4BRYB

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
b'PPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GEMININ
molecule tags Cell cycle
source organism Homo sapiens
publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryB00
2ZXXA 4BRYB 3E1RA 1UIIA 3WUVA 2Q6QA 4BRYA 3WUUA 2WVRA 3F5HA 3WUTA
chains in the Genus database with same CATH superfamily
2Z4EA 1U57A 3H1KD 1FBMA 1KB9E 2HG5D 3MIWA 1NTKE 2G3AA 3H1IJ 3IN6A 4OH8B 3Q2YA 3G9RA 2E43A 1P84H 1NYHA 2YXQB 1BSNA 3L75J 2KLVA 1BCCJ 5AVWB 3H1JJ 1VQLP 1KQGB 5AW6B 4L75A 3NMDA 2Q3EA 3P7KA 3PJSK 4JYBA 5L8RJ 2FY8A 1DH3A 2J58A 2KB7P 4PV1C 1IJDB 5TJHA 1UIXA 2QJKC 3EFGA 3HD7C 5B5EH 1JY3N 3VMZA 2H43A 1SFCD 5AVTB 3MP7B 3P8CE 1VQPP 1Q86Q 3AE4C 4LC1A 2FYUK 2JDIH 3H1KE 3HUSB 2V4HA 3PP5A 4HYTB 3L73J 3CXHH 3ITKA 1IFNA 4WY4A 1KILA 2OTKE 3L70E 3IR9A 1L0LG 4AYCA 1MFTA 3KZIE 1FZCA 3BCCJ 1IO4A 4GOEA 2WSCH 5AVRB 2RMZA 2K37A 2QM8A 4PD4H 5KJ7D 4MN4C 2KSJA 3M9BA 3S9OA 1N7SB 3BRVB 1CI6B 1SQVD 5AVXB 4IFFA 3S4RA 3L74D 5B5EE 5KLVJ 1EDLA 2E75C 2IPPA 2O1JA 1G2CB 2O3JA 2O01J 1N2DC 1G1JA 2WSSH 3V4WA 1LWUC 1K73Q 2FFDB 2RN0A 2AEMA 4GIFA 2KYVA 3CXHD 2IDBA 1NHLA 3CX5D 3GHGC 1HWTC 1KILD 3CX5E 3TGUJ 2BEZF 2M0BA 3FWNA 1AFOA 1EDJA 1LTJA 3CC4P 2FKWB 1IK9A 2JKVA 1NTZK 2NPSC 2R5DA 3AEAC 1IFIA 3VOPA 2M5AB 2QA4P 3TDKA 1QX8A 1EDKA 1LTAC 3L71D 3GLMA 3TF5A 1SQVJ 3AE2C 1ZP0C 5CBNA 4UB6E 3CX5I 3H1ID 2W27A 2WZ7A 1SQBG 5CJ4A 3H25A 1WRGA 4EOTA 3H1LE 3Q5SA 5DJUB 1EXJA 1OIPA 2IFNA 4ZKUA 2ZYDA 4IL6E 2QEXP 1VDFA 3AE5C 1FU1A 3VYIA 5KAIH 3CWBE 1L0LE 1WMKA 3NTNA 2Q3IA 1IK7A 2Y0EA 2AXTH 3CWBD 4N78D 3CCQP 5APTA 5K5GB 1T8ZA 1LP1A 1RF0A 1GK6A 1L0LK 4GOFA 3N4XA 2WQYC 3L71E 2ZAEB 1S2EA 1BSHA 3MUDC 1PPJD 1J1DC 1EC5A 4IL6X 2Y9YA 5GTHH 1PPJE 1Q7YQ 1FC2C 4H44D 3L72D 1HJBA 4KHXA 3U1CA 1OW8A 2M3EA 1PZQA 3GHGB 5AW8B 3VMXA 1NJIQ 4XE5B 3JCUH 3G4SP 2QE7H 4ZMDA 4L73A 1ZR2A 2QRXA 2WPVB 1FDOA 1USEA 1A02J 2POHA 1MV8A 3BATA 4I2LC 3HUSA 5TISH 2WSFJ 4H0LD 3HE4A 1YTZI 1NAYA 2OYIC 2QG4A 3ABVC 4DJGA 1JTHB 1OX3A 1T2KD 1GL2D 1LWUB 1X8YA 1ZMEC 3KYQA 4DOJA 2QSIA 1L0NG 2KIKA 2PP6A 3SWYA 4B86A 1BGYE 3OAKA 3TGUD 5GTHE 1SQPE 4OVNF 3V6IA 4M3LA 1BGYD 1RE3A 1NAFA 1U7JA 1Y9BA 2JO1A 2JR8A 2KS1B 3B5ND 3JSVC 3MTUE 2KS1A 4PJ0H 1KB9I 2ZYAA 1PV3A 3JC22 3AEFC 1NTME 3D71A 1JMMA 2KSEA 3AEDC 5KAFE 1KYOI 2V7QJ 1VQOP 2R32A 3KZIH 1J2JB 1U7MA 1D7MA 3VN0A 1EQ7A 2K1AA 2E76C 3CMAP 3CLQA 1SQPJ 3CCUP 2OTLP 1BGYJ 1S3JA 2W6BA 4C7RA 5H2FH 2XZRA 1S9KE 1L4AB 1YYCA 3CCLP 1OWAA 2E74D 2FYNB 3WUUA 1CW5A 2YIUB 4JYCA 4XA4A 1LTTC 1AJYA 4PD4D 1SFCB 4OGQB 2LXBA 1NTMG 1SFCA 2H89C 2QJKB 3P32A 4H44C 1K9MQ 3CCEP 3Q3DA 2IBZD 3GG2A 1LT9C 2GUSA 5GTIH 1ZLLA 4ASWA 1FZBA 1PGPA 2ZVNB 3L70D 4D6TG 1CSBA 4DCKA 