4BRYB

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
PPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GEMININ
publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryB00
2WVRA 3F5HA 3E1RA 3WUVA 3WUTA 2Q6QA 3WUUA 4BRYB 4BRYA 2ZXXA 1UIIA
chains in the Genus database with same CATH superfamily
2P58A 2QIWA 1NKZB 3LW5H 1SQBJ 2HODB 3GG2A 2K88A 2NPSD 5KLVK 4L76A 1LTJB 2K37A 3V4WA 1K05A 5KLVE 3CC2P 3Q2YA 2Y9YA 1NKNA 1CI6B 1KB9I 5KJ7D 3LIEA 3OJAB 2KIKA 5KKZC 2QJYC 1NU1G 2W6BA 1HJBA 1P84E 1WT6A 1EZVD 1SQVK 3PJSK 1SLQA 1RF0A 2AXCA 3CXHD 1FZCB 1HJ0A 4WY4D 1UIIA 3A0BE 1J1EC 4HB1A 1GU5A 3BATA 4IOIH 3H1KD 4H44D 1FZFA 3I5CA 5AVSB 2YO3A 3PP5A 1Q2NA 2IBZD 4N3YB 4I6MC 4O9BA 2QEXP 2BCCG 1YJWP 3T97B 1T3JA 1KYOD 5KLVJ 1K9MQ 1LJ2A 2IYOA 4H0LC 1IO4A 1N73C 2WPQA 3BASA 1HBWA 1LWUB 1N8RQ 1LTAC 1KFNA 3TGUD 2OTKE 1VPCA 2K9YA 2I8DA 4HJGH 2MJZA 3BRTB 2Y0DA 1IFPA 1M1JB 4I7ZC 3MD0A 3TNUB 3G6EP 4U3FE 1JY2N 2FYNC 1ZP0C 1PIXA 4WBAA 1PGOA 4RJTA 3FWNA 4KHXA 1JY3N 2GUSA 3N7NA 2M0BA 3HTKA 1VQ5P 1X9VA 3M0AA 2Q3IA 1OW8A 5AVQB 4XFJA 1S72P 5B66E 2LXCB 3SWYA 3LIDA 3L70G 1SQPG 1ZXGA 3W68A 2IYPA 3HUSB 4NPEA 3A0HE 4WVZA 1H0TA 1Q7YQ 1OW7A 3RK3B 2O1KA 3H1LE 2R44A 3H1HD 3P8CD 2ITAA 2QM8A 1G2CB 3AEAC 4K35A 1G1JA 3IF4A 4W80A 3H1JD 5CBNA 5CCHD 1K73Q 1IFNA 2D2CC 2KXPB 5KAFH 2KB7P 1R8EA 4GODA 1HVVA 1JY2O 2A06D 4ZMDA 2KSEA 2Q6QA 2N9YB 4PJ0H 1SQBD 2LXBA 2ZFCA 2R5BA 3S1KA 4XA4A 5E79H 1X22A 3L4FA 1NJIQ 1URQA 2KNCB 2WT7B 1YIJP 2MKVA 1YHQP 2WSFJ 1PP9D 2G8YA 3TGUG 3H1LJ 1FOSF 2E76D 2WQYC 3CMAP 5APTA 2E75D 1RH5B 1M56D 1MUUA 2YKPA 2G3AA 1KYOI 5AW0B 4RO0A 3VTPC 2WPRA 3GHGC 2K9JA 1EXJA 1KZUB 1BE3E 2HR3A 3HD7D 1M8OB 1KD1Q 1T2KC 3GHGA 1HUCA 3L72E 4R4LA 2E74D 2V7QH 2XDJA 1L0NJ 3NFQA 1PZQA 3L71G 2J5UA 1Y8AA 1AJYA 1NTMK 2AEJA 4EIJA 1GL2D 1NTME 2POHA 1AQ5A 3RL0g 2DW3A 3AEDC 1S4XA 4QMAA 2P10A 3PHLA 3GF7A 2J59M 4YXWH 1BDCA 3MGNA 3RL0D 2Q1KA 1BGYG 1SFCC 1BCCE 1M1KQ 5APYA 4OGQD 1EDLA 1NTZK 5AW7B 1VF5B 2ZXEB 2QJKB 3E1RA 1U7MA 1NTZE 2OYHB 4EDFA 2OQQA 3CCVP 1BE3J 3GF3A 3V2NA 3A7OA 3L72J 2ZJSE 2ZT9D 1S9KE 2FYUG 2OYIB 2NRGA 2HODA 3H1JG 1NTMJ 1LTJC 1GMJA 3ZDMA 1S3JA 3CWBE 3B5NB 2KZJA 1LTIC 1SQQK 1ZMEC 4RKUJ 4YXDC 4JPZB 3CMEP 1SQQE 3L71E 2VRSA 1PGPA 1RQUA 3MZWB 2E74B 3WU2H 1FAVA 1RF1B 1KQLA 3GW6A 2YMKA 1LTTC 2FYZA 1FZCC 4AQRD 5DJUB 2GM4A 1FZCA 4OVNF 1PP9G 1NTZJ 1N7SA 5AW9B 4BWNA 3L74D 1K8AQ 2YXRB 1Y9BA 2KLVA 3VMYA 4BRYB 2ZVOB 4D6TD 3CD6P 2JKVA 1E79H 1GDTA 5AVXB 2KP8A 2JJLA 3SFDC 2OTJP 5GTIH 3T97A 3CWBJ 4K3AA 2N1TA 5EFWB 1IK9A 5AW4B 1FZGA 3N4XA 1LWUC 2FYUK 4C7NB 1SQQJ 4N78E 1DEEG 3Q5RA 1LWUA 2FFDB 1SP4A 2A45H 1EXIA 2JEEA 1SQXG 1M1JC 3HE4A 1L0LG 3HRNA 2W8ZA 2Q7CA 3EFGA 2AXTH 2IZ1A 1FS0E 