2DW3A

Solution structure of the rhodobacter sphaeroides pufx membrane protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Rhodobacter sphaeroides PufX membrane protein: implications for the quinone exchange and protein-protein interactions
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis
molecule keywords Intrinsic membrane protein pufX
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2dw3A01
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH superfamily
3S4RA 2MJZA 1N7SC 2QJYC 3H32B 5AVQB 1EXJA 2ZT9D 4AQRD 1WMKA 1SQXG 2E5YA 1IJDB 3BASA 5APTA 1URQD 1LTJA 2KNCA 3CXHE 1JB0J 3L74E 3L37A 1FJKA 5KAIH 3USSA 5CCGC 2OYOA 2QG4A 4I2LC 1T6AA 1L0LK 3FXEA 3RK3C 3AE8C 3L35A 5AW4B 3Q2YA 3CCSP 2B87A 2FYUE 3L75G 1BCCE 1LT9B 1S5LX 4EI2A 1L0NE 1YQ4C 2Q6QA 3GLMA 5CBNA 2W83C 3HD7A 1YI2P 1KQLA 2WPSA 4MN4C 1K9MQ 1GZLA 1RY3A 1ZN5A 2K9JA 2ZT9C 4PD4D 1DD4A 1E79H 1S5LH 3CCJP 3GHGB 1FC2C 1N7SA 5TJHA 1YYCA 1U7MA 1LWUA 3TNUA 1X79B 3U59A 2WPVB 2Q9IA 1SQXJ 2E75D 3AE9C 1QVFO 2IBZI 1VQLP 2WSCH 1RH5B 2PAJA 3GF7A 1L2PA 1SQBD 5CCGA 2NPSB 2H7HA 2CPSA 4A7PA 3N4XA 5AVZB 3I56P 3FGAD 1SQQJ 3V2RA 3AEAC 2OTLP 1L0LG 1YQ3C 1NTZE 1PPJE 1VQOP 3L71E 3TGUE 1CI6B 1PP9J 1N73B 1LTSC 1X9VA 4JF7A 2YKOA 3TF5A 1RF1A 2J59M 3CX5H 2IFNA 1VQNP 5APUA 1BE3G 2LXCB 3KZIE 5AW8B 1RQVA 1URQB 1PFIA 1SQBK 1NKZB 5APWA 2K9JB 4HH2A 1NGMB 3W67A 1NH4A 3CWBJ 2C0WA 2FYNC 1OMIA 1GL2A 1U7JA 3GHGA 3H1HE 1DEEG 5AW9B 1DEBA 4DCKA 4EYYQ 5AW7B 1HGVA 3S9OA 4ZKPA 3PLNA 4GDOA 1AJYA 4UB6H 1CW5A 1Q86Q 4XE5B 4AUWA 2XNDH 5AW1B 1YITP 1S9KD 1FZGA 1LT9C 3VYIA 3H1IJ 3P8CD 1KILB 3AE6C 2H43A 2P10A 2WPRA 3OAKA 2E42A 1RQUA 2KI7B 4IL6E 3CC4P 3PJSK 1Y8AA 3W68A 3E1IA 3CCVP 1Q81Q 2N1TC 1IFNA 4GKGA 1URQC 5KAFE 3I55P 1OW6A 5TISH 1PGJA 1EC5A 1PP9G 3CI9A 4TT3H 1KB9I 1KILA 1A02F 2O01J 2AEFA 2IBZG 2M8RA 3LIDA 1OX3A 2YO2A 3BRTB 2NPSC 3IFMA 2OYIA 3TDKA 4K3AA 1IFPA 4BXLA 4IFDK 4JYBA 3CCRP 1EDJA 1P84H 1VQMP 2FY8A 4D6TD 5DJTB 1YJWP 3H1IE 1GL2B 1T3JA 1YTZI 3EFFK 3KYQA 2V4HA 4IL6H 1FOSF 1JUNA 2E75B 2JDIH 3Q5PA 5AVVB 4L76A 1Q2NA 2WPQA 1N2DC 3BRVB 4Y28J 1GD2E 3B5NC 2VRSA 1URQA 3GW6A 1SQXD 2H8PD 2N1TB 4U3FE 1P84I 3H6PA 3C1LA 3P7KA 3RK2C 1SFCA 3L72E 2QJKB 3ABVC 3O8ZA 3M9QA 3H25A 1GU4A 2HFED 3H1LJ 3HE4A 1RE4C 2FXOA 5AVXB 2OYIC 1HF9A 5AVRB 4WVZA 1YIJP 3L75J 2AXCA 2I1JA 1JEKA 1KMIZ 1NTME 5CJ4A 3G9RA 2E74C 1P84D 3AEEC 4PV1D 5AVWB 3T97A 3IR9A 3P8CE 1NTZJ 3CX5E 5CBOA 2FYNB 1SQVG 2K37A 2WVRA 1FAVA 3CLQA 5KJ7D 5KJ7A 1SQVK 2H88C 1R5LA 2WQYC 1FZCB 2HPCA 1SQPE 3M06A 2N9YB 1EDKA 4BRYA 2SPZA 4NPEA 5CCHA 1RF1B 2N1TD 2OGUA 2KSEA 3V4QA 1KB9E 2QEXP 2KK7A 1SQXE 4U3FD 3VN0A 3SSUA 1G1JA 1N73C 3CXHI 5KLIB 5TISE 2FFDC 2FYZA 3L72D 5BVZA 