4BRYB

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
PPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords GEMININ
publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryB00
3E1RA 3WUTA 1UIIA 3WUUA 3F5HA 4BRYB 2Q6QA 3WUVA 4BRYA 2ZXXA 2WVRA
chains in the Genus database with same CATH superfamily
5APSA 1PP9G 2AEFA 3KXDA 3CD6P 2HPCA 1HUCA 2KSJA 1HWTC 4U3FE 1VF5C 2E74B 2E76D 1FAVA 3H1IE 3E7KA 4GODA 1RF1A 2RMZA 5BU5A 1VQLP 2D2CB 4I1LA 2IBZE 1K05A 1OW8A 2K9YA 1DH3A 1L4AC 1FZCC 1P84D 1NAFA 1GK4A 4JPZB 2O01H 2KNCB 1KYOD 1YTZI 3OA7A 2RKLA 3H1LE 1YHQP 3L37A 3Q5RA 1NTZE 1L0NE 3PJSK 5GTHE 1JTHA 5AW9B 1LTBC 1H8AA 2FXMA 1ZN5A 3HE4B 1H88A 1MFZA 1KV4A 3I5CA 1T3UA 4B86A 2QJPC 1LP1A 1URQC 5CCGA 3CCRP 4DCKA 3RK3C 3MZWB 3B5ND 2W8ZA 2BCCE 2Q7CA 2HFED 5KLVK 3CXHE 5KJ7C 2OYHB 1Q90D 3L73J 4HKZH 3IN6A 4GDOA 1OMIA 3O8ZA 1PGOA 2V7QH 2FFDA 4KHXA 1T2KC 3CC7P 3L4FA 1SQXE 1NWQA 1MKMA 1J1EB 4I2LC 1NVOA 4OGQD 3L75E 3BASA 1BE3E 4H0LC 1DD4A 4R4MA 1SQVG 1ZOYC 2YIUC 1K04A 3LIEA 1S3JA 5APXA 4GOFA 3SFDC 1GDTA 3L73D 4ZKPA 3WUUA 2E75D 3P7KA 3A5TA 1FJPA 2QE7H 1XTCC 1KTMA 2YMKA 2Z4EA 1Q7YQ 3L70E 3S4RA 3H32A 3EFGA 1FOSF 4NPFX 3CXHH 2QM8A 2C9NY 1X22A 1WRGA 1AFOA 1OXZA 3TGUJ 2QJYC 2JO1A 3KHUA 3W67A 3PHLA 5CCGD 2MJZA 3MP7B 1JM0A 1DIPA 5KAFE 3GHGC 3MUDC 1HGZA 1FZEA 2IFNA 3TK1A 1NTKE 3OW2O 1SQQJ 2HG5D 2WSCJ 3TGUD 1YITP 1LWUA 1FZGA 3FXEA 1N86A 1RY3A 3CCEP 1RE3A 4EYYQ 3H1KE 2IZ0A 1SQBE 2JKVA 2WPVB 2NRGA 1PGJA 1KQFB 2WSSH 1YYCA 3AE7C 1GL2B 2J5UA 3TDKA 4RO0A 3L73G 4TLFA 3CCMP 1EZVE 4QMAA 2LXCB 2WZ7A 2WWWA 2A45I 1RH5B 2FKWB 1BCCJ 3RK2D 3PH0A 3NMDA 1CZQA 3VMZA 3AE3C 5CCHD 4YPCA 1X0TA 2KZJA 3BRVB 5KAFH 2HLOA 3VMXA 4LC1A 3PP5A 1JUNA 1G2CB 2RH0A 2Y0CA 2FYZA 1KILB 2XZRA 1M90Q 2A06D 3CX5D 2Q9IA 1AVOA 1NU1G 2ZVOB 2QRXA 5AW8B 1K8AQ 2YKQA 3LW5H 1BCCD 2HR3A 1FS0E 1QX8A 3B8EB 2N9YB 2YMYA 2OYOA 2WSFJ 2N1TA 4WY4A 4DZOA 1GMJA 2M8RA 1L0LE 3IFMA 1HF9A 2UWJE 1G1IA 2DW3A 5KKZC 3SFEC 2CK3H 2W83C 5KLIC 2KI7B 5H2FH 3P8CD 2O1KA 3H1JE 1OVUA 3KQGA 1IJDB 2QJKC 3M0AA 1KB9D 3S1KA 3L71J 1Q2NA 2JP3A 5AVSB 1LTJC 1OW6A 1SQQG 2K9JA 1S9KD 3GMAA 3E1RA 4D6TJ 5KLVJ 2QEXP 2M3EA 3H1HE 1R5SA 3FXDA 1DD3A 1M1JA 4M3LA 3EWKA 2FYUE 1NH4A 1LT9B 3OAKA 1N73C 4PV1C 3A0HH 4N6JA 3L71D 3O6QA 4I7ZB 1VDFA 1YJ9P 4IL6H 2K3RA 3HD7A 1BCCG 4D6TD 5KLVD 2V4HA 2FXOA 3NTNA 1KILE 1GD2E 2P10A 3AEEC 1VF5B 4N78D 1SFCC 1HJBA 1LT1A 5AW4B 1ZRTD 1OZHA 3CCVP 2XDJA 3FGAD 3V2PA 1VF5D 1YBKA 1JMBA 4NPDA 2H43A 1IFNA 1NGMB 2N1TD 4WY4D 2YXRB 1L4AB 1FZCB 5L8RJ 3K5BA 4U3FJ 5AW6B 1JMMA 2OQQA 1Q86Q 3HUSC 3H1IJ 4O9BA 3M9BA 1KYOI 1RE4A 4WWIA 2KS1A 1UIXA 1AVYA 3F5HA 1JNMA 1HBWA 1RF0C 5CMZA 1QVFO 4K3AA 4H44D 2W6JH 4U3FD 2H8PD 2QJPB 1W2EA 