4BRYB

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
PPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords GEMININ
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryB00
4BRYB 3F5HA 3E1RA 2ZXXA 1UIIA 2Q6QA 4BRYA 3WUVA 3WUUA 2WVRA 3WUTA
chains in the Genus database with same CATH superfamily
3V4QA 3H1HD 2KNCA 2JP3A 1PGJA 1L0NE 1ZN5A 2KXPB 3T97B 3I55P 1NJIQ 1K73Q 2OYIB 1VQ4P 3N4XA 4XE5B 4AUWA 2NPSC 1PL5A 5KJ7D 1NU1G 3ABVC 2IZ1A 5BU5A 4EI2A 2QRXA 1CI6A 1LWUC 3CCVP 2FFDB 1IFMA 2FYNB 4U7JA 1SQXE 3AEGC 5TISE 3RGUA 1RQVA 4NPFX 1PGQA 2JDIH 2YIUB 3H1HJ 3WUTA 1ZXGA 3P8CE 4GOFA 1NGMB 1Q82Q 4N6JA 2KI7B 4BRYA 1BCCD 1ZRTE 3NMDA 4N78D 4QMAA 3VMAA 3LW5J 2OARA 2WSCJ 2AXCA 1R5SA 1GU4A 1KYOH 2IFNA 2V7QH 1NTMD 1H8AA 1DH3A 2WPSA 3L74G 5AVZB 2WQYC 2Q5UA 3MTUE 2C9LY 2AXTE 4U3FJ 2HG5D 2A45H 4L76A 1VF5B 2WMMA 1ZR4A 3AEAC 1SQVG 3L73G 4W7ZA 1J1EB 3V2PA 1M1KQ 3HD7D 1FOSF 1R5LA 3HE4A 1N7SD 3HTKB 3MD0A 1VQOP 2M3EA 3N7NA 2PAJA 4YTPC 4DOJA 1S72P 3CC4P 1N73B 5KLVD 1T3JA 3NXSA 3H1JE 3HE4B 4YPCA 3U1AA 1VQ6P 1ZMEC 2KSEA 1JY2P 1OZHA 3GF7A 5H2FE 5CBOA 1IO4A 2WWWA 3CMAP 1DEBA 1KQLA 1IFDA 2M5AB 2L91A 3S9OA 2OYHC 1VPCA 5CJ0A 4EIJA 2E42A 3A7OA 3A0HE 3L75D 1QL2A 2PGDA 2Q6QA 2K3RA 3A5TA 1EDKA 1KQSO 1FJKA 3CCMP 1LP1B 1URQD 4WY4A 5L8RJ 3H1KD 2OGUA 3CXHH 2XNDH 3JCUE 2LXCB 5TJHA 2HPCB 1AFOA 5DJTB 3HUSB 1S3JA 1RE4A 3E7KA 3M91A 1PP9E 4KJMA 4U3FD 4CPGA 2P58A 1SQPG 5AW3B 1SQXD 2FYUE 5H2FH 4AYCA 2OYHB 3M9HA 3CL3D 1RH5B 1IZNB 2O3JA 1M7LA 3H1LG 2QG4A 3P8CD 2W27A 4JYBA 3OJAB 5APUA 5AVSB 4C7NA 1GZLA 1VQ5P 1T2KD 2P10A 1GW4A 2KLVA 3H25A 1BGYJ 1SQVK 1IFPA 1SFCD 1MFTA 2C0XA 2L5GB 1LTAC 3QWOC 4IFFA 1BGYG 2AEJA 2WPRA 2YXRB 5AW9B 3GMAA 5KLIC 3KYQA 1N73C 2BCCE 3CXHD 3LW5H 3HE5B 1CI6B 1VQKP 4IFDK 1YBKA 2WSSH 2YMYA 4D6TE 2QJKB 1FZCA 1G1IA 1NH4A 3MHVA 1OVRA 1CSBA 3PLNA 3H32A 5AW7B 3TDKA 2FFDC 4OGQD 1M8OB 3SWYA 1K05A 1RE4C 3AEFC 1NTKG 1KILE 5AW5B 4LGDE 3RK3D 3VP9A 1Q90D 4A7PA 1LJ2A 2QE7H 1SQBG 4H44B 3Q5RA 5CCHD 2YO2A 4PV1D 2JEEA 4DZOA 5KLIB 