1RE3A 1KQSO 1NHLA 1NU1E 1MFTA 1RF0A 3A0BH 3L70E 1VQ9P 3H1ID 2KOGA 4O9BA 1J1DB 3KHUA 3B4SA 3VP8A 1AVOA 1T8ZA 4BWNA 2NPSA 1N8RQ 5APQA 5KJ7C 1FJPA 3A0BE 2JJLA 2RN0A 1JM0A 4I7ZB 1L0NG 1MZ9A 4LC1A 4I6MC 1HVVA 2HR3A 1OIPA 4GOEA 1M1JB 3H32A 2BCCE 2P58A 1ZMEC 3G4SP 2DW3A 3RK2D 1E5WA 3L74J 3OJAB 2OTJP 3H1KJ 1S4XA 3IAOA 1T2KD 3PH0A 4DJGA 1SFCC 1KQFB 5KKZB 1IFJA 1ZLLA 2P1JA 1QL1A 2IYPA 3A2AA 5H2FH 3VMAA 2B87B 2G8YA 4D6TJ 1PP9D 2ZVOB 1RE4A 4PV1B 3FXDA 1JY2O 1VF5C 2R3CA 1J1EC 3L70J 2HODB 5KLVJ 2WWWA 5H2FE 2A06G 1SQQD 3ITKA 3R4YA 1KYOD 4I1LA 4PD4I 5AW2B 4EOTA 2OYIB 1S5LE 1HWTC 3TYYA 4L75A 1EZVG 1LP1A 1LTJB 4JQ0D 1FE6A 2O01N 4OGQC 3Q5RA 1GTWA 2Q5UA 4DT0A 3LIEA 3AEFC 2WT7A 2WT7B 1BGYG 1FDIA 3CC2P 2ZJSE 1NVOA 1YTZT 2K88A 1H8AA 4L73A 1FU1A 3AECC 5AW6B 1YBKA 3B5ND 1YJNP 4XFJA 1PGQA 1M8OB 1SQBE 1HJBA 3JSVC 3CCEP 4C7NB 1OFCX 4WBAA 2YIUC 2IX7C 1SQQK 1PL5A 2LXBA 2P7JA 3AEDC 4NPFX 4Z1MH 2YNYA 1JTHB 1OW7A 3G6EP 5KLVE 1N7LA 2FFDA 3T97B 2R44A 1ZR2A 3VP9A 1VQPP 4Y99C 2O01H 2QM8A 3RBXA 2PFXA 4EDFA 3KQGA 4N78E 1IFMA 2Q1KA 1VPCA 1X0TA 1L0ND 3SFEC 1L4AC 3PHLA 3UIAA 1FZCA 1OVUA 1KV4A 2BCCJ 4HJGH 2BCCD 2H89C 2JR8A 5CMZA 4BRYB 5KAIE 3PTZA 1KQGB 2FBWC 3H1HD 5B5EH 2W6AA 1BSHA 3E7KA 2P67A 2WSFH 3U1AA 3CCMP 1G2CA 1QEXA 1H0TA 4IL6X 3SWKA 2FYUK 3L73G 1DD3A 4N6JA 1BDDA 4YTPC 1L0NK 4H44B 3NMDA 1Q90D 1SQBJ 3L73D 1SFCB 2AXTH 1SLQA 2D2CB 3O6QB 5E79E 2I8DA 2XNXA 3B5NB 1X22A 3MD0A 3N7NA 3WU2E 5KAFH 2KNCB 1Q82Q 1BGYD 3AE4C 2LKMA 2IYOA 2M3BA 2QSIA 2OARA 3L4FA 4N78D 3RGUA 2YMYA 2ZYDA 1FOSE 1S1CX 3PRJA 3L72G 4JYCA 1DIPA 2M3EA 3BCCJ 1HH0A 2M5AA 2Q3EA 1BDCA 3HRNA 3KXDA 5AVSB 2IPPA 2W6BA 2YXRB 1OVRA 1KFNA 3HTKA 3CCQP 1BCCJ 4UB8H 5AVTB 1QL2A 1QGKB 3H1HJ 1NTMG 4OGQD 2RKLA 4ASVA 2AXTE 5GTHH 3AE3C 4PD4E 4YXWH 3CX5I 2Y0CA 2M5AB 2A06D 3H1LE 3L74D 1SQVE 2ITAA 1FDOA 1N86A 4HKZH 4OH8B 5CCHD 1JNMA 1MKMA 2W8ZA 1KILC 3L36A 1Q7YQ 2ZYAA 2E74B 1UIIA 3NXSA 1SQPG 1LTJC 1OXZA 1QLED 2HYNA 3A3YB 4IFMA 3SFDC 3L71J 3TGUJ 1AFOA 2WSEJ 4YXDC 2W27A 1ZRTD 4W80A 3CCLP 1LNQA 1J1EB 3OA7A 1NYHA 3GHGC 1NTZK 3PP5A 3RK3B 4ZKUA 1VQKP 1JMBA 1NU1G 2QJKC 4U7JA 3MGNA 3V6IA 3K5BA 5K5GB 4PD4H 3L71D 2BEQD 1SP4A 3TGUD 2Z5IA 4DOJA 1DX7A 1EDLA 3VMYA 2FXMA 2PRRA 2CK3H 1NWQA 5AVYB 4CPGA 3A0HH 1SQPJ 1QX8A 3I5CA 4U3FG 1GL2C 1NTKG 3H1JJ 2Y9YA 1LWUC 4NPDA 4QMAA 3RK2B 3V5BA 1BSNA 1N73A 3Q5SA 4KHXA 1KFMA 3D70A 2O1KA 3CMEP 4EIJA 4ZNCA 2E76B 2B89A 2N9BA 3IF4A 1S3JA 1KORA 1PGPA 2MKVA 2R3SA 1NTZD 1PPJD 2QJPB 3QH9A 4H44D 3RL0B 2QIWA 2QJYB 2FYUJ 1NTMJ 1UIXA 2PP6A 4IFFA 2LR2A 1ZOYC 5BU5A 1MUUA 2R5DA 3H1KE 2QE7H 1HGZA 2V7QH 1NAYA 1JMMA 2KZIA 3BCCD 4RO0A 1JY2N 1SQVD 3HE4B 2KLUA 3TSIA 3VMXA 2HPCB 4H0LD 2A06E 2GA1A 3H1LD 2C9NY 3BCCG 