD 3G3ZA 1SQXE 4JPZB 1NU1K 1X22A 2VRSA 1ZW0A 1EDLA 3B5NC 1PGQA 3RK3E 1HBWA 1JY3O 2XKMA 1KQFB 1ZRTE 3TGUD 2IZ1A 3VMAA 4EDFA 4JQ0D 4W7YA 4UB8H 2P67A 2HODA 1SQPE 3JSVC 4DZOA 1DEEG 3O6QA 4PV1C 5AW4B 1NVOA 1S5LH 4B86A 2BCCJ 1K8AQ 5AW7B 2B88A 2XV5A 1LWUB 1RF1C 3R2PA 2UWJE 3Q5RA 4UB6H 3MP7B 5E79H 1T6AA 2YMKA 2IBZE 1IFMA 2JKVA 3B4SA 1VQMP 1ZLLA 4U3FD 3B5NA 2M5AB 2N1TD 3Q1MA 1ZN5A 1BCCG 2FYUE 3H1IG 3I55P 3VTPC 2E42A 1BE3J 5KJ7D 5GTIE 3BCCG 2A06G 3CPWO 1KD1Q 1PPJE 5CCHD 1NGMB 2B9BA 1PFIA 4NPDA 5AVYB 4D6TJ 3U1CA 1ZV8A 2FXMA 4H13D 4XA4A 2HG5D 3L70J 3G6EP 3P7KA 2RH0A 2E74C 2YIUB 2KZJA 1KQLA 4U3FE 4PD4I 2K9JB 3SFDC 2QJKB 3SWKA 3E1RA 3HD7D 4DJGA 1BGYD 4OGQC 3AEGC 3H1HD 3H32B 5AVTB 1LTAC 3AE5C 3LW5H 2FYUK 2Q3EA 2WSCH 3RK2C 5KAFE 3AEAC 4K3AA 5TJHA 1U7JA 3HTKB 1URQB 1PP9G 1GL2B 3TK1A 4Y99B 4ASVA 1QLED 1SFCC 3FXEA 1YITP 2V4HA 1VPCA 2CPSA 1NU1G 1KB9I 3AE2C 1FDIA 3FXDA 4GDOA 2Q7CA 1JY2N 3WU2H 2YKQA 3W68A 4KT0J 3H1HE 1H88A 3D6ZA 5KLVD 3A5TA 2KNCB 1FZCC 1EZVG 1FZAA 2E5TA 3RK3B 1LP1B 2JJLA 2SPZA 4KHXA 4RKUJ 3L73E 1JOCA 3PHLA 1BDDA 2POHA 2W6AA 1NKNA 1GW4A 2YO3A 1BSHA 2CK3H 3GHGB 3L72E 2WSSH 2M8RA 1G1IA 2W6BA 3P8MC 4IOIH 1NYHA 3L71D 1SQBD 2GA1A 1A02F 2M3EA 1NTKE 1PGPA 3MIWA 2W27A 5KLVE 3NFQA 1K04A 1GU5A 4JYBA 3V2PA 4WY4D
chains in the Genus database with same CATH topology
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITA A;  2NRG A;  2DW3 A; 
#chains in the Genus database with same CATH topology
 3KZI E;  2JDI H;  3V2R A;  5APX A;  1FZC A;  5CJ4 A;  1PIX A;  2QRX A;  1HWT C;  1L0L D;  2LXB A;  3H1L J;  4U7J A;  1BDC A;  1VQ6 P;  1JCD A;  5K5G B;  2AEF A;  5CCG C;  2N9Y B;  3VMZ A;  2O1J A;  1KIL C;  1EZV I;  1PV3 A;  1K73 Q;  3CWB E;  3CX5 I;  3H1J E;  3L74 D;  3RBZ A;  5B66 H;  2ZT9 B;  1P84 I;  3WUT A;  2H8P D;  1OIP A;  3CCJ P;  4C7R A;  2Q6Q A;  3TGU G;  2N1T B;  3K5B A;  1NTZ D;  2QM7 A;  1Y47 A;  4H0L B;  1IK9 A;  2KK7 A;  5AVW B;  4AUW A;  1DH3 A;  5B5E H;  1KYO E;  1VQO P;  5KLV K;  