2L5GB 3RBZA 3RK3B 2YO3A 3H1ID 3L74E 3L71G 3V6IA 3H1LJ 1L0NJ 2WMMA 4AUWA 1LTIC 2PGDA 3JCUE 3FWLA 4D6TG 5KLVG 2YNYA 2M3BA 5DJTB 3VP8A 3HD7D 4A7PA 3RBXA 2Q3EA 1G1JA 1Q82Q 2KNCA 3AEAC 2BCCJ 2R3SA 5APTA 5C39A 3H1LD 1NTZD 3R4YA 1L0ND 3RL0D 3CWBJ 4H0LB 3L36A 2QA4P 5KTBA 2QG4A 2ZT9C 2YIUB 5AW0B 3HE4A 1NAYA 2FYUK 3VMYA 3U1AA 1LTSC 3LIDA 4HYTB 4PD4H 1VQOP 4XFJA 5TISH 1JY2O 5APVA 1AQTA 1S5LE 4H13D 3HTKB 1BGYE 2BCCD 2BEQD 3L75J 2OARA 4LLHA 1BE3J 3JCUH 3CXHD 2ZXEB 4KT0J 4U3FG 1KN7A 1YQ3C 2OYHA 3OJAB 5K5GB 2QJYB 1QL1A 5AVUB 3GF3A 4BXLA 1U57A 2CPBA 2OYIC 1FDOA 1KQSO 1SQXD 2E74D 2E42A 3GHGB 1M7LA 3BRTB 3L70J 3RK3E 2KP8A 1X79B 3BCCG 3L75D 1PP9E 1BE3D 1CI6A 4WB4A 4Z1MH 2D2CD 1EDLA 3M0DA 3II6A 4WBAA 1S72P 5CBNA 4WVZA 3SSUA 1JB0J 5CBOA 5CJ4A 1CSBA 3CPWO 2WVRA 2W27A 2Y9YA 2H89C 3H1LG 3L72E 1NKNA 2K1AA 1S5LH 4RJTA 2A45H 3L70D 1IK7A 3IR9A 3RL0g 2KLUA 3N7NA 1PIXA 2W90A 2RN0A 1ZLLA 1N2DC 3WU2H 2FYNC 3H1KJ 4TT3H 3NXSA 1SQBJ 1Z56A 5AW3B 2B87B 3CWBG 2ZXXA 2HODB 2C0WA 4UB8H 1H89A 2WSEJ 4RESB 3TNUB 1PGQA 2NPSC 2C9LY 2KSEA 3M91A 2P1JA 4U7JA 3H1KD 3L75G 1BE3G 1OVRA 1SQBD 3P8MC 3USSA 2AXTE 3AE5C 5AVXB 1CI6B 1AQ5A 1S5LX 2H88C 3GLMA 1JEKA 1EZVD 1LTGC 1GL2A 2E43A 3G9RA 5KKZB 2QVAA 3EQ2A 5KLIB 3CMAP 1NOHA 4XA4A 4EOTA 1SQVE 1VQNP 4RKUJ 2QJKB 4PD4I 5AVWB 1L0LJ 1G2CA 1LTJB 1MFTA 1KILA 1RF0A 1FJKA 3V5BA 1HGVA 1VL2A 2B9BA 2E76C 1D7MA 3VMAA 4YTPC 2PFXA 2AXTH 1VQMP 1N73B 3A2AA 4PV1B 2OGUA 1JY3O 1L0LD 2KLVA 4IFMA 2L91A 2XV5A 3H1HJ 2JR8A 1FZAA 3H1KG 1HTLC 2O1JA 2JWDA 1NTME 2FYUJ 2WQYC 1NTZK 1SFCB 1L0NK 3S9OA 3H1JD 2YO2A 3CCJP 1KFNA 2I1KA 2ZYGA 2FY8A 2Q5UA 2PAJA 2JWAA 2Y0DA 5AW2B 5APQA 1EXIA 1KYOH 1TU3F 1USDA 3UIAA 3H1HD 1X8YA 1GL2D 5H2FE 2M5AB 3HUSB 1OW7A 2FYUD 5APUA 4BRYB 1KD1Q 3HRNA 1LNQA 1IK9A 1M8OB 3B5NC 2O3JA 1LT9A 1WMKA 1SLQA 2JEEA 3KZIE 1JO5A 4L75A 3EFFK 3ITKA 5KAIE 1RQVA 4IFDK 2ZFCA 1KILD 1SQXK 3ABVC 3C9IA 4JYCA 1PPJE 2P7JA 1XTGB 4IOIH 2OYIA 3QWOC 3A0HE 1NU1E 4OGQC 2QIWA 1RF1C 4IL6E 3CI9A 3TGUG 4W7YA 2IDBA 2AEMA 1KQGB 3CC4P 1OVVA 1L4AA 1FC2C 1FZCA 2IYPA 2IPPA 3Q5SA 2E75C 3W68A 3L74J 1WT6A 3HE5B 2KOGA 3T97B 1HJ0A 4AQRD 3KZIH 3MD0A 5KAIH 3TYYA 2WTYA 2ZT9B 2IFMA 1EDKA 2FYUG 2GUSA 2IZ1A 2P67A 3CCLP 2IYOA 2LXBA 4EI2A 2N9BA 1URQA 1SQPE 3NFQA 5CCGC 3L74D 1RQUA 2A06G 3V4QA 1SQQE 3L35A 1NTKK 3B4SA 4JBZA 3FX0A 4MN4C 2OTKE 2JJLA 1R5LA 2MKVA 4JQ0D 5KJ7A 1ZXGA 3C8VA 2O01J 2R5BA 3WMM0 1N7SC 1SQBK 3BATA 2OYIB 5AVRB 1SVFA 1BGYJ 2FFDC 2E5YA 2Q6QA 5B5EE 2I1JA 1HH0A 1SS1A 1P84I 1L2PA 1W5CE 1IFDA 1BSHA 4PJ0E 3RK2C 1L4AD 3AE4C 1E79H 3A0BH 5CCHC 4C7NA 1BGYD 1IO4A 2LR2A 3HTKA 2WSCH 2BEZF 1UIIA 2FBWC 1ZR4A 1IZNB 2YKOA 2KUBA 4I6MC 2V7QJ 1URQB 1DEBA 4YXWH 4IL6X 1IFMA 4PD4E 2R44A 3IF4A 