2L5GB 3CWBE 3WUVA 2A45H 1FZAA 1LTIC 2KIKA 2R5BA 2GUVA 3CX5D 3LW5J 3NFQA 3R2PA 3KZIH 3B8EB 3CD6P 1RHZB 4OWFA 1LWUB 2CPBA 2E5TA 2M0BA 1NKNA 2OYHC 1T3UA 5B5EE 1GK6A 3A5TA 3G3ZA 1ZP0C 4OGQB 1GW4A 3D6YA 1FZEA 1LT1A 3RK3D 1KB9D 1LP1B 1SQBG 2ZAEB 2GM4A 2UWJE 3CPWO 2YKPA 2ZVNB 3RL0D 1W2BO 5KLVD 1SQQE 1ZW0A 3ZDMA 1AA0A 1LT9A 4PJ0E 3IN6A 1W5CE 1IFDA 1VQ5P 1NU1D 2IZ1A 2JO1A 4W7ZA 1VQ7P 2ZXEB 3HTKB 1QVGO 1OZHA 1PIXA 2E74D 5KKZC 3AE7C 2Y0EA 4XA4A 1N7SB 3V2PA 2Z5HA 1VDFA 1KZUB 1L4AB 2A45G 2OYHA 3CC7P 3KPEA 4YPCA 2BCCG 5BU8B 3SWFA 2XZRA 2W90A 2ZXXA 4ASWA 1KILD 2O1JA 4D6TE 2QJPC 3RL0C 3O6QA 2B88A 1USDA 2YO3A 3VOPA 3WUUA 3JCUH 1KB9H 2FYUG 1NU1K 1NTKK 2WSSH 3RL0g 3V2NA 1AQ5A 1GMJA 4GIFA 1JY2P 2XKMA 3RK3E 5AW3B 2POHA 5B66E 1VL2A 1ZXGA 2YKQA 3OW2O 1MFZA 3L73E 1U57A 3V2QA 4W7YA 3HD7C 3H1JG 1NTKJ 3F89A 4U3FJ 3SWYA 3MUDA 5B66H 3B5NA 1G1IA 1BGYE 3AE2C 1N7SD 3C8VA 2C9LY 1CSBA 1RE3C 3Q1MA 1VQ6P 1X8YA 3LW5H 4GT1A 3WUTA 4LGDE 2KLVA 1GL2D 4M3LA 1NTKD 2IFMA 2ZT9B 1NU1J 1SS1A 1XTGB 2KYVA 3HE5B 5EFWB 2D2CC 2KXPB 1LTGC 1JY3N 2B9BA 3QWOC 3L70D 2L91A 4UB8E 5GTIH 1SFCD 1NOHA 1VF5D 1FZBA 1GK4A 2KSJA 2KS1B 1L0LE 3II6A 4HB1A 5KLVG 2QA4P 1M90Q 1PZQA 3L71G 2Y0DA 5AW5B 1WT6A 3TGUG 1FDMA 4H0LC 4HYTB 1JTHA 1G2CB 1Y9BA 2Q3IA 1R5SA 3HE5A 1BE3E 1L4AD 3AE5C 3TNUB 2WZ7A 4WY4C 1IZNB 3L74G 4H13B 4LLHA 2FKWB 1KTMA 2D2CD 1Z56A 3H1HG 2XU6A 2E75C 3L75E 1K05A 1BCCG 5KTBA 2JEEA 2P2UA 2WTYA 1JCDA 3GG2A 1LTTC 2JWDA 3MP7B 1LJ2A 1J1DC 1S9KE 2YXQB 1KC8Q 2NZ2A 2FYUD 4B86A 2AEMA 3NTNA 5APVA 3AEBC 1YJ9P 1LGHB 3L72J 3BVHA 1M56D 5AW0B 5KLIC 2FFDB 1OW8A 1CZQA 2K9YA 2WSEH 5GTHE 2YIUB 2I1KA 2WSFJ 2E43A 1NJIQ 3MHVA 2KUBA 4H13C 1M57D 1SQPD 4WY4B 3WU2H 2GUSA 3KDPB 5CJ0A 1TU3F 1IFIA 1JY3O 1PP9E 3E1RA 3M0DA 3P8MC 4DZOA 1M7LA 1NTKE 4C7RA 2ZFCA 1IO4A 1JY3P 2IBZD 3L73J 1M1KQ 1VF5B 1FBMA 1W2EA 2V7QJ 4PV1C 4RESB 2NPSD 1SQVJ 4R4LA 1NTZG 1PPJG 3EFGA 3EQ2A 3EWKA 1OVVA 3M0AA 1KYOH 4N3YB 4C7NA 3L75D 3FX0A 1R8EA 2WITA 1PV3A 2BEZF 3JCUE 3V4WA 3HD7D 1JCCA 2K1AA 1AVYA 1BE3D 1SQPK 4H13D 4JPZB 3CWBD 4WWIA 5CHXA 3VMZA 4WB4A 3VTPC 2Y9ZA 2JP3A 3H1LG 4JBZA 1AQTA 1KYOI 1D7MA 1SQXK 1JO5A 1S72P 1EQ7A 1GW3A 2OQQA 3CL3D 3RBZA 1H89A 1JOCA 3H1JD 2XDJA 4WY4A 3M0DC 3F5HA 3FWNA 2HODA 3A7OA 1GDTA 3CXHH 2RH0A 4Y99B 2HLOA 1LTAC 4TLFA 4KJMA 1CI6A 3AE1C 2G3AA 2HG5D 4OVNF 3D6ZA 1GU5A 1PGOA 1K73Q 1USEA 3S1KA 1H0TB 2A45I 4AYCA 1MV8A 2E76D 2AEJA 1ZRTE 4K35A 2OTKE 4UB6E 1YHQP 2KZJA 3B71A 2J58A 1EZVI 2R32A 2K3RA 1M1JA 4L74A 2ZYGA 2KP8A 1EZVD 4WY4D 4C46A 1FZCC 1K04A 3WMM0 3Q3DA 1K8AQ 1BGYJ 5DJUB 2YMKA 3HUSA 3HUSB 1KD1Q 3MUDC 2IBZE 1LTBC 4H0LB 5CCHC 3U1CA 1AV1A 1SVFA 5CCGD 1IK7A 2KB7P 3P32A 5APXA 3TK1A 4H44C 3CMAP 4GODA 1KILE 1Y47A 