4BRYB

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
PPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GEMININ
publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryB00
2Q6QA 1UIIA 4BRYA 3WUVA 2ZXXA 3WUTA 3WUUA 3E1RA 4BRYB 3F5HA 2WVRA
chains in the Genus database with same CATH superfamily
3H1KJ 2AEFA 3OAKA 3V2RA 1LTJC 4PD4E 1SFCB 3A0HH 1WMKA 1VQNP 2Y0DA 5DJUB 4XA4A 4IL6E 4UB8H 2P10A 3TK1A 1NTKE 1FBMA 1NU1G 3IR9A 3P8MC 3VMAA 3KXDA 2Z4EA 1G1IA 3OA7A 1OVVA 3N7NA 5AVUB 1L0NG 1PGOA 1BSHA 4IOIH 3W67A 2WPRA 1KFNA 1J1EB 3SWFA 3S1KA 1YI2P 1FOSE 2QJPB 2ZYAA 1HF9A 3M0DC 1ZRTE 3V6IA 3T97B 1P84I 5GTHE 1N7SC 2A45I 1KILA 1GL2D 1GZLA 5KLVD 3CWBE 2FYUK 3VMZA 1VQOP 2QM8A 3W68A 1DX7A 4Y99C 4RKUJ 1H8AA 3FXEA 1QLED 2HFED 1GTWA 1J1DC 1IC2A 4H0LD 4BXLA 3SFEC 2GA1A 3WUTA 4ZMDA 2WSEH 2LXBA 1KILB 1JY2P 4QMAA 3MD0A 5M1BA 2OYIA 2QG4A 4I6MC 1EDKA 1KQFB 1X9VA 1HVVA 3P8CD 4BRYA 2N1TB 3BRTB 3H1JG 1LTBC 3A0BH 1MUUA 1YBKA 4U7JA 3GMAA 3O8ZA 3BASA 1GL2C 3HD7A 1CW5A 4L75A 2M8RA 1ZR4A 3PRJA 3QH9A 4KJMA 3V2QA 4HB1A 1NKZB 2IX7C 2ZVOB 2ZFCA 5B5EE 4C46A 1KQGB 1NU1E 4O9BA 2QSIA 4BRYB 4H0LC 2IBZE 3CX5E 2IZ1A 2PRRA 5AVYB 4HH2A 1PL5A 4GOEA 3CCSP 2HODA 3M9QA 3ITKA 5BU5A 2WSCJ 1SQXG 1VF5D 3CPWO 1JEKA 1CI6B 4H13D 1KYOD 1KC8Q 2OGUA 3K5BA 1J2JB 3L73J 3AEBC 1NTZG 4D6TJ 1VQ7P 2QJKB 5KJ7C 5AW9B 1LWUC 5AW3B 1BGYJ 4ZKUA 2GUSA 3FXDA 1S72P 3VMXA 4TLFA 1JY3O 4XE5B 3CMEP 1BCCJ 1OW6A 2AEMA 1JNMA 1LT9A 2KNCB 3RL0B 1FZCB 1YITP 1VQ5P 3ZDMA 3HE4B 1XTCC 1IFIA 1LT1A 2C0XA 1RF0C 3H32A 3H25A 3PLNA 4KT0J 4RO0A 3AEGC 3NTNA 1RF1B 1M1JA 1NTKK 1X22A 2C9LY 1FOSF 2KS1A 2WPSA 1VF5C 4EI2A 4H13C 1A02F 1SFCD 3EFGA 1BE3D 1S3JA 1LT9B 5CBNA 1URQB 5KLIC 1KYOH 3C1LA 3FX0A 1JO5A 3VTPC 4PV1B 2YKPA 1KZUB 1YIJP 1NO4A 1NVOA 4OGQB 1H0TA 1LTJB 3L70J 3SSUA 2K3RA 3B5NA 4Z1MH 4U3FG 2IPPA 2J59M 3CC4P 4WVZA 1PP9G 4L74A 2OYHC 5KKZC 3CWBJ 4WY4A 1R5SA 1VQ9P 3UIAA 3H1LD 3HUSA 1SFCC 1T8ZA 2QRXA 5AW7B 3P7KA 3CD6P 3L37A 5AVVB 4L73A 1SQXE 3JCUH 1M8OB 1YQ3C 5APVA 3B5NB 2C0WA 3A5TA 5APUA 2FYUG 3G71P 2IFNA 1NTZE 3QWOC 1QEXA 2DW3A 1IJDB 2G8YA 1JY3N 2P58A 1JM0A 1L0LE 2AXTH 3CX5I 1MFTA 1J1EC 1KILD 1HUCA 4GIFA 3A2AA 4IFFA 2QJPC 1PPJG 4YTPC 1NU1K 2N1TD 5TISE 1NU1J 3TNUB 1KQLA 1FE6A 2KYVA 1J1DB 2Y0CA 3BCCD 3NXSA 1L4AB 1N8RQ 3GHGA 2GM4A 2WPVB 4N3YB 1M90Q 5DJTB 1RE4C 1L0NJ 2XV5A 2YKOA 1UIIA 4GDOA 3JSVC 1G1JA 1SQBG 4LGDE 1LTGC 1KILC 1IK9A 4XFJA 1R5LA 4Y28J 4U3FE 3GHGB 3AE3C 1D7MA 2B87A 1L2PA 1N2DC 1VQPP 2N1TC 4AUWA 1SQVD 1H88A 2ZJSE 2KLUA 2NZ2A 2C9NY 2OQQA 5AVRB 3WU2E 2KI7B 2P7JA 3L71E 4A7PA 2D2CB 3MUDA 1FC2C 2FYUE 2V7QJ 2LXCB 1YTZT 5CCGA 3KZIE 1NTKG 3D6ZA 2KXPB 2ZAEB 3CCEP 1ZXGA 3HTKB 1X0TA 2AEJA 2YO2A 3H1JJ 3RK2B 