1M1K Q;  3A0B H;  5APQ A;  3AEE C;  1KOR A;  3H1K J;  4I6M C;  4YXD C;  4Z1M H;  2E43 A;  4ZKP A;  5AVV B;  1NTM D;  1NOH A;  3V5B A;  1YTZ I;  4H13 B;  5CCG A;  4C7N B;  1KIL A;  1AJY A;  2W6J H;  1KMI Z;  4TT3 H;  2C9N Y;  1SQB K;  4U3F G;  1OW7 A;  2KI7 B;  1L0N D;  1S1C X;  3PH0 A;  1ZP0 C;  4HYT B;  1X8Y A;  3GW6 A;  2L91 A;  2WTY A;  2IX7 C;  3HUS C;  4BRY A;  3CD6 P;  1FDO A;  1CI6 B;  1VF5 D;  1S72 P;  2AEM A;  1L0L K;  1IFD A;  3SWF A;  2BCC E;  4I2L C;  1JY2 P;  2R32 A;  2IDB A;  5APS A;  1AVY A;  1VQP P;  4OH8 B;  2O01 H;  1SS1 A;  1KB9 E;  1HTL C;  3M9H A;  1XTC C;  3AEB C;  1SP4 A;  3HE5 A;  4AQR D;  3RL0 C;  1YQ4 C;  1OFC X;  3CC4 P;  2H89 C;  2FYN B;  1BE3 E;  1WT6 A;  5BVZ A;  1QL1 A;  1BGY G;  2D2C C;  2E76 C;  2NZ2 A;  4HB1 A;  1N7S D;  4EOT A;  1NTZ K;  3H1H G;  2GUS A;  1NO4 A;  1YQ3 C;  2E75 C;  2QM8 A;  1Q82 Q;  4JYC A;  3HUS A;  3L75 J;  1ZXG A;  2QJP B;  4D6T E;  1QGK B;  2QJY B;  1EQ7 A;  5CMZ A;  3V4W A;  3BVH A;  3D70 A;  2AEJ A;  2KOG A;  1OVU A;  3L70 E;  1L4A C;  5GTI H;  1NTM K;  1N8R Q;  4WB4 A;  1FJP A;  1RH5 B;  4H44 B;  1MV8 A;  1CSB A;  4N3Y B;  1URQ D;  1OXZ A;  1GL2 D;  2LR2 A;  1YJ9 P;  2K37 A;  1T3U A;  5AVU B;  2WT7 B;  1GZL A;  1MZ9 A;  3VOP A;  1HVV A;  3RL0 g;  2IYP A;  1NAY A;  2FFD C;  1L0N K;  1GK4 A;  1PZQ A;  5B5E E;  3CMA P;  5TIS E;  3R4Y A;  1SQX D;  2WVR A;  1NWQ A;  1EDI A;  4WWI A;  5BU8 B;  2CPB A;  1FZG A;  1JNM A;  4KJM A;  3RK3 D;  5APU A;  1SQV D;  5L8R J;  1ZRT D;  2M0B A;  2O1K A;  2K3R A;  1EC5 A;  1L4A A;  1DD4 A;  1SQQ D;  3H6P A;  1M8O B;  2K9J A;  3VN0 A;  5KAF H;  2WSF H;  1MFZ A;  2YKO A;  4EYY Q;  1EXI A;  3L71 G;  1H0T A;  1SQB G;  2FXP A;  1SQP D;  1K05 A;  3B71 A;  2WPS A;  1LT9 C;  3KXD A;  3H32 A;  3HE4 B;  1KQS O;  1WMK A;  2FFD A;  2V7Q H;  2L5G B;  3PJS K;  3B5N D;  1FE6 A;  2J58 A;  3HTK A;  2JWD A;  2A45 H;  3O8Z A;  1CW5 A;  2I1K A;  1L0L G;  2Z5I A;  2IBZ D;  1SQV E;  1OWA A;  1SQQ E;  2WMM A;  