1HJ0A 2IDBA 2J5UA 2W6JH 3CXHD 3L70G 3BATA 3CCUP 5GTIE 3H1IG 1IC2A 4PJ0H 1OWAA 4D6TG 2C0XA 3JC22 1NTMD 1RF0C 1S2EA 3MIWA 1BCCD 3D71A 2QVAA 2XV5A 1M1JC 2WMMA 3H1KG 2JKVA 1DH3A 4ZMDA 1ZV8A 2WSCJ 5E79H 3FWLA 1IK9A 1J2JB 5APYA 3H1KD 5APSA 3BCCE 3CWBG 4I7ZC 2JWAA 2N1TA 2Q7CA 5AVUB 3MZWB 3HUSC 2IZ0A 1H88A 5L8RJ 3GF3A 1EDIA 3H1JE 3M91A 1L0NJ 4GOFA 4RJTA 5C39A 3AEGC 1EXIA 5M1BA 3M9BA 1L4AA 2RMZA 4RKUJ 2OYHB 3A0HE 1BE3J 1T2KC 3C9IA 3GMAA 1ZR4A 2KS1A 3G71P 1HUCA 1NAFA 1FS0E 1NTMK 3HD7B 1KYOE 3M9HA 1NO4A 1XTCC 1WRGA 2O3JA 3MTUE 5KLVK 4IOIH 2QRXA 4KT0J 1VQ4P 1HTLC 1L0LJ 1VQ8P 2NRGA 1P84E 1L0LD 2FXPA 1FZFA 1SQQG 2QM7A 1RF1C 1EZVE 2BASA 2PGDA 2E76C 4R4MA 2Z4EA 1KN7A 1HBWA 1A02J
chains in the Genus database with same CATH topology
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITA A;  2NRG A;  2DW3 A; 
#chains in the Genus database with same CATH topology
 3S4R A;  2MJZ A;  1N7S C;  2QJY C;  3H32 B;  5AVQ B;  1EXJ A;  2ZT9 D;  4AQR D;  1WMK A;  1SQX G;  2E5Y A;  1IJD B;  3BAS A;  5APT A;  1URQ D;  1LTJ A;  2KNC A;  3CXH E;  1JB0 J;  3L74 E;  3L37 A;  1FJK A;  5KAI H;  3USS A;  5CCG C;  2OYO A;  2QG4 A;  4I2L C;  1T6A A;  1L0L K;  3FXE A;  3RK3 C;  3AE8 C;  3L35 A;  5AW4 B;  3Q2Y A;  3CCS P;  2B87 A;  2FYU E;  3L75 G;  1BCC E;  1LT9 B;  1S5L X;  4EI2 A;  1L0N E;  1YQ4 C;  2Q6Q A;  3GLM A;  5CBN A;  2W83 C;  3HD7 A;  1YI2 P;  1KQL A;  2WPS A;  4MN4 C;  1K9M Q;  1GZL A;  1RY3 A;  1ZN5 A;  2K9J A;  2ZT9 C;  4PD4 D;  1DD4 A;  1E79 H;  1S5L H;  3CCJ P;  3GHG B;  1FC2 C;  1N7S A;  5TJH A;  1YYC A;  1U7M A;  1LWU A;  3TNU A;  1X79 B;  3U59 A;  2WPV B;  2Q9I A;  1SQX J;  2E75 D;  3AE9 C;  1QVF O;  2IBZ I;  1VQL P;  2WSC H;  1RH5 B;  2PAJ A;  3GF7 A;  1L2P A;  1SQB D;  5CCG A;  2NPS B;  2H7H A;  2CPS A;  4A7P A;  3N4X A;  5AVZ B;  3I56 P;  3FGA D;  1SQQ J;  3V2R A;  3AEA C;  2OTL P;  1L0L G;  1YQ3 C;  1NTZ E;  1PPJ E;  1VQO P;  3L71 E;  3TGU E;  1CI6 B;  1PP9 J;  1N73 B;  1LTS C;  1X9V A;  4JF7 A;  2YKO A;  3TF5 A;  1RF1 A;  2J59 M;  3CX5 H;  2IFN A;  1VQN P;  5APU A;  1BE3 G;  2LXC B;  3KZI E;  5AW8 B;  1RQV A;  1URQ B;  1PFI A;  1SQB K;  1NKZ B;  5APW A;  2K9J B;  4HH2 A;  1NGM B;  3W67 A;  1NH4 A;  3CWB J;  2C0W A;  2FYN C;  1OMI A;  1GL2 A;  1U7J A;  3GHG A;  3H1H E;  1DEE G;  5AW9 B;  1DEB A;  4DCK A;  4EYY Q;  5AW7 B;  1HGV A;  3S9O A;  4ZKP A;  3PLN A;  4GDO A;  1AJY A;  4UB6 H;  1CW5 A;  1Q86 Q;  4XE5 B;  4AUW A;  2XND H;  5AW1 B;  1YIT P;  1S9K D;  1FZG A;  1LT9 C;  3VYI A;  3H1I J;  3P8C D;  1KIL B;  3AE6 C;  2H43 A;  2P10 A;  2WPR A;  3OAK A;  2E42 A;  1RQU A;  2KI7 B;  4IL6 E;  3CC4 P;  3PJS K;  1Y8A A;  3W68 A;  3E1I A;  