2O1KA

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
43
structure length
43
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Non-structural glycoprotein NSP4
publication title Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein
rcsb
source organism Simian rotavirus a/sa11
total genus 20
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o1kA00
2O1KA 4HH2A 4DOJA 2L5GB 4WBAA 4LLHA 2WITA 3MIWA 4C7RA 2O1JA 4WB4A 1G1JA 3CI9A 1G1IA
chains in the Genus database with same CATH superfamily
4U3FD 2BCCG 4C7NA 4LC1A 3CMAP 1PGPA 3A0HE 4WWIA 4K35A 1MV8A 2J5UA 1Q7YQ 2J58A 2E76C 1OFCX 1DEBA 3Q3DA 1AVYA 1G2CB 3P7KA 3D6ZA 3H1HJ 2C9LY 1N73B 1IK9A 2BCCJ 3H1HD 3FGAD 2KSEA 1IJDB 5AW7B 4DJGA 1HTLC 3MP7B 1URQD 3SSUA 1OZHA 3IFMA 1KTMA 2B89A 1FE6A 2A45H 1JY2N 1IO4A 3CCUP 1NVOA 2BEZF 2K37A 3D6YA 4GKGA 1HJBA 5B5EE 2YIUB 4AYCA 1JY3O 4BRYA 4Y28J 2KI7B 2WWWA 5DJUB 1EXIA 2WSEH 1SQQG 3V2PA 4YPCA 3OW2O 2OYHB 2WSCJ 3RGUA 3BRTB 2I8DA 4JYBA 1L0LD 1HWTC 2HPCA 2K3RA 2YXRB 1NJIQ 4N6JA 3MD0A 2QRXA 3C9IA 4WB4A 3IF4A 2C0WA 1SQQJ 1GW3A 1KV4A 1N86A 2Y9YA 1SQQD 3VMXA 3L36A 3H32A 1A02J 2P2UA 3CCSP 4H13C 1FDOA 3SWKA 2H88C 1PL5A 1A02F 1KORA 1JY2P 3H6PA 5AW2B 5KKZB 3BRVB 3W67A 3VP9A 4C46A 4JYCA 1SQXD 1T3JA 3CXHH 3RL0C 3HE5A 4UB8E 3KXDA 1FOSE 1IFDA 3HTKA 4PV1B 3TGUG 1VQLP 1GL2A 5AVWB 1SFCA 2I1JA 1RF1A 1KILE 1LGHB 4U3FE 4U7JA 2N1TD 1N7SC 1AJYA 2W8ZA 2BASA 1NTMG 4EDFA 3L73D 2NPSD 1M7LA 1OMIA 2KS1B 2QVAA 3HUSC 1VQ4P 2BEQD 2OTKE 3TGUJ 1SQVD 1JTHA 3GF3A 2YKPA 5E79H 5CHXA 3A5TA 3H1HE 3D71A 3VMAA 2JP3A 1NTMJ 2BCCE 2W6JH 3AE2C 3B5ND 2O1JA 1JCCA 3AEEC 1TU3F 1VQ6P 5CCHC 1FBMA 5AW9B 3LIEA 3L70G 5TISH 5CJ4A 2Q9IA 1S4XA 3CC2P 2ZYAA 2PFXA 1KB9I 3NFQA 3JSVC 4NPDA 1NU1K 4AQRD 2R5BA 1KYOD 3JCUE 1SS1A 3CX5D 2H8PD 4PD4D 4PJ0E 3FXDA 1M90Q 1RE3C 2G8YA 2HFED 2E74C 2WITA 1KILC 2FYZA 3L70J 2QM7A 4R4MA 1AVOA 1JNMA 3PJSK 3BASA 2LXCB 1LTBC 2FYNB 1K8AQ 5B66H 3OAKA 5AVSB 1YTZI 3RK3E 2QJYB 3BVHA 3L74D 2Q6QA 3L72D 2FKWB 4N78D 1FZCC 1H0TB 2RN0A 3H1LG 4N3YB 2I1KA 3U59A 1SQQE 3ABVC 1PP9D 1KC8Q 2B9BA 2WSFH 4GODA 1ZRTD 4AUWA 2A45G 1PGJA 1AA0A 4TT3H 5APTA 3H1LJ 1VF5B 2R44A 1G1JA 2QIWA 1SQPG 2KIKA 4XFJA 1JEKA 5AVXB 3SWFA 1GDTA 1USDA 2HODA 4HJGH 4NPEA 2AXTE 5BU5A 4I2LC 3CC7P 2FYUG 1EZVG 2KZJA 3TNUB 1P84D 2L91A 1NTZG 2W6AA 2E43A 1SQPJ 4NPFX 1NTKG 1IFJA 3TGUE 2H7HA 1MFTA 1SQBD 2WSEJ 3TK1A 1DD4A 1Q90D 5KLVD 3ZDMA 1NTME 2FYUJ 1UIXA 1NTZJ 2A06D 3AE4C 1NTKJ 1H88A 2IZ0A 2W83C 3L37A 4I7ZB 2ZJSE 2GM4A 1NAFA 3G9RA 3NTNA 2V7QH 4BRYB 3EWKA 2M8RA 3R4YA 3FWNA 2QJPB 2PRRA 4BWNA 3H1JD 2HR3A 1QVFO 3L70E 3C8VA 5AVYB 1K05A 4DOJA 3WU2E 3EFFK 1J1DB 2POHA 4ASVA 2KLVA 3CXHD 1MUUA 1ZN5A 1JMBA 3A0BH 3II6A 2Z5HA 3TDKA 1OWAA 1AV1A 1OVRA 3GW6A 3WUUA 4PV1D 1JM0A 3AE7C 1K9MQ 3GF7A 3A7OA 5AVQB 3H32B 2M0BA 1IK7A 1N7SA 3PH0A 3P8CD 2IBZD 5GTIH 1N8RQ 3HE4A 3MGNA 3HUSA 1NAYA 3WUTA 1CSBA 1ZRTE 5K5GB 1J2JB 3HE5B 2C0XA 1SVFA 2QA4P 3L71G 1DX7A 1USEA 2KNCA 3MUDC 1GL2B 1FZGA 1FZEA 3PRJA 1SFCB 1VQ7P 1RF1B 3H1LE 1L0NG 3L75G 3CL3D 1BGYG 5CCHA 1LT9B 5APUA 4WY4A 3GG2A 3VN0A 3L71J 3V4QA 2YMYA 3CX5H 4H0LC 4PD4H 2OTLP 1BE3D 3C1LA 3EQ2A 1L0NJ 2E5YA 3L75J 5BVZA 1RE3A 1J1EB 1BGYJ 2O01N 1SQPE 1QL2A 2IZ1A 1YIJP 1KILA 5AVRB 3Q5SA 2LR2A 3RK2B 5EFWB 2M3BA 1BDDA 1HJ0A 2VRSA 1M57D 1T3UA 2FYUE 1EZVE 1NTZE 2YXQB 2P67A 1BDCA 1NTKE 3GHGC 4DZOA 5CCGD 2YO3A 2JO1A 1FDMA 2QG4A 2WSFJ 1VQPP 4M3LA 1U7MA 3HD7C 1LWUB 4EYYQ 5KLIB 4I6MC 2WVRA 3BCCG 2FFDB 1N2DC 2ZT9B 2V4HA 3CXHE 4I1LA 1FAVA 4YXDC 1VF5D 1VQNP 1DIPA 3G3ZA 2XU6A 3HRNA 3BCCJ 2KP8A 3BCCD 1L0LG 3T97A 1P84H 2E76B 2IYPA 2FBWC 3Q5PA 1MZ9A 3S1KA 4BXLA 1QX8A 1IFIA 1L4AC 3GMAA 1H8AA 2M5AA 2UWJE 3SWYA 1PPJD 3I55P 1GU5A 5E79E 5GTHH 1RHZB 1L0LJ 1K04A 2ZAEB 2IX7C 2O1KA 3AEAC 2HODB 1YYCA 2GA1A 3FXEA 3K5BA 3RBXA 2Y0EA 1SQXG 3AE8C 5TISE 3M0AA 