1GW3A 3B8EB 3IF4A 2WMMA 2QJKC 2JP3A 1URQD 4EIJA 2OYOA 2R3SA 4OVNF 5H2FE 1MKMA 3LIEA 2KLVA 1P84H 3Q2YA 1VQKP 2FYNB 1FDMA 2A45H 1KB9E 3LW5J 2K1AA 4C7NA 4OGQD 5CCHA 3V5BA 2E76B 1PV3A 4H13B 1U7JA 1QX8A 3L75D 2BCCD 1HJBA 4D6TD 1SQXJ 4HKZH 5KLIB 1RF1C 1T2KC 1NTZK 1BGYD 1NTZJ 3NFQA 2Y9ZA 2B88A 3M9BA 2IZ0A 1FZFA 5AVQB 3WUVA 1SQBE 1W5CE 3H1HD 3I55P 1RQVA 5CJ4A 1LT9C 4C7NB 1URQC 3AE1C 1L0LK 3B4SA 3B5ND 4RJTA 1WT6A 4UB8E 2R32A 4ZNCA 3KYQA 4OGQC 2YXQB 4WY4D 4N6JA 1GU5A 1OW7A 3PP5A 3WMM0 3G3ZA 2Y0EA 4DZOA 1RHZB 2VRSA 2HYNA 3MHVA 2WSCH 2W27A 1JTHB 2JDIH 1NOHA 3CXHI 1JUNA 2OTLP 1IFMA 3AE6C 4CPGA 3Q5SA 1AVYA 2IBZG 2BEQD 3EFFK 3WUUA 2YMKA 2FFDA 3HE5A 4I2LC 1T3UA 3B5NC 1L4AD 1JMMA 4PD4H 1OWAA 3E1RA 5AW4B 4U3FJ 2K37A 4WY4C 4IL6H 3GLMA 1RH5B 1R8EA 1PP9J 1M57D 1JY2O 2PAJA 4LC1A 1FZEA 1PZQA 1M1KQ 1K05A 1RQUA 3HE5B 3MTUE 2K9JA 3ABVC 4HYTB 3L72D 1KQSO 2A06D 2FYUJ 1PGQA 3KHUA 1HH0A 3M91A 2MKVA 2E43A 1L4AC 3CLQA 1SQVK 4RESB 3AE9C 2G3AA 2IFMA 2D2CD 3R4YA 1KB9I 4WWIA 1FU1A 4C7RA 3OJAB 1Z56A 1H89A 5KLVE 1NWQA 3TGUD 3Q1MA 1JCDA 1EDLA 3D70A 1QGKB 1AV1A 3RBXA 3RK2D 3GHGC 1NHLA 1DD4A 2ZVNB 2OYIB 3RK3B 1JCCA 1BE3G 5CCGD 1M7LA 1U7MA 1PFIA 1GU4A 3IN6A 4LLHA 3P8CE 1SQBK 3HD7B 3F5HA 2D2CC 1HBWA 2E76D 1S4XA 1SQBJ 1DEBA 3TDKA 5L8RJ 4M3LA 4PD4I 2H7HA 1Q82Q 2L91A 1Y8AA 3G4SP 3L4FA 3GG2A 1PGPA 4KHXA 4PJ0E 1EZVD 2Q3EA 5B5EH 1GK4A 3RK2C 1JY2N 2HODB 1VQLP 3CX5H 3H1LG 1L0LG 4UB6H 3MUDC 1GD2E 1LJ2A 1YHQP 5CCGC 4W7ZA 2J58A 3CC2P 3RL0g 1IZNB 2FYNC 1KYOE 3L74D 1NTKJ 2H88C 5GTIE 2QM7A 4WB4A 1VQ4P 3V4WA 1IFJA 2E76C 3H1ID 3H1JD 5C39A 1SQQD 1LP1A 2YO3A 3M0AA 3C9IA 1G2CA 1NH4A 2WVRA 2M3EA 1SQPD 2WZ7A 1Q86Q 3AE5C 2FXOA 3H32B 3FWNA 3HRNA 5KTBA 1K73Q 1M1JB 3E7KA 1MZ9A 2O1JA 1PIXA 2KS1B 3VP8A 2W83C 2JO1A 1NTMD 1KFMA 1LP1B 1QL2A 2WQYC 1A02J 2ITAA 1XTGB 2H89C 3PTZA 1G2CB 2V7QH 2I1KA 1FZGA 2JWAA 2WPQA 2Q5UA 4AYCA 3BCCG 2R3CA 4MN4C 1BE3E 3IFMA 5E79E 1SQPE 3CI9A 3L71G 2V4HA 3GW6A 1H0TB 2E74B 1Q7YQ 2JR8A 2E42A 1AQ5A 1KORA 2NPSA 2WSFJ 3CL3D 2QEXP 2O01J 2AXTE 1OVUA 1HJ0A 3H1KD 1AFOA 1U57A 4WY4B 5B66E 1N7SA 3HUSB 5KLVK 1N73A 4DJGA 1SQVG 5APYA 1ZV8A 3LW5H 3H1LE 1ZW0A 2IBZI 1QVGO 1T6AA 2CPBA 3RGUA 3U59A 2HPCA 1Q81Q 1AVOA 3CCLP 3KPEA 1NAFA 5CJ0A 3P32A 3CXHD 1IK7A 3AE8C 3H1KE 2KB7P 1JOCA 2ZXEB 2WT7A 3TF5A 2J5UA 2UWJE 2K9YA 3VYIA 1GL2A 3RK3D 2Q9IA 1PP9D 1FJPA 3AECC 1KILE 2R5BA 3S9OA 3CCMP 3CC7P 1VL2A 2M5AA 2LR2A 2YMYA 1LTIC 1RE3A 2KSJA 3HD7D 1ZP0C 2CPSA 2NRGA 3MIWA 3BCCE 5AW2B 1P84D 2KK7A 2RN0A 3L75G 2BCCG 4JF7A 2H43A 4YXWH 2B9BA 1S5LH 4W80A 2FKWB 2M5AB 5KJ7A 3CXHH 1LWUA 1ZR2A 1N7LA 2OYIC 3RK3C 3H1HG 1NAYA 2B87B 2GUVA 2FXPA 4BWNA 2FBWC 3FGAD 3SWYA 2R5DA 3HD7C 1EDJA 1SQVE 3O6QA 3VP9A 3VMYA 