1GU5A 5TISE 4ZNCA 1VQ8P 3L72J 4L74A 2FYNB 4C7RA 1MV8A 1IFPA 1URQD 1NTZJ 2YXQB 1VQKP 3RK3D 1L0LK 3IAOA 2CPSA 3GHGA 1PP9D 2IBZD 1BSNA 4W80A 3MUDA 2IX7C 5B5EH 2P58A 2VRSA 3H25A 4CPGA 4ASWA 1K9MQ 2NPSB 1FZBA 5KJ7D 2POHA 4PJ0H 1VQ7P 3L72D 1LWUC 1NHLA 5KLVE 3I56P 5AVZB 1RE3C 3B71A 2Z5IA 4GIFA 1HVVA 1T2KD 2OTLP 1N8RQ 3H6PA 1VQ6P 4GKGA 3BVHA 1ZRTE 3A7OA 2JDIH 2AXCA 2ITAA 3PTZA 1ZR2A 3V2QA 4H0LD 1U7JA 5CHXA 1KB9H 1SQPK 2WSFH 1GTWA 1GU4A 4C7NB 1SQXJ 1OWAA 2LKMA 1PV3A 5AVVB 1KMIZ 2B87A 1QGKB 3PLNA 1Y47A 1GZLA 2PP6A 3RGUA 2J58A 1R8EA 2HODA 3CC2P 3G71P 1PFIA 3H1IG 1BDDA 3TNUA 3WU2E 3M06A 4Y99C 2E76B 1KQLA 3PRJA 2IBZG 1VQPP 1SQVJ 3VOPA 1J1DC 4UB8E 1JY2P 4EDFA 2XU6A 2W6AA 2N1TC 4DOJA 3AE6C 1DX7A 1VQ4P 1QL2A 4WY4C 1H0TA 3VN0A 3L72G 3Q3DA 1NTZG 1L0NG 1KORA 3BCCE 2WT7B 1QLED 3I55P 3A3YB 1SQVD 4XE5B 3Q1MA 5E79H 1NTKJ 3SWKA 1N7LA 1LTJA 3LW5J 5B66H 2P2UA 3V2NA 4H44C 3Q5PA 5BVZA 2M0BA 2WPQA 1NTMJ 2BCCG 2GUVA 1JY3N 1M1JC 2HYNA 3B5NB 1ZP0C 2WPRA 1N73A 1M56D 3CX5I 2B88A 5TJHA 1NTKD 3AEBC 3P32A 1SQXG 3AEFC 5AVTB 3G3ZA 2KZIA 3HD7C 3CWBE 1NTMD 2HPCB 3F89A 1N7SA 1SFCA 1FE6A 1FDIA 4OGQB 4ZMDA 3RL0C 1RF1B 3D6ZA 1H0TB 3GW6A 3VYIA 2Q1KA 4KJMA 3CCQP 2XNDH 5GTHH 5AVQB 4OWFA 4ASVA 3L70G 2E75B 2M5AA 3HUSA 3M9HA 2K88A 5DJUB 1P84E 4BRYA 2W6BA 4H13C 4BWNA 3AE2C 4C46A 1SP4A 3KDPB 1NU1J 1KB9I 5CCHA 1RE4C 1KYOE 2R3CA 3AE9C 3JSVC 1MZ9A 1JTHB 3GF7A 2Q3IA 1YJWP 3KYQA 3TF5A 1PPJD 3H1JJ 4NPEA 1LP1B 2E74C 2SPZA 2O01N 1NTKG 1NU1D 1LTAC 1OFCX 3VTPC 2ZAEB 4HB1A 1Y8AA 4PV1D 2D2CC 1NTMG 2ZYDA 1SQBG 1N7SB 3R2PA 1NJIQ 2G3AA 2C0XA 2XNXA 1SQPJ 1YIJP 5APYA 1P84H 2FFDB 3HE5A 1N7SD 1LGHB 1DEEG 4ZKUA 1A02J 1EZVG 1SFCD 2KIKA 2KK7A 2KYVA 3T97A 3G4SP 1A02F 1T6AA 1AV1A 1AA0A 1CW5A 1JY3P 3AEGC 4AYCA 3ZDMA 1YJNP 3RK2B 1SQPD 5CJ0A 2K37A 1YTZT 5AW5B 2B89A 1W2BO 1OIPA 1SQQD 1GW3A 3L73E 3KPEA 3CLQA 3CL3D 1OX3A 2WPSA 3H32B 3CMEP 1PPJG 2QSIA 1K73Q 3MTUE 1ZV8A 1S2EA 2OYHC 1M1KQ 4OH8B 5M1BA 2G8YA 3U1CA 3MIWA 5AVYB 2NZ2A 1ZW0A 1L0LG 3GG2A 1NO4A 2WITA 5APWA 2Z5HA 2IBZI 1EXJA 1IC2A 1U7MA 2KB7P 1J1EC 3U59A 1FOSE 4JF7A 3H1JG 3M0DC 1SQVK 4JYBA 4EIJA 1T3JA 1NYHA 1S4XA 2WSEH 1LWUB 3TGUE 3N4XA 3AE8C 3H1HG 1VQ5P 3WUTA 1LTTC 1VPCA 2OTJP 1JCDA 1FDMA 1AJYA 1SQPG 1S1CX 4PD4D 2ZT9D 4GT1A 3A0BE 4R4LA 4W7ZA 4LGDE 1GK6A 5AW1B 1YI2P 4N3YB 3V2RA 2E5TA 3Q2YA 3CXHI 4K35A 2J59M 1FZFA 1IFIA 1NTMK 2NPSA 2R32A 2GM4A 1EC5A 2QM7A 2A06E 3CX5E 5EFWB 4Y99B 2YKPA 1RHZB 1EDJA 4HJGH 1BCCE 1J1DB 2ZVNB 1USEA 1JY2N 2N1TB 3D6YA 4DJGA 4WY4B 1GL2C 4YXDC 4HH2A 3SWYA 1LJ2A 3D71A 2BASA 1PP9J 1ZMEC 1BDCA 1JOCA 5GTIE 1GW4A 1EDIA 1EQ7A 1PL5A 3WUVA 3V4WA 3MHVA 3P8CE 4DT0A 3AEDC 1PZQA 2FXPA 2I8DA 1KB9E 1M57D 2K9JB 3L74G 4H44B 1KILC 4Y28J 