5CBOA 4C7RA 2W90A 3L71E 2V7QJ 3EFGA 4KJMA 4D6TD 1LNQA 2K1AA 4UB6H 4W7YA 1L0NE 3L75E 2R5DA 3QH9A 5AVTB 3L73G 1BGYE 1SQXJ 1PV3A 1T6AA 3MIWA 1KB9D 1SQQK 3AE9C 1YQ4C 1DEEG 1SQVG 3KPEA 1W2EA 5B66E 2KB7P 2HLOA 1ZXGA 2HG5D 2JR8A 3A2AA 2WMMA 1JY2O 3L73J 4GIFA 4DT0A 3M06A 4H13B 1OVUA 1E5WA 1IFPA 4IFFA 1T2KD 2KSJA 1SQVJ 1OW7A 4GOFA 3RL0B 1EXJA 1YQ3C 3I56P 2K88A 1N7LA 1NWQA 3TF5A 3MUDA 1KN7A 3PLNA 4ZKPA 1GL2D 1HF9A 4Z1MH 1SFCD 3IAOA 5APWA 3CCRP 2OYIC 1N7SB 2Z5IA 4WY4C 3N7NA 3HE4B 1YITP 2Y9ZA 3BCCE 4B86A 1YJNP 4YTPC 4H44B 1WMKA 1LJ2A 3L74G 2AEMA 1NTMK 3L72G 2IPPA 1BSHA 2M3EA 2JKVA 2K9YA 1LTGC 3VMYA 2D2CC 2PAJA 2FY8A 2H89C 1Q82Q 1PP9G 1EQ7A 3H1KD 4RO0A 1S1CX 1L0LE 3RK2D 1S3JA 3L35A 3L74J 3UIAA 3L72J 1QVGO 2KLUA 1VQ9P 3AEGC 2IFNA 2GUSA 4IL6H 2E75D 2GUVA 3L4FA 1G2CA 4WVZA 3VOPA 3GHGA 2YMKA 1PP9J 5CBNA 1VL2A 2E74B 2NZ2A 1LTAC 1KILB 5CJ0A 3M0DC 5KAFH 2G3AA 3HD7A 2JDIH 3IN6A 1URQC 3CLQA 3CCEP 1GD2E 1RF0C 3H1ID 3Q1MA 1SQXE 2KYVA 4GT1A 3CI9A 1FZCB 3A0BE 4C7NB 1YJ9P 1X79B 1KQFB 2JWDA 1SQBG 3AE1C 4GOEA 1GW4A 5KLVG 3AE5C 1M1KQ 2O01H 3L73E 2Z4EA 2AXCA 3A3YB 5APQA 1CW5A 5GTIE 2A06G 2DW3A 2NRGA 5C39A 1SQVE 1L4AA 1SQBJ 4HYTB 1HGVA 1CI6A 3PP5A 5KLVJ 5KAIH 2K9JA 1G1IA 4EIJA 3CWBD 2RH0A 2ZVNB 4TLFA 1PGQA 1EDLA 3O6QA 3H1JG 1M1JC 1X22A 4ASWA 5AVVB 3T97B 5APSA 1CZQA 1SQPK 1OVVA 3G4SP 3QWOC 5KJ7D 1LTJC 2ZVOB 1HH0A 2AEJA 2P10A 3RK3B 1KYOE 1KQSO 2OYOA 4JBZA 4Y99C 1U7JA 3CX5E 4PD4E 5DJTB 3H1JJ 2FYUK 4OH8B 1NKNA 1NTZK 2WPVB 2Q5UA 1YI2P 2IBZG 2N1TC 1NTKK 2HPCB 1KB9H 2NPSC 4IL6X 1XTCC 1BCCG 1KMIZ 1T2KC 4WBAA 4EI2A 5AVUB 3GLMA 5M1BA 2LXBA 3L74E 1SP4A 2LKMA 4XA4A 3L72E 4N78E 1JUNA 1NHLA 2Q1KA 2KOGA 2A45I 2OTJP 2QJKB 3Q2YA 3AEFC 3B5NC 1BCCJ 4H13D 2YO2A 1PP9E 4RKUJ 1BCCD 3MZWB 1GZLA 1GU4A 1NH4A 1NOHA 4W7ZA 3HTKB 5L8RJ 1ZMEC 1BE3G 3F5HA 3KQGA 2MKVA 1EZVI 1HUCA 1X0TA 4XE5B 2PGDA 2OYIA 1Q86Q 2WTYA 1N7SD 5AVZB 1GK6A 2HYNA 4K3AA 1BE3J 1JTHB 1P84E 3O8ZA 4H44D 1JMMA 3V5BA 1QL1A 2ZFCA 4YXWH 1WRGA 5AW5B 2CPSA 3G6EP 1U57A 2E75C 1SQBE 1LP1A 4JF7A 5KLVE 5GTHE 1FDIA 1RQVA 4IFMA 1M8OB 3S9OA 3MTUE 1JY3N 2A06E 1L0NK 1Q81Q 1LWUC 1FZAA 2R3CA 2QEXP 4H0LB 3S4RA 1N73C 1JB0J 1JOCA 1FOSF 2B87A 2Q3IA 2E74D 1QGKB 3M0DA 4KT0J 2WPQA 1KILD 5APVA 1FS0E 4UB6E 3H1JE 4OGQB 3AECC 1RH5B 1URQA 4O9BA 4R4LA 1RF0A 3NMDA 1IFMA 2XNXA 4LLHA 3CCVP 2CK3H 1ZW0A 5TJHA 4RJTA 4HB1A 4DCKA 4L75A 3KZIH 5H2FH 3TNUA 2ZXEB 1PPJG 3GHGB 3SFDC 1FC2C 2YIUC 1YTZT 1NKZB 2BCCD 2Q7CA 1KD1Q 2O01J 2QM8A 3P8CE 3OA7A 1S9KD 2IBZE 3HD7B 1FU1A 2L5GB 1VQOP 1FZBA 1JY3P 2OYHC 2QE7H 1BCCE 1S5LH 1RE4C 3FX0A 1PZQA 2KUBA 2ZYGA 1LT1A 3TYYA 3E1RA 1VPCA 1IZNB 2W6BA 5KJ7C 4D6TG 1WT6A 2OARA 2Y0DA 3PTZA 3CCMP 1M1JA 2JJLA 1X8YA 2SPZA 2QSIA 5KKZC 1LTJA 4D6TJ 1L4AB 1Q2NA 3RK3D 1L0LK 1BE3E 1R5SA 2YKQA 2E5TA 1CI6B 3LW5H 4PV1C 2K9JB 2N1TA 3O6QB 3A0HH 4ZKUA 2AEFA 3WMM0 3U1AA 2NPSA 2WT7A 1EDJA 1S2EA 4ZNCA 4LGDE 1LTIC 3V2QA 1R5LA 1KFMA 3TSIA 4IL6E 5AW1B 2PP6A 1SQXK 3MHVA 1QLED 3B5NA 1LTSC 3SFEC 1RQUA 3NXSA 4L73A 5KAFE 1NU1G 3JC22 1DD3A 1VQ5P 1LT9A 4HKZH 3B71A 5APYA 2Q3EA 4KHXA 1KQLA 5B5EH 1IFNA 1L2PA 1BSNA 3AE3C 4H44C 1Y9BA 3U1CA 1EDIA 3ITKA 3TGUD 4MN4C 1SQVK 1NU1J 1MKMA 1S5LX 4RESB 3H1KG 1SLQA 2WPSA 3AE6C 1NU1D 3P8MC 3E7KA 3HUSB 2KK7A 3AEBC 3RBZA 1NTMD 1S9KE 1AFOA 3CD6P 2FYNC 2P58A 2KNCB 3KYQA 1OIPA 3M9BA 4A7PA 2QJYC 3V4WA 2P1JA 1NO4A 1PPJE 2N9BA 3H1KJ 1IC2A 3CPWO 5CCGC 5KAIE 2OYIB 2W27A 4WY4B 1HBWA 3H1IG 4CPGA 3L70D 1LWUA 2IYOA 4UB8H 1MFZA 2FXMA 3W68A 2JEEA 3M9QA 1YJWP 5CMZA 4H0LD 1N73A 2FFDA 4D6TE 1D7MA 2D2CB 1JO5A 4OVNF 1VF5C 1HGZA 1LP1B 2B88A 2E42A 2YKOA 1ZP0C 3D70A 3H1IJ 5AW8B 1NYHA 4OGQD 3OJAB 1M56D 3V2NA 3H25A 1H89A 1JCDA 2XNDH 1KB9E 3VYIA 2RKLA 1PGOA 2ZT9D 1Y47A 3RL0g 2FXPA 3CMEP 2XKMA 1KYOI 2B87B 4JQ0D 3CWBG 1T8ZA 1ZR4A 3CX5I 1OXZA 3H1LD 4PD4I 3N4XA 3F89A 1KQGB 1URQB 