3CCV P;  1Q81 Q;  2N1T C;  1IFN A;  4GKG A;  1URQ C;  5KAF E;  3I55 P;  1OW6 A;  5TIS H;  1PGJ A;  1EC5 A;  1PP9 G;  3CI9 A;  4TT3 H;  1KB9 I;  1KIL A;  1A02 F;  2O01 J;  2AEF A;  2IBZ G;  2M8R A;  3LID A;  1OX3 A;  2YO2 A;  3BRT B;  2NPS C;  3IFM A;  2OYI A;  3TDK A;  4K3A A;  1IFP A;  4BXL A;  4IFD K;  4JYB A;  3CCR P;  1EDJ A;  1P84 H;  1VQM P;  2FY8 A;  4D6T D;  5DJT B;  1YJW P;  3H1I E;  1GL2 B;  1T3J A;  1YTZ I;  3EFF K;  3KYQ A;  2V4H A;  4IL6 H;  1FOS F;  1JUN A;  2E75 B;  2JDI H;  3Q5P A;  5AVV B;  4L76 A;  1Q2N A;  2WPQ A;  1N2D C;  3BRV B;  4Y28 J;  1GD2 E;  3B5N C;  2VRS A;  1URQ A;  3GW6 A;  1SQX D;  2H8P D;  2N1T B;  4U3F E;  1P84 I;  3H6P A;  3C1L A;  3P7K A;  3RK2 C;  1SFC A;  3L72 E;  2QJK B;  3ABV C;  3O8Z A;  3M9Q A;  3H25 A;  1GU4 A;  2HFE D;  3H1L J;  3HE4 A;  1RE4 C;  2FXO A;  5AVX B;  2OYI C;  1HF9 A;  5AVR B;  4WVZ A;  1YIJ P;  3L75 J;  2AXC A;  2I1J A;  1JEK A;  1KMI Z;  1NTM E;  5CJ4 A;  3G9R A;  2E74 C;  1P84 D;  3AEE C;  4PV1 D;  5AVW B;  3T97 A;  3IR9 A;  3P8C E;  1NTZ J;  3CX5 E;  5CBO A;  2FYN B;  1SQV G;  2K37 A;  2WVR A;  1FAV A;  3CLQ A;  5KJ7 D;  5KJ7 A;  1SQV K;  2H88 C;  1R5L A;  2WQY C;  1FZC B;  2HPC A;  1SQP E;  3M06 A;  2N9Y B;  1EDK A;  4BRY A;  2SPZ A;  4NPE A;  5CCH A;  1RF1 B;  2N1T D;  2OGU A;  2KSE A;  3V4Q A;  1KB9 E;  2QEX P;  2KK7 A;  1SQX E;  4U3F D;  3VN0 A;  3SSU A;  1G1J A;  1N73 C;  3CXH I;  5KLI B;  5TIS E;  2FFD C;  2FYZ A;  3L72 D;  5BVZ A;  1RE3 A;  1KQS O;  1NHL A;  1NU1 E;  1MFT A;  1RF0 A;  3A0B H;  3L70 E;  1VQ9 P;  3H1I D;  2KOG A;  4O9B A;  1J1D B;  3KHU A;  3B4S A;  3VP8 A;  1AVO A;  1T8Z A;  4BWN A;  2NPS A;  1N8R Q;  5APQ A;  5KJ7 C;  1FJP A;  3A0B E;  2JJL A;  2RN0 A;  1JM0 A;  4I7Z B;  1L0N G;  1MZ9 A;  4LC1 A;  4I6M C;  1HVV A;  2HR3 A;  1OIP A;  4GOE A;  1M1J B;  3H32 A;  2BCC E;  2P58 A;  1ZME C;  3G4S P;  2DW3 A;  3RK2 D;  1E5W A;  3L74 J;  3OJA B;  2OTJ P;  3H1K J;  1S4X A;  3IAO A;  1T2K D;  3PH0 A;  4DJG A;  1SFC C;  1KQF B;  5KKZ B;  1IFJ A;  1ZLL A;  2P1J A;  1QL1 A;  2IYP A;  3A2A A;  5H2F H;  3VMA A;  2B87 B;  2G8Y A;  4D6T J;  1PP9 D;  2ZVO B;  1RE4 A;  4PV1 B;  3FXD A;  1JY2 O;  1VF5 C;  2R3C A;  1J1E C;  3L70 J;  2HOD B;  5KLV J;  2WWW A;  5H2F E;  2A06 G;  1SQQ D;  3ITK A;  3R4Y A;  1KYO D;  4I1L A;  4PD4 I;  5AW2 B;  4EOT A;  2OYI B;  1S5L E;  1HWT C;  3TYY A;  4L75 A;  1EZV G;  1LP1 A;  1LTJ B;  4JQ0 D;  1FE6 A;  2O01 N;  4OGQ C;  3Q5R A;  1GTW A;  2Q5U A;  4DT0 A;  3LIE A;  3AEF C;  2WT7 A;  2WT7 B;  1BGY G;  1FDI A;  3CC2 P;  2ZJS E;  1NVO A;  1YTZ T;  2K88 A;  1H8A A;  4L73 A;  1FU1 A;  3AEC C;  5AW6 B;  1YBK A;  3B5N D;  1YJN