2ZXXA 4H44D 4ASVA 5AVXB 2WITA 2YIUC 2FYZA 2KP8A 2XZRA 3KZIH 1FAVA 1ZLLA 4WBAA 1DH3A 2W8ZA 4GOFA 2Q1KA 3I5CA 2O01N 1EXJA 1SQPK 5KAFE 3EQ2A 2KZIA 4N78D 3L73D 1NJIQ 4HJGH 2PP6A 4EOTA 1EQ7A 3V4QA 2KUBA 3CCUP 2SPZA 2IYOA 2B89A 2HR3A 1BCCD 3CCQP 4JYCA 5KAIE 2ZYGA 4PD4D 4H44C 3C8VA 2E74D 1KB9H 3A0HE 4IFDK 1YJNP 3H1LJ 1L0LJ 1EDIA 1QL1A 4I7ZB 1M1JC 4DT0A 1NTKD 3L75E 2BCCE 2W6AA 5KLVG 3L72G 4D6TE 1FZAA 2E75B 2A06G 3KQGA 1BGYE 3GF7A 1CSBA 3M06A 2L5GB 2QJYC 1HWTC 3JC22 1GMJA 4NPDA 3H1HE 2NPSD 2YNYA 1EC5A 1FS0E 2WTYA 3V2PA 3Q5PA 2Q7CA 3F89A 1OVRA 1KMIZ 2E74C 3L36A 3L70D 1N7SD 1ZRTD 2XU6A 5TJHA 1MFZA 4R4MA 1YYCA 1X79B 3PHLA 2N9BA 1S1CX 3V2NA 2JJLA 3TGUG 3T97A 1K9MQ 3CWBD 1ZN5A 1BSNA 3HUSC 3BCCJ 2BEZF 4TT3H 2FFDB 3CMAP 2RH0A 1S9KD 3CCJP 1VQ8P 3OW2O 3L71J 2R44A 1RE4A 2NPSC 1SVFA 3L70E 3MP7B 1YTZI 5AVWB 4GT1A 3VOPA 1Q2NA 3CCRP 1FDIA 1VPCA 3G6EP 1N73C 1W2BO 1SLQA 2Q6QA 3A0BE 1NGMB 2KZJA 5GTHH 2N1TA 1EZVG 1SQVJ 2K9JB 1S5LX 1S9KE 4ASWA 2AXCA 1VDFA 2JEEA 4W7YA 4I1LA 4R4LA 1NU1D 1RY3A 3NMDA 3L72E 2I8DA 2IBZD 3CX5D 2A06E 3KDPB 3L74G 4AQRD 1E5WA 2WSFH 3H1IG 1JB0J 1K8AQ 2O01H 1SQQG 5KJ7D 2FY8A 1L0ND 1HGVA 1CI6A 1X8YA 5K5GB 1SQPG 2CK3H 2XNXA 3PJSK 1RE3C 1JMBA 3TSIA 1OIPA 1OX3A 3TGUE 3D71A 1NTMG 4UB6E 2YIUB 2KNCA 1S2EA 2LKMA 1FZCA 1K04A 1OXZA 3HE4A 3L75J 2BCCJ 1ZMEC 1L0NE 1UIXA 1RF1A 3SWKA 5CCHD 4DCKA 2QVAA 2P67A 4K35A 1PGJA 5AW0B 2W6BA 1YJ9P 2P1JA 1SS1A 1BDDA 4JYBA 1E79H 3H1HJ 3D6YA 1DEEG 3TYYA 1URQA 1Q90D 1ZOYC 5AW6B 3AE7C 2I1JA 2E75D 4PJ0H 3H1KG 2QIWA 4H44B 1EZVE 3U1CA 1GW4A 1LTJA 2ZT9B 3U1AA 2Y9YA 3Q5RA 3IAOA 1JY3P 5CCHC 3A7OA 4NPEA 1LTTC 5GTIH 1HTLC 3LIDA 4GODA 3L74E 4YPCA 3AE4C 1SQXD 4EYYQ 3H1IE 5CHXA 2QJYB 4I7ZC 3H1JE 3USSA 1SQQE 3JCUE 1NTZD 1KD1Q 1FJKA 2WSEJ 2E75C 2HLOA 5CBOA 1VQMP 1AJYA 4IL6X 3BVHA 3M9HA 2OTJP 2XNDH 3BATA 3S4RA 1L0LD 3Q3DA 3AE2C 3M0DA 1NTME 2E5YA 1BDCA 1VQ6P 1LTAC 4JBZA 3FWLA 5CMZA 3G9RA 2RKLA 5AVSB 1M56D 2QE7H 1DD3A 1LTSC 3I56P 5KLVJ 5E79H 3L72J 2H8PD 1WRGA 1SP4A 2A45G 1Y9BA 1OMIA 5AW5B 2OARA 2NPSB 4B86A 3TNUA 2Z5IA 3AEFC 1L4AA 1KV4A 1OFCX 5APSA 3SFDC 5BVZA 3N4XA 1EXIA 1YJWP 2FFDC 1N7SB 2M0BA 2WWWA 2N9YB 1GDTA 3AEEC 5B66H 1N73B 1T3JA 1MV8A 2QA4P 2XKMA 4Y99B 4U3FD 2YXRB 3TGUJ 2XDJA 2M3BA 2Q3IA 2HPCB 5APQA 4L76A 1OW8A 3EWKA 3RBZA 5TISH 1L0NK 3L71D 1FDOA 1KYOI 5AVZB 1KN7A 3II6A 1Y47A 1IFDA 3MZWB 1LGHB 1S5LE 2PFXA 2FYUD 2WT7B 3CXHE 1DIPA 3L73G 3AEDC 1GL2B 3VN0A 1AA0A 3H6PA 1EZVI 4D6TG 3CCVP 3A3YB 2K88A 4JPZB 4IFMA 1FZBA 5AW8B 1BGYG 1GK6A 2KSEA 1YQ4C 3RK3E 1PP9E 3HTKA 1BCCG 3E1IA 2OTKE 1IO4A 4H0LB 2W6JH 2W90A 1CZQA 1IFNA 2HG5D 1PPJD 3PH0A 3RL0D 2KOGA 1IFPA 1P84E 3AEAC 2MJZA 2RMZA 3WU2H 1KB9D 1RF0A 2IDBA 4GKGA 1LWUB 3MGNA 5AW1B 