3CX5H 1S9KE 1VQ9P 3BCCJ 3C1LA 1NU1K 1M1JB 2KXPB 4GOEA 4L76A 4UB6E 1E5WA 2AEJA 3AECC 2ZJSE 1QVGO 1FBMA 3MGNA 1KC8Q 3O6QB 1Q81Q 3L71E 4L73A 2XKMA 1JCCA 3HD7B 4IFFA 3AE1C 1T8ZA 2NPSD 3BCCD 3CCUP 4D6TE 1PGPA 3E1IA 1YQ4C 3M9QA 2WT7A 3D70A 1FU1A 4N78E 1J2JB 5GTIH 2H7HA 3CCSP 3RL0B 3QH9A 1X9VA 1EZVI 4OVNF 1KZUB 3SWFA 3VP9A 3FWNA 1MUUA 2A45G 1BGYG 2Y9ZA 1SQQK 1QEXA 1NKZB 1Y9BA 3G6EP 2GA1A 5AW7B 5BU8B 4H13B 5E79E 3B5NA 1KFMA 1LT9C 4UB6H 2R5DA 5B66E 2KS1B 3JC22 2PRRA 3TSIA 2ZYAA 1IFJA 4I7ZC 2Y0EA 3CWBD
chains in the Genus database with same CATH topology
3E1RA 3WUTA 1UIIA 3WUUA 3F5HA 4BRYB 2Q6QA 3WUVA 4BRYA 2ZXXA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1R A;  3WUT A;  1UII A;  3WUU A;  3F5H A;  4BRY B;  2Q6Q A;  3WUV A;  4BRY A;  2ZXX A;  2WVR A; 
#chains in the Genus database with same CATH topology
 5APS A;  1PP9 G;  2AEF A;  3KXD A;  3CD6 P;  2HPC A;  1HUC A;  2KSJ A;  1HWT C;  4U3F E;  1VF5 C;  2E74 B;  2E76 D;  1FAV A;  3H1I E;  3E7K A;  4GOD A;  1RF1 A;  2RMZ A;  5BU5 A;  1VQL P;  2D2C B;  4I1L A;  2IBZ E;  1K05 A;  1OW8 A;  2K9Y A;  1DH3 A;  1L4A C;  1FZC C;  1P84 D;  1NAF A;  1GK4 A;  4JPZ B;  2O01 H;  2KNC B;  1KYO D;  1YTZ I;  3OA7 A;  2RKL A;  3H1L E;  1YHQ P;  3L37 A;  3Q5R A;  1NTZ E;  1L0N E;  3PJS K;  5GTH E;  1JTH A;  5AW9 B;  1LTB C;  1H8A A;  2FXM A;  1ZN5 A;  3HE4 B;  1H88 A;  1MFZ A;  1KV4 A;  3I5C A;  1T3U A;  4B86 A;  2QJP C;  1LP1 A;  1URQ C;  5CCG A;  3CCR P;  4DCK A;  3RK3 C;  3MZW B;  3B5N D;  2W8Z A;  2BCC E;  2Q7C A;  2HFE D;  5KLV K;  3CXH E;  5KJ7 C;  2OYH B;  1Q90 D;  3L73 J;  4HKZ H;  3IN6 A;  4GDO A;  1OMI A;  3O8Z A;  1PGO A;  2V7Q H;  2FFD A;  4KHX A;  1T2K C;  3CC7 P;  3L4F A;  1SQX E;  1NWQ A;  1MKM A;  1J1E B;  4I2L C;  1NVO A;  4OGQ D;  3L75 E;  3BAS A;  1BE3 E;  4H0L C;  1DD4 A;  4R4M A;  1SQV G;  1ZOY C;  2YIU C;  1K04 A;  3LIE A;  1S3J A;  5APX A;  4GOF A;  3SFD C;  1GDT A;  3L73 D;  4ZKP A;  3WUU A;  2E75 D;  3P7K A;  3A5T A;  1FJP A;  2QE7 H;  1XTC C;  1KTM A;  2YMK A;  2Z4E A;  1Q7Y Q;  3L70 E;  3S4R A;  3H32 A;  3EFG A;  1FOS F;  4NPF X;  3CXH H;  2QM8 A;  2C9N Y;  1X22 A;  1WRG A;  1AFO A;  1OXZ A;  3TGU J;  2QJY C;  2JO1 A;  3KHU A;  3W67 A;  3PHL A;  5CCG D;  2MJZ A;  3MP7 B;  1JM0 A;  1DIP A;  5KAF E;  3GHG C;  3MUD C;  1HGZ A;  1FZE A;  2IFN A;  3TK1 A;  1NTK E;  3OW2 O;  1SQQ J;  2HG5 D;  2WSC J;  3TGU D;  1YIT P;  1LWU A;  1FZG A;  3FXE A;  1N86 A;  1RY3 A;  3CCE P;  1RE3 A;  4EYY Q;  3H1K E;  2IZ0 A;  1SQB E;  2JKV A;  2WPV B;  2NRG A;  1PGJ A;  1KQF B;  2WSS H;  1YYC A;  3AE7 C;  1GL2 B;  2J5U A;  3TDK A;  4RO0 A;  3L73 G;  4TLF A;  3CCM P;  1EZV E;  4QMA A;  2LXC