1WRG A;  2NPS C;  2W90 A;  1JMM A;  2FYU D;  3WUU A;  1R5S A;  5APY A;  4PV1 D;  1NJI Q;  3Q2Y A;  5APT A;  5AW9 B;  5BU5 A;  1YYC A;  3L74 G;  1X0T A;  1PPJ D;  1LT9 A;  1T8Z A;  5CJ0 A;  2H88 C;  1NTZ G;  2LKM A;  1ZR2 A;  3G71 P;  1BCC J;  2WSE J;  3H1I J;  4GOE A;  2ZT9 D;  1T3J A;  1G2C A;  5C39 A;  3Q5P A;  1AQT A;  3BCC J;  1SQX K;  1KN7 A;  1VF5 B;  3FGA D;  4H0L D;  1VDF A;  3KZI H;  4CPG A;  2XND H;  4R4M A;  1NTM G;  5KLI C;  1M1J C;  2NPS A;  2OYH B;  1LTJ B;  1SQV K;  1RQU A;  2K88 A;  2B87 B;  1SQQ K;  2R5D A;  5CBN A;  2XDJ A;  3CLQ A;  2FKW B;  2E5Y A;  3D71 A;  1SQP K;  3L36 A;  1L0N G;  5KJ7 C;  1W2B O;  1JUN A;  2HPC B;  1JY3 N;  2Y9Y A;  3AE4 C;  1JM0 A;  2Z4E A;  1N7S B;  5CCH C;  4LGD E;  1FOS E;  3H1K E;  2KXP B;  2QE7 H;  1ZR4 A;  1KFM A;  2IZ0 A;  1KYO H;  1FBM A;  4N78 E;  1M1J A;  2FYZ A;  1KC8 Q;  1PP9 J;  3VP9 A;  3ZDM A;  1DIP A;  3A3Y B;  1GU4 A;  3LIE A;  1IFI A;  2FY8 A;  1NU1 J;  1SFC D;  1RF0 C;  3HD7 C;  2XNX A;  3L73 D;  1VQK P;  1N73 C;  1K9M Q;  3VYI A;  2FBW C;  3CXH I;  2PAJ A;  3Q5S A;  5KJ7 A;  1Q81 Q;  1IJD B;  1GDT A;  3MGN A;  3L72 D;  1J1D B;  5CCH A;  5CBO A;  4OVN F;  1JCC A;  2K1A A;  5KKZ C;  4YPC A;  2ITA A;  1JTH A;  1NTK D;  3MZW B;  3CCM P;  3AE6 C;  4A7P A;  3II6 A;  3TDK A;  2Q5U A;  2HOD B;  1AVO A;  3O6Q B;  2RKL A;  2I8D A;  1OVV A;  1LTI C;  1RF0 A;  3HD7 A;  1DEB A;  1S4X A;  3M0A A;  1N73 A;  3GMA A;  4NPE A;  1MKM A;  1S3J A;  4H44 D;  1LT1 A;  2YNY A;  1KB9 H;  3S9O A;  1VQL P;  2IFM A;  4BXL A;  3KDP B;  4LC1 A;  1CI6 A;  3USS A;  3CCV P;  2KUB A;  3B5N B;  1SQX G;  1YHQ P;  3CWB D;  3H1J D;  2ZYG A;  3HRN A;  1SQV G;  5AW5 B;  3RGU A;  1M7L A;  1SQQ G;  4L74 A;  3QH9 A;  4EIJ A;  4Y28 J;  4RO0 A;  2KZI A;  2O01 N;  1KYO D;  1JEK A;  1J1E B;  4PV1 B;  3CI9 A;  5H2F E;  1SQP G;  1JB0 J;  2AXC A;  4WY4 C;  1U57 A;  3AE8 C;  3TNU A;  1RF1 B;  2OYI C;  1MFT A;  3TGU J;  3FWN A;  5M1B A;  4DT0 A;  3CCU P;  1VQ5 P;  