1T2KD 3L74J 2O1KA 1SQQK 3H1IJ 1NYHA 1SQQJ 1LNQA 2IYPA 2YKQA 3BRVB 2O3JA 1HGZA 2ZT9D 2KIKA 1BE3J 5AVTB 2PGDA 1QVFO 1NKNA 1SQBD 3O6QB 1SQPJ 1PPJE 4PV1D 2Z5HA 2ZYDA 3L70G 2FXMA 3B71A 3R2PA 1OZHA 4NPFX 5APXA 5APWA 1USDA 1NTMK 4EDFA 3RL0C 1VF5B 1FZCC 1W2EA 1NTMJ 1SQXK 3L35A 5H2FH 5EFWB 2POHA 3CWBG 4OWFA 1USEA 2JKVA 5BU8B 2P2UA 2OYHA 4K3AA 3GF3A 2BASA 2JWDA 5APTA 1N86A 1TU3F 1SFCA 5KAFH 2ZT9C 4JQ0D 4N78E 3L73E 1JTHA 2E5TA 1KTMA 4ZKPA 4PV1C 2WSSH 4DOJA 1AQTA 5KAIH 1BCCE 4OH8B 2OYHB 4YXDC 5KKZB
chains in the Genus database with same CATH topology
2Q6QA 1UIIA 4BRYA 3WUVA 2ZXXA 3WUTA 3WUUA 3E1RA 4BRYB 3F5HA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q6Q A;  1UII A;  4BRY A;  3WUV A;  2ZXX A;  3WUT A;  3WUU A;  3E1R A;  4BRY B;  3F5H A;  2WVR A; 
#chains in the Genus database with same CATH topology
 3H1K J;  2AEF A;  3OAK A;  3V2R A;  1LTJ C;  4PD4 E;  1SFC B;  3A0H H;  1WMK A;  1VQN P;  2Y0D A;  5DJU B;  4XA4 A;  4IL6 E;  4UB8 H;  2P10 A;  3TK1 A;  1NTK E;  1FBM A;  1NU1 G;  3IR9 A;  3P8M C;  3VMA A;  3KXD A;  2Z4E A;  1G1I A;  3OA7 A;  1OVV A;  3N7N A;  5AVU B;  1L0N G;  1PGO A;  1BSH A;  4IOI H;  3W67 A;  2WPR A;  1KFN A;  1J1E B;  3SWF A;  3S1K A;  1YI2 P;  1FOS E;  2QJP B;  2ZYA A;  1HF9 A;  3M0D C;  1ZRT E;  3V6I A;  3T97 B;  1P84 I;  5GTH E;  1N7S C;  2A45 I;  1KIL A;  1GL2 D;  1GZL A;  5KLV D;  3CWB E;  2FYU K;  3VMZ A;  1VQO P;  2QM8 A;  3W68 A;  1DX7 A;  4Y99 C;  4RKU J;  1H8A A;  3FXE A;  1QLE D;  2HFE D;  1GTW A;  1J1D C;  1IC2 A;  4H0L D;  4BXL A;  3SFE C;  2GA1 A;  3WUT A;  4ZMD A;  2WSE H;  2LXB A;  1KIL B;  1JY2 P;  4QMA A;  3MD0 A;  5M1B A;  2OYI A;  2QG4 A;  4I6M C;  1EDK A;  1KQF B;  1X9V A;  1HVV A;  3P8C D;  4BRY A;  2N1T B;  3BRT B;  3H1J G;  1LTB C;  3A0B H;  1MUU A;  1YBK A;  4U7J A;  3GMA A;  3O8Z A;  3BAS A;  1GL2 C;  3HD7 A;  1CW5 A;  4L75 A;  2M8R A;  1ZR4 A;  3PRJ A;  3QH9 A;  4KJM A;  3V2Q A;  4HB1 A;  1NKZ B;  2IX7 C;  2ZVO B;  2ZFC A;  5B5E E;  4C46 A;  1KQG B;  1NU1 E;  4O9B A;  2QSI A;  4BRY B;  4H0L C;  2IBZ E;  3CX5 E;  2IZ1 A;  2PRR A;  5AVY B;  4HH2 A;  1PL5 A;  4GOE A;  3CCS P;  2HOD A;  3M9Q A;  3ITK A;  5BU5 A;  2WSC J;  1SQX G;  1VF5 D;  3CPW O;  1JEK A;  1CI6 B;  4H13 D;  1KYO D;  1KC8 Q;  2OGU A;  3K5B A;  1J2J B;  3L73 J;  3AEB C;  1NTZ G;  4D6T J;  1VQ7 P;  2QJK B;  5KJ7 C;  5AW9 B;  1LWU C;  5AW3 B;  1BGY J;  4ZKU A;  2GUS A;  3FXD A;  1S72 P;  3VMX A;  4TLF A;  1JY3 O;  4XE5 B;  3CME P;  1BCC J;  1OW6 A;  2AEM A;  1JNM A;  1LT9 A;  2KNC B;  3RL0 B;  1FZC B;  1YIT P;  1VQ5 P;  3ZDM A;  3HE4 B;  1XTC C;  1IFI A;  1LT1 A;  2C0X A;  1RF0 C;  3H32 A;  3H25 A;  3PLN A;  4KT0 J;  