P;  4XFJ A;  1PGQ A;  1M8O B;  1SQB E;  1HJB A;  3JSV C;  3CCE P;  4C7N B;  1OFC X;  4WBA A;  2YIU C;  2IX7 C;  1SQQ K;  1PL5 A;  2LXB A;  2P7J A;  3AED C;  4NPF X;  4Z1M H;  2YNY A;  1JTH B;  1OW7 A;  3G6E P;  5KLV E;  1N7L A;  2FFD A;  3T97 B;  2R44 A;  1ZR2 A;  3VP9 A;  1VQP P;  4Y99 C;  2O01 H;  2QM8 A;  3RBX A;  2PFX A;  4EDF A;  3KQG A;  4N78 E;  1IFM A;  2Q1K A;  1VPC A;  1X0T A;  1L0N D;  3SFE C;  1L4A C;  3PHL A;  3UIA A;  1FZC A;  1OVU A;  1KV4 A;  2BCC J;  4HJG H;  2BCC D;  2H89 C;  2JR8 A;  5CMZ A;  4BRY B;  5KAI E;  3PTZ A;  1KQG B;  2FBW C;  3H1H D;  5B5E H;  2W6A A;  1BSH A;  3E7K A;  2P67 A;  2WSF H;  3U1A A;  3CCM P;  1G2C A;  1QEX A;  1H0T A;  4IL6 X;  3SWK A;  2FYU K;  3L73 G;  1DD3 A;  4N6J A;  1BDD A;  4YTP C;  1L0N K;  4H44 B;  3NMD A;  1Q90 D;  1SQB J;  3L73 D;  1SFC B;  2AXT H;  1SLQ A;  2D2C B;  3O6Q B;  5E79 E;  2I8D A;  2XNX A;  3B5N B;  1X22 A;  3MD0 A;  3N7N A;  3WU2 E;  5KAF H;  2KNC B;  1Q82 Q;  1BGY D;  3AE4 C;  2LKM A;  2IYO A;  2M3B A;  2QSI A;  2OAR A;  3L4F A;  4N78 D;  3RGU A;  2YMY A;  2ZYD A;  1FOS E;  1S1C X;  3PRJ A;  3L72 G;  4JYC A;  1DIP A;  2M3E A;  3BCC J;  1HH0 A;  2M5A A;  2Q3E A;  1BDC A;  3HRN A;  3KXD A;  5AVS B;  2IPP A;  2W6B A;  2YXR B;  1OVR A;  1KFN A;  3HTK A;  3CCQ P;  1BCC J;  4UB8 H;  5AVT B;  1QL2 A;  1QGK B;  3H1H J;  1NTM G;  4OGQ D;  2RKL A;  4ASV A;  2AXT E;  5GTH H;  3AE3 C;  4PD4 E;  4YXW H;  3CX5 I;  2Y0C A;  2M5A B;  2A06 D;  3H1L E;  3L74 D;  1SQV E;  2ITA A;  1FDO A;  1N86 A;  4HKZ H;  4OH8 B;  5CCH D;  1JNM A;  1MKM A;  2W8Z A;  1KIL C;  3L36 A;  1Q7Y Q;  2ZYA A;  2E74 B;  1UII A;  3NXS A;  1SQP G;  1LTJ C;  1OXZ A;  1QLE D;  2HYN A;  3A3Y B;  4IFM A;  3SFD C;  3L71 J;  3TGU J;  1AFO A;  2WSE J;  4YXD C;  2W27 A;  1ZRT D;  4W80 A;  3CCL P;  1LNQ A;  1J1E B;  3OA7 A;  1NYH A;  3GHG C;  1NTZ K;  3PP5 A;  3RK3 B;  4ZKU A;  1VQK P;  1JMB A;  1NU1 G;  2QJK C;  4U7J A;  3MGN A;  3V6I A;  3K5B A;  5K5G B;  4PD4 H;  3L71 D;  2BEQ D;  1SP4 A;  3TGU D;  2Z5I A;  4DOJ A;  1DX7 A;  1EDL A;  3VMY A;  2FXM A;  2PRR A;  2CK3 H;  1NWQ A;  5AVY B;  4CPG A;  3A0H H;  1SQP J;  1QX8 A;  3I5C A;  4U3F G;  1GL2 C;  1NTK G;  3H1J J;  2Y9Y A;  1LWU C;  4NPD A;  4QMA A;  3RK2 B;  3V5B A;  1BSN A;  1N73 A;  3Q5S A;  4KHX A;  1KFM A;  3D70 A;  2O1K A;  3CME P;  4EIJ A;  4ZNC A;  2E76 B;  2B89 A;  2N9B A;  3IF4 A;  1S3J A;  1KOR A;  1PGP A;  2MKV A;  2R3S A;  1NTZ D;  1PPJ D;  2QJP B;  3QH9 A;  4H44 D;  3RL0 B;  2QIW A;  2QJY B;  2FYU J;  1NTM J;  1UIX A;  2PP6 A;  4IFF A;  2LR2 A;  1ZOY C;  5BU5 A;  1MUU A;  2R5D A;  3H1K E;  2QE7 H;  1HGZ A;  2V7Q H;  1NAY A;  1JMM A;  2KZI