1SFCA 5M1BA 1Q7YQ 1HTLC 2WPVB 1GMJA 1ZOYC 3CWBJ 1BE3D 3AE9C 2XZRA 1GL2A 3E1IA 1VQPP 2ZYAA 1BSNA 4PV1C 2OYHA 1GK4A 2E5YA 4R4MA 4DCKA 1JTHA 1JMBA 2KSJA 1DEEG 2FXOA 1FZCB 1PPJE 2QSIA 1Z56A 4K35A 3TGUJ 1L4AD 2AEMA 3F5HA 5KAFE 3WMM0 4AQRD 1NTZG 1OIPA 4PJ0H 4I7ZB 5KTBA 2R44A 1QLED 5APVA 2E76D 1SP4A 2FYUD 3AE5C 1BCCE 3L4FA 1U57A 4N78E 1HJBA 1CZQA 1A02J 2Q1KA 2ZJSE 3CLQA 2C0WA 3L72D 2MKVA 2WT7B 1AJYA 3KXDA 1KMIZ 3CC2P 4IOIH 2P67A 3V2NA 5KLVE 3L37A 2WT7A 1LT9A 3RK3C 5CHXA 3CCLP 2N1TB 3SSUA 1DX7A 3H1IE 1KN7A 2KUBA 2ZVOB 3MP7B 4NPEA 1Y9BA 1BCCJ 1S5LX 3IR9A 2P2UA 3HUSC 2W6BA 2IDBA 1Y8AA 3LIEA 3H1LJ 3H1HG 3V4WA 5AW1B 2Y0DA 1JY3P 1YI2P 2YKPA 1LTGC 1NOHA 5TISH 3CX5E 2A06G 3BCCE 4B86A 1SQPJ 1YJWP 1EZVE 1NTKK 3VTPC 1H88A 1OMIA 4WY4C 1AV1A 1NU1J 2E75C 3BRVB 1OW6A 2SPZA 4C7RA 1T3UA 1E5WA 2M5AA 2N1TC 3L75E 2J59M 4WWIA 2E43A 4BRYB 1USDA 1W2BO 2YXQB 2ZT9B 1VQ8P 3H1KE 3AE1C 1JY3N 5EFWB 3A0BH 1PIXA 4YXWH 2OQQA 3BASA 4UB6E 3TSIA 2P1JA 1R8EA 2ZVNB 3TGUG 1HH0A 1RF1A 1QL1A 4GKGA 4N3YB 5KAIE 1H0TA 2O1KA 1X9VA 1GDTA 1AQTA 1NTMG 2E76B 3H6PA 3KQGA 4ASVA 1YTZT 5GTHE 1HBWA 4Y99C 3W68A 1BE3J 1X0TA 3CI9A 3CCRP 1KB9D 1ZLLA 1J1EC 1H89A 3CWBG 1YQ4C 1LNQA 4JBZA 1HWTC 2GUVA 1SLQA 2E5TA 1GL2D 2K37A 3RL0g 5B66E 2ZAEB 2Q3IA 2WPQA 1URQA 4WY4D 2HYNA 4ZKPA 1NKNA 1S5LH 2GM4A 1JEKA 2IBZG 2Y0CA 2KZJA 1X8YA 5C39A 1N7LA 1KB9I 1SQQE 1SQVJ 3HE5A 3L73J 2AXTH 1Y47A 4DT0A 3GLMA 3H1ID 1FZEA 1YTZI 2HLOA 2OYOA 2P7JA 3GHGB 3EWKA 3A3YB 4UB6H 5GTHH 3VYIA 1L0LG 3H32B 2BEZF 3FGAD 3D6YA 2KB7P 2RKLA 4GDOA 3CMEP 3PH0A 2YIUC 1YYCA 4JF7A 1N8RQ 1G2CA 1MV8A 3USSA 1FC2C 3BCCD 2A45G 1QEXA 2W83C 1SQBK 1G2CB 1ZRTD 2BASA 3A0HH 3AEBC 1L0LK 1KILA 4W80A 1D7MA 2FYZA 5APQA 1KFMA 1KYOE 3FX0A 3L35A 4H13B 1NTKJ 4U3FG 1SQPD 2E76C 1SQXG 4I2LC 3HD7A 1N7SA 5APXA 2Y0EA 2I8DA 1WRGA 3H1LD 4OGQC 2FFDA 1L4AB 2YKOA 5AVVB 5CCGC 3R2PA 1EQ7A 3HD7B 1YITP 1PZQA 1FU1A 5GTIE 2H8PD 3FXDA 3CX5I 3H1JJ 3Q3DA 5KAFH 2O01N 2N9YB 3PP5A 2M0BA 5KLVK 3P8MC 3CD6P 1VDFA 3L70E 3AE6C 4H13C 4H44D 3C8VA 1M56D 4WY4B 