1M1JA 3E1IA 5AVRB 3AE5C 3TNUA 1LP1B 2XV5A 1H89A 3H1LD 3BCCE 5E79E 1AA0A 2FKWB 2N9BA 3CCJP 3V2PA 1JCDA 2KOGA 5AVZB 4PD4D 1GZLA 1KORA 2WSCH 3CX5H 3AEEC 3KPEA 3JC22 3TYYA 2WTYA 1JUNA 2H7HA 3I56P 5B5EH 2AEFA 3NTNA 3L73G 5BU8B 3S4RA 1L0ND 3R4YA 1X8YA 1M90Q 3S9OA 1OZHA 4LC1A 1PGJA 1PPJG 2M5AB 3HUSC 1IFMA 3L37A 4BXLA 4PV1D 5H2FE 4W7YA 3RK3C 3H1IE 3HUSA 3G9RA 1NAYA 1YYCA 1ZLLA 3BCCJ 4UB6E 2QM7A 2W83C 1SQXK 1W2BO 1FOSE 1L0LK 1T8ZA 5AVWB 1SQXE 1S5LE 1SQVE 3L75G 1G2CA 3V2RA 3L74G 1T3UA 4D6TG 5BVZA 1BE3D 3C9IA 4Z1MH 1CSBA 3L72D 2BEQD 3CPWO 1J1DB 3CCLP 1JM0A 1KILB 3AE4C 1DX7A 1AQTA 3M9BA 1KYOH 2RKLA 2WT7A 2WPVB 5AVTB 1KB9E 1NH4A 3GLMA 1MFTA 1Q86Q 2YXQB 1NTKG 2PAJA 1N73A 5AW5B 3D70A 4IL6H 3G71P 1W5CE 1E5WA 1LGHB 2A45G 3V4QA 1WRGA 3KDPB 4Y99B 1SQVJ 2NPSB 1FBMA 3MUDC 3SSUA 1NTZD 1NU1K 2ZXXA 3MUDA 1NU1E 3ITKA 3JCUH 3WU2E 1Q82Q 2E43A 1KFMA 5C39A 1IZNB 5AVYB 1IC2A 1JMBA 2A45I 1S5LX 2M3BA 1VQPP 1G1IA 3WUTA 4AYCA 3R2PA 1FZEA 1GW3A 5TISH 3CWBD 3W67A 4LLHA 5GTHH 4WY4B 5APUA 1L0NG 1XTGB 4ZKUA 4H44B 3EFFK 3A2AA 4EYYQ 1JY3P 3TK1A 4PD4I 2BCCE 1VQLP 4HH2A 3F5HA 3M0DC 2O01N 1VF5C 2XU6A 3CX5I 2ZAEB 2QJKC 4H0LD 3VMZA 2OYHC 2KK7A 4W7ZA 1S2EA 1MV8A 1NTKK 2OYHA 2QJPB 2R32A 1QEXA 1NU1J 2K3RA 4U3FJ 1N86A 2JP3A 3QH9A 3K5BA 1EZVG 1AV1A 2OYIC 1A02F 2KUBA 2YIUB 3L35A 2YO2A 2OYIA 1LT9B 3B5NC 2AXTE 3AE6C 1NGMB 3B5NA 1ZN5A 3AE7C 2YMYA 3H1KG 3O6QB 2C9NY 2HG5D 4L75A 1L4AD 4N78D 2E74C 2L91A 2IBZG 1EZVI 1H8AA 1RF1C 2Y0CA 3EQ2A 3H32B 2BCCJ 3CXHI 1RF1A 3C1LA 2R5DA 3RBZA 2J58A 1VQNP 1ZR4A 1VQ6P 5B5EE 1JMMA 2C0XA 2WSEJ 4GDOA 2CPBA 2O01J 4H13D 3VMXA 3AEGC 5APVA 2IBZI 4BRYA 2BASA 3BCCD 5CJ0A 3MHVA 2FXOA 1SQPK 1JTHB 3L70E 1HH0A 1SQPE 3RK2D 4WB4A 2I1JA 1VDFA 1NWQA 1QGKB 2JO1A 3KXDA 4C7NA 1Z56A 2FFDC 3M91A 2Q3EA 2FFDA 1USDA 2D2CD 1JO5A 1IFDA 2KZIA 1MKMA 2C9LY 5KLVD 1X0TA 1VQ7P 5AVVB 3LW5J 1URQD 1LP1A 1BDDA 2XNDH 2OARA 1VQOP 1L4AB 1QX8A 4WWIA 1P84D 2W90A 2IFMA 3P32A 1YITP 2Z4EA 3Q3DA 1KYOE 3H25A 2YKOA 5AW6B 5L8RJ 1YQ3C 4UB8H 3L70J 1SQPJ 1SFCA 1SQVD 3RK3E 3AE3C 3A0BH 2RN0A 3D6YA 3TGUE 2B87A 1D7MA 3H1HG 2QA4P 2M3EA 3CC7P 1L2PA 4H13B 1KC8Q 4IL6E 2E76B 1M57D 1HWTC 1JB0J 2E75B 1H88A 1EC5A 1PL5A 1H0TB 1ZRTE 2OYOA 3RK2B 2M5AA 2A06G 2I1KA 4HYTB 5CCGC 2ZYGA 1KB9D 1LTJA 1CI6A 5CCGA 1SQBG 3IFMA 1YI2P 3HD7B 1RE4C 1FZBA 3CCMP 3AECC 2AEMA 2FXPA 1RE4A 4L74A 4OWFA 1BCCJ 3SFEC 5TISE 1NYHA 2XNXA 1GL2B 5AW8B 3CCEP 5KTBA 2SPZA 1GU4A 3G4SP 1VQKP 1NU1D 5CJ4A 4U3FD 1GD2E 1URQB 1J1DC 3RGUA 4JQ0D 4ASVA 1BGYE 2KSJA 3RL0B 1KILC 3IAOA 2PGDA 2IPPA 1KILA 3G3ZA 4OGQB 3KZIH 1TU3F 4JYCA 2Q9IA 1HGZA 2WMMA 2HPCB 1ZOYC 1ZR2A 3L71J 1DIPA 2FYUE 3MP7B 1VL2A 2BCCD 3H1JE 1DH3A 2ZT9B 4Y99C 2NPSC 5KAFE 5KLVG 1FDIA 2W6AA 