A;  3BCC D;  4RO0 A;  1JY2 N;  1SQV D;  3HE4 B;  2KLU A;  3TSI A;  3VMX A;  2HPC B;  4H0L D;  2A06 E;  2GA1 A;  3H1L D;  2C9N Y;  3BCC G;  2L5G B;  3CWB E;  3WUV A;  2A45 H;  1FZA A;  1LTI C;  2KIK A;  2R5B A;  2GUV A;  3CX5 D;  3LW5 J;  3NFQ A;  3R2P A;  3KZI H;  3B8E B;  3CD6 P;  1RHZ B;  4OWF A;  1LWU B;  2CPB A;  2E5T A;  2M0B A;  1NKN A;  2OYH C;  1T3U A;  5B5E E;  1GK6 A;  3A5T A;  3G3Z A;  1ZP0 C;  4OGQ B;  1GW4 A;  3D6Y A;  1FZE A;  1LT1 A;  3RK3 D;  1KB9 D;  1LP1 B;  1SQB G;  2ZAE B;  2GM4 A;  2UWJ E;  3CPW O;  2YKP A;  2ZVN B;  3RL0 D;  1W2B O;  5KLV D;  1SQQ E;  1ZW0 A;  3ZDM A;  1AA0 A;  1LT9 A;  4PJ0 E;  3IN6 A;  1W5C E;  1IFD A;  1VQ5 P;  1NU1 D;  2IZ1 A;  2JO1 A;  4W7Z A;  1VQ7 P;  2ZXE B;  3HTK B;  1QVG O;  1OZH A;  1PIX A;  2E74 D;  5KKZ C;  3AE7 C;  2Y0E A;  4XA4 A;  1N7S B;  3V2P A;  2Z5H A;  1VDF A;  1KZU B;  1L4A B;  2A45 G;  2OYH A;  3CC7 P;  3KPE A;  4YPC A;  2BCC G;  5BU8 B;  3SWF A;  2XZR A;  2W90 A;  2ZXX A;  4ASW A;  1KIL D;  2O1J A;  4D6T E;  2QJP C;  3RL0 C;  3O6Q A;  2B88 A;  1USD A;  2YO3 A;  3VOP A;  3WUU A;  3JCU H;  1KB9 H;  2FYU G;  1NU1 K;  1NTK K;  2WSS H;  3RL0 g;  3V2N A;  1AQ5 A;  1GMJ A;  4GIF A;  1JY2 P;  2XKM A;  3RK3 E;  5AW3 B;  2POH A;  5B66 E;  1VL2 A;  1ZXG A;  2YKQ A;  3OW2 O;  1MFZ A;  3L73 E;  1U57 A;  3V2Q A;  4W7Y A;  3HD7 C;  3H1J G;  1NTK J;  3F89 A;  4U3F J;  3SWY A;  3MUD A;  5B66 H;  3B5N A;  1G1I A;  1BGY E;  3AE2 C;  1N7S D;  3C8V A;  2C9L Y;  1CSB A;  1RE3 C;  3Q1M A;  1VQ6 P;  1X8Y A;  3LW5 H;  4GT1 A;  3WUT A;  4LGD E;  2KLV A;  1GL2 D;  4M3L A;  1NTK D;  2IFM A;  2ZT9 B;  1NU1 J;  1SS1 A;  1XTG B;  2KYV A;  3HE5 B;  5EFW B;  2D2C C;  2KXP B;  1LTG C;  1JY3 N;  2B9B A;  3QWO C;  3L70 D;  2L91 A;  4UB8 E;  5GTI H;  1SFC D;  1NOH A;  1VF5 D;  1FZB A;  1GK4 A;  2KSJ A;  2KS1 B;  1L0L E;  3II6 A;  4HB1 A;  5KLV G;  2QA4 P;  1M90 Q;  1PZQ A;  3L71 G;  2Y0D A;  5AW5 B;  1WT6 A;  3TGU G;  1FDM A;  4H0L C;  4HYT B;  1JTH A;  1G2C B;  1Y9B A;  2Q3I A;  1R5S A;  3HE5 A;  1BE3 E;  1L4A D;  3AE5 C;  3TNU B;  2WZ7 A;  4WY4 C;  1IZN B;  3L74 G;  4H13 B;  4LLH A;  2FKW B;  1KTM A;  2D2C D;  1Z56 A;  3H1H G;  2XU6 A;  2E75 C;  3L75 E;  1K05 A;  1BCC G;  5KTB A;  2JEE A;  2P2U A;  2WTY A;  1JCD A;  3GG2 A;  1LTT C;  2JWD A;  3MP7 B;  1LJ2 A;  1J1D C;  1S9K E;  2YXQ B;  1KC8 Q;  2NZ2 A;  2FYU D;  4B86 A;  2AEM A;  3NTN A;  5APV A;  3AEB C;  1YJ9 P;  1LGH B;  3L72 J;  3BVH A;  1M56 D;  5AW0 B;  5KLI C;  2FFD B;  1OW8 A;  1CZQ A;  2K9Y A;  2WSE H;  5GTH E;  2YIU B;  2I1K A;  2WSF J;  2E43 A;  1NJI Q;  3MHV A;  2KUB A;  4H13 C;  1M57 D;  1SQP D;  4WY4 B;  3WU2 H;  2GUS A;  