B;  2WZ7 A;  2WWW A;  2A45 I;  1RH5 B;  2FKW B;  1BCC J;  3RK2 D;  3PH0 A;  3NMD A;  1CZQ A;  3VMZ A;  3AE3 C;  5CCH D;  4YPC A;  1X0T A;  2KZJ A;  3BRV B;  5KAF H;  2HLO A;  3VMX A;  4LC1 A;  3PP5 A;  1JUN A;  1G2C B;  2RH0 A;  2Y0C A;  2FYZ A;  1KIL B;  2XZR A;  1M90 Q;  2A06 D;  3CX5 D;  2Q9I A;  1AVO A;  1NU1 G;  2ZVO B;  2QRX A;  5AW8 B;  1K8A Q;  2YKQ A;  3LW5 H;  1BCC D;  2HR3 A;  1FS0 E;  1QX8 A;  3B8E B;  2N9Y B;  2YMY A;  2OYO A;  2WSF J;  2N1T A;  4WY4 A;  4DZO A;  1GMJ A;  2M8R A;  1L0L E;  3IFM A;  1HF9 A;  2UWJ E;  1G1I A;  2DW3 A;  5KKZ C;  3SFE C;  2CK3 H;  2W83 C;  5KLI C;  2KI7 B;  5H2F H;  3P8C D;  2O1K A;  3H1J E;  1OVU A;  3KQG A;  1IJD B;  2QJK C;  3M0A A;  1KB9 D;  3S1K A;  3L71 J;  1Q2N A;  2JP3 A;  5AVS B;  1LTJ C;  1OW6 A;  1SQQ G;  2K9J A;  1S9K D;  3GMA A;  3E1R A;  4D6T J;  5KLV J;  2QEX P;  2M3E A;  3H1H E;  1R5S A;  3FXD A;  1DD3 A;  1M1J A;  4M3L A;  3EWK A;  2FYU E;  1NH4 A;  1LT9 B;  3OAK A;  1N73 C;  4PV1 C;  3A0H H;  4N6J A;  3L71 D;  3O6Q A;  4I7Z B;  1VDF A;  1YJ9 P;  4IL6 H;  2K3R A;  3HD7 A;  1BCC G;  4D6T D;  5KLV D;  2V4H A;  2FXO A;  3NTN A;  1KIL E;  1GD2 E;  2P10 A;  3AEE C;  1VF5 B;  4N78 D;  1SFC C;  1HJB A;  1LT1 A;  5AW4 B;  1ZRT D;  1OZH A;  3CCV P;  2XDJ A;  3FGA D;  3V2P A;  1VF5 D;  1YBK A;  1JMB A;  4NPD A;  2H43 A;  1IFN A;  1NGM B;  2N1T D;  4WY4 D;  2YXR B;  1L4A B;  1FZC B;  5L8R J;  3K5B A;  4U3F J;  5AW6 B;  1JMM A;  2OQQ A;  1Q86 Q;  3HUS C;  3H1I J;  4O9B A;  3M9B A;  1KYO I;  1RE4 A;  4WWI A;  2KS1 A;  1UIX A;  1AVY A;  3F5H A;  1JNM A;  1HBW A;  1RF0 C;  5CMZ A;  1QVF O;  4K3A A;  4H44 D;  2W6J H;  4U3F D;  2H8P D;  2QJP B;  1W2E A;  2L5G B;  3RBZ A;  3RK3 B;  2YO3 A;  3H1I D;  3L74 E;  3L71 G;  3V6I A;  3H1L J;  1L0N J;  2WMM A;  4AUW A;  1LTI C;  2PGD A;  3JCU E;  3FWL A;  4D6T G;  5KLV G;  2YNY A;  2M3B A;  5DJT B;  3VP8 A;  3HD7 D;  4A7P A;  3RBX A;  2Q3E A;  1G1J A;  1Q82 Q;  2KNC A;  3AEA C;  2BCC J;  2R3S A;  5APT A;  5C39 A;  3H1L D;  1NTZ D;  3R4Y A;  1L0N D;  3RL0 D;  3CWB J;  4H0L B;  3L36 A;  2QA4 P;  5KTB A;  2QG4 A;  2ZT9 C;  2YIU B;  5AW0 B;  3HE4 A;  1NAY A;  2FYU K;  3VMY A;  3U1A A;  1LTS C;  3LID A;  4HYT B;  4PD4 H;  1VQO P;  4XFJ A;  5TIS H;  1JY2 O;  5APV A;  1AQT A;  1S5L E;  4H13 D;  3HTK B;  1BGY E;  2BCC D;  2BEQ D;  3L75 J;  2OAR A;  4LLH A;  1BE3 J;  3JCU H;  3CXH D;  2ZXE B;  4KT0 J;  4U3F G;  1KN7 A;  1YQ3 C;  2OYH A;  3OJA B;  5K5G B;  2QJY B;  1QL1 A;  5AVU B;  3GF3 A;  4BXL A;  1U57 A;  2CPB A;  2OYI C;  1FDO A;  1KQS O;  1SQX D;  2E74 D;  2E42 A;  3GHG B;  1M7L A;  3BRT B;  3L70 J;  3RK3 E;  2KP8 A;  1X79 B;  3BCC G;  3L75 D;  