3MGNA 5E79E 3M91A 3A5TA 1H88A 2XKMA 3GF3A 1VL2A 1NTMK 1Z56A 5APVA 2WSCJ 1TU3F 1RF1A 1KQFB 2I8DA 3T97A 2BASA 2GUVA 1GW4A 3AEBC 3L75E 4I7ZB 2HFED 2IBZI 3CI9A 4PV1D 1SQBE 3KXDA 3L75D 3L74G 4EYYQ 3H1IE 4K3AA 1YJ9P 3AEGC 1UIIA 3H1LD 1GK4A 1HTLC 1PGQA 4NPEA 1X22A 3H1HG 3PH0A 4NPFX 3RGUA 2PAJA 2E76B 1RHZB 2WPSA 3CWBJ 1HGVA 2D2CB 4GKGA 1YIJP 1DIPA 3MUDA 3D70A 2FBWC 2E75D 2FYNC 1M1JB 4IOIH 1YJWP 1GTWA 1HF9A 2WPQA 2ZT9D 1SQVE 1QL2A 2PFXA 1AQTA 3CCJP 2XU6A 1N73C 4JF7A 3FGAD 1IFDA 1PFIA 3M9HA 1IFPA 1W2EA 2RH0A 5KLVG 3V4QA 2O01H 3PLNA 3U59A 5CBOA 1L0NK 2YNYA 3B5NA 3KPEA 4L76A 2IFMA 1LT1A 4Y99C 2E5YA 2OGUA 3JCUE 1KD1Q 3L72J 3CC7P 3B71A 4N6JA 1AA0A 1S5LH 2Y0DA 4N78E 1NTZJ 4WY4B 1VQ9P 1JY3O 3USSA 3HD7D 5BVZA 1T3UA 2AXCA 1ZOYC 4HH2A 1LT9A 4WVZA 2BCCD 1NU1K 3B4SA 3M0DC 4BXLA 1H0TB 1JEKA 5KLVE 3KQGA 1JCDA 4I6MC 2R44A 1USDA 1JB0J 1MFZA 1KN7A 1DD3A 4C7NA 1VQ8P 1VQKP 2XV5A 2K9JB 1J1EC 4H13B 3F89A 3Q5RA 2HODB 3BCCE 3FWLA 4U3FD 5KLVK 2QJPC 3K5BA 3L70J 3B8EB 4U3FE 5AW1B 3SWKA 1M1KQ 4IFDK 1LJ2A 1M1JC 4JPZB 1IFMA 2ITAA 2Q1KA 3L73E 1FOSE 3RK2B 1OZHA 2OYHC 2P58A 1P84I 1VPCA 2CK3H 4PJ0E 1JTHA 1URQA 4ZKPA 1BE3E 1PP9J 3FX0A 3L74J 1NTKG 4N3YB 4Y99B 5APSA 4BRYB 5KLIB 2B9BA 3GF7A 5C39A 3QWOC 2WTYA 1QL1A 4HJGH 1VF5C 1Q90D 2CPBA 2M3BA 4WY4C 4EIJA 2OTJP 2J5UA 2KK7A 3H1LG 1N73A 3H1JE 1QLED 3IFMA 2R5BA 1CZQA 2G8YA 2LKMA 2MKVA 1VQ6P 3OW2O 1PGOA 2ZT9B 2P1JA 1NTKJ 3AE3C 1PP9G 2DW3A 2JEEA 3RK2C 1AVYA 1LTSC 1J1DB 3FXEA 4A7PA 5BU8B 1SQBK 1KILC 5E79H 4RJTA 1YITP 1NH4A 3L4FA 1Q2NA 2N9YB 3N7NA 1SQXE 1LGHB 1NVOA 2WPRA 1SS1A 2C0XA 2FYUJ 4TT3H 1S72P 1S9KD 1J1EB 3EWKA 3V2PA 5B66H 1RY3A 2OYOA 2W6AA 3RBZA 2YMYA 2IX7C 3H1HE 3O8ZA 1OVUA 3Q1MA 3IAOA 3L72E 4C46A 4EDFA 2YIUC 2BEQD 3WU2H 1FE6A 1K05A 4PD4E 1VQMP 2KI7B 1DD4A 3E1IA 2XNXA 1VQ5P 2N1TB 1NTMD 2E74C 2I1JA 2HYNA 1KB9D 1L2PA 2QJYC 3SFDC 1IZNB 1RQVA 1WT6A 2A06G 2PGDA 4YXWH 1RE4A 3C8VA 1LTIC 3CXHI 3RK3E 3RL0B 1YHQP 4L74A 1N86A 4GT1A 1NKZB 1HJ0A 3HE5B 4HB1A 3UIAA 1N7SC 3V5BA 3L37A 1NTKK 1LNQA 1SQQG 1DX7A 2WMMA 1AVOA 2FYUD 3GMAA 1NWQA 1L0NE 2SPZA 1OW6A 3D6YA 1RQUA 1SQXJ 2O1KA 1N8RQ 2HR3A 3R2PA 1SVFA 2E5TA 1EZVI 1LT9B 2K9YA 3KHUA 2K3RA 3PRJA 1S4XA 3U1AA 3V2NA 2IBZE 2K88A 2E74B 1Q81Q 3MZWB 1GL2C 2UWJE 1JUNA 4W80A 5AVZB 2IZ0A 1SQVG 1KILE 2Y0CA 4UB6H 5CHXA 3RK3D 2Z5IA 1DEBA 1IC2A 1M1JA 5EFWB 1FZEA 5APXA 4R4MA 3IF4A 1K04A 4IL6H 4ASVA 4I1LA 3LIEA 1KYOD 1KFMA 1BCCG 5AW0B 3VP9A 3VTPC 1NOHA 1S5LE 2KNCA 3A0BE 4Y28J 1KILB 4JBZA 3L74E 1KMIZ 1BE3J 1PP9E 2WWWA 5CCHC 1VQ7P 3B5NB 5AW7B 1XTGB 5AVSB 1JCCA 1SQVK 2VRSA 2YMKA 3VMAA 2ZVOB 3CCRP 1M56D 2V7QH 1NU1D 1T6AA 1IFJA 4U3FJ 4PD4I 3CWBG 1RF1B 3F5HA 1OVRA 1PGJA 3KDPB 4D6TE 1QEXA 1H0TA 2WITA 2OYHB 3CD6P 