3HD7D 2OYHA 1YHQP 2XV5A 2E76D 2O3JA 5APXA 5AW4B 1RE4A 4IFDK 1UIIA 2OGUA 2OQQA 3JCUH 3WUVA 5KJ7A 4OWFA 3CWBJ 1VQ8P 4PJ0H 4I7ZC 1ZLLA 1E79H 3RK3C 1PFIA 1HVVA 1FJPA 3M9HA 1SQPD 2XDJA 1ZOYC 2QJPC 2KZIA 2R32A 1GK4A 1NU1E 1SQBK 2WSCH 3CCQP 4ZMDA 1RY3A 2XZRA 5KLVK 1R8EA 1J1DC 3IR9A 2M5AB 2FYUD 2N9YB 1EZVD 3CCLP 1L4AD 1NTZD 4EOTA 1PIXA 3E1IA 3LW5J 3Q5RA 4L74A 1DH3A 1AQ5A 1NTKD 1GTWA 4QMAA 1FJKA 1Z56A 1KFNA 1M1JB 3H1KE 2FXOA 2QJKC 2WPRA 2YNYA 1Y8AA 2IDBA 3G71P 1OW8A 1XTGB 2KS1A 3P32A 1S72P 1LTJB 1FZFA 2J59M 2WSSH 2WZ7A 2WQYC 1OX3A 2CPBA 4Y99B 1P84I 4L76A 2ZYDA 5AW3B 3AEDC 3PHLA 1GL2C 3CCJP 1SFCC 3M91A 1EDKA 1RF1C 2R3SA 2N1TB 1NGMB 3KDPB 3VMZA 2NPSB 3I5CA 2WT7B 2AXTH 1GMJA 1LT9C 1VQMP 3H1IE 3RL0D 3FWLA 1K73Q 3B8EB 3BATA 2ITAA 3KHUA 2C9NY 2MJZA 3USSA 1VQKP 2IFMA 3VP8A 1AQTA 3KZIE 1OW6A 5H2FE 1ZR2A 1J1EC 3B5NB 2H43A 5KTBA 1QEXA 2P7JA 3B4SA 2Y0CA 3RK2C 3V6IA 1S5LE 2RMZA 1KYOH 4GDOA 3CXHI 3V2RA 3L71D 4W80A 1H0TA 1LTTC 3CWBE 5CCGA 4JPZB 5CCHD 1X9VA 1W5CE 4U3FG 1L0ND 4WY4D 3L75D 1KZUB 4IOIH 1VDFA 5BU8B 1BGYD 3VTPC 1ZV8A 3CC4P 3LIDA 5KLIC 3WU2H 2IBZI 4OGQC 1YBKA 2JWAA 2FFDC 1EC5A 1W2BO 2ZT9C 2KXPB 4HH2A 2E75B 3R2PA 5AW0B 4U3FJ 1FZCA 2D2CD 3H1HG 5AW6B 2ZXXA
chains in the Genus database with same CATH topology
4DOJA 1J1DB 1LTAC 2POHA 4C7NA 2KLVA 1KILB 4LC1A 5CJ0A 1MUUA 1ZN5A 3M0DC 4LGDE 1LTIC 2Z5HA 3II6A 3V2QA 3HD7A 1OWAA 1KFMA 3TSIA 1URQC 3CLQA 5AW1B 1GD2E 1RF0C 2PP6A 1MV8A 1SQXK 2J58A 1DEBA 2KYVA 3A7OA 1G2CB 3P7KA 5AVQB 3H32B 3B5NA 4GT1A 3CI9A 1LTSC 1N7SA 3NXSA 3P8CD 2C9LY 1FZCB 1N73B 1IK9A 4C7NB 3HE4A 1X79B 3MGNA 1LT9A 3HUSA 1IJDB 5AW7B 5APYA 1CSBA 4KHXA 1J2JB 1GW4A 3HE5B 1HTLC 2C0XA 1KQLA 1SVFA 1IFNA 1DX7A 2O01H 2Z4EA 1URQD 3A3YB 3U1CA 3IFMA 5APQA 1CW5A 1GL2B 1FZGA 1FZEA 1SFCB 1RF1B 1SQVK 2A45H 1JY2N 1IO4A 4RESB 1L4AA 1SLQA 2WPSA 3P8MC 3CL3D 4HYTB 5CCHA 1LT9B 4GKGA 3HUSB 1HJBA 5APUA 4WY4A 1HGVA 1S9KE 1CI6A 3PP5A 4AYCA 1AFOA 1JY3O 3VN0A 1G1IA 4EIJA 2WWWA 3V4QA 2WSEH 3KYQA 3M9BA 2YMYA 3V2PA 1M1JC 3V4WA 2OYHB 3EQ2A 5AVVB 3BRTB 2P1JA 1NO4A 5APSA 1CZQA 2N9BA 4JYBA 5BVZA 1SQPK 1HWTC 2HPCA 1RE3A 1J1EB 1IC2A 5KJ7D 1LTJC 1QL2A 4N6JA 5CCGC 2OYIB 1KILA 3MD0A 2W27A 4WY4B 1HH0A 5AVRB 3RK3B 1HBWA 3C9IA 4WB4A 2C0WA 3RK2B 4Y99C 2M3BA 1GW3A 1N86A 2FYUK 2VRSA 4OH8B 1LWUA 3VMXA 1NKNA 1NTZK 1MFZA 2FXMA 3L36A 1T3UA 3H32A 1A02J 2Q5UA 2P2UA 2JEEA 2N1TC 3M9QA 5CMZA 1NTKK 2P67A 1N73A 2HPCB 2FFDA 2NPSC 1XTCC 1A02F 3GHGC 4DZOA 1JY2P 1JO5A 3H6PA 5AW2B 3BRVB 1T2KC 4C46A 3VP9A 4WBAA 1HGZA 4JYCA 2E42A 5AVUB 2YKOA 5CCGD 3RL0C 1T3JA 2YO3A 3HE5A 5AW8B 1SP4A 1FDMA 2LKMA 4XA4A 1FOSE 4M3LA 3HD7C 4N78E 3OJAB 1JUNA 3V2NA 1LWUB 1NHLA 1IFDA 3HTKA 2KOGA 4I6MC 1H89A 1JCDA 2A45I 1GL2A 5AVWB 1SFCA 3VYIA 2I1JA 1RF1A 1LGHB 2FFDB 1N2DC 3B5NC 2N1TD 2YO2A 1N7SC 2BASA 2NPSD 4I1LA 1GZLA 1FAVA 1M7LA 1GU4A 2XKMA 1NH4A 1NOHA 3HUSC 1T8ZA 4W7ZA 1ZR4A 1OXZA 3HTKB 3N4XA 3G3ZA 1JTHA 2XU6A 3HRNA 3KQGA 1URQB 3HD7D 2OYHA 2YKPA 2XV5A 2KP8A 3T97A 1HUCA 5CHXA 5APXA 5AW4B 3A5TA 1RE4A 4IFDK 4XE5B 2OYIA 1MZ9A 3B5ND 2O1JA 2WTYA 5KJ7A 1N7SD 1IFIA 1L4AC 1JCCA 5AVZB 1GK6A 5CCHC 1FBMA 1H8AA 2HYNA 3SWYA 1ZLLA 3LIEA 5AW9B 3RK3C 1GU5A 5CJ4A 2Q9IA 1JTHB 1PFIA 1HVVA 1FJPA 3M9HA 2XDJA 3O8ZA 1JMMA 3V5BA 2IX7C 3NFQA 1QL1A 2ZFCA 4AQRD 1NU1K 2R5BA 2O1KA 1WRGA 2R32A 1GK4A 5AW5B 2CPSA 2HODB 1SQBK 2WSCH 2H8PD 1YYCA 1RY3A 1RE3C 2XZRA 5KLVK 2HFED 4JF7A 1J1DC 3M0AA 2WITA 3IR9A 1KILC 4C7RA 2FYZA 2QM7A 1L4AD 4EOTA 3E1IA 4IFMA 3EFGA 3MTUE 1JNMA 1DH3A 1AQ5A 1JY3N 3BASA 1GTWA 1L0NK 1LTBC 1LWUC 1FZAA 4W7YA 1FJKA 2R3CA 3OAKA 5AVSB 1Z56A 1YTZI 1KFNA 1M1JB 3BVHA 2R5DA 5AVTB 2FKWB 2WPRA 4N78D 1FZCC 2YNYA 1N73C 1JOCA 1FOSF 1XTGB 3P32A 3MIWA 2Q3IA 1LTJB 1SQQK 1FZFA 2J59M 4N3YB 3M0DA 2WPQA 2I1KA 1KILD 5APVA 3KPEA 3U59A 1W2EA 2WZ7A 1URQA 2KB7P 4O9BA 2CPBA 4Y99B 