1PP9 E;  1BE3 D;  1CI6 A;  4WB4 A;  4Z1M H;  2D2C D;  1EDL A;  3M0D A;  3II6 A;  4WBA A;  1S72 P;  5CBN A;  4WVZ A;  3SSU A;  1JB0 J;  5CBO A;  5CJ4 A;  1CSB A;  3CPW O;  2WVR A;  2W27 A;  2Y9Y A;  2H89 C;  3H1L G;  3L72 E;  1NKN A;  2K1A A;  1S5L H;  4RJT A;  2A45 H;  3L70 D;  1IK7 A;  3IR9 A;  3RL0 g;  2KLU A;  3N7N A;  1PIX A;  2W90 A;  2RN0 A;  1ZLL A;  1N2D C;  3WU2 H;  2FYN C;  3H1K J;  4TT3 H;  3NXS A;  1SQB J;  1Z56 A;  5AW3 B;  2B87 B;  3CWB G;  2ZXX A;  2HOD B;  2C0W A;  4UB8 H;  1H89 A;  2WSE J;  4RES B;  3TNU B;  1PGQ A;  2NPS C;  2C9L Y;  2KSE A;  3M91 A;  2P1J A;  4U7J A;  3H1K D;  3L75 G;  1BE3 G;  1OVR A;  1SQB D;  3P8M C;  3USS A;  2AXT E;  3AE5 C;  5AVX B;  1CI6 B;  1AQ5 A;  1S5L X;  2H88 C;  3GLM A;  1JEK A;  1EZV D;  1LTG C;  1GL2 A;  2E43 A;  3G9R A;  5KKZ B;  2QVA A;  3EQ2 A;  5KLI B;  3CMA P;  1NOH A;  4XA4 A;  4EOT A;  1SQV E;  1VQN P;  4RKU J;  2QJK B;  4PD4 I;  5AVW B;  1L0L J;  1G2C A;  1LTJ B;  1MFT A;  1KIL A;  1RF0 A;  1FJK A;  3V5B A;  1HGV A;  1VL2 A;  2B9B A;  2E76 C;  1D7M A;  3VMA A;  4YTP C;  2PFX A;  2AXT H;  1VQM P;  1N73 B;  3A2A A;  4PV1 B;  2OGU A;  1JY3 O;  1L0L D;  2KLV A;  4IFM A;  2L91 A;  2XV5 A;  3H1H J;  2JR8 A;  1FZA A;  3H1K G;  1HTL C;  2O1J A;  2JWD A;  1NTM E;  2FYU J;  2WQY C;  1NTZ K;  1SFC B;  1L0N K;  3S9O A;  3H1J D;  2YO2 A;  3CCJ P;  1KFN A;  2I1K A;  2ZYG A;  2FY8 A;  2Q5U A;  2PAJ A;  2JWA A;  2Y0D A;  5AW2 B;  5APQ A;  1EXI A;  1KYO H;  1TU3 F;  1USD A;  3UIA A;  3H1H D;  1X8Y A;  1GL2 D;  5H2F E;  2M5A B;  3HUS B;  1OW7 A;  2FYU D;  5APU A;  4BRY B;  1KD1 Q;  3HRN A;  1LNQ A;  1IK9 A;  1M8O B;  3B5N C;  2O3J A;  1LT9 A;  1WMK A;  1SLQ A;  2JEE A;  3KZI E;  1JO5 A;  4L75 A;  3EFF K;  3ITK A;  5KAI E;  1RQV A;  4IFD K;  2ZFC A;  1KIL D;  1SQX K;  3ABV C;  3C9I A;  4JYC A;  1PPJ E;  2P7J A;  1XTG B;  4IOI H;  2OYI A;  3QWO C;  3A0H E;  1NU1 E;  4OGQ C;  2QIW A;  1RF1 C;  4IL6 E;  3CI9 A;  3TGU G;  4W7Y A;  2IDB A;  2AEM A;  1KQG B;  3CC4 P;  1OVV A;  1L4A A;  1FC2 C;  1FZC A;  2IYP A;  2IPP A;  3Q5S A;  2E75 C;  3W68 A;  3L74 J;  1WT6 A;  3HE5 B;  2KOG A;  3T97 B;  1HJ0 A;  4AQR D;  3KZI H;  3MD0 A;  5KAI H;  3TYY A;  2WTY A;  2ZT9 B;  2IFM A;  1EDK A;  2FYU G;  2GUS A;  2IZ1 A;  2P67 A;  3CCL P;  2IYO A;  2LXB A;  4EI2 A;  2N9B A;  1URQ A;  1SQP E;  3NFQ A;  5CCG C;  3L74 D;  1RQU A;  2A06 G;  3V4Q A;  1SQQ E;  3L35 A;  1NTK K;  3B4S A;  4JBZ A;  3FX0 A;  4MN4 C;  2OTK E;  2JJL A;  1R5L A;  2MKV A;  4JQ0 D;  5KJ7 A;  1ZXG A;  3C8V A;  2O01 J;  2R5B A;  3WMM 0;  1N7S C;  1SQB K;  3BAT A;  2OYI B;  5AVR B;  1SVF A;  1BGY J;  2FFD C;  2E5Y A;  2Q6Q A;  5B5E E;  