2Z5IA 1SQBK 3CCQP 2NPSA 1AVOA 2PRRA 2WSFH 2W6JH 5KJ7C 1NO4A 4ZNCA 5DJTB 4PJ0E 2E5YA 5KJ7A 2R3CA 3U1CA 1BGYJ 3CCRP 1N7SD 4PD4H 3Q5PA 4ASWA 4GKGA 2FXMA 3CCSP 4IFFA 1PP9E 1OVRA 2QE7H 4WY4C 2RMZA 4WY4A 4KJMA 1P84I 4H44C 3RBXA 1FJPA 3TSIA 2R3SA 1Y47A 3AE1C 2IFNA 2FYUJ 2YKQA 2N1TD 3AEFC 3H1JJ 1N2DC 4A7PA 3HE5B 2P2UA 1YJ9P 4NPDA 2HYNA 2ZYDA 1GW4A 2IDBA 4GIFA 2QJPC 2BEZF 2IX7C 1BSHA 5M1BA 3FXDA 1OW6A 1OX3A 3P8MC 2YIUC 3E7KA 1LT9C 2HLOA 3D6ZA 2JWDA 3CXHH 1L0LE 2JR8A 2B89A 1AVYA 1LT9A 1SQPD 3L70D 1A02J 1LT1A 1GK6A 1PP9J 1Q81Q 2C0WA 4U3FG 4EI2A 3O6QA 1RF0C 1CW5A 5KLIB 1JEKA 4GOEA 1DEBA 2KYVA 4JYBA 3TDKA 3VOPA 1R5LA 4I1LA 3TF5A 1R5SA 3H32A 4UB8E 1J2JB 4GT1A 1YBKA 1NTMD 1M7LA 1N7SB 1OVVA 3FX0A 3B71A 2QVAA 3OAKA 2KNCA 1Q90D 1LTSC 2Y0EA 1FE6A 1USEA 3AE9C 1U57A 1FC2C 3H1IJ 3L73E 2V7QJ 1EDKA 2O3JA 1EDIA 4YPCA 2KS1B 3CI9A 3Q5SA 2H8PD 1QL1A 2OGUA 2OTLP 2N1TB 1BCCD 2Z5HA 5AW1B 1JTHA 1SQXJ 2GA1A 2M8RA 1PPJE 1L0LJ 5CMZA 2KLUA 3RK3D 3V2QA 2CPSA 3KHUA 2WITA 2LKMA 3H1LG 3KYQA 4PV1B 3CL3D 3VMAA 1OVUA 2H43A 1KQSO 1X79B 5KAIH 1IFIA 3HE4B 1CZQA 1S9KD 1OFCX 3AE8C 2L5GB 3L75E 2GUVA 3VN0A 1ZRTD 3L74E 1JY2P 5CCHC 4D6TE 3JSVC 3PH0A 4L73A 4N6JA 5CCHA 3U59A 1YJNP 3VP8A 3L73J 1L4AC 3FGAD 3WMM0 4DCKA 1SQQD 3L71D 1HGVA 2V4HA 1L4AA 1U7JA 3IN6A 3FWLA 1FJKA 1XTCC 4RESB 2PP6A 5GTIE 4C46A 3QWOC 3KZIE 1GTWA 2YNYA 5AW3B 3I55P 3M0DA 5APQA 4H13C 3PLNA 1T6AA 1NTKE 3F89A 2E76C 5TJHA 5BU5A 4HKZH 5AW2B 2E75C 3AEBC 4CPGA 1VQ9P 1BGYD 1DD3A 1VQMP 1LTGC 3UIAA 3Q1MA 2LR2A 3L75J 3RK2C 4XE5B 4Y28J 3L74J 3U1AA 3VP9A 3BRVB 4D6TJ 1BE3G 3L72G 5KKZB 3HD7C 4DT0A 2QJYB 1KILE 2WZ7A 1OMIA 1MZ9A 3HD7A 1DD4A 2FYUD 4PD4E 1NTMG 4IFMA 5APSA 1RHZB 2QRXA 2E42A 1GL2C 1EQ7A 1YTZI 2WPSA 3CX5E 1NAFA 1GL2A 2FY8A 1L0NK 3NMDA 2B88A 1J1EB 2NZ2A 1L0NE 1AFOA 3FXEA 1RE3C 3M06A 1OWAA 1KQFB 1URQC 3V6IA 3AE2C 1NTKJ 1NVOA 3RL0C 1RE3A 5APXA 1JY3O 1BCCG 1QVFO 5CBOA 1PGQA 1VF5D 2H88C 4JF7A 1VQ4P 3CC4P 4KT0J 4OGQC 3GMAA 1IK7A 2H89C 2B9BA 1NTZG 4I2LC 2P67A 4H0LB 3MIWA 1N73B 1FDOA 2JDIH 2HPCA 1VQ8P 2K1AA 1EZVE 3M9QA 3PTZA 1LNQA 1YQ4C 3O8ZA 2ZT9C 3CXHE 3B5ND 1UIXA 2WSCJ 3B4SA 1FDMA 1FU1A 1LTBC 2O1JA 3CWBG 3BVHA 2XZRA 1OXZA 5H2FH 1KQGB 4I7ZB 3H1KE 4M3LA 2FBWC 1SQQG 2UWJE 3H1ID 1K04A 1W2EA 2IBZE 2FYNB 3II6A 5AVUB 4UB6H 1P84H 1JOCA 2P7JA 2JWAA 4MN4C 1S5LH 1SQXD 1L0LD 2ZYAA 3HTKB 4R4MA 1ZW0A 1KN7A 3CCUP 1QVGO 4YTPC 2HFED 2ZVNB 5APWA 2QG4A 3WUUA 2P1JA 1S1CX 3HE5A 1PFIA 1NOHA 2WSSH 1KB9H 3SWFA 3OA7A 3H1KJ 3ABVC 1T2KD 1YTZT 2IZ0A 1ZV8A 3JCUE 3L73D 4OH8B 5KAIE 1KTMA 1IFJA 4AUWA 1RQVA 1OIPA 1NHLA 3KQGA 1PPJD 2D2CB 5GTHE 2Y9ZA 3M9HA 2XKMA 3SWKA 5KLIC 3TGUJ 3BCCG 4TT3H 1BSNA 1SFCD 3USSA 2E5TA 1GK4A 1N7SC 3OW2O 3B8EB 1JNMA 3H6PA 