4RO0 A;  3AEG C;  3NTN A;  1RF1 B;  1M1J A;  1NTK K;  1X22 A;  2C9L Y;  1FOS F;  2KS1 A;  2WPS A;  1VF5 C;  4EI2 A;  4H13 C;  1A02 F;  1SFC D;  3EFG A;  1BE3 D;  1S3J A;  1LT9 B;  5CBN A;  1URQ B;  5KLI C;  1KYO H;  3C1L A;  3FX0 A;  1JO5 A;  3VTP C;  4PV1 B;  2YKP A;  1KZU B;  1YIJ P;  1NO4 A;  1NVO A;  4OGQ B;  1H0T A;  1LTJ B;  3L70 J;  3SSU A;  2K3R A;  3B5N A;  4Z1M H;  4U3F G;  2IPP A;  2J59 M;  3CC4 P;  4WVZ A;  1PP9 G;  4L74 A;  2OYH C;  5KKZ C;  3CWB J;  4WY4 A;  1R5S A;  1VQ9 P;  3UIA A;  3H1L D;  3HUS A;  1SFC C;  1T8Z A;  2QRX A;  5AW7 B;  3P7K A;  3CD6 P;  3L37 A;  5AVV B;  4L73 A;  1SQX E;  3JCU H;  1M8O B;  1YQ3 C;  5APV A;  3B5N B;  2C0W A;  3A5T A;  5APU A;  2FYU G;  3G71 P;  2IFN A;  1NTZ E;  3QWO C;  1QEX A;  2DW3 A;  1IJD B;  2G8Y A;  1JY3 N;  2P58 A;  1JM0 A;  1L0L E;  2AXT H;  3CX5 I;  1MFT A;  1J1E C;  1KIL D;  1HUC A;  4GIF A;  3A2A A;  4IFF A;  2QJP C;  1PPJ G;  4YTP C;  1NU1 K;  2N1T D;  5TIS E;  1NU1 J;  3TNU B;  1KQL A;  1FE6 A;  2KYV A;  1J1D B;  2Y0C A;  3BCC D;  3NXS A;  1L4A B;  1N8R Q;  3GHG A;  2GM4 A;  2WPV B;  4N3Y B;  1M90 Q;  5DJT B;  1RE4 C;  1L0N J;  2XV5 A;  2YKO A;  1UII A;  4GDO A;  3JSV C;  1G1J A;  1SQB G;  4LGD E;  1LTG C;  1KIL C;  1IK9 A;  4XFJ A;  1R5L A;  4Y28 J;  4U3F E;  3GHG B;  3AE3 C;  1D7M A;  2B87 A;  1L2P A;  1N2D C;  1VQP P;  2N1T C;  4AUW A;  1SQV D;  1H88 A;  2ZJS E;  2KLU A;  2NZ2 A;  2C9N Y;  2OQQ A;  5AVR B;  3WU2 E;  2KI7 B;  2P7J A;  3L71 E;  4A7P A;  2D2C B;  3MUD A;  1FC2 C;  2FYU E;  2V7Q J;  2LXC B;  1YTZ T;  5CCG A;  3KZI E;  1NTK G;  3D6Z A;  2KXP B;  2ZAE B;  3CCE P;  1ZXG A;  3HTK B;  1X0T A;  2AEJ A;  2YO2 A;  3H1J J;  3RK2 B;  1GW3 A;  3B8E B;  3IF4 A;  2WMM A;  2QJK C;  2JP3 A;  1URQ D;  4EIJ A;  2OYO A;  2R3S A;  4OVN F;  5H2F E;  1MKM A;  3LIE A;  2KLV A;  1P84 H;  3Q2Y A;  1VQK P;  2FYN B;  1FDM A;  2A45 H;  1KB9 E;  3LW5 J;  2K1A A;  4C7N A;  4OGQ D;  5CCH A;  3V5B A;  2E76 B;  1PV3 A;  4H13 B;  1U7J A;  1QX8 A;  3L75 D;  2BCC D;  1HJB A;  4D6T D;  1SQX J;  4HKZ H;  5KLI B;  1RF1 C;  1T2K C;  1NTZ K;  1BGY D;  1NTZ J;  3NFQ A;  2Y9Z A;  2B88 A;  3M9B A;  2IZ0 A;  1FZF A;  5AVQ B;  3WUV A;  1SQB E;  1W5C E;  3H1H D;  3I55 P;  1RQV A;  5CJ4 A;  1LT9 C;  4C7N B;  1URQ C;  3AE1 C;  1L0L K;  3B4S A;  3B5N D;  4RJT A;  1WT6 A;  4UB8 E;  2R32 A;  4ZNC A;  3KYQ A;  4OGQ C;  2YXQ B;  4WY4 D;  4N6J A;  1GU5 A;  1OW7 A;  3PP5 A;  3WMM 0;  3G3Z A;  2Y0E A;  4DZO A;  1RHZ B;  2VRS A;  2HYN A;  3MHV A;  2WSC H;  2W27 A;  1JTH B;  2JDI H;  1NOH A;  3CXH I;  1JUN A;  2OTL P;  1IFM A;  3AE6 C;  4CPG A;  3Q5S A;  1AVY A;  2IBZ G;  2BEQ D;  3EFF K;  3WUU A;  