2KLUA 5CCGD 1H8AA 2CPSA 3CCVP 1BE3D 1KYOE 3HD7A 2N1TC 4H13D 4XFJA 1FZGA 2Q9IA 1BDCA 4C7NB 1FOSF 3RL0D 1N7SD 1JY2O 1MKMA 1S1CX 1ZRTD 1NTMJ 1YI2P 3CMEP 1N7LA 3L73G 4JQ0D 2AEJA 3W68A 3CPWO 3R4YA 5APUA 5KKZB 2WVRA 3AE6C 3RK3B 2GM4A 3BCCD 2KZJA 3A7OA 4YXDC 2N1TD 4H13C 2C9LY 3HTKB 1HVVA 2W8ZA 4D6TD 1PPJG 4UB8H 3HRNA 2FXPA 4O9BA 1SQQK 3AECC 5APQA 4GODA 4NPDA 2BCCE 3LW5J 2BCCJ 3EFFK 2ZXEB 1SQXD 2IBZG 4GDOA 3CC2P 3SWFA 2P67A 1M8OB 5DJTB 3OA7A 1G1IA 1M57D 1N7SA 1OXZA 4WBAA 5CMZA 3RL0g 2P7JA 2FYZA 2YKPA 4U7JA 1AQ5A 1FZCB 4RO0A 4WB4A 1HBWA 2XDJA 3H1JD 4OWFA 1EZVE 5H2FE 5KJ7C 5CCHA 1SFCC 2A06E 2C0WA 2H8PD 3AE7C 3M9QA 5B66E 2D2CD 3B5NC 4KJMA 1FS0E 2PRRA 3A0HH 2P2UA 2JP3A 4R4LA 5AVUB 2C9NY 3L71J 4AUWA 2L5GB 1QVGO 2ZYGA 1Y47A 4HKZH 1K8AQ 5KLIC 1SQBJ 4D6TJ 1T2KC 3RK3C 3TSIA 3NXSA 1YTZT 3ZDMA 4CPGA 2AXTE 3RK2D 1YJNP 3PHLA 2NPSA 3BASA 3L72G 3I5CA 3M0DA 2D2CC 2ZT9C 4ZNCA 3OJAB 3S1KA 2HODA 1LTJB 2KNCB 3H6PA 1JMBA 2E42A 1FDIA 1BDDA 1RF0C 3NFQA 1AV1A 1X0TA 2B89A 1LWUA 2QVAA 2R3SA 2M5AA 3A0HE 3C9IA 1ZN5A 3H1IG 1ZR4A 2NZ2A 2YKOA 5CCHD 3L35A 1KC8Q 2HPCA 1RH5B 3L36A 3D6ZA 4OGQD 5CCGA 3AEEC 4LLHA 1H89A 2WSEJ 4BRYA 1URQD 4W7YA 3TGUE 1P84D 1SQPD 2I1KA 2YXRB 1URQC 1M7LA 1ZV8A 2NPSD 1SQBD 2W90A 5TISE 3HD7B 5CJ0A 1KV4A 3L70G 3H1KG 4DT0A 2WSFH 5AVQB 2IYPA 1LP1B 3HUSC 1ZXGA 2QIWA 1FZFA 2N9BA 3A0BH 3M0AA 1NKNA 1KQLA 1L4AA 1T3JA 2H88C 1KQSO 1JY2N 1PIXA 3I55P 3A2AA 1VQNP 1DEEG 2LR2A 5APWA 2QM7A 3E1RA 4U3FG 3HTKA 1SQXG 2W6JH 1SQXK 1YQ3C 2ZFCA 3CL3D 1P84E 1NTZG 3H1HD 5KAFH 1BCCD 4LGDE 5AVVB 1ZRTE 4QMAA 2OQQA 1JM0A 3V2RA 3H1KJ 1EZVG 3G6EP 1GW3A 1NTKD 2HLOA 1KYOH 2O01N 1HGZA 3HE4B 4WY4D 1GU5A 3H1JG 1MUUA 4WWIA 1W5CE 1L0LD 1JY3P 2W83C 2ZXXA 1R5LA 2OARA 3H1HJ 2B88A 2A45H 3BRTB 3L75G 1X9VA 3MHVA 5APYA 4UB8E 1VF5B 3T97B 3TYYA 1BGYG 5KJ7A 5CCGC 4RESB 1LTBC 2OYHA 2M8RA 2YKQA 2JWDA 1RE4C 1GU4A 2KXPB 4H44B 1BE3G 1L0ND 2OYIA 4BWNA 5GTIE 4OGQC 1BCCE 1R8EA 1NGMB 1GDTA 1VQ4P 1PP9D 1JOCA 3P8CD 4Z1MH 5AW2B 3CCSP 3AE1C 4YPCA 2FFDC 5M1BA 1KZUB 1YQ4C 2QJPB 2Q7CA 2E76D 2FXMA 3CXHE 2A45G 1OW7A 2KOGA 3BCCG 3TNUA 1SQQJ 2NPSB 4H0LB 1L0LJ 2A06D 3VP8A 1URQB 4RKUJ 2KUBA 3EQ2A 1HH0A 1KORA 4TLFA 5KTBA 2B87A 1JY2P 1MZ9A 1NO4A 3H1LJ 3H32B 4I7ZC 2P10A 3W67A 1OVVA 3L71G 1RE3C 1EDIA 1GZLA 3FXDA 5AW3B 1LTGC 2WSEH 5KLVD 5BU5A 5KKZC 1FJKA 3CX5H 5AW4B 3RL0C 1PL5A 2MJZA 1SLQA 3O6QB 1RF1C 2AEFA 4IFMA 3M06A 5AW5B 2J59M 2Q5UA 1Y8AA 3TK1A 1M90Q 1NU1E 2A45I 5AW9B 2LXCB 2Y9ZA 1FZCC 1KTMA 2FYUG 3AE9C 1CI6A 1GMJA 1OFCX 3E7KA 1KFNA 3HE5A 3L73D 2IZ1A 2IYOA 1L4AD 1FZAA 3LW5H 3WUVA 2BCCG 2YO3A 3WU2E 2K9JA 1N73B 2QJYB 1FJPA 1OMIA 1XTCC 3SSUA 2XNDH 1G2CA 3LIDA 1L0NJ 4DZOA 2KZIA 2NRGA 1NTZE 3C1LA 2H7HA 2OYIB 1S5LX 1E79H 