3L75D 3D71A 4LGDE 3V5BA 5K5GB 2RH0A 3H1HE 1FZAA 1QL2A 4IL6X 3P8CE 3IR9A 3VYIA 1JCCA 1HTLC 2KI7B 2N1TC 2KS1A 5CHXA 2CK3H 5B66H 4DOJA 2Q5UA 1EDJA 2K9JB 5CCGD 2A06E 1MFZA 1KV4A 3P7KA 3H1IG 3L36A 3GHGB 4TLFA 2WSEH 2PFXA 4PV1C 4C7RA 2O01H 4NPFX 1N7LA 3A0HH 1SQBE 1PV3A 4ZKPA 2QSIA 2WWWA 3WUVA 1NTKD 1RY3A 3EWKA 1SVFA 1IJDB 3NXSA 1QLED 4DJGA 4B86A 4GOFA 1SQVG 3C8VA 1WMKA 4IFDK 3PRJA 4DZOA 4EOTA 2W27A 3CLQA 1HF9A 3H1HJ 1SS1A 2WVRA 4U7JA 1KILD 3A5TA 4JBZA 1SFCB 3A3YB 3MTUE 1KMIZ 3CX5D 2B87B
chains in the Genus database with same CATH topology
2WVRA 3F5HA 3E1RA 3WUVA 3WUTA 2Q6QA 3WUUA 4BRYB 4BRYA 2ZXXA 1UIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVR A;  3F5H A;  3E1R A;  3WUV A;  3WUT A;  2Q6Q A;  3WUU A;  4BRY B;  4BRY A;  2ZXX A;  1UII A; 
#chains in the Genus database with same CATH topology
 2P58 A;  2QIW A;  1NKZ B;  3LW5 H;  1SQB J;  2HOD B;  3GG2 A;  2K88 A;  2NPS D;  5KLV K;  4L76 A;  1LTJ B;  2K37 A;  3V4W A;  1K05 A;  5KLV E;  3CC2 P;  3Q2Y A;  2Y9Y A;  1NKN A;  1CI6 B;  1KB9 I;  5KJ7 D;  3LIE A;  3OJA B;  2KIK A;  5KKZ C;  2QJY C;  1NU1 G;  2W6B A;  1HJB A;  1P84 E;  1WT6 A;  1EZV D;  1SQV K;  3PJS K;  1SLQ A;  1RF0 A;  2AXC A;  3CXH D;  1FZC B;  1HJ0 A;  4WY4 D;  1UII A;  3A0B E;  1J1E C;  4HB1 A;  1GU5 A;  3BAT A;  4IOI H;  3H1K D;  4H44 D;  1FZF A;  3I5C A;  5AVS B;  2YO3 A;  3PP5 A;  1Q2N A;  2IBZ D;  4N3Y B;  4I6M C;  4O9B A;  2QEX P;  2BCC G;  1YJW P;  3T97 B;  1T3J A;  1KYO D;  5KLV J;  1K9M Q;  1LJ2 A;  2IYO A;  4H0L C;  1IO4 A;  1N73 C;  2WPQ A;  3BAS A;  1HBW A;  1LWU B;  1N8R Q;  1LTA C;  1KFN A;  3TGU D;  2OTK E;  1VPC A;  2K9Y A;  2I8D A;  4HJG H;  2MJZ A;  3BRT B;  2Y0D A;  1IFP A;  1M1J B;  4I7Z C;  3MD0 A;  3TNU B;  3G6E P;  4U3F E;  1JY2 N;  2FYN C;  1ZP0 C;  1PIX A;  4WBA A;  1PGO A;  4RJT A;  3FWN A;  4KHX A;  1JY3 N;  2GUS A;  3N7N A;  2M0B A;  3HTK A;  1VQ5 P;  1X9V A;  3M0A A;  2Q3I A;  1OW8 A;  5AVQ B;  4XFJ A;  1S72 P;  5B66 E;  2LXC B;  3SWY A;  3LID A;  3L70 G;  1SQP G;  1ZXG A;  3W68 A;  2IYP A;  3HUS B;  4NPE A;  3A0H E;  4WVZ A;  1H0T A;  1Q7Y Q;  1OW7 A;  3RK3 B;  2O1K A;  3H1L E;  2R44 A;  3H1H D;  3P8C D;  2ITA A;  2QM8 A;  1G2C B;  3AEA C;  4K35 A;  1G1J A;  3IF4 A;  4W80 A;  3H1J D;  5CBN A;  5CCH D;  1K73 Q;  1IFN A;  2D2C C;  2KXP B;  5KAF H;  2KB7 P;  1R8E A;  4GOD A;  1HVV A;  1JY2 O;  2A06 D;  4ZMD A;  2KSE A;  2Q6Q A;  2N9Y B;  4PJ0 H;  1SQB D;  2LXB A;  2ZFC A;  2R5B A;  3S1K A;  4XA4 A;  5E79 H;  1X22 A;  3L4F A;  1NJI Q;  1URQ A;  2KNC B;  2WT7 B;  1YIJ P;  2MKV A;  1YHQ P;  2WSF J;  1PP9 D;  2G8Y A;  3TGU G;  3H1L J;  1FOS F;  2E76 D;  2WQY C;  3CMA P;  5APT A;  