2I1J A;  1HH0 A;  1SS1 A;  1P84 I;  1L2P A;  1W5C E;  1IFD A;  1BSH A;  4PJ0 E;  3RK2 C;  1L4A D;  3AE4 C;  1E79 H;  3A0B H;  5CCH C;  4C7N A;  1BGY D;  1IO4 A;  2LR2 A;  3HTK A;  2WSC H;  2BEZ F;  1UII A;  2FBW C;  1ZR4 A;  1IZN B;  2YKO A;  2KUB A;  4I6M C;  2V7Q J;  1URQ B;  1DEB A;  4YXW H;  4IL6 X;  1IFM A;  4PD4 E;  2R44 A;  3IF4 A;  1GU5 A;  5TIS E;  4ZNC A;  1VQ8 P;  3L72 J;  4L74 A;  2FYN B;  4C7R A;  1MV8 A;  1IFP A;  1URQ D;  1NTZ J;  2YXQ B;  1VQK P;  3RK3 D;  1L0L K;  3IAO A;  2CPS A;  3GHG A;  1PP9 D;  2IBZ D;  1BSN A;  4W80 A;  3MUD A;  2IX7 C;  5B5E H;  2P58 A;  2VRS A;  3H25 A;  4CPG A;  4ASW A;  1K9M Q;  2NPS B;  1FZB A;  5KJ7 D;  2POH A;  4PJ0 H;  1VQ7 P;  3L72 D;  1LWU C;  1NHL A;  5KLV E;  3I56 P;  5AVZ B;  1RE3 C;  3B71 A;  2Z5I A;  4GIF A;  1HVV A;  1T2K D;  2OTL P;  1N8R Q;  3H6P A;  1VQ6 P;  4GKG A;  3BVH A;  1ZRT E;  3A7O A;  2JDI H;  2AXC A;  2ITA A;  3PTZ A;  1ZR2 A;  3V2Q A;  4H0L D;  1U7J A;  5CHX A;  1KB9 H;  1SQP K;  2WSF H;  1GTW A;  1GU4 A;  4C7N B;  1SQX J;  1OWA A;  2LKM A;  1PV3 A;  5AVV B;  1KMI Z;  2B87 A;  1QGK B;  3PLN A;  1Y47 A;  1GZL A;  2PP6 A;  3RGU A;  2J58 A;  1R8E A;  2HOD A;  3CC2 P;  3G71 P;  1PFI A;  3H1I G;  1BDD A;  3TNU A;  3WU2 E;  3M06 A;  4Y99 C;  2E76 B;  1KQL A;  3PRJ A;  2IBZ G;  1VQP P;  1SQV J;  3VOP A;  1J1D C;  4UB8 E;  1JY2 P;  4EDF A;  2XU6 A;  2W6A A;  2N1T C;  4DOJ A;  3AE6 C;  1DX7 A;  1VQ4 P;  1QL2 A;  4WY4 C;  1H0T A;  3VN0 A;  3L72 G;  3Q3D A;  1NTZ G;  1L0N G;  1KOR A;  3BCC E;  2WT7 B;  1QLE D;  3I55 P;  3A3Y B;  1SQV D;  4XE5 B;  3Q1M A;  5E79 H;  1NTK J;  3SWK A;  1N7L A;  1LTJ A;  3LW5 J;  5B66 H;  2P2U A;  3V2N A;  4H44 C;  3Q5P A;  5BVZ A;  2M0B A;  2WPQ A;  1NTM J;  2BCC G;  2GUV A;  1JY3 N;  1M1J C;  2HYN A;  3B5N B;  1ZP0 C;  2WPR A;  1N73 A;  1M56 D;  3CX5 I;  2B88 A;  5TJH A;  1NTK D;  3AEB C;  3P32 A;  1SQX G;  3AEF C;  5AVT B;  3G3Z A;  2KZI A;  3HD7 C;  3CWB E;  1NTM D;  2HPC B;  3F89 A;  1N7S A;  1SFC A;  1FE6 A;  1FDI A;  4OGQ B;  4ZMD A;  3RL0 C;  1RF1 B;  3D6Z A;  1H0T B;  3GW6 A;  3VYI A;  2Q1K A;  4KJM A;  3CCQ P;  2XND H;  5GTH H;  5AVQ B;  4OWF A;  4ASV A;  3L70 G;  2E75 B;  2M5A A;  3HUS A;  3M9H A;  2K88 A;  5DJU B;  1P84 E;  4BRY A;  2W6B A;  4H13 C;  4BWN A;  3AE2 C;  4C46 A;  1SP4 A;  3KDP B;  1NU1 J;  1KB9 I;  5CCH A;  1RE4 C;  1KYO E;  2R3C A;  3AE9 C;  3JSV C;  1MZ9 A;  1JTH B;  3GF7 A;  2Q3I A;  1YJW P;  3KYQ A;  3TF5 A;  1PPJ D;  3H1J J;  4NPE A;  1LP1 B;  2E74 C;  2SPZ A;  2O01 N;  1NTK G;  1NU1 D;  1LTA C;  1OFC X;  3VTP C;  2ZAE B;  4HB1 A;  1Y8A A;  4PV1 D;  2D2C C;  1NTM G;  2ZYD A;  1SQB G;  1N7S B;  3R2P A;  