1RF0A 2HLOA 2WSFH 3NMDA 1IFMA 2HG5D 5AW3B 2XNXA 4LLHA 3A2AA 1GL2C 1SFCC 1JY2O 3M91A 4GIFA 1RF1C 4AUWA 3M06A 2A45G 2N1TB 1E5WA 3KDPB 4IFFA 3VMZA 2NPSB 3I5CA 2WT7B 1T2KD 3TNUA 2ZXEB 1LT9C 5APTA 3GHGB 2KSJA 3RL0D 3B8EB 1G1JA 1YTZT 3BATA 3RL0B 1NKZB 2Q7CA 5AVXB 2QM8A 3P8CE 2C9NY 2MJZA 3OA7A 3SWFA 1S9KD 3HD7B 1FU1A 1GDTA 2L5GB 2IFMA 1N7LA 1NWQA 1FZBA 1JY3P 3VP8A 2OYHC 2HODA 3MUDA 4ZKPA 1GL2D 5BU5A 4I2LC 1SFCD 1ZR2A 1RE4C 5APWA 1J1EC 3B5NB 3TNUB 3TYYA 2OYIC 1N7SB 2Z5IA 2W6AA 4WY4C 1VPCA 2H43A 3N7NA 2W6BA 5KJ7C 2E43A 5KTBA 2P7JA 1WT6A 2OARA 1IFJA 3HE4B 3RK2C 2H7HA 4B86A 3TK1A 1NTMK 1M1JA 2IPPA 2JJLA 1X8YA 3V2RA 4W80A 1LTTC 1LTGC 3VMYA 2PAJA 1LTJA 5CCGA 5CCHD 1X9VA 1L4AB 4WY4D 1EQ7A 3RK3D 1KZUB 1L0LK 1H88A 1VDFA 2YKQA 3L37A 5BU8B 2GM4A 1CI6B 1NAFA 3VTPC 1ZV8A 3LIDA 3L35A 3LW5H 3RK2D 3NTNA 3UIAA 2M8RA 2IFNA 2GUSA 2N1TA 2FFDC 4ZKUA 3WMM0 2GUVA 2NPSA 1G2CA 3L4FA 3U1AA 2WT7A 4HH2A 3VOPA 3GHGA 3R2PA 5AW0B 1FZCA 5AVYB 5AW6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1K A;  4HH2 A;  4DOJ A;  2L5G B;  4WBA A;  4LLH A;  2WIT A;  3MIW A;  4C7R A;  2O1J A;  4WB4 A;  1G1J A;  3CI9 A;  1G1I A; 
#chains in the Genus database with same CATH topology
 4U3F D;  2BCC G;  4C7N A;  4LC1 A;  3CMA P;  1PGP A;  3A0H E;  4WWI A;  4K35 A;  1MV8 A;  2J5U A;  1Q7Y Q;  2J58 A;  2E76 C;  1OFC X;  1DEB A;  3Q3D A;  1AVY A;  1G2C B;  3P7K A;  3D6Z A;  3H1H J;  2C9L Y;  1N73 B;  1IK9 A;  2BCC J;  3H1H D;  3FGA D;  2KSE A;  1IJD B;  5AW7 B;  4DJG A;  1HTL C;  3MP7 B;  1URQ D;  3SSU A;  1OZH A;  3IFM A;  1KTM A;  2B89 A;  1FE6 A;  2A45 H;  1JY2 N;  1IO4 A;  3CCU P;  1NVO A;  2BEZ F;  2K37 A;  3D6Y A;  4GKG A;  1HJB A;  5B5E E;  2YIU B;  4AYC A;  1JY3 O;  4BRY A;  4Y28 J;  2KI7 B;  2WWW A;  5DJU B;  1EXI A;  2WSE H;  1SQQ G;  3V2P A;  4YPC A;  3OW2 O;  2OYH B;  2WSC J;  3RGU A;  3BRT B;  2I8D A;  4JYB A;  1L0L D;  1HWT C;  2HPC A;  2K3R A;  2YXR B;  1NJI Q;  4N6J A;  3MD0 A;  2QRX A;  3C9I A;  4WB4 A;  3IF4 A;  2C0W A;  1SQQ J;  1GW3 A;  1KV4 A;  1N86 A;  2Y9Y A;  1SQQ D;  3VMX A;  3L36 A;  3H32 A;  1A02 J;  2P2U A;  3CCS P;  4H13 C;  1FDO A;  3SWK A;  2H88 C;  1PL5 A;  1A02 F;  1KOR A;  1JY2 P;  3H6P A;  5AW2 B;  5KKZ B;  3BRV B;  3W67 A;  3VP9 A;  4C46 A;  4JYC A;  1SQX D;  1T3J A;  3CXH H;  3RL0 C;  3HE5 A;  4UB8 E;  3KXD A;  1FOS E;  1IFD A;  3HTK A;  4PV1 B;  3TGU G;  1VQL P;  1GL2 A;  5AVW B;  1SFC A;  2I1J A;  1RF1 A;  1KIL E;  1LGH B;  4U3F E;  4U7J A;  2N1T D;  1N7S C;  1AJY A;  2W8Z A;  2BAS A;  1NTM G;  4EDF A;  3L73 D;  2NPS D;  1M7L A;  1OMI A;  2KS1 B;  2QVA A;  3HUS C;  1VQ4 P;  2BEQ D;  2OTK E;  3TGU J;  1SQV D;  1JTH A;  3GF3 A;  2YKP A;  5E79 H;  5CHX A;  3A5T A;  3H1H E;  3D71 A;  3VMA A;  2JP3 A;  1NTM J;  2BCC E;  2W6J H;  3AE2 C;  3B5N D;  2O1J A;  1JCC A;  3AEE C;  1TU3 F;  1VQ6 P;  5CCH C;  1FBM A;  5AW9 B;  3LIE A;  3L70 G;  5TIS H;  5CJ4 A;  2Q9I A;  1S4X A;  3CC2 P;  2ZYA A;  2PFX A;  1KB9 I;  3NFQ A;  3JSV C;  4NPD A;  1NU1 K;  4AQR D;  2R5B A;  1KYO D;  3JCU E;  1SS1 A;  3CX5 D;  2H8P D;  4PD4 D;  4PJ0 E;  3FXD A;  1M90 Q;  1RE3 C;  2G8Y A;  2HFE D;  2E74 C;  2WIT A;  1KIL C;  2FYZ A;  3L70 J;  2QM7 A;  4R4M A;  1AVO A;  1JNM A;  3PJS K;  3BAS A;  2LXC B;  1LTB C;  2FYN B;  1K8A Q;  5B66 H;  3OAK A;  5AVS B;  1YTZ I;  3RK3 E;  2QJY B;  3BVH A;  3L74 D;  2Q6Q A;  3L72 D;  2FKW B;  4N78 D;  1FZC C;  1H0T B;  2RN0 A;  3H1L G;  4N3Y B;  2I1K A;  3U59 A;  1SQQ E;  3ABV C;  1PP9 D;  1KC8 Q;  2B9B A;  2WSF H;  4GOD A;  1ZRT D;  4AUW A;  2A45 G;  1PGJ A;  1AA0 A;  4TT3 H;  5APT A;  3H1L J;  1VF5 B;  2R44 A;  1G1J A;  2QIW A;  1SQP G;  2KIK A;  4XFJ A;  1JEK A;  5AVX B;  3SWF A;  1GDT A;  1USD A;  2HOD A;  4HJG H;  4NPE A;  2AXT E;  5BU5 A;  4I2L C;  3CC7 P;  2FYU G;  1EZV G;  2KZJ A;  3TNU B;  1P84 D;  2L91 A;  1NTZ G;  2W6A A;  2E43 A;  1SQP J;  4NPF X;  1NTK G;  1IFJ A;  3TGU E;  2H7H A;  1MFT A;  1SQB D;  2WSE J;  3TK1 A;  1DD4 A;  1Q90 D;  5KLV D;  3ZDM A;  1NTM E;  2FYU J;  1UIX A;  1NTZ J;  2A06 D;  3AE4 C;  1NTK J;  1H88 A;  2IZ0 A;  2W83 C;  3L37 A;  4I7Z B;  2ZJS E;  2GM4 A;  1NAF A;  3G9R A;  3NTN A;  2V7Q H;  4BRY B;  3EWK A;  2M8R A;  3R4Y A;  3FWN A;  2QJP B;  2PRR A;  4BWN A;  3H1J D;  2HR3 A;  1QVF O;  3L70 E;  3C8V A;  5AVY B;  1K05 A;  4DOJ A;  3WU2 E;  3EFF K;  1J1D B;  2POH A;  4ASV A;  2KLV A;  3CXH D;  1MUU A;  1ZN5 A;  1JMB A;  3A0B H;  3II6 A;  2Z5H A;  3TDK A;  1OWA A;  1AV1 A;  1OVR A;  3GW6 A;  3WUU A;  4PV1 D;  1JM0 A;  3AE7 C;  1K9M Q;  3GF7 A;  3A7O A;  5AVQ B;  3H32 B;  2M0B A;  1IK7 A;  1N7S A;  3PH0 A;  3P8C D;  2IBZ D;  5GTI H;  1N8R Q;  3HE4 A;  3MGN A;  3HUS A;  1NAY A;  3WUT A;  1CSB A;  1ZRT E;  5K5G B;  1J2J B;  3HE5 B;  2C0X A;  1SVF A;  2QA4 P;  3L71 G;  1DX7 A;  1USE A;  2KNC A;  3MUD C;  1GL2 B;  1FZG A;  1FZE A;  3PRJ A;  1SFC B;  1VQ7 P;  1RF1 B;  3H1L E;  1L0N G;  3L75 G;  3CL3 D;  1BGY G;  5CCH A;  1LT9 B;  5APU A;  4WY4 A;  3GG2 A;  3VN0 A;  3L71 J;  3V4Q A;  2YMY A;  3CX5 H;  4H0L C;  4PD4 H;  2OTL P;  1BE3 D;  3C1L A;  3EQ2 A;  1L0N J;  2E5Y A;  3L75 J;  5BVZ A;  1RE3 A;  1J1E B;  1BGY J;  2O01 N;  1SQP E;  1QL2 A;  2IZ1 A;  1YIJ P;  1KIL A;  5AVR B;  3Q5S A;  2LR2 A;  3RK2 B;  5EFW B;  2M3B A;  1BDD A;  1HJ0 A;  2VRS A;  1M57 D;  1T3U A;  2FYU E;  1EZV E;  1NTZ E;  2YXQ B;  2P67 A;  1BDC A;  1NTK E;  3GHG C;  4DZO A;  5CCG D;  2YO3 A;  2JO1 A;  1FDM A;  2QG4 A;  2WSF J;  1VQP P;  4M3L A;  1U7M A;  3HD7 C;  1LWU B;  4EYY Q;  5KLI B;  4I6M C;  2WVR A;  3BCC G;  2FFD B;  1N2D C;  2ZT9 B;  2V4H A;  3CXH E;  4I1L A;  1FAV A;  4YXD C;  1VF5 D;  1VQN P;  1DIP A;  3G3Z A;  2XU6 A;  3HRN A;  3BCC J;  2KP8 A;  3BCC D;  1L0L G;  3T97 A;  1P84 H;  2E76 B;  2IYP A;  2FBW C;  3Q5P A;  1MZ9 A;  3S1K A;  4BXL A;  1QX8 A;  1IFI A;  1L4A C;  3GMA A;  1H8A A;  2M5A A;  2UWJ E;  3SWY A;  1PPJ D;  3I55 P;  1GU5 A;  5E79 E;  5GTH H;  1RHZ B;  1L0L J;  1K04 A;  2ZAE B;  2IX7 C;  2O1K A;  3AEA C;  2HOD B;  1YYC A;  2GA1 A;  3FXE A;  3K5B A;  3RBX A;  2Y0E A;  1SQX G;  3AE8 C;  5TIS E;  3M0A A;  5CBO A;  4C7R A;  2W90 A;  3L71 E;  2V7Q J;  3EFG A;  4KJM A;  4D6T D;  1LNQ A;  2K1A A;  4UB6 H;  4W7Y A;  1L0N E;  3L75 E;  2R5D A;  3QH9 A;  5AVT B;  3L73 G;  1BGY E;  1SQX J;  1PV3 A;  1T6A A;  3MIW A;  1KB9 D;  1SQQ K;  3AE9 C;  1YQ4 C;  1DEE G;  1SQV G;  3KPE A;  1W2E A;  5B66 E;  2KB7 P;  2HLO A;  1ZXG A;  2HG5 D;  2JR8 A;  3A2A A;  2WMM A;  1JY2 O;  3L73 J;  4GIF A;  4DT0 A;  3M06 A;  4H13 B;  1OVU A;  1E5W A;  1IFP A;  4IFF A;  1T2K D;  2KSJ A;  1SQV J;  1OW7 A;  4GOF A;  3RL0 B;  1EXJ A;  1YQ3 C;  3I56 P;  2K88 A;  1N7L A;  1NWQ A;  3TF5 A;  3MUD A;  1KN7 A;  3PLN A;  4ZKP A;  1GL2 D;  1HF9 A;  4Z1M H;  1SFC D;  3IAO A;  5APW A;  3CCR P;  2OYI C;  1N7S B;  2Z5I A;  4WY4 C;  3N7N A;  3HE4 B;  1YIT P;  2Y9Z A;  3BCC E;  4B86 A;  1YJN P;  4YTP C;  4H44 B;  1WMK A;  1LJ2 A;  3L74 G;  2AEM A;  1NTM K;  3L72 G;  2IPP A;  1BSH A;  2M3E A;  2JKV A;  2K9Y A;  1LTG C;  3VMY A;  2D2C C;  2PAJ A;  2FY8 A;  2H89 C;  1Q82 Q;  1PP9 G;  1EQ7 A;  3H1K D;  4RO0 A;  1S1C X;  1L0L E;  3RK2 D;  1S3J A;  3L35 A;  3L74 J;  3UIA A;  3L72 J;  1QVG O;  2KLU A;  1VQ9 P;  3AEG C;  2IFN A;  2GUS A;  4IL6 H;  2E75 D;  2GUV A;  3L4F A;  1G2C A;  4WVZ A;  3VOP A;  3GHG A;  2YMK A;  1PP9 J;  5CBN A;  1VL2 A;  2E74 B;  2NZ2 A;  1LTA C;  1KIL B;  5CJ0 A;  3M0D C;  5KAF H;  2G3A A;  3HD7 A;  2JDI H;  3IN6 A;  1URQ C;  3CLQ A;  3CCE P;  1GD2 E;  1RF0 C;  3H1I D;  3Q1M A;  1SQX E;  2KYV A;  4GT1 A;  3CI9 A;  1FZC