1NTZD 3V2QA 4K35A 4AQRD 1W2BO 3MD0A 4YTPC 1Q82Q 2FFDA 2GA1A 2Z5HA 1R5SA 3A3YB 1NU1J 1YBKA 2ZJSE 4H0LC 2JWAA 3SFEC 2B87B 3H32A 3PTZA 1L4AC 4PV1B 3VMYA 3GHGA 3BVHA 1EZVD 1KB9H 5KAIE 3G3ZA 3Q5PA 1QVFO 1LTJC 1FDMA 1HUCA 2WT7A 3AE8C 3TNUB 3WUTA 4EI2A 2WT7B 3CCMP 1E5WA 1SQPK 3QH9A 2E75B 1EXIA 3II6A 2N1TA 1GL2A 1JO5A 4W7ZA 1VF5D 1SP4A 1GL2B 2Q6QA 2KP8A 3GW6A 3RBXA 1JNMA 1NU1G 2YO2A 2L91A 1QGKB 3TGUG 3WMM0 1SQQD 2FYUE 1A02F 1GD2E 1X79B 2FXOA 2RKLA 1SQQE 2JJLA 3I56P 2R3CA 1ZW0A 3P8MC 1SQPG 3G71P 5AVYB 2HPCB 4KT0J 1FAVA 3O6QA
chains in the Genus database with same CATH topology
2ZXXA 4BRYB 3E1RA 1UIIA 3WUVA 2Q6QA 4BRYA 3WUUA 2WVRA 3F5HA 3WUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXX A;  4BRY B;  3E1R A;  1UII A;  3WUV A;  2Q6Q A;  4BRY A;  3WUU A;  2WVR A;  3F5H A;  3WUT A; 
#chains in the Genus database with same CATH topology
 2Z4E A;  1U57 A;  3H1K D;  1FBM A;  1KB9 E;  2HG5 D;  3MIW A;  1NTK E;  2G3A A;  3H1I J;  3IN6 A;  4OH8 B;  3Q2Y A;  3G9R A;  2E43 A;  1P84 H;  1NYH A;  2YXQ B;  1BSN A;  3L75 J;  2KLV A;  1BCC J;  5AVW B;  3H1J J;  1VQL P;  1KQG B;  5AW6 B;  4L75 A;  3NMD A;  2Q3E A;  3P7K A;  3PJS K;  4JYB A;  5L8R J;  2FY8 A;  1DH3 A;  2J58 A;  2KB7 P;  4PV1 C;  1IJD B;  5TJH A;  1UIX A;  2QJK C;  3EFG A;  3HD7 C;  5B5E H;  1JY3 N;  3VMZ A;  2H43 A;  1SFC D;  5AVT B;  3MP7 B;  3P8C E;  1VQP P;  1Q86 Q;  3AE4 C;  4LC1 A;  2FYU K;  2JDI H;  3H1K E;  3HUS B;  2V4H A;  3PP5 A;  4HYT B;  3L73 J;  3CXH H;  3ITK A;  1IFN A;  4WY4 A;  1KIL A;  2OTK E;  3L70 E;  3IR9 A;  1L0L G;  4AYC A;  1MFT A;  3KZI E;  1FZC A;  3BCC J;  1IO4 A;  4GOE A;  2WSC H;  5AVR B;  2RMZ A;  2K37 A;  2QM8 A;  4PD4 H;  5KJ7 D;  4MN4 C;  2KSJ A;  3M9B A;  3S9O A;  1N7S B;  3BRV B;  1CI6 B;  1SQV D;  5AVX B;  4IFF A;  3S4R A;  3L74 D;  5B5E E;  5KLV J;  1EDL A;  2E75 C;  2IPP A;  2O1J A;  1G2C B;  2O3J A;  2O01 J;  1N2D C;  1G1J A;  2WSS H;  3V4W A;  1LWU C;  1K73 Q;  2FFD B;  2RN0 A;  2AEM A;  4GIF A;  2KYV A;  3CXH D;  2IDB A;  1NHL A;  3CX5 D;  3GHG C;  1HWT C;  1KIL D;  3CX5 E;  3TGU J;  2BEZ F;  2M0B A;  3FWN A;  1AFO A;  1EDJ A;  1LTJ A;  3CC4 P;  2FKW B;  1IK9 A;  2JKV A;  1NTZ K;  2NPS C;  2R5D A;  3AEA C;  1IFI A;  3VOP A;  2M5A B;  2QA4 P;  3TDK A;  1QX8 A;  1EDK A;  1LTA C;  3L71 D;  3GLM A;  3TF5 A;  1SQV J;  3AE2 C;  1ZP0 C;  5CBN A;  4UB6 E;  3CX5 I;  3H1I D;  2W27 A;  2WZ7 A;  1SQB G;  5CJ4 A;  3H25 A;  1WRG A;  4EOT A;  3H1L E;  3Q5S A;  5DJU B;  1EXJ A;  1OIP A;  2IFN A;  4ZKU A;  2ZYD A;  4IL6 E;  2QEX P;  1VDF A;  3AE5 C;  1FU1 A;  3VYI A;  5KAI H;  3CWB E;  1L0L E;  1WMK A;  3NTN A;  2Q3I A;  1IK7 A;  2Y0E A;  2AXT H;  3CWB D;  