2E75 D;  1RH5 B;  1M56 D;  1MUU A;  2YKP A;  2G3A A;  1KYO I;  5AW0 B;  4RO0 A;  3VTP C;  2WPR A;  3GHG C;  2K9J A;  1EXJ A;  1KZU B;  1BE3 E;  2HR3 A;  3HD7 D;  1M8O B;  1KD1 Q;  1T2K C;  3GHG A;  1HUC A;  3L72 E;  4R4L A;  2E74 D;  2V7Q H;  2XDJ A;  1L0N J;  3NFQ A;  1PZQ A;  3L71 G;  2J5U A;  1Y8A A;  1AJY A;  1NTM K;  2AEJ A;  4EIJ A;  1GL2 D;  1NTM E;  2POH A;  1AQ5 A;  3RL0 g;  2DW3 A;  3AED C;  1S4X A;  4QMA A;  2P10 A;  3PHL A;  3GF7 A;  2J59 M;  4YXW H;  1BDC A;  3MGN A;  3RL0 D;  2Q1K A;  1BGY G;  1SFC C;  1BCC E;  1M1K Q;  5APY A;  4OGQ D;  1EDL A;  1NTZ K;  5AW7 B;  1VF5 B;  2ZXE B;  2QJK B;  3E1R A;  1U7M A;  1NTZ E;  2OYH B;  4EDF A;  2OQQ A;  3CCV P;  1BE3 J;  3GF3 A;  3V2N A;  3A7O A;  3L72 J;  2ZJS E;  2ZT9 D;  1S9K E;  2FYU G;  2OYI B;  2NRG A;  2HOD A;  3H1J G;  1NTM J;  1LTJ C;  1GMJ A;  3ZDM A;  1S3J A;  3CWB E;  3B5N B;  2KZJ A;  1LTI C;  1SQQ K;  1ZME C;  4RKU J;  4YXD C;  4JPZ B;  3CME P;  1SQQ E;  3L71 E;  2VRS A;  1PGP A;  1RQU A;  3MZW B;  2E74 B;  3WU2 H;  1FAV A;  1RF1 B;  1KQL A;  3GW6 A;  2YMK A;  1LTT C;  2FYZ A;  1FZC C;  4AQR D;  5DJU B;  2GM4 A;  1FZC A;  4OVN F;  1PP9 G;  1NTZ J;  1N7S A;  5AW9 B;  4BWN A;  3L74 D;  1K8A Q;  2YXR B;  1Y9B A;  2KLV A;  3VMY A;  4BRY B;  2ZVO B;  4D6T D;  3CD6 P;  2JKV A;  1E79 H;  1GDT A;  5AVX B;  2KP8 A;  2JJL A;  3SFD C;  2OTJ P;  5GTI H;  3T97 A;  3CWB J;  4K3A A;  2N1T A;  5EFW B;  1IK9 A;  5AW4 B;  1FZG A;  3N4X A;  1LWU C;  2FYU K;  4C7N B;  1SQQ J;  4N78 E;  1DEE G;  3Q5R A;  1LWU A;  2FFD B;  1SP4 A;  2A45 H;  1EXI A;  2JEE A;  1SQX G;  1M1J C;  3HE4 A;  1L0L G;  3HRN A;  2W8Z A;  2Q7C A;  3EFG A;  2AXT H;  2IZ1 A;  1FS0 E;  1M1J A;  3E1I A;  5AVR B;  3AE5 C;  3TNU A;  1LP1 B;  2XV5 A;  1H89 A;  3H1L D;  3BCC E;  5E79 E;  1AA0 A;  2FKW B;  2N9B A;  3CCJ P;  3V2P A;  1JCD A;  2KOG A;  5AVZ B;  4PD4 D;  1GZL A;  1KOR A;  2WSC H;  3CX5 H;  3AEE C;  3KPE A;  3JC2 2;  3TYY A;  2WTY A;  1JUN A;  2H7H A;  3I56 P;  5B5E H;  2AEF A;  3NTN A;  3L73 G;  5BU8 B;  3S4R A;  1L0N D;  3R4Y A;  1X8Y A;  1M90 Q;  3S9O A;  1OZH A;  4LC1 A;  1PGJ A;  1PPJ G;  2M5A B;  3HUS C;  1IFM A;  3L37 A;  4BXL A;  4PV1 D;  5H2F E;  4W7Y A;  3RK3 C;  3H1I E;  3HUS A;  3G9R A;  1NAY A;  1YYC A;  1ZLL A;  3BCC J;  4UB6 E;  2QM7 A;  2W83 C;  1SQX K;  1W2B O;  1FOS E;  1L0L K;  1T8Z A;  5AVW B;  1SQX E;  1S5L E;  1SQV E;  3L75 G;  1G2C A;  3V2R A;  3L74 G;  1T3U A;  4D6T G;  5BVZ A;  1BE3 D;  3C9I A;  4Z1M H;  1CSB A;  3L72 D;  2BEQ D;  3CPW O;  1J1D B;  3CCL P;  1JM0 A;  1KIL B;  3AE4 C;  1DX7 A;  1AQT A;  3M9B A;  1KYO H;  2RKL A;  2WT7 A;  2WPV B;  5AVT B;  1KB9 E;  1NH4 A;  3GLM