3M9Q A;  3P8C E;  1UIX A;  4AYC A;  3CCS P;  2IBZ G;  1USD A;  2N9B A;  2W8Z A;  1NTK K;  2KS1 A;  2FYU G;  2OTK E;  3FWL A;  5TIS H;  3PLN A;  3T97 A;  1LNQ A;  1M57 D;  1JY3 P;  1M56 D;  1VQ4 P;  2WZ7 A;  1PPJ G;  1KIL E;  4L73 A;  2WPQ A;  3BRV B;  3NTN A;  3GLM A;  4WY4 A;  2BCC D;  3AEF C;  2GM4 A;  4U3F J;  2KB7 P;  3KQG A;  3AED C;  3N7N A;  2E74 B;  2OYI A;  1FDM A;  1PGJ A;  3RBX A;  3OAK A;  1KB9 D;  4PD4 E;  1X9V A;  2QA4 P;  4WVZ A;  3E1I A;  4OGQ B;  1RHZ B;  2J59 M;  2ZJS E;  1BE3 D;  3F5H A;  3RK2 B;  2AXT E;  5DJU B;  1ZOY C;  2JWA A;  5AVQ B;  1Q7Y Q;  1SFC B;  3U1A A;  4D6T D;  1LWU C;  1L2P A;  3AE7 C;  1OMI A;  2IBZ I;  2OYO A;  3I5C A;  1BCC E;  3L70 D;  3H1I E;  5AVZ B;  3TSI A;  5APW A;  1AA0 A;  3IR9 A;  1BGY J;  3TYY A;  2P2U A;  3BCC E;  2A06 E;  3H1H J;  3KPE A;  1QVF O;  5AVX B;  1JMB A;  1BSN A;  2HLO A;  2A45 G;  1IFP A;  1USE A;  1GTW A;  3Q3D A;  1VQ9 P;  4GKG A;  3PP5 A;  1L4A D;  2OQQ A;  4I7Z B;  3L73 G;  1SLQ A;  1R8E A;  1EXJ A;  3OA7 A;  2QVA A;  1LWU A;  2YIU C;  4ZKU A;  1N7S C;  3WUV A;  2ZAE B;  3V2Q A;  1FAV A;  1XTG B;  2QJK C;  2PGD A;  3L72 G;  3PRJ A;  1QL2 A;  2M5A A;  5AW3 B;  1A02 J;  5KLV J;  3S1K A;  2ZXE B;  3EFF K;  2WPV B;  2XZR A;  2Y0E A;  1AV1 A;  2KSE A;  1NTK G;  1HUC A;  2WQY C;  1YIJ P;  2OTJ P;  5KLV G;  1PP9 E;  1EDK A;  2Z5H A;  3VMY A;  1FU1 A;  1URQ C;  1GL2 C;  1NU1 E;  3CCL P;  1DX7 A;  4Y99 C;  3CC7 P;  1T2K D;  2KYV A;  1KQG B;  1VL2 A;  3CCE P;  1G1J A;  3L71 J;  1SQB J;  5CHX A;  1N7S A;  1NKZ B;  1KIL B;  5KAI E;  3CWB J;  1FS0 E;  3LID A;  1EZV E;  1YTZ T;  2KIK A;  1E5W A;  3CX5 E;  1FZB A;  2Y0C A;  3MUD C;  3CWB G;  3H1J G;  3RK3 C;  1P84 E;  1Z56 A;  5AW8 B;  1L0L J;  3JC2 2;  1W2E A;  1E79 H;  3LW5 J;  1EDJ A;  1OW6 A;  1SVF A;  4BRY B;  2WSC J;  1FJK A;  1URQ A;  3JCU E;  1GL2 A;  3C8V A;  3H1L D;  3V6I A;  4ZNC A;  3B8E B;  1LTB C;  3GHG C;  3D6Y A;  3VMX A;  4W7Z A;  3QWO C;  1LGH B;  1LTS C;  