2YMK A;  2FFD A;  3HE5 A;  4I2L C;  1T3U A;  3B5N C;  1L4A D;  1JMM A;  4PD4 H;  1OWA A;  3E1R A;  5AW4 B;  4U3F J;  2K37 A;  4WY4 C;  4IL6 H;  3GLM A;  1RH5 B;  1R8E A;  1PP9 J;  1M57 D;  1JY2 O;  2PAJ A;  4LC1 A;  1FZE A;  1PZQ A;  1M1K Q;  1K05 A;  1RQU A;  3HE5 B;  3MTU E;  2K9J A;  3ABV C;  4HYT B;  3L72 D;  1KQS O;  2A06 D;  2FYU J;  1PGQ A;  3KHU A;  1HH0 A;  3M91 A;  2MKV A;  2E43 A;  1L4A C;  3CLQ A;  1SQV K;  4RES B;  3AE9 C;  2G3A A;  2IFM A;  2D2C D;  3R4Y A;  1KB9 I;  4WWI A;  1FU1 A;  4C7R A;  3OJA B;  1Z56 A;  1H89 A;  5KLV E;  1NWQ A;  3TGU D;  3Q1M A;  1JCD A;  1EDL A;  3D70 A;  1QGK B;  1AV1 A;  3RBX A;  3RK2 D;  3GHG C;  1NHL A;  1DD4 A;  2ZVN B;  2OYI B;  3RK3 B;  1JCC A;  1BE3 G;  5CCG D;  1M7L A;  1U7M A;  1PFI A;  1GU4 A;  3IN6 A;  4LLH A;  3P8C E;  1SQB K;  3HD7 B;  3F5H A;  2D2C C;  1HBW A;  2E76 D;  1S4X A;  1SQB J;  1DEB A;  3TDK A;  5L8R J;  4M3L A;  4PD4 I;  2H7H A;  1Q82 Q;  2L91 A;  1Y8A A;  3G4S P;  3L4F A;  3GG2 A;  1PGP A;  4KHX A;  4PJ0 E;  1EZV D;  2Q3E A;  5B5E H;  1GK4 A;  3RK2 C;  1JY2 N;  2HOD B;  1VQL P;  3CX5 H;  3H1L G;  1L0L G;  4UB6 H;  3MUD C;  1GD2 E;  1LJ2 A;  1YHQ P;  5CCG C;  4W7Z A;  2J58 A;  3CC2 P;  3RL0 g;  1IZN B;  2FYN C;  1KYO E;  3L74 D;  1NTK J;  2H88 C;  5GTI E;  2QM7 A;  4WB4 A;  1VQ4 P;  3V4W A;  1IFJ A;  2E76 C;  3H1I D;  3H1J D;  5C39 A;  1SQQ D;  1LP1 A;  2YO3 A;  3M0A A;  3C9I A;  1G2C A;  1NH4 A;  2WVR A;  2M3E A;  1SQP D;  2WZ7 A;  1Q86 Q;  3AE5 C;  2FXO A;  3H32 B;  3FWN A;  3HRN A;  5KTB A;  1K73 Q;  1M1J B;  3E7K A;  1MZ9 A;  2O1J A;  1PIX A;  2KS1 B;  3VP8 A;  2W83 C;  2JO1 A;  1NTM D;  1KFM A;  1LP1 B;  1QL2 A;  2WQY C;  1A02 J;  2ITA A;  1XTG B;  2H89 C;  3PTZ A;  1G2C B;  2V7Q H;  2I1K A;  1FZG A;  2JWA A;  2WPQ A;  2Q5U A;  4AYC A;  3BCC G;  2R3C A;  4MN4 C;  1BE3 E;  3IFM A;  5E79 E;  1SQP E;  3CI9 A;  3L71 G;  2V4H A;  3GW6 A;  1H0T B;  2E74 B;  1Q7Y Q;  2JR8 A;  2E42 A;  1AQ5 A;  1KOR A;  2NPS A;  2WSF J;  3CL3 D;  2QEX P;  2O01 J;  2AXT E;  1OVU A;  1HJ0 A;  3H1K D;  1AFO A;  1U57 A;  4WY4 B;  5B66 E;  1N7S A;  3HUS B;  5KLV K;  1N73 A;  4DJG A;  1SQV G;  5APY A;  1ZV8 A;  3LW5 H;  3H1L E;  1ZW0 A;  2IBZ I;  1QVG O;  1T6A A;  2CPB A;  3RGU A;  3U59 A;  2HPC A;  1Q81 Q;  1AVO A;  3CCL P;  3KPE A;  1NAF A;  5CJ0 A;  3P32 A;  3CXH D;  1IK7 A;  3AE8 C;  3H1K E;  2KB7 P;  1JOC A;  2ZXE B;  2WT7 A;  3TF5 A;  2J5U A;  2UWJ E;  2K9Y A;  3VYI A;  1GL2 A;  3RK3 D;  2Q9I A;  1PP9 D;  1FJP A;  3AEC C;  1KIL E;  2R5B A;  3S9O A;  3CCM P;  3CC7 P;  1VL2 A;  2M5A A;  2LR2 A;  2YMY A;  1LTI C;  1RE3 A;  2KSJ A;  3HD7 D;  1ZP0 C;  2CPS A;  2NRG A;  3MIW A;  