4N78 D;  3CCQ P;  5APT A;  5K5G B;  1T8Z A;  1LP1 A;  1RF0 A;  1GK6 A;  1L0L K;  4GOF A;  3N4X A;  2WQY C;  3L71 E;  2ZAE B;  1S2E A;  1BSH A;  3MUD C;  1PPJ D;  1J1D C;  1EC5 A;  4IL6 X;  2Y9Y A;  5GTH H;  1PPJ E;  1Q7Y Q;  1FC2 C;  4H44 D;  3L72 D;  1HJB A;  4KHX A;  3U1C A;  1OW8 A;  2M3E A;  1PZQ A;  3GHG B;  5AW8 B;  3VMX A;  1NJI Q;  4XE5 B;  3JCU H;  3G4S P;  2QE7 H;  4ZMD A;  4L73 A;  1ZR2 A;  2QRX A;  2WPV B;  1FDO A;  1USE A;  1A02 J;  2POH A;  1MV8 A;  3BAT A;  4I2L C;  3HUS A;  5TIS H;  2WSF J;  4H0L D;  3HE4 A;  1YTZ I;  1NAY A;  2OYI C;  2QG4 A;  3ABV C;  4DJG A;  1JTH B;  1OX3 A;  1T2K D;  1GL2 D;  1LWU B;  1X8Y A;  1ZME C;  3KYQ A;  4DOJ A;  2QSI A;  1L0N G;  2KIK A;  2PP6 A;  3SWY A;  4B86 A;  1BGY E;  3OAK A;  3TGU D;  5GTH E;  1SQP E;  4OVN F;  3V6I A;  4M3L A;  1BGY D;  1RE3 A;  1NAF A;  1U7J A;  1Y9B A;  2JO1 A;  2JR8 A;  2KS1 B;  3B5N D;  3JSV C;  3MTU E;  2KS1 A;  4PJ0 H;  1KB9 I;  2ZYA A;  1PV3 A;  3JC2 2;  3AEF C;  1NTM E;  3D71 A;  1JMM A;  2KSE A;  3AED C;  5KAF E;  1KYO I;  2V7Q J;  1VQO P;  2R32 A;  3KZI H;  1J2J B;  1U7M A;  1D7M A;  3VN0 A;  1EQ7 A;  2K1A A;  2E76 C;  3CMA P;  3CLQ A;  1SQP J;  3CCU P;  2OTL P;  1BGY J;  1S3J A;  2W6B A;  4C7R A;  5H2F H;  2XZR A;  1S9K E;  1L4A B;  1YYC A;  3CCL P;  1OWA A;  2E74 D;  2FYN B;  3WUU A;  1CW5 A;  2YIU B;  4JYC A;  4XA4 A;  1LTT C;  1AJY A;  4PD4 D;  1SFC B;  4OGQ B;  2LXB A;  1NTM G;  1SFC A;  2H89 C;  2QJK B;  3P32 A;  4H44 C;  1K9M Q;  3CCE P;  3Q3D A;  2IBZ D;  3GG2 A;  1LT9 C;  2GUS A;  5GTI H;  1ZLL A;  4ASW A;  1FZB A;  1PGP A;  2ZVN B;  3L70 D;  4D6T G;  1CSB A;  4DCK A;  3MGN A;  5E79 E;  3M91 A;  3A5T A;  1H88 A;  2XKM A;  3GF3 A;  1VL2 A;  1NTM K;  1Z56 A;  5APV A;  2WSC J;  1TU3 F;  1RF1 A;  1KQF B;  2I8D A;  3T97 A;  2BAS A;  2GUV A;  1GW4 A;  3AEB C;  3L75 E;  4I7Z B;  2HFE D;  2IBZ I;  3CI9 A;  4PV1 D;  1SQB E;  3KXD A;  3L75 D;  3L74 G;  4EYY Q;  3H1I E;  4K3A A;  1YJ9 P;  3AEG C;  1UII A;  3H1L D;  1GK4 A;  1HTL C;  1PGQ A;  4NPE A;  1X22 A;  3H1H G;  3PH0 A;  4NPF X;  3RGU A;  2PAJ A;  2E76 B;  1RHZ B;  2WPS A;  3CWB J;  1HGV A;  2D2C B;  4GKG A;  1YIJ P;  1DIP A;  3MUD A;  3D70 A;  2FBW C;  2E75 D;  2FYN C;  1M1J B;  4IOI H;  1YJW P;  1GTW A;  1HF9 A;  2WPQ A;  2ZT9 D;  1SQV E;  1QL2 A;  2PFX A;  1AQT A;  3CCJ P;  2XU6 A;  1N73 C;  4JF7 A;  3FGA D;  1IFD A;  1PFI A;  3M9H A;  1IFP A;  1W2E A;  2RH0 A;  5KLV G;  3V4Q A;  2O01 H;  3PLN A;  3U59 A;  5CBO A;  1L0N K;  2YNY A;  3B5N A;  3KPE A;  4L76 A;  2IFM A;  1LT1 A;  4Y99 C;  2E5Y A;  2OGU A;  3JCU E;  1KD1 Q;  3L72 J;  3CC7 P;  3B71 A;  4N6J A;  1AA0 A;  1S5L H;  2Y0D A;  4N78 E;  