3L74 J;  1J2J B;  1UII A;  2I1J A;  1NH4 A;  2K9Y A;  2MKV A;  3HE5 B;  1H8A A;  1NTZ J;  2GUV A;  3SFE C;  3A0H E;  1KFN A;  2BAS A;  2IPP A;  2KNC A;  3KYQ A;  2IFN A;  3MUD A;  3EQ2 A;  1DD3 A;  3I56 P;  1LP1 A;  1KV4 A;  3H25 A;  1J1E C;  1GMJ A;  3E7K A;  3HUS B;  2ZFC A;  3H1L E;  1NTM J;  5APV A;  1YBK A;  1Q90 D;  5GTH H;  3NMD A;  3H1K D;  4YXW H;  3GHG A;  2HR3 A;  2YXQ B;  2BCC G;  3TGU E;  4N78 D;  3TF5 A;  1W5C E;  2ZT9 C;  3RL0 B;  4TLF A;  5H2F H;  1L0N J;  3KHU A;  2JP3 A;  3CC2 P;  4JF7 A;  2N1T C;  4M3L A;  1KYO I;  3NXS A;  4H0L C;  2LXC B;  1JY2 O;  3P32 A;  2E74 D;  2D2C B;  2E76 B;  2YO2 A;  3AE3 C;  1FOS F;  3AEC C;  2ZYD A;  3AE9 C;  1BE3 G;  2C9L Y;  2HYN A;  3CCQ P;  2E75 B;  1N2D C;  2KSJ A;  2W83 C;  5AW0 B;  1M90 Q;  2R5B A;  4OGQ D;  2KP8 A;  2P58 A;  4H13 C;  4K35 A;  4D6T G;  1L4A B;  1RF1 A;  4R4L A;  1QEX A;  2PP6 A;  3WMM 0;  5AVR B;  3RK2 D;  3L70 G;  4PJ0 E;  2ZVN B;  1H0T B;  5KTB A;  1IFJ A;  1LTT C;  1HJB A;  2N1T A;  3UIA A;  2WIT A;  1U7M A;  2QSI A;  2M3B A;  2FFD B;  3V4Q A;  4LLH A;  2H43 A;  4PD4 H;  3L75 D;  2G3A A;  5AW6 B;  4C7N A;  1VQ8 P;  2WWW A;  2AXT H;  2FXO A;  1BGY E;  3GF3 A;  2QG4 A;  3F89 A;  3V2N A;  2FYN C;  3VP8 A;  2QEX P;  1RQV A;  4GT1 A;  2MJZ A;  1RY3 A;  1MUU A;  1LT9 B;  1IC2 A;  1NAF A;  4GIF A;  3CXH H;  1SQX J;  2KLU A;  3GG2 A;  2WSE H;  1KTM A;  1N7L A;  1S2E A;  4UB8 E;  2HFE D;  2KLV A;  3BAS A;  2QJP C;  3L75 E;  1IO4 A;  1RE4 C;  1G2C B;  1SQV J;  2QJY C;  4I7Z C;  2Q1K A;  3OJA B;  1R5L A;  1S5L E;  1SFC A;  2IYO A;  4L76 A;  1SQQ J;  2P1J A;  5GTH E;  3P8C D;  1S5L X;  4MN4 C;  2NPS B;  1Q2N A;  4C46 A;  1IZN B;  2Q3I A;  2JEE A;  4H44 C;  3CME P;  1LJ2 A;  4UB6 E;  1RE3 C;  5E79 E;  1SQP J;  2O01 J;  1GD2 E;  4GOF A;  2PFX A;  1TU3 F;  5CCG D;  1OX3 A;  1KIL D;  2C0W A;  3PTZ A;  2B89 A;  3M91 A;  1LTG C;  4N6J A;  2R3S A;  2Y0D A;  1RE4 A;  4HH2 A;  2FYU J;  2QIW A;  1Q86 Q;  1YJW P;  3BAT A;  