3BCC E;  5AW2 B;  1P84 D;  2KK7 A;  2RN0 A;  3L75 G;  2BCC G;  4JF7 A;  2H43 A;  4YXW H;  2B9B A;  1S5L H;  4W80 A;  2FKW B;  2M5A B;  5KJ7 A;  3CXH H;  1LWU A;  1ZR2 A;  1N7L A;  2OYI C;  3RK3 C;  3H1H G;  1NAY A;  2B87 B;  2GUV A;  2FXP A;  4BWN A;  2FBW C;  3FGA D;  3SWY A;  2R5D A;  3HD7 C;  1EDJ A;  1SQV E;  3O6Q A;  3VP9 A;  3VMY A;  2ZXX A;  4H44 D;  4ASV A;  5AVX B;  2WIT A;  2YIU C;  2FYZ A;  2KP8 A;  2XZR A;  3KZI H;  1FAV A;  1ZLL A;  4WBA A;  1DH3 A;  2W8Z A;  4GOF A;  2Q1K A;  3I5C A;  2O01 N;  1EXJ A;  1SQP K;  5KAF E;  3EQ2 A;  2KZI A;  4N78 D;  3L73 D;  1NJI Q;  4HJG H;  2PP6 A;  4EOT A;  1EQ7 A;  3V4Q A;  2KUB A;  3CCU P;  2SPZ A;  2IYO A;  2B89 A;  2HR3 A;  1BCC D;  3CCQ P;  4JYC A;  5KAI E;  2ZYG A;  4PD4 D;  4H44 C;  3C8V A;  2E74 D;  1KB9 H;  3A0H E;  4IFD K;  1YJN P;  3H1L J;  1L0L J;  1EDI A;  1QL1 A;  4I7Z B;  1M1J C;  4DT0 A;  1NTK D;  3L75 E;  2BCC E;  2W6A A;  5KLV G;  3L72 G;  4D6T E;  1FZA A;  2E75 B;  2A06 G;  3KQG A;  1BGY E;  3GF7 A;  1CSB A;  3M06 A;  2L5G B;  2QJY C;  1HWT C;  3JC2 2;  1GMJ A;  4NPD A;  3H1H E;  2NPS D;  2YNY A;  1EC5 A;  1FS0 E;  2WTY A;  3V2P A;  3Q5P A;  2Q7C A;  3F89 A;  1OVR A;  1KMI Z;  2E74 C;  3L36 A;  3L70 D;  1N7S D;  1ZRT D;  2XU6 A;  5TJH A;  1MFZ A;  4R4M A;  1YYC A;  1X79 B;  3PHL A;  2N9B A;  1S1C X;  3V2N A;  2JJL A;  3TGU G;  3T97 A;  1K9M Q;  3CWB D;  1ZN5 A;  1BSN A;  3HUS C;  3BCC J;  2BEZ F;  4TT3 H;  2FFD B;  3CMA P;  2RH0 A;  1S9K D;  3CCJ P;  1VQ8 P;  3OW2 O;  3L71 J;  2R44 A;  1RE4 A;  2NPS C;  1SVF A;  3L70 E;  3MP7 B;  1YTZ I;  5AVW B;  4GT1 A;  3VOP A;  1Q2N A;  3CCR P;  1FDI A;  1VPC A;  3G6E P;  1N73 C;  1W2B O;  1SLQ A;  2Q6Q A;  3A0B E;  1NGM B;  2KZJ A;  5GTH H;  2N1T A;  1EZV G;  1SQV J;  2K9J B;  1S5L X;  1S9K E;  4ASW A;  2AXC A;  1VDF A;  2JEE A;  4W7Y A;  4I1L A;  4R4L A;  1NU1 D;  1RY3 A;  3NMD A;  3L72 E;  2I8D A;  2IBZ D;  3CX5 D;  2A06 E;  3KDP B;  3L74 G;  4AQR D;  1E5W A;  2WSF H;  3H1I G;  1JB0 J;  1K8A Q;  2O01 H;  1SQQ G;  5KJ7 D;  2FY8 A;  1L0N D;  1HGV A;  1CI6 A;  1X8Y A;  5K5G B;  1SQP G;  2CK3 H;  2XNX A;  3PJS K;  1RE3 C;  1JMB A;  3TSI A;  1OIP A;  1OX3 A;  3TGU E;  3D71 A;  1NTM G;  4UB6 E;  2YIU B;  2KNC A;  1S2E A;  2LKM A;  1FZC A;  1K04 A;  1OXZ A;  3HE4 A;  3L75 J;  2BCC J;  1ZME C;  1L0N E;  1UIX A;  1RF1 A;  3SWK A;  5CCH D;  4DCK A;  2QVA A;  2P67 A;  4K35 A;  1PGJ A;  5AW0 B;  2W6B A;  1YJ9 P;  2P1J A;  1SS1 A;  1BDD A;  4JYB A;  1E79 H;  3H1H J;  3D6Y A;  1DEE G;  3TYY A;  1URQ A;  1Q90 D;  1ZOY C;  5AW6 B;  3AE7 C;  2I1J A;  2E75 D;  4PJ0 H;  3H1K G;  2QIW A;  4H44 B;  1EZV E;  3U1C A;  1GW4 A;  1LTJ A;  