1NTZ J;  4WY4 B;  1VQ9 P;  1JY3 O;  3USS A;  3HD7 D;  5BVZ A;  1T3U A;  2AXC A;  1ZOY C;  4HH2 A;  1LT9 A;  4WVZ A;  2BCC D;  1NU1 K;  3B4S A;  3M0D C;  4BXL A;  1H0T B;  1JEK A;  5KLV E;  3KQG A;  1JCD A;  4I6M C;  2R44 A;  1USD A;  1JB0 J;  1MFZ A;  1KN7 A;  1DD3 A;  4C7N A;  1VQ8 P;  1VQK P;  2XV5 A;  2K9J B;  1J1E C;  4H13 B;  3F89 A;  3Q5R A;  2HOD B;  3BCC E;  3FWL A;  4U3F D;  5KLV K;  2QJP C;  3K5B A;  3L70 J;  3B8E B;  4U3F E;  5AW1 B;  3SWK A;  1M1K Q;  4IFD K;  1LJ2 A;  1M1J C;  4JPZ B;  1IFM A;  2ITA A;  2Q1K A;  3L73 E;  1FOS E;  3RK2 B;  1OZH A;  2OYH C;  2P58 A;  1P84 I;  1VPC A;  2CK3 H;  4PJ0 E;  1JTH A;  1URQ A;  4ZKP A;  1BE3 E;  1PP9 J;  3FX0 A;  3L74 J;  1NTK G;  4N3Y B;  4Y99 B;  5APS A;  4BRY B;  5KLI B;  2B9B A;  3GF7 A;  5C39 A;  3QWO C;  2WTY A;  1QL1 A;  4HJG H;  1VF5 C;  1Q90 D;  2CPB A;  2M3B A;  4WY4 C;  4EIJ A;  2OTJ P;  2J5U A;  2KK7 A;  3H1L G;  1N73 A;  3H1J E;  1QLE D;  3IFM A;  2R5B A;  1CZQ A;  2G8Y A;  2LKM A;  2MKV A;  1VQ6 P;  3OW2 O;  1PGO A;  2ZT9 B;  2P1J A;  1NTK J;  3AE3 C;  1PP9 G;  2DW3 A;  2JEE A;  3RK2 C;  1AVY A;  1LTS C;  1J1D B;  3FXE A;  4A7P A;  5BU8 B;  1SQB K;  1KIL C;  5E79 H;  4RJT A;  1YIT P;  1NH4 A;  3L4F A;  1Q2N A;  2N9Y B;  3N7N A;  1SQX E;  1LGH B;  1NVO A;  2WPR A;  1SS1 A;  2C0X A;  2FYU J;  4TT3 H;  1S72 P;  1S9K D;  1J1E B;  3EWK A;  3V2P A;  5B66 H;  1RY3 A;  2OYO A;  2W6A A;  3RBZ A;  2YMY A;  2IX7 C;  3H1H E;  3O8Z A;  1OVU A;  3Q1M A;  3IAO A;  3L72 E;  4C46 A;  4EDF A;  2YIU C;  2BEQ D;  3WU2 H;  1FE6 A;  1K05 A;  4PD4 E;  1VQM P;  2KI7 B;  1DD4 A;  3E1I A;  2XNX A;  1VQ5 P;  2N1T B;  1NTM D;  2E74 C;  2I1J A;  2HYN A;  1KB9 D;  1L2P A;  2QJY C;  3SFD C;  1IZN B;  1RQV A;  1WT6 A;  2A06 G;  2PGD A;  4YXW H;  1RE4 A;  3C8V A;  1LTI C;  3CXH I;  3RK3 E;  3RL0 B;  1YHQ P;  4L74 A;  1N86 A;  4GT1 A;  1NKZ B;  1HJ0 A;  3HE5 B;  4HB1 A;  3UIA A;  1N7S C;  3V5B A;  3L37 A;  1NTK K;  1LNQ A;  1SQQ G;  1DX7 A;  2WMM A;  1AVO A;  2FYU D;  3GMA A;  1NWQ A;  1L0N E;  2SPZ A;  1OW6 A;  3D6Y A;  1RQU A;  1SQX J;  2O1K A;  1N8R Q;  2HR3 A;  3R2P A;  1SVF A;  2E5T A;  1EZV I;  1LT9 B;  2K9Y A;  3KHU A;  2K3R A;  3PRJ A;  1S4X A;  3U1A A;  3V2N A;  2IBZ E;  2K88 A;  2E74 B;  1Q81 Q;  3MZW B;  1GL2 C;  2UWJ E;  1JUN A;  4W80 A;  5AVZ B;  2IZ0 A;  1SQV G;  1KIL E;  2Y0C A;  4UB6 H;  5CHX A;  3RK3 D;  2Z5I A;  1DEB A;  1IC2 A;  1M1J A;  5EFW B;  1FZE A;  5APX A;  4R4M A;  3IF4 A;  1K04 A;  4IL6 H;  4ASV A;  4I1L A;  3LIE A;  1KYO D;  1KFM A;  1BCC G;  5AW0 B;  3VP9 A;  3VTP C;  1NOH A;  1S5L E;  2KNC A;  3A0B E;  4Y28 J;  1KIL B;  4JBZ A;  3L74 E;  1KMI Z;  1BE3 J;  1PP9 E;  