3H1L G;  4PD4 D;  3L71 E;  1SQB E;  3GF7 A;  1QVG O;  3C1L A;  5KLI B;  1M1J B;  2DW3 A;  3BRT B;  4IFF A;  1RE3 A;  4DOJ A;  3FX0 A;  3SWY A;  4NPF X;  2WT7 A;  3IN6 A;  4XFJ A;  4HKZ H;  4IFD K;  1NHL A;  4GOD A;  2OAR A;  4IL6 H;  3CL3 D;  3G9R A;  1L0L E;  2O3J A;  4W80 A;  2J5U A;  5KAI H;  2ZVO B;  3M9B A;  4RES B;  1S9K D;  3CXH D;  1VQN P;  1BCC D;  2P7J A;  3H1I D;  3M06 A;  3CX5 H;  1P84 H;  1JTH B;  1OW8 A;  1OZH A;  2C0X A;  3H1K G;  3BCC D;  2A06 D;  1HJ0 A;  3L74 E;  3EFG A;  1IK7 A;  2YMY A;  2WSF J;  3JCU H;  1NTZ E;  3WU2 E;  3HD7 B;  2P10 A;  1N73 B;  4YTP C;  3HE4 A;  1AQ5 A;  1S9K E;  3M0D C;  2V7Q J;  3CXH E;  3RL0 D;  3L37 A;  1AFO A;  5DJT B;  1NTM E;  1HH0 A;  3ABV C;  3A0H H;  1VF5 C;  5AW2 B;  3S4R A;  1YI2 P;  2OTL P;  2BEZ F;  3A2A A;  3IFM A;  5KKZ B;  1D7M A;  2D2C D;  2E76 D;  4EI2 A;  2OYH C;  5EFW B;  1LTJ C;  4HJG H;  1HGZ A;  2OGU A;  1FZC B;  1QX8 A;  2E75 D;  4ZMD A;  2PRR A;  3L73 J;  3MD0 A;  1PP9 D;  1H89 A;  1L0N E;  4RJT A;  1Y9B A;  1FZF A;  1FC2 C;  4OWF A;  1NU1 D;  3MTU E;  1HGV A;  3L72 J;  4WBA A;  3TNU B;  1GK6 A;  3L35 A;  1IFN A;  2RN0 A;  1N86 A;  2WPR A;  3M0D A;  3IF4 A;  1VQ7 P;  2NRG A;  1FZE A;  4JBZ A;  1NTK J;  4BWN A;  2JO1 A;  3G4S P;  3L75 G;  1EZV D;  2ZXX A;  2Q9I A;  1HF9 A;  1PL5 A;  4QMA A;  3CCR P;  3SSU A;  2OYH A;  3CX5 D;  1Y8A A;  4DCK A;  1GW3 A;  1LTJ A;  2KS1 B;  1P84 D;  2B87 A;  1X79 B;  3T97 B;  4L75 A;  4ASW A;  2XU6 A;  5B66 E;  3ITK A;  1YJN P;  3IAO A;  1OVR A;  1ZME C;  2R44 A;  3A7O A;  2G8Y A;  2HPC A;  4IL6 E;  4WY4 B;  3W67 A;  2BEQ D;  1JO5 A;  4IL6 X;  1J1D C;  4PJ0 H;  2OYI B;  3A0B E;  4XE5 B;  2A45 I;  2JR8 A;  2YKP A;  3H1J J;  3L4F A;  1PGO A;  1KZU B;  3C9I A;  1T2K C;  2H7H A;  3N4X A;  1CZQ A;  2Y9Z A;  4IFM A;  2R3C A;  3EWK A;  3AE1 C;  2YXR B;  3U59 A;  2ZYA A;  4I1L A;  5AW1 B;  4O9B A;  2RMZ A;  3MHV A;  3OW2 O;  5AVS B;  2NPS D;  3G3Z A;  1SQX E;  4JPZ B;  1NU1 K;  1X22 