1NJI Q;  2G3A A;  2C0X A;  2XNX A;  1SQP J;  1YIJ P;  5APY A;  1P84 H;  2FFD B;  3HE5 A;  1N7S D;  1LGH B;  1DEE G;  4ZKU A;  1A02 J;  1EZV G;  1SFC D;  2KIK A;  2KK7 A;  2KYV A;  3T97 A;  3G4S P;  1A02 F;  1T6A A;  1AV1 A;  1AA0 A;  1CW5 A;  1JY3 P;  3AEG C;  4AYC A;  3ZDM A;  1YJN P;  3RK2 B;  1SQP D;  5CJ0 A;  2K37 A;  1YTZ T;  5AW5 B;  2B89 A;  1W2B O;  1OIP A;  1SQQ D;  1GW3 A;  3L73 E;  3KPE A;  3CLQ A;  3CL3 D;  1OX3 A;  2WPS A;  3H32 B;  3CME P;  1PPJ G;  2QSI A;  1K73 Q;  3MTU E;  1ZV8 A;  1S2E A;  2OYH C;  1M1K Q;  4OH8 B;  5M1B A;  2G8Y A;  3U1C A;  3MIW A;  5AVY B;  2NZ2 A;  1ZW0 A;  1L0L G;  3GG2 A;  1NO4 A;  2WIT A;  5APW A;  2Z5H A;  2IBZ I;  1EXJ A;  1IC2 A;  1U7M A;  2KB7 P;  1J1E C;  3U59 A;  1FOS E;  4JF7 A;  3H1J G;  3M0D C;  1SQV K;  4JYB A;  4EIJ A;  1T3J A;  1NYH A;  1S4X A;  2WSE H;  1LWU B;  3TGU E;  3N4X A;  3AE8 C;  3H1H G;  1VQ5 P;  3WUT A;  1LTT C;  1VPC A;  2OTJ P;  1JCD A;  1FDM A;  1AJY A;  1SQP G;  1S1C X;  4PD4 D;  2ZT9 D;  4GT1 A;  3A0B E;  4R4L A;  4W7Z A;  4LGD E;  1GK6 A;  5AW1 B;  1YI2 P;  4N3Y B;  3V2R A;  2E5T A;  3Q2Y A;  3CXH I;  4K35 A;  2J59 M;  1FZF A;  1IFI A;  1NTM K;  2NPS A;  2R32 A;  2GM4 A;  1EC5 A;  2QM7 A;  2A06 E;  3CX5 E;  5EFW B;  4Y99 B;  2YKP A;  1RHZ B;  1EDJ A;  4HJG H;  1BCC E;  1J1D B;  2ZVN B;  1USE A;  1JY2 N;  2N1T B;  3D6Y A;  4DJG A;  4WY4 B;  1GL2 C;  4YXD C;  4HH2 A;  3SWY A;  1LJ2 A;  3D71 A;  2BAS A;  1PP9 J;  1ZME C;  1BDC A;  1JOC A;  5GTI E;  1GW4 A;  1EDI A;  1EQ7 A;  1PL5 A;  3WUV A;  3V4W A;  3MHV A;  3P8C E;  4DT0 A;  3AED C;  1PZQ A;  2FXP A;  2I8D A;  1KB9 E;  1M57 D;  2K9J B;  3L74 G;  4H44 B;  1KIL C;  4Y28 J;  3CX5 H;  1S9K E;  1VQ9 P;  3BCC J;  3C1L A;  1NU1 K;  1M1J B;  2KXP B;  4GOE A;  4L76 A;  4UB6 E;  1E5W A;  2AEJ A;  3AEC C;  2ZJS E;  1QVG O;  1FBM A;  3MGN A;  1KC8 Q;  3O6Q B;  1Q81 Q;  3L71 E;  4L73 A;  2XKM A;  1JCC A;  3HD7 B;  4IFF A;  3AE1 C;  1T8Z A;  2NPS D;  3BCC D;  3CCU P;  4D6T E;  1PGP A;  3E1I A;  1YQ4 C;  3M9Q A;  2WT7 A;  3D70 A;  1FU1 A;  4N78 E;  1J2J B;  5GTI H;  2H7H A;  3CCS P;  3RL0 B;  3QH9 A;  1X9V A;  1EZV I;  4OVN F;  1KZU B;  3SWF A;  3VP9 A;  3FWN A;  1MUU A;  2A45 G;  1BGY G;  2Y9Z A;  1SQQ K;  1QEX A;  1NKZ B;  1Y9B A;  3G6E P;  2GA1 A;  5AW7 B;  5BU8 B;  4H13 B;  5E79 E;  3B5N A;  1KFM A;  1LT9 C;  4UB6 H;  2R5D A;  5B66 E;  2KS1 B;  3JC2 2;  2PRR A;  3TSI A;  2ZYA A;  1IFJ A;  4I7Z C;  2Y0E A;  3CWB D; 
#chains in the Genus database with same CATH homology
 3E1R A;  3WUT A;  1UII A;  3WUU A;  3F5H A;  4BRY B;  2Q6Q A;  3WUV A;  4BRY A;  2ZXX A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...