2WWW A;  5CCH C;  1VQ7 P;  3B5N B;  5AW7 B;  1XTG B;  5AVS B;  1JCC A;  1SQV K;  2VRS A;  2YMK A;  3VMA A;  2ZVO B;  3CCR P;  1M56 D;  2V7Q H;  1NU1 D;  1T6A A;  1IFJ A;  4U3F J;  4PD4 I;  3CWB G;  1RF1 B;  3F5H A;  1OVR A;  1PGJ A;  3KDP B;  4D6T E;  1QEX A;  1H0T A;  2WIT A;  2OYH B;  3CD6 P;  2KLU A;  5CCG D;  1H8A A;  2CPS A;  3CCV P;  1BE3 D;  1KYO E;  3HD7 A;  2N1T C;  4H13 D;  4XFJ A;  1FZG A;  2Q9I A;  1BDC A;  4C7N B;  1FOS F;  3RL0 D;  1N7S D;  1JY2 O;  1MKM A;  1S1C X;  1ZRT D;  1NTM J;  1YI2 P;  3CME P;  1N7L A;  3L73 G;  4JQ0 D;  2AEJ A;  3W68 A;  3CPW O;  3R4Y A;  5APU A;  5KKZ B;  2WVR A;  3AE6 C;  3RK3 B;  2GM4 A;  3BCC D;  2KZJ A;  3A7O A;  4YXD C;  2N1T D;  4H13 C;  2C9L Y;  3HTK B;  1HVV A;  2W8Z A;  4D6T D;  1PPJ G;  4UB8 H;  3HRN A;  2FXP A;  4O9B A;  1SQQ K;  3AEC C;  5APQ A;  4GOD A;  4NPD A;  2BCC E;  3LW5 J;  2BCC J;  3EFF K;  2ZXE B;  1SQX D;  2IBZ G;  4GDO A;  3CC2 P;  3SWF A;  2P67 A;  1M8O B;  5DJT B;  3OA7 A;  1G1I A;  1M57 D;  1N7S A;  1OXZ A;  4WBA A;  5CMZ A;  3RL0 g;  2P7J A;  2FYZ A;  2YKP A;  4U7J A;  1AQ5 A;  1FZC B;  4RO0 A;  4WB4 A;  1HBW A;  2XDJ A;  3H1J D;  4OWF A;  1EZV E;  5H2F E;  5KJ7 C;  5CCH A;  1SFC C;  2A06 E;  2C0W A;  2H8P D;  3AE7 C;  3M9Q A;  5B66 E;  2D2C D;  3B5N C;  4KJM A;  1FS0 E;  2PRR A;  3A0H H;  2P2U A;  2JP3 A;  4R4L A;  5AVU B;  2C9N Y;  3L71 J;  4AUW A;  2L5G B;  1QVG O;  2ZYG A;  1Y47 A;  4HKZ H;  1K8A Q;  5KLI C;  1SQB J;  4D6T J;  1T2K C;  3RK3 C;  3TSI A;  3NXS A;  1YTZ T;  3ZDM A;  4CPG A;  2AXT E;  3RK2 D;  1YJN P;  3PHL A;  2NPS A;  3BAS A;  3L72 G;  3I5C A;  3M0D A;  2D2C C;  2ZT9 C;  4ZNC A;  3OJA B;  3S1K A;  2HOD A;  1LTJ B;  2KNC B;  3H6P A;  1JMB A;  2E42 A;  1FDI A;  1BDD A;  1RF0 C;  3NFQ A;  1AV1 A;  1X0T A;  2B89 A;  1LWU A;  2QVA A;  2R3S A;  2M5A A;  3A0H E;  3C9I A;  1ZN5 A;  3H1I G;  1ZR4 A;  2NZ2 A;  2YKO A;  5CCH D;  3L35 A;  1KC8 Q;  2HPC A;  1RH5 B;  3L36 A;  3D6Z A;  4OGQ D;  5CCG A;  3AEE C;  4LLH A;  1H89 A;  2WSE J;  4BRY A;  1URQ D;  4W7Y A;  3TGU E;  1P84 D;  1SQP D;  2I1K A;  2YXR B;  1URQ C;  1M7L A;  1ZV8 A;  2NPS D;  1SQB D;  2W90 A;  5TIS E;  3HD7 B;  5CJ0 A;  1KV4 A;  3L70 G;  3H1K G;  4DT0 A;  2WSF H;  5AVQ B;  2IYP A;  1LP1 B;  3HUS C;  1ZXG A;  2QIW A;  1FZF A;  2N9B A;  3A0B H;  3M0A A;  1NKN A;  1KQL A;  1L4A A;  1T3J A;  2H88 C;  1KQS O;  1JY2 N;  1PIX A;  3I55 P;  3A2A A;  1VQN P;  1DEE G;  2LR2 A;  5APW A;  2QM7 A;  3E1R A;  4U3F G;  3HTK A;  1SQX G;  2W6J H;  1SQX K;  1YQ3 C;  2ZFC A;  3CL3 D;  1P84 E;  1NTZ G;  3H1H D;  5KAF H;  1BCC D;  4LGD E;  5AVV B;  1ZRT E;  4QMA A;  2OQQ A;  1JM0 A;  3V2R A;  3H1K J;  1EZV