A;  1MFT A;  1Q86 Q;  2YXQ B;  1NTK G;  2PAJ A;  1N73 A;  5AW5 B;  3D70 A;  4IL6 H;  3G71 P;  1W5C E;  1E5W A;  1LGH B;  2A45 G;  3V4Q A;  1WRG A;  3KDP B;  4Y99 B;  1SQV J;  2NPS B;  1FBM A;  3MUD C;  3SSU A;  1NTZ D;  1NU1 K;  2ZXX A;  3MUD A;  1NU1 E;  3ITK A;  3JCU H;  3WU2 E;  1Q82 Q;  2E43 A;  1KFM A;  5C39 A;  1IZN B;  5AVY B;  1IC2 A;  1JMB A;  2A45 I;  1S5L X;  2M3B A;  1VQP P;  1G1I A;  3WUT A;  4AYC A;  3R2P A;  1FZE A;  1GW3 A;  5TIS H;  3CWB D;  3W67 A;  4LLH A;  5GTH H;  4WY4 B;  5APU A;  1L0N G;  1XTG B;  4ZKU A;  4H44 B;  3EFF K;  3A2A A;  4EYY Q;  1JY3 P;  3TK1 A;  4PD4 I;  2BCC E;  1VQL P;  4HH2 A;  3F5H A;  3M0D C;  2O01 N;  1VF5 C;  2XU6 A;  3CX5 I;  2ZAE B;  2QJK C;  4H0L D;  3VMZ A;  2OYH C;  2KK7 A;  4W7Z A;  1S2E A;  1MV8 A;  1NTK K;  2OYH A;  2QJP B;  2R32 A;  1QEX A;  1NU1 J;  2K3R A;  4U3F J;  1N86 A;  2JP3 A;  3QH9 A;  3K5B A;  1EZV G;  1AV1 A;  2OYI C;  1A02 F;  2KUB A;  2YIU B;  3L35 A;  2YO2 A;  2OYI A;  1LT9 B;  3B5N C;  2AXT E;  3AE6 C;  1NGM B;  3B5N A;  1ZN5 A;  3AE7 C;  2YMY A;  3H1K G;  3O6Q B;  2C9N Y;  2HG5 D;  4L75 A;  1L4A D;  4N78 D;  2E74 C;  2L91 A;  2IBZ G;  1EZV I;  1H8A A;  1RF1 C;  2Y0C A;  3EQ2 A;  3H32 B;  2BCC J;  3CXH I;  1RF1 A;  3C1L A;  2R5D A;  3RBZ A;  2J58 A;  1VQN P;  1ZR4 A;  1VQ6 P;  5B5E E;  1JMM A;  2C0X A;  2WSE J;  4GDO A;  2CPB A;  2O01 J;  4H13 D;  3VMX A;  3AEG C;  5APV A;  2IBZ I;  4BRY A;  2BAS A;  3BCC D;  5CJ0 A;  3MHV A;  2FXO A;  1SQP K;  1JTH B;  3L70 E;  1HH0 A;  1SQP E;  3RK2 D;  4WB4 A;  2I1J A;  1VDF A;  1NWQ A;  1QGK B;  2JO1 A;  3KXD A;  4C7N A;  1Z56 A;  2FFD C;  3M91 A;  2Q3E A;  2FFD A;  1USD A;  2D2C D;  1JO5 A;  1IFD A;  2KZI A;  1MKM A;  2C9L Y;  5KLV D;  1X0T A;  1VQ7 P;  5AVV B;  3LW5 J;  1URQ D;  1LP1 A;  1BDD A;  2XND H;  2OAR A;  1VQO P;  1L4A B;  1QX8 A;  4WWI A;  1P84 D;  2W90 A;  2IFM A;  3P32 A;  1YIT P;  2Z4E A;  3Q3D A;  1KYO E;  3H25 A;  2YKO A;  5AW6 B;  5L8R J;  1YQ3 C;  4UB8 H;  3L70 J;  1SQP J;  1SFC A;  1SQV D;  3RK3 E;  3AE3 C;  3A0B H;  2RN0 A;  3D6Y A;  3TGU E;  2B87 A;  1D7M A;  3H1H G;  2QA4 P;  2M3E A;  3CC7 P;  1L2P A;  4H13 B;  1KC8 Q;  4IL6 E;  2E76 B;  1M57 D;  1HWT C;  1JB0 J;  2E75 B;  1H88 A;  1EC5 A;  1PL5 A;  1H0T B;  1ZRT E;  2OYO A;  3RK2 B;  2M5A A;  2A06 G;  2I1K A;  4HYT B;  5CCG C;  2ZYG A;  1KB9 D;  1LTJ A;  1CI6 A;  5CCG A;  1SQB G;  3IFM A;  1YI2 P;  3HD7 B;  1RE4 C;  1FZB A;  3CCM P;  3AEC C;  2AEM A;  2FXP A;  1RE4 A;  4L74 A;  4OWF A;  1BCC J;  3SFE C;  5TIS E;  1NYH A;  2XNX A;  1GL2 B;  5AW8 B;  3CCE P;  5KTB A;  2SPZ A;  1GU4 A;  3G4S P;  1VQK P;  1NU1 D;  5CJ4 A;  4U3F D;  1GD2 E;  1URQ B;  1J1D C;  3RGU A;  4JQ0 D;  4ASV A;  1BGY E;  2KSJ A;  3RL0 B;  1KIL C;  3IAO A;  2PGD A;  2IPP A;  1KIL A;  3G3Z A;  4OGQ B;  3KZI H;  1TU3 F;  4JYC A;  2Q9I A;  1HGZ A;  2WMM A;  2HPC B;  1ZOY C;  1ZR2 A;  3L71 J;  1DIP A;  2FYU E;  3MP7 B;  1VL2 A;  2BCC D;  3H1J E;  1DH3 A;  2ZT9 B;  4Y99 C;  2NPS C;  5KAF E;  5KLV G;  1FDI A;  2W6A A;  2Z5I A;  1SQB K;  3CCQ P;  2NPS A;  1AVO A;  2PRR A;  2WSF H;  2W6J H;  5KJ7 C;  1NO4 A;  4ZNC A;  5DJT B;  4PJ0 E;  2E5Y A;  5KJ7 A;  2R3C A;  3U1C A;  1BGY J;  3CCR P;  1N7S D;  4PD4 H;  3Q5P A;  4ASW A;  4GKG A;  2FXM A;  3CCS P;  4IFF A;  1PP9 E;  1OVR A;  2QE7 H;  4WY4 C;  2RMZ A;  4WY4 A;  4KJM A;  1P84 I;  4H44 C;  3RBX A;  1FJP A;  3TSI A;  2R3S A;  1Y47 A;  3AE1 C;  2IFN A;  2FYU J;  2YKQ A;  2N1T D;  3AEF C;  3H1J J;  1N2D C;  4A7P A;  3HE5 B;  2P2U A;  1YJ9 P;  4NPD A;  2HYN A;  2ZYD A;  1GW4 A;  2IDB A;  4GIF A;  2QJP C;  2BEZ F;  2IX7 C;  1BSH A;  5M1B A;  3FXD A;  1OW6 A;  1OX3 A;  3P8M C;  2YIU C;  3E7K A;  1LT9 C;  2HLO A;  3D6Z A;  2JWD A;  3CXH H;  1L0L E;  2JR8 A;  2B89 A;  1AVY A;  1LT9 A;  1SQP D;  3L70 D;  1A02 J;  1LT1 A;  1GK6 A;  1PP9 J;  1Q81 Q;  2C0W A;  4U3F G;  4EI2 A;  3O6Q A;  1RF0 C;  1CW5 A;  5KLI B;  1JEK A;  4GOE A;  1DEB A;  2KYV A;  4JYB A;  3TDK A;  3VOP A;  1R5L A;  4I1L A;  3TF5 A;  1R5S A;  3H32 A;  4UB8 E;  1J2J B;  4GT1 A;  1YBK A;  1NTM D;  1M7L A;  1N7S B;  1OVV A;  3FX0 A;  3B71 A;  2QVA A;  3OAK A;  2KNC A;  1Q90 D;  1LTS C;  2Y0E A;  1FE6 A;  1USE A;  3AE9 C;  1U57 A;  1FC2 C;  3H1I J;  3L73 E;  2V7Q J;  1EDK A;  2O3J A;  1EDI A;  4YPC A;  2KS1 B;  3CI9 A;  3Q5S A;  2H8P D;  1QL1 A;  2OGU A;  2OTL P;  2N1T B;  1BCC D;  2Z5H A;  5AW1 B;  1JTH A;  1SQX J;  2GA1 A;  2M8R A;  1PPJ E;  1L0L J;  5CMZ A;  2KLU A;  3RK3 D;  3V2Q A;  2CPS A;  3KHU A;  2WIT A;  2LKM A;  3H1L G;  3KYQ A;  4PV1 B;  3CL3 D;  3VMA A;  1OVU A;  2H43 A;  1KQS O;  1X79 B;  5KAI H;  1IFI A;  3HE4 B;  1CZQ A;  1S9K D;  1OFC X;  3AE8 C;  2L5G B;  3L75 E;  2GUV A;  3VN0 A;  1ZRT D;  3L74 E;  1JY2 P;  5CCH C;  4D6T E;  3JSV C;  3PH0 A;  4L73 A;  4N6J A;  5CCH A;  3U59 A;  1YJN P;  3VP8 A;  3L73 J;  1L4A C;  3FGA D;  3WMM 0;  4DCK A;  1SQQ D;  3L71 D;  1HGV A;  2V4H A;  1L4A A;  1U7J A;  3IN6 A;  3FWL A;  1FJK A;  1XTC C;  4RES B;  2PP6 A;  5GTI E;  4C46 A;  3QWO C;  3KZI E;  1GTW A;  2YNY A;  5AW3 B;  3I55 P;  3M0D A;  5APQ A;  4H13 C;  3PLN A;  1T6A A;  1NTK E;  3F89 A;  2E76 C;  5TJH A;  5BU5 A;  4HKZ H;  5AW2 B;  2E75 C;  3AEB C;  4CPG A;  1VQ9 P;  1BGY D;  1DD3 A;  1VQM P;  1LTG C;  3UIA A;  3Q1M A;  2LR2 A;  3L75 J;  3RK2 C;  4XE5 B;  4Y28 J;  3L74 J;  3U1A A;  3VP9 