B;  3A0B E;  4C7N B;  1YJ9 P;  1X79 B;  1KQF B;  2JWD A;  1SQB G;  3AE1 C;  4GOE A;  1GW4 A;  5KLV G;  3AE5 C;  1M1K Q;  2O01 H;  3L73 E;  2Z4E A;  2AXC A;  3A3Y B;  5APQ A;  1CW5 A;  5GTI E;  2A06 G;  2DW3 A;  2NRG A;  5C39 A;  1SQV E;  1L4A A;  1SQB J;  4HYT B;  1HGV A;  1CI6 A;  3PP5 A;  5KLV J;  5KAI H;  2K9J A;  1G1I A;  4EIJ A;  3CWB D;  2RH0 A;  2ZVN B;  4TLF A;  1PGQ A;  1EDL A;  3O6Q A;  3H1J G;  1M1J C;  1X22 A;  4ASW A;  5AVV B;  3T97 B;  5APS A;  1CZQ A;  1SQP K;  1OVV A;  3G4S P;  3QWO C;  5KJ7 D;  1LTJ C;  2ZVO B;  1HH0 A;  2AEJ A;  2P10 A;  3RK3 B;  1KYO E;  1KQS O;  2OYO A;  4JBZ A;  4Y99 C;  1U7J A;  3CX5 E;  4PD4 E;  5DJT B;  3H1J J;  2FYU K;  4OH8 B;  1NKN A;  1NTZ K;  2WPV B;  2Q5U A;  1YI2 P;  2IBZ G;  2N1T C;  1NTK K;  2HPC B;  1KB9 H;  2NPS C;  4IL6 X;  1XTC C;  1BCC G;  1KMI Z;  1T2K C;  4WBA A;  4EI2 A;  5AVU B;  3GLM A;  5M1B A;  2LXB A;  3L74 E;  1SP4 A;  2LKM A;  4XA4 A;  3L72 E;  4N78 E;  1JUN A;  1NHL A;  2Q1K A;  2KOG A;  2A45 I;  2OTJ P;  2QJK B;  3Q2Y A;  3AEF C;  3B5N C;  1BCC J;  4H13 D;  2YO2 A;  1PP9 E;  4RKU J;  1BCC D;  3MZW B;  1GZL A;  1GU4 A;  1NH4 A;  1NOH A;  4W7Z A;  3HTK B;  5L8R J;  1ZME C;  1BE3 G;  3F5H A;  3KQG A;  2MKV A;  1EZV I;  1HUC A;  1X0T A;  4XE5 B;  2PGD A;  2OYI A;  1Q86 Q;  2WTY A;  1N7S D;  5AVZ B;  1GK6 A;  2HYN A;  4K3A A;  1BE3 J;  1JTH B;  1P84 E;  3O8Z A;  4H44 D;  1JMM A;  3V5B A;  1QL1 A;  2ZFC A;  4YXW H;  1WRG A;  5AW5 B;  2CPS A;  3G6E P;  1U57 A;  2E75 C;  1SQB E;  1LP1 A;  4JF7 A;  5KLV E;  5GTH E;  1FDI A;  1RQV A;  4IFM A;  1M8O B;  3S9O A;  3MTU E;  1JY3 N;  2A06 E;  1L0N K;  1Q81 Q;  1LWU C;  1FZA A;  2R3C A;  2QEX P;  4H0L B;  3S4R A;  1N73 C;  1JB0 J;  1JOC A;  1FOS F;  2B87 A;  2Q3I A;  2E74 D;  1QGK B;  3M0D A;  4KT0 J;  2WPQ A;  1KIL D;  5APV A;  1FS0 E;  4UB6 E;  3H1J E;  4OGQ B;  3AEC C;  1RH5 B;  1URQ A;  4O9B A;  4R4L A;  1RF0 A;  3NMD A;  1IFM A;  2XNX A;  4LLH A;  3CCV P;  2CK3 H;  1ZW0 A;  5TJH A;  4RJT A;  4HB1 A;  4DCK A;  4L75 A;  3KZI H;  5H2F H;  3TNU A;  2ZXE B;  1PPJ G;  3GHG B;  3SFD C;  1FC2 C;  2YIU C;  1YTZ T;  1NKZ B;  2BCC D;  2Q7C A;  1KD1 Q;  2O01 J;  2QM8 A;  3P8C E;  3OA7 A;  1S9K D;  2IBZ E;  3HD7 B;  1FU1 A;  2L5G B;  1VQO P;  1FZB A;  1JY3 P;  2OYH C;  2QE7 H;  1BCC E;  1S5L H;  1RE4 C;  3FX0 A;  1PZQ A;  2KUB A;  2ZYG A;  1LT1 A;  3TYY A;  3E1R A;  1VPC A;  1IZN B;  2W6B A;  5KJ7 C;  4D6T G;  1WT6 A;  2OAR A;  2Y0D A;  3PTZ A;  3CCM P;  1M1J A;  2JJL A;  1X8Y A;  2SPZ A;  2QSI A;  5KKZ C;  1LTJ A;  4D6T J;  1L4A B;  1Q2N A;  3RK3 D;  1L0L K;  1BE3 E;  1R5S A;  2YKQ A;  2E5T A;  1CI6 B;  3LW5 H;  4PV1 C;  2K9J B;  2N1T A;  3O6Q B;  3A0H H;  4ZKU A;  2AEF A;  3WMM 0;  3U1A A;  2NPS A;  2WT7 A;  1EDJ A;  1S2E A;  4ZNC A;  4LGD E;  1LTI C;  3V2Q A;  1R5L A;  1KFM A;  3TSI A;  4IL6 E;  5AW1 B;  2PP6 A;  1SQX K;  3MHV A;  1QLE D;  3B5N A;  1LTS C;  3SFE C;  1RQU A;  3NXS A;  4L73 A;  5KAF E;  1NU1 G;  3JC2 2;  1DD3 A;  1VQ5 P;  1LT9 A;  4HKZ H;  3B71 A;  5APY A;  2Q3E A;  4KHX A;  1KQL A;  5B5E H;  1IFN A;  1L2P A;  1BSN A;  3AE3 C;  4H44 C;  1Y9B A;  3U1C A;  1EDI A;  3ITK A;  3TGU D;  4MN4 C;  1SQV K;  1NU1 J;  1MKM A;  1S5L X;  4RES B;  3H1K G;  1SLQ A;  2WPS A;  3AE6 C;  1NU1 D;  3P8M C;  3E7K A;  3HUS B;  2KK7 A;  3AEB C;  3RBZ A;  1NTM D;  1S9K E;  1AFO A;  3CD6 P;  2FYN C;  2P58 A;  2KNC B;  3KYQ A;  1OIP A;  3M9B A;  4A7P A;  2QJY C;  3V4W A;  2P1J A;  1NO4 A;  1PPJ E;  2N9B A;  3H1K J;  1IC2 A;  3CPW O;  5CCG C;  5KAI E;  2OYI B;  2W27 A;  4WY4 B;  1HBW A;  3H1I G;  4CPG A;  3L70 D;  1LWU A;  2IYO A;  4UB8 H;  1MFZ A;  2FXM A;  3W68 A;  2JEE A;  3M9Q A;  1YJW P;  5CMZ A;  4H0L D;  1N73 A;  2FFD A;  4D6T E;  1D7M A;  2D2C B;  1JO5 A;  