G;  3G6E P;  1GW3 A;  1NTK D;  2HLO A;  1KYO H;  2O01 N;  1HGZ A;  3HE4 B;  4WY4 D;  1GU5 A;  3H1J G;  1MUU A;  4WWI A;  1W5C E;  1L0L D;  1JY3 P;  2W83 C;  2ZXX A;  1R5L A;  2OAR A;  3H1H J;  2B88 A;  2A45 H;  3BRT B;  3L75 G;  1X9V A;  3MHV A;  5APY A;  4UB8 E;  1VF5 B;  3T97 B;  3TYY A;  1BGY G;  5KJ7 A;  5CCG C;  4RES B;  1LTB C;  2OYH A;  2M8R A;  2YKQ A;  2JWD A;  1RE4 C;  1GU4 A;  2KXP B;  4H44 B;  1BE3 G;  1L0N D;  2OYI A;  4BWN A;  5GTI E;  4OGQ C;  1BCC E;  1R8E A;  1NGM B;  1GDT A;  1VQ4 P;  1PP9 D;  1JOC A;  3P8C D;  4Z1M H;  5AW2 B;  3CCS P;  3AE1 C;  4YPC A;  2FFD C;  5M1B A;  1KZU B;  1YQ4 C;  2QJP B;  2Q7C A;  2E76 D;  2FXM A;  3CXH E;  2A45 G;  1OW7 A;  2KOG A;  3BCC G;  3TNU A;  1SQQ J;  2NPS B;  4H0L B;  1L0L J;  2A06 D;  3VP8 A;  1URQ B;  4RKU J;  2KUB A;  3EQ2 A;  1HH0 A;  1KOR A;  4TLF A;  5KTB A;  2B87 A;  1JY2 P;  1MZ9 A;  1NO4 A;  3H1L J;  3H32 B;  4I7Z C;  2P10 A;  3W67 A;  1OVV A;  3L71 G;  1RE3 C;  1EDI A;  1GZL A;  3FXD A;  5AW3 B;  1LTG C;  2WSE H;  5KLV D;  5BU5 A;  5KKZ C;  1FJK A;  3CX5 H;  5AW4 B;  3RL0 C;  1PL5 A;  2MJZ A;  1SLQ A;  3O6Q B;  1RF1 C;  2AEF A;  4IFM A;  3M06 A;  5AW5 B;  2J59 M;  2Q5U A;  1Y8A A;  3TK1 A;  1M90 Q;  1NU1 E;  2A45 I;  5AW9 B;  2LXC B;  2Y9Z A;  1FZC C;  1KTM A;  2FYU G;  3AE9 C;  1CI6 A;  1GMJ A;  1OFC X;  3E7K A;  1KFN A;  3HE5 A;  3L73 D;  2IZ1 A;  2IYO A;  1L4A D;  1FZA A;  3LW5 H;  3WUV A;  2BCC G;  2YO3 A;  3WU2 E;  2K9J A;  1N73 B;  2QJY B;  1FJP A;  1OMI A;  1XTC C;  3SSU A;  2XND H;  1G2C A;  3LID A;  1L0N J;  4DZO A;  2KZI A;  2NRG A;  1NTZ E;  3C1L A;  2H7H A;  2OYI B;  1S5L X;  1E79 H;  1NTZ D;  3V2Q A;  4K35 A;  4AQR D;  1W2B O;  3MD0 A;  4YTP C;  1Q82 Q;  2FFD A;  2GA1 A;  2Z5H A;  1R5S A;  3A3Y B;  1NU1 J;  1YBK A;  2ZJS E;  4H0L C;  2JWA A;  3SFE C;  2B87 B;  3H32 A;  3PTZ A;  1L4A C;  4PV1 B;  3VMY A;  3GHG A;  3BVH A;  1EZV D;  1KB9 H;  5KAI E;  3G3Z A;  3Q5P A;  1QVF O;  1LTJ C;  1FDM A;  1HUC A;  2WT7 A;  3AE8 C;  3TNU B;  3WUT A;  4EI2 A;  2WT7 B;  3CCM P;  1E5W A;  1SQP K;  3QH9 A;  2E75 B;  1EXI A;  3II6 A;  2N1T A;  1GL2 A;  1JO5 A;  4W7Z A;  1VF5 D;  1SP4 A;  1GL2 B;  2Q6Q A;  2KP8 A;  3GW6 A;  3RBX A;  1JNM A;  1NU1 G;  2YO2 A;  2L91 A;  1QGK B;  3TGU G;  3WMM 0;  1SQQ D;  2FYU E;  1A02 F;  1GD2 E;  1X79 B;  2FXO A;  2RKL A;  1SQQ E;  2JJL A;  3I56 P;  2R3C A;  1ZW0 A;  3P8M C;  1SQP G;  3G71 P;  5AVY B;  2HPC B;  4KT0 J;  1FAV A;  3O6Q A; 
#chains in the Genus database with same CATH homology
 2ZXX A;  4BRY B;  3E1R A;  1UII A;  3WUV A;  2Q6Q A;  4BRY A;  3WUU A;  2WVR A;  3F5H A;  3WUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...