2ZT9 B;  3U1A A;  2Y9Y A;  3Q5R A;  3IAO A;  1JY3 P;  5CCH C;  3A7O A;  4NPE A;  1LTT C;  5GTI H;  1HTL C;  3LID A;  4GOD A;  3L74 E;  4YPC A;  3AE4 C;  1SQX D;  4EYY Q;  3H1I E;  5CHX A;  2QJY B;  4I7Z C;  3H1J E;  3USS A;  1SQQ E;  3JCU E;  1NTZ D;  1KD1 Q;  1FJK A;  2WSE J;  2E75 C;  2HLO A;  5CBO A;  1VQM P;  1AJY A;  4IL6 X;  3BVH A;  3M9H A;  2OTJ P;  2XND H;  3BAT A;  3S4R A;  1L0L D;  3Q3D A;  3AE2 C;  3M0D A;  1NTM E;  2E5Y A;  1BDC A;  1VQ6 P;  1LTA C;  4JBZ A;  3FWL A;  5CMZ A;  3G9R A;  2RKL A;  5AVS B;  1M56 D;  2QE7 H;  1DD3 A;  1LTS C;  3I56 P;  5KLV J;  5E79 H;  3L72 J;  2H8P D;  1WRG A;  1SP4 A;  2A45 G;  1Y9B A;  1OMI A;  5AW5 B;  2OAR A;  2NPS B;  4B86 A;  3TNU A;  2Z5I A;  3AEF C;  1L4A A;  1KV4 A;  1OFC X;  5APS A;  3SFD C;  5BVZ A;  3N4X A;  1EXI A;  1YJW P;  2FFD C;  1N7S B;  2M0B A;  2WWW A;  2N9Y B;  1GDT A;  3AEE C;  5B66 H;  1N73 B;  1T3J A;  1MV8 A;  2QA4 P;  2XKM A;  4Y99 B;  4U3F D;  2YXR B;  3TGU J;  2XDJ A;  2M3B A;  2Q3I A;  2HPC B;  5APQ A;  4L76 A;  1OW8 A;  3EWK A;  3RBZ A;  5TIS H;  1L0N K;  3L71 D;  1FDO A;  1KYO I;  5AVZ B;  1KN7 A;  3II6 A;  1Y47 A;  1IFD A;  3MZW B;  1LGH B;  1S5L E;  2PFX A;  2FYU D;  2WT7 B;  3CXH E;  1DIP A;  3L73 G;  3AED C;  1GL2 B;  3VN0 A;  1AA0 A;  3H6P A;  1EZV I;  4D6T G;  3CCV P;  3A3Y B;  2K88 A;  4JPZ B;  4IFM A;  1FZB A;  5AW8 B;  1BGY G;  1GK6 A;  2KSE A;  1YQ4 C;  3RK3 E;  1PP9 E;  3HTK A;  1BCC G;  3E1I A;  2OTK E;  1IO4 A;  4H0L B;  2W6J H;  2W90 A;  1CZQ A;  1IFN A;  2HG5 D;  1PPJ D;  3PH0 A;  3RL0 D;  2KOG A;  1IFP A;  1P84 E;  3AEA C;  2MJZ A;  2RMZ A;  3WU2 H;  1KB9 D;  1RF0 A;  2IDB A;  4GKG A;  1LWU B;  3MGN A;  5AW1 B;  1T2K D;  3L74 J;  2O1K A;  1SQQ K;  3H1I J;  1NYH A;  1SQQ J;  1LNQ A;  2IYP A;  2YKQ A;  3BRV B;  2O3J A;  1HGZ A;  2ZT9 D;  2KIK A;  1BE3 J;  5AVT B;  2PGD A;  1QVF O;  1NKN A;  1SQB D;  3O6Q B;  1SQP J;  1PPJ E;  4PV1 D;  2Z5H A;  2ZYD A;  3L70 G;  2FXM A;  3B71 A;  3R2P A;  1OZH A;  4NPF X;  5APX A;  5APW A;  1USD A;  1NTM K;  4EDF A;  3RL0 C;  1VF5 B;  1FZC C;  1W2E A;  1NTM J;  1SQX K;  3L35 A;  5H2F H;  5EFW B;  2POH A;  3CWB G;  4OWF A;  1USE A;  2JKV A;  5BU8 B;  2P2U A;  2OYH A;  4K3A A;  3GF3 A;  2BAS A;  2JWD A;  5APT A;  1N86 A;  1TU3 F;  1SFC A;  5KAF H;  2ZT9 C;  4JQ0 D;  4N78 E;  3L73 E;  1JTH A;  2E5T A;  1KTM A;  4ZKP A;  4PV1 C;  2WSS H;  4DOJ A;  1AQT A;  5KAI H;  1BCC E;  4OH8 B;  2OYH B;  4YXD C;  5KKZ B; 
#chains in the Genus database with same CATH homology
 2Q6Q A;  1UII A;  4BRY A;  3WUV A;  2ZXX A;  3WUT A;  3WUU A;  3E1R A;  4BRY B;  3F5H A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...