4OVN F;  1VF5 C;  1HGZ A;  1LP1 B;  2B88 A;  2E42 A;  2YKO A;  1ZP0 C;  3D70 A;  3H1I J;  5AW8 B;  1NYH A;  4OGQ D;  3OJA B;  1M56 D;  3V2N A;  3H25 A;  1H89 A;  1JCD A;  2XND H;  1KB9 E;  3VYI A;  2RKL A;  1PGO A;  2ZT9 D;  1Y47 A;  3RL0 g;  2FXP A;  3CME P;  2XKM A;  1KYO I;  2B87 B;  4JQ0 D;  3CWB G;  1T8Z A;  1ZR4 A;  3CX5 I;  1OXZ A;  3H1L D;  4PD4 I;  3N4X A;  3F89 A;  1KQG B;  1URQ B;  3HD7 D;  2OYH A;  1YHQ P;  2XV5 A;  2E76 D;  2O3J A;  5APX A;  5AW4 B;  1RE4 A;  4IFD K;  1UII A;  2OGU A;  2OQQ A;  3JCU H;  3WUV A;  5KJ7 A;  4OWF A;  3CWB J;  1VQ8 P;  4PJ0 H;  4I7Z C;  1ZLL A;  1E79 H;  3RK3 C;  1PFI A;  1HVV A;  1FJP A;  3M9H A;  1SQP D;  2XDJ A;  1ZOY C;  2QJP C;  2KZI A;  2R32 A;  1GK4 A;  1NU1 E;  1SQB K;  2WSC H;  3CCQ P;  4ZMD A;  1RY3 A;  2XZR A;  5KLV K;  1R8E A;  1J1D C;  3IR9 A;  2M5A B;  2FYU D;  2N9Y B;  1EZV D;  3CCL P;  1L4A D;  1NTZ D;  4EOT A;  1PIX A;  3E1I A;  3LW5 J;  3Q5R A;  4L74 A;  1DH3 A;  1AQ5 A;  1NTK D;  1GTW A;  4QMA A;  1FJK A;  1Z56 A;  1KFN A;  1M1J B;  3H1K E;  2FXO A;  2QJK C;  2WPR A;  2YNY A;  1Y8A A;  2IDB A;  3G71 P;  1OW8 A;  1XTG B;  2KS1 A;  3P32 A;  1S72 P;  1LTJ B;  1FZF A;  2J59 M;  2WSS H;  2WZ7 A;  2WQY C;  1OX3 A;  2CPB A;  4Y99 B;  1P84 I;  4L76 A;  2ZYD A;  5AW3 B;  3AED C;  3PHL A;  1GL2 C;  3CCJ P;  1SFC C;  3M91 A;  1EDK A;  1RF1 C;  2R3S A;  2N1T B;  1NGM B;  3KDP B;  3VMZ A;  2NPS B;  3I5C A;  2WT7 B;  2AXT H;  1GMJ A;  1LT9 C;  1VQM P;  3H1I E;  3RL0 D;  3FWL A;  1K73 Q;  3B8E B;  3BAT A;  2ITA A;  3KHU A;  2C9N Y;  2MJZ A;  3USS A;  1VQK P;  2IFM A;  3VP8 A;  1AQT A;  3KZI E;  1OW6 A;  5H2F E;  1ZR2 A;  1J1E C;  3B5N B;  2H43 A;  5KTB A;  1QEX A;  2P7J A;  3B4S A;  2Y0C A;  3RK2 C;  3V6I A;  1S5L E;  2RMZ A;  1KYO H;  4GDO A;  3CXH I;  3V2R A;  3L71 D;  4W80 A;  1H0T A;  1LTT C;  3CWB E;  5CCG A;  4JPZ B;  5CCH D;  1X9V A;  1W5C E;  4U3F G;  1L0N D;  4WY4 D;  3L75 D;  1KZU B;  4IOI H;  1VDF A;  5BU8 B;  1BGY D;  3VTP C;  1ZV8 A;  3CC4 P;  3LID A;  5KLI C;  3WU2 H;  2IBZ I;  4OGQ C;  1YBK A;  2JWA A;  2FFD C;  1EC5 A;  1W2B O;  2ZT9 C;  2KXP B;  4HH2 A;  2E75 B;  3R2P A;  5AW0 B;  4U3F J;  1FZC A;  2D2C D;  3H1H G;  5AW6 B;  2ZXX A; 
#chains in the Genus database with same CATH homology
 4DOJ A;  1J1D B;  1LTA C;  2POH A;  4C7N A;  2KLV A;  1KIL B;  4LC1 A;  5CJ0 A;  1MUU A;  1ZN5 A;  3M0D C;  4LGD E;  1LTI C;  2Z5H A;  3II6 A;  3V2Q A;  3HD7 A;  1OWA A;  1KFM A;  3TSI A;  1URQ C;  3CLQ A;  5AW1 B;  1GD2 E;  1RF0 C;  2PP6 A;  1MV8 A;  1SQX K;  2J58 A;  1DEB A;  2KYV A;  3A7O A;  1G2C B;  3P7K A;  5AVQ B;  3H32 B;  3B5N A;  4GT1 A;  3CI9 A;  1LTS C;  1N7S A;  3NXS A;  3P8C D;  2C9L Y;  1FZC B;  1N73 B;  1IK9 A;  4C7N B;  3HE4 A;  1X79 B;  3MGN A;  1LT9 A;  3HUS A;  1IJD B;  5AW7 B;  5APY A;  1CSB A;  4KHX A;  1J2J B;  1GW4 A;  3HE5 B;  1HTL C;  2C0X A;  1KQL A;  1SVF A;  1IFN A;  1DX7 A;  2O01 H;  2Z4E A;  1URQ D;  3A3Y B;  3U1C A;  3IFM A;  5APQ A;  1CW5 A;  1GL2 B;  1FZG A;  1FZE A;  1SFC B;  1RF1 B;  1SQV K;  2A45 H;  1JY2 N;  1IO4 A;  4RES B;  1L4A A;  1SLQ A;  2WPS A;  3P8M C;  3CL3 D;  4HYT B;  5CCH A;  1LT9 B;  4GKG A;  3HUS B;  1HJB A;  5APU A;  4WY4 A;  1HGV A;  1S9K E;  1CI6 A;  3PP5 A;  4AYC A;  1AFO A;  1JY3 O;  3VN0 A;  1G1I A;  4EIJ A;  2WWW A;  3V4Q A;  2WSE H;  3KYQ A;  3M9B A;  2YMY A;  3V2P A;  1M1J C;  3V4W A;  2OYH B;  3EQ2 A;  5AVV B;  3BRT B;  2P1J A;  1NO4 A;  5APS A;  1CZQ A;  2N9B A;  4JYB A;  5BVZ A;  1SQP K;  1HWT C;  2HPC A;  1RE3 A;  1J1E B;  1IC2 A;  5KJ7 D;  1LTJ C;  1QL2 A;  4N6J A;  5CCG C;  2OYI B;  1KIL A;  3MD0 A;  2W27 A;  4WY4 B;  1HH0 A;  5AVR B;  3RK3 B;  1HBW A;  3C9I A;  4WB4 A;  2C0W A;  3RK2 B;  4Y99 C;  2M3B A;  1GW3 A;  1N86 A;  2FYU K;  2VRS