A;  3BRV B;  4D6T J;  1BE3 G;  3L72 G;  5KKZ B;  3HD7 C;  4DT0 A;  2QJY B;  1KIL E;  2WZ7 A;  1OMI A;  1MZ9 A;  3HD7 A;  1DD4 A;  2FYU D;  4PD4 E;  1NTM G;  4IFM A;  5APS A;  1RHZ B;  2QRX A;  2E42 A;  1GL2 C;  1EQ7 A;  1YTZ I;  2WPS A;  3CX5 E;  1NAF A;  1GL2 A;  2FY8 A;  1L0N K;  3NMD A;  2B88 A;  1J1E B;  2NZ2 A;  1L0N E;  1AFO A;  3FXE A;  1RE3 C;  3M06 A;  1OWA A;  1KQF B;  1URQ C;  3V6I A;  3AE2 C;  1NTK J;  1NVO A;  3RL0 C;  1RE3 A;  5APX A;  1JY3 O;  1BCC G;  1QVF O;  5CBO A;  1PGQ A;  1VF5 D;  2H88 C;  4JF7 A;  1VQ4 P;  3CC4 P;  4KT0 J;  4OGQ C;  3GMA A;  1IK7 A;  2H89 C;  2B9B A;  1NTZ G;  4I2L C;  2P67 A;  4H0L B;  3MIW A;  1N73 B;  1FDO A;  2JDI H;  2HPC A;  1VQ8 P;  2K1A A;  1EZV E;  3M9Q A;  3PTZ A;  1LNQ A;  1YQ4 C;  3O8Z A;  2ZT9 C;  3CXH E;  3B5N D;  1UIX A;  2WSC J;  3B4S A;  1FDM A;  1FU1 A;  1LTB C;  2O1J A;  3CWB G;  3BVH A;  2XZR A;  1OXZ A;  5H2F H;  1KQG B;  4I7Z B;  3H1K E;  4M3L A;  2FBW C;  1SQQ G;  2UWJ E;  3H1I D;  1K04 A;  1W2E A;  2IBZ E;  2FYN B;  3II6 A;  5AVU B;  4UB6 H;  1P84 H;  1JOC A;  2P7J A;  2JWA A;  4MN4 C;  1S5L H;  1SQX D;  1L0L D;  2ZYA A;  3HTK B;  4R4M A;  1ZW0 A;  1KN7 A;  3CCU P;  1QVG O;  4YTP C;  2HFE D;  2ZVN B;  5APW A;  2QG4 A;  3WUU A;  2P1J A;  1S1C X;  3HE5 A;  1PFI A;  1NOH A;  2WSS H;  1KB9 H;  3SWF A;  3OA7 A;  3H1K J;  3ABV C;  1T2K D;  1YTZ T;  2IZ0 A;  1ZV8 A;  3JCU E;  3L73 D;  4OH8 B;  5KAI E;  1KTM A;  1IFJ A;  4AUW A;  1RQV A;  1OIP A;  1NHL A;  3KQG A;  1PPJ D;  2D2C B;  5GTH E;  2Y9Z A;  3M9H A;  2XKM A;  3SWK A;  5KLI C;  3TGU J;  3BCC G;  4TT3 H;  1BSN A;  1SFC D;  3USS A;  2E5T A;  1GK4 A;  1N7S C;  3OW2 O;  3B8E B;  1JNM A;  3H6P A;  3L75 D;  3D71 A;  4LGD E;  3V5B A;  5K5G B;  2RH0 A;  3H1H E;  1FZA A;  1QL2 A;  4IL6 X;  3P8C E;  3IR9 A;  3VYI A;  1JCC A;  1HTL C;  2KI7 B;  2N1T C;  2KS1 A;  5CHX A;  2CK3 H;  5B66 H;  4DOJ A;  2Q5U A;  1EDJ A;  2K9J B;  5CCG D;  2A06 E;  1MFZ A;  1KV4 A;  3P7K A;  3H1I G;  3L36 A;  3GHG B;  4TLF A;  2WSE H;  2PFX A;  4PV1 C;  4C7R A;  2O01 H;  4NPF X;  1N7L A;  3A0H H;  1SQB E;  1PV3 A;  4ZKP A;  2QSI A;  2WWW A;  3WUV A;  1NTK D;  1RY3 A;  3EWK A;  1SVF A;  1IJD B;  3NXS A;  1QLE D;  4DJG A;  4B86 A;  4GOF A;  1SQV G;  3C8V A;  1WMK A;  4IFD K;  3PRJ A;  4DZO A;  4EOT A;  2W27 A;  3CLQ A;  1HF9 A;  3H1H J;  1SS1 A;  2WVR A;  4U7J A;  1KIL D;  3A5T A;  4JBZ A;  1SFC B;  3A3Y B;  3MTU E;  1KMI Z;  3CX5 D;  2B87 B; 
#chains in the Genus database with same CATH homology
 2WVR A;  3F5H A;  3E1R A;  3WUV A;  3WUT A;  2Q6Q A;  3WUU A;  4BRY B;  4BRY A;  2ZXX A;  1UII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...