A;  2VRS A;  1ZW0 A;  1EDL A;  3B5N C;  1PGQ A;  3RK3 E;  1HBW A;  1JY3 O;  2XKM A;  1KQF B;  1ZRT E;  3TGU D;  2IZ1 A;  3VMA A;  4EDF A;  4JQ0 D;  4W7Y A;  4UB8 H;  2P67 A;  2HOD A;  1SQP E;  3JSV C;  4DZO A;  1DEE G;  3O6Q A;  4PV1 C;  5AW4 B;  1NVO A;  1S5L H;  4B86 A;  2BCC J;  1K8A Q;  5AW7 B;  2B88 A;  2XV5 A;  1LWU B;  1RF1 C;  3R2P A;  2UWJ E;  3Q5R A;  4UB6 H;  3MP7 B;  5E79 H;  1T6A A;  2YMK A;  2IBZ E;  1IFM A;  2JKV A;  3B4S A;  1VQM P;  1ZLL A;  4U3F D;  3B5N A;  2M5A B;  2N1T D;  3Q1M A;  1ZN5 A;  1BCC G;  2FYU E;  3H1I G;  3I55 P;  3VTP C;  2E42 A;  1BE3 J;  5KJ7 D;  5GTI E;  3BCC G;  2A06 G;  3CPW O;  1KD1 Q;  1PPJ E;  5CCH D;  1NGM B;  2B9B A;  1PFI A;  4NPD A;  5AVY B;  4D6T J;  3U1C A;  1ZV8 A;  2FXM A;  4H13 D;  4XA4 A;  2HG5 D;  3L70 J;  3G6E P;  3P7K A;  2RH0 A;  2E74 C;  2YIU B;  2KZJ A;  1KQL A;  4U3F E;  4PD4 I;  2K9J B;  3SFD C;  2QJK B;  3SWK A;  3E1R A;  3HD7 D;  4DJG A;  1BGY D;  4OGQ C;  3AEG C;  3H1H D;  3H32 B;  5AVT B;  1LTA C;  3AE5 C;  3LW5 H;  2FYU K;  2Q3E A;  2WSC H;  3RK2 C;  5KAF E;  3AEA C;  4K3A A;  5TJH A;  1U7J A;  3HTK B;  1URQ B;  1PP9 G;  1GL2 B;  3TK1 A;  4Y99 B;  4ASV A;  1QLE D;  1SFC C;  3FXE A;  1YIT P;  2V4H A;  1VPC A;  2CPS A;  1NU1 G;  1KB9 I;  3AE2 C;  1FDI A;  3FXD A;  4GDO A;  2Q7C A;  1JY2 N;  3WU2 H;  2YKQ A;  3W68 A;  4KT0 J;  3H1H E;  1H88 A;  3D6Z A;  5KLV D;  3A5T A;  2KNC B;  1FZC C;  1EZV G;  1FZA A;  2E5T A;  3RK3 B;  1LP1 B;  2JJL A;  2SPZ A;  4KHX A;  4RKU J;  3L73 E;  1JOC A;  3PHL A;  1BDD A;  2POH A;  2W6A A;  1NKN A;  1GW4 A;  2YO3 A;  1BSH A;  2CK3 H;  3GHG B;  3L72 E;  2WSS H;  2M8R A;  1G1I A;  2W6B A;  3P8M C;  4IOI H;  1NYH A;  3L71 D;  1SQB D;  2GA1 A;  1A02 F;  2M3E A;  1NTK E;  1PGP A;  3MIW A;  2W27 A;  5KLV E;  3NFQ A;  1K04 A;  1GU5 A;  4JYB A;  3V2P A;  4WY4 D; 
#chains in the Genus database with same CATH homology
 2ITA A;  2NRG A;  2DW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...