A;  4OH8 B;  1LWU A;  3VMX A;  1NKN A;  1NTZ K;  1MFZ A;  2FXM A;  3L36 A;  1T3U A;  3H32 A;  1A02 J;  2Q5U A;  2P2U A;  2JEE A;  2N1T C;  3M9Q A;  5CMZ A;  1NTK K;  2P67 A;  1N73 A;  2HPC B;  2FFD A;  2NPS C;  1XTC C;  1A02 F;  3GHG C;  4DZO A;  1JY2 P;  1JO5 A;  3H6P A;  5AW2 B;  3BRV B;  1T2K C;  4C46 A;  3VP9 A;  4WBA A;  1HGZ A;  4JYC A;  2E42 A;  5AVU B;  2YKO A;  5CCG D;  3RL0 C;  1T3J A;  2YO3 A;  3HE5 A;  5AW8 B;  1SP4 A;  1FDM A;  2LKM A;  4XA4 A;  1FOS E;  4M3L A;  3HD7 C;  4N78 E;  3OJA B;  1JUN A;  3V2N A;  1LWU B;  1NHL A;  1IFD A;  3HTK A;  2KOG A;  4I6M C;  1H89 A;  1JCD A;  2A45 I;  1GL2 A;  5AVW B;  1SFC A;  3VYI A;  2I1J A;  1RF1 A;  1LGH B;  2FFD B;  1N2D C;  3B5N C;  2N1T D;  2YO2 A;  1N7S C;  2BAS A;  2NPS D;  4I1L A;  1GZL A;  1FAV A;  1M7L A;  1GU4 A;  2XKM A;  1NH4 A;  1NOH A;  3HUS C;  1T8Z A;  4W7Z A;  1ZR4 A;  1OXZ A;  3HTK B;  3N4X A;  3G3Z A;  1JTH A;  2XU6 A;  3HRN A;  3KQG A;  1URQ B;  3HD7 D;  2OYH A;  2YKP A;  2XV5 A;  2KP8 A;  3T97 A;  1HUC A;  5CHX A;  5APX A;  5AW4 B;  3A5T A;  1RE4 A;  4IFD K;  4XE5 B;  2OYI A;  1MZ9 A;  3B5N D;  2O1J A;  2WTY A;  5KJ7 A;  1N7S D;  1IFI A;  1L4A C;  1JCC A;  5AVZ B;  1GK6 A;  5CCH C;  1FBM A;  1H8A A;  2HYN A;  3SWY A;  1ZLL A;  3LIE A;  5AW9 B;  3RK3 C;  1GU5 A;  5CJ4 A;  2Q9I A;  1JTH B;  1PFI A;  1HVV A;  1FJP A;  3M9H A;  2XDJ A;  3O8Z A;  1JMM A;  3V5B A;  2IX7 C;  3NFQ A;  1QL1 A;  2ZFC A;  4AQR D;  1NU1 K;  2R5B A;  2O1K A;  1WRG A;  2R32 A;  1GK4 A;  5AW5 B;  2CPS A;  2HOD B;  1SQB K;  2WSC H;  2H8P D;  1YYC A;  1RY3 A;  1RE3 C;  2XZR A;  5KLV K;  2HFE D;  4JF7 A;  1J1D C;  3M0A A;  2WIT A;  3IR9 A;  1KIL C;  4C7R A;  2FYZ A;  2QM7 A;  1L4A D;  4EOT A;  3E1I A;  4IFM A;  3EFG A;  3MTU E;  1JNM A;  1DH3 A;  1AQ5 A;  1JY3 N;  3BAS A;  1GTW A;  1L0N K;  1LTB C;  1LWU C;  1FZA A;  4W7Y A;  1FJK A;  2R3C A;  3OAK A;  5AVS B;  1Z56 A;  1YTZ I;  1KFN A;  1M1J B;  3BVH A;  2R5D A;  5AVT B;  2FKW B;  2WPR A;  4N78 D;  1FZC C;  2YNY A;  1N73 C;  1JOC A;  1FOS F;  1XTG B;  3P32 A;  3MIW A;  2Q3I A;  1LTJ B;  1SQQ K;  1FZF A;  2J59 M;  4N3Y B;  3M0D A;  2WPQ A;  2I1K A;  1KIL D;  5APV A;  3KPE A;  3U59 A;  1W2E A;  2WZ7 A;  1URQ A;  2KB7 P;  4O9B A;  2CPB A;  4Y99 B;  1RF0 A;  2HLO A;  2WSF H;  3NMD A;  1IFM A;  2HG5 D;  5AW3 B;  2XNX A;  4LLH A;  3A2A A;  1GL2 C;  1SFC C;  1JY2 O;  3M91 A;  4GIF A;  1RF1 C;  4AUW A;  3M06 A;  2A45 G;  2N1T B;  1E5W A;  3KDP B;  4IFF A;  3VMZ A;  2NPS B;  3I5C A;  2WT7 B;  1T2K D;  3TNU A;  2ZXE B;  1LT9 C;  5APT A;  3GHG B;  2KSJ A;  3RL0 D;  3B8E B;  1G1J A;  1YTZ T;  3BAT A;  3RL0 B;  1NKZ B;  2Q7C A;  5AVX B;  2QM8 A;  3P8C E;  2C9N Y;  2MJZ A;  3OA7 A;  3SWF A;  1S9K D;  3HD7 B;  1FU1 A;  1GDT A;  2L5G B;  2IFM A;  1N7L A;  1NWQ A;  1FZB A;  1JY3 P;  3VP8 A;  2OYH C;  2HOD A;  3MUD A;  4ZKP A;  1GL2 D;  5BU5 A;  4I2L C;  1SFC D;  1ZR2 A;  1RE4 C;  5APW A;  1J1E C;  3B5N B;  3TNU B;  3TYY A;  2OYI C;  1N7S B;  2Z5I A;  2W6A A;  4WY4 C;  1VPC A;  2H43 A;  3N7N A;  2W6B A;  5KJ7 C;  2E43 A;  5KTB A;  2P7J A;  1WT6 A;  2OAR A;  1IFJ A;  3HE4 B;  3RK2 C;  2H7H A;  4B86 A;  3TK1 A;  1NTM K;  1M1J A;  2IPP A;  2JJL A;  1X8Y A;  3V2R A;  4W80 A;  1LTT C;  1LTG C;  3VMY A;  2PAJ A;  1LTJ A;  5CCG A;  5CCH D;  1X9V A;  1L4A B;  4WY4 D;  1EQ7 A;  3RK3 D;  1KZU B;  1L0L K;  1H88 A;  1VDF A;  2YKQ A;  3L37 A;  5BU8 B;  2GM4 A;  1CI6 B;  1NAF A;  3VTP C;  1ZV8 A;  3LID A;  3L35 A;  3LW5 H;  3RK2 D;  3NTN A;  3UIA A;  2M8R A;  2IFN A;  2GUS A;  2N1T A;  2FFD C;  4ZKU A;  3WMM 0;  2GUV A;  2NPS A;  1G2C A;  3L4F A;  3U1A A;  2WT7 A;  4HH2 A;  3VOP A;  3GHG A;  3R2P A;  5AW0 B;  1FZC A;  5AVY B;  5AW6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...