3KDP B;  5CJ0 A;  1TU3 F;  1IFI A;  1JY3 O;  1PP9 E;  3E1R A;  3M0D A;  3P8M C;  4DZO A;  1M7L A;  1NTK E;  4C7R A;  2ZFC A;  1IO4 A;  1JY3 P;  2IBZ D;  3L73 J;  1M1K Q;  1VF5 B;  1FBM A;  1W2E A;  2V7Q J;  4PV1 C;  4RES B;  2NPS D;  1SQV J;  4R4L A;  1NTZ G;  1PPJ G;  3EFG A;  3EQ2 A;  3EWK A;  1OVV A;  3M0A A;  1KYO H;  4N3Y B;  4C7N A;  3L75 D;  3FX0 A;  1R8E A;  2WIT A;  1PV3 A;  2BEZ F;  3JCU E;  3V4W A;  3HD7 D;  1JCC A;  2K1A A;  1AVY A;  1BE3 D;  1SQP K;  4H13 D;  4JPZ B;  3CWB D;  4WWI A;  5CHX A;  3VMZ A;  4WB4 A;  3VTP C;  2Y9Z A;  2JP3 A;  3H1L G;  4JBZ A;  1AQT A;  1KYO I;  1D7M A;  1SQX K;  1JO5 A;  1S72 P;  1EQ7 A;  1GW3 A;  2OQQ A;  3CL3 D;  3RBZ A;  1H89 A;  1JOC A;  3H1J D;  2XDJ A;  4WY4 A;  3M0D C;  3F5H A;  3FWN A;  2HOD A;  3A7O A;  1GDT A;  3CXH H;  2RH0 A;  4Y99 B;  2HLO A;  1LTA C;  4TLF A;  4KJM A;  1CI6 A;  3AE1 C;  2G3A A;  2HG5 D;  4OVN F;  3D6Z A;  1GU5 A;  1PGO A;  1K73 Q;  1USE A;  3S1K A;  1H0T B;  2A45 I;  4AYC A;  1MV8 A;  2E76 D;  2AEJ A;  1ZRT E;  4K35 A;  2OTK E;  4UB6 E;  1YHQ P;  2KZJ A;  3B71 A;  2J58 A;  1EZV I;  2R32 A;  2K3R A;  1M1J A;  4L74 A;  2ZYG A;  2KP8 A;  1EZV D;  4WY4 D;  4C46 A;  1FZC C;  1K04 A;  3WMM 0;  3Q3D A;  1K8A Q;  1BGY J;  5DJU B;  2YMK A;  3HUS A;  3HUS B;  1KD1 Q;  3MUD C;  2IBZ E;  1LTB C;  4H0L B;  5CCH C;  3U1C A;  1AV1 A;  1SVF A;  5CCG D;  1IK7 A;  2KB7 P;  3P32 A;  5APX A;  3TK1 A;  4H44 C;  3CMA P;  4GOD A;  1KIL E;  1Y47 A;  1HJ0 A;  2IDB A;  2J5U A;  2W6J H;  3CXH D;  3L70 G;  3BAT A;  3CCU P;  5GTI E;  3H1I G;  1IC2 A;  4PJ0 H;  1OWA A;  4D6T G;  2C0X A;  3JC2 2;  1NTM D;  1RF0 C;  1S2E A;  3MIW A;  1BCC D;  3D71 A;  2QVA A;  2XV5 A;  1M1J C;  2WMM A;  3H1K G;  2JKV A;  1DH3 A;  4ZMD A;  1ZV8 A;  2WSC J;  5E79 H;  3FWL A;  1IK9 A;  1J2J B;  5APY A;  3H1K D;  5APS A;  3BCC E;  3CWB G;  4I7Z C;  2JWA A;  2N1T A;  2Q7C A;  5AVU B;  3MZW B;  3HUS C;  2IZ0 A;  1H88 A;  5L8R J;  3GF3 A;  1EDI A;  3H1J E;  3M91 A;  1L0N J;  4GOF A;  4RJT A;  5C39 A;  3AEG C;  1EXI A;  5M1B A;  3M9B A;  1L4A A;  2RMZ A;  4RKU J;  2OYH B;  3A0H E;  1BE3 J;  1T2K C;  3C9I A;  3GMA A;  1ZR4 A;  2KS1 A;  3G71 P;  1HUC A;  1NAF A;  1FS0 E;  1NTM K;  3HD7 B;  1KYO E;  3M9H A;  1NO4 A;  1XTC C;  1WRG A;  2O3J A;  3MTU E;  5KLV K;  4IOI H;  2QRX A;  4KT0 J;  1VQ4 P;  1HTL C;  1L0L J;  1VQ8 P;  2NRG A;  1P84 E;  1L0L D;  2FXP A;  1FZF A;  1SQQ G;  2QM7 A;  1RF1 C;  1EZV E;  2BAS A;  2PGD A;  2E76 C;  4R4M A;  2Z4E A;  1KN7 A;  1HBW A;  1A02 J; 
#chains in the Genus database with same CATH homology
 2ITA A;  2NRG A;  2DW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...