1KILD 3RK3E 1PGPA 2GA1A 1NAFA 2W8ZA 3L72E 2W90A 3L71G 3OAKA 2IPPA 4PV1B 1RF1C 2LR2A 4LC1A 2POHA 3SWFA 2OTJP 3L36A 1QGKB 4NPDA 1JM0A 2KNCB 3A2AA 1LTJC 2JO1A 2V4HA 1KILC 4TLFA 1BE3E 1Q2NA 1HGZA 2JKVA 2BEQD 3OW2O 3RBXA 1SQBD 3B5ND 2D2CB 2E74D 3U1CA 4YXDC 1QX8A 1EXJA 3RBZA 3ZDMA 4I1LA 4TT3H 2IYOA 1PFIA 4JQ0D 5AW2B 1VQLP 1BDCA 3CCQP 3CCSP 1NTMJ 1N7SB 5KKZC 1KFNA 4UB8E 3RK2B 1EDLA 5CBNA 2YMKA 4RO0A 2GUSA 2KIKA 1VQNP 1HVVA 1IFJA 1KYOI 1L0NK 1LTJA 1LTIC 2B89A 2ZT9D 2WITA 3O6QB 3B8EB 4HYTB 1KYOD 2HODB 3ITKA 4GOEA 1SQPE 3W67A 5B5EH 3O6QA 1GU5A 3MGNA 2FYUG 2ZXXA 5E79E 3CPWO 1L0LJ 1FZBA 2WSEJ 2Q7CA 3SFDC 3H1LE 4BWNA 1S9KE 1LT9B 2WSFJ 2NZ2A 1NAYA 2PRRA 1M57D 5AVRB 3L74E 2Z4EA 1IFIA 2G3AA 5KAIH 3L74J 2V7QJ 3PJSK 3I56P 1KB9E 5KLVJ 1LTSC 3QH9A 2KLUA 1FAVA 2BCCG 1L0NG 1KB9H 2K9JB 2OTKE 1YJNP 4XFJA 4EYYQ 2J58A 1CW5A 2R5DA 1NU1E 4D6TG 2LXBA 1NKZB 2ZFCA 1DD3A 1JY2O 3MUDC 4R4LA 3KZIE 2IFMA 4RESB 3RL0B 3P32A 3SFEC 3VMYA 1GL2C 5B66H 3C1LA 3AE2C 5KJ7C 2A06D 3Q5SA 1DIPA 2FXPA 1P84H 2E74B 1Q81Q 1NTKE 2D2CD 2NRGA 5AVWB 1P84E 3C9IA 1JY2N 2HPCA 3L72J 3GHGA 2B87A 5BVZA 1YJ9P 2NPSD 1BDDA 2LKMA 1SQBJ 2KK7A 1WMKA 3AE4C 3VOPA 2H88C 3V2RA 1A02F 1M1JA 1N2DC 4L74A 1NHLA 2O01H 3S1KA 2IZ0A 2K1AA 3L75J 1ZV8A 1NVOA 4IL6X 3WU2E 3O8ZA 1EC5A 1H0TB 1GL2B 2W6JH 3TGUD 2C9NY 3EQ2A 3G71P 1LT9C 1PP9G 2DW3A 1LWUB 1SVFA 3L71J 3JC22 2CPSA 1JOCA 3K5BA 4L73A 4Y28J 5CJ4A 1FS0E 3TNUB 3VMXA 1YHQP 1N73A 2N1TD 4BXLA 1IFNA 1EZVI 1SQPK 5AVQB 2XKMA 1URQB 2G8YA 2UWJE 3CWBD 2HODA 3RL0D 3CCUP 1J1DB 2RN0A 3P7KA 3Q2YA 1OXZA 2J5UA 1S4XA 1SQQD 2KS1A 3H1JG 4WBAA 2QA4P 1BSHA 1GK6A 3JCUH 4H0LD 4HJGH 2IBZD 4O9BA 3AECC 1RF0C 4HH2A 1K04A 3CCEP 1L2PA 1IC2A 1N7SC 1SQXK 1USEA 3B5NA 3G3ZA 3L70D 2ZXEB 2N9BA 1K9MQ 4UB8H 1OFCX 1AA0A 2RMZA 5CCHA 1QVFO 3CCJP 1HGVA 2E75B 1LGHB 2R32A 3H1IG 1VF5C 2I1JA 1JNMA 2KOGA 2K9JA 1L0LD 2N1TA 1KC8Q 1FDIA 3M0DC 3M9QA 1JB0J 1M1JB 2PFXA 1WT6A 1XTCC 4W7YA 4LLHA 4KHXA 1PGOA 5DJUB 3TK1A 4IL6H 3BCCG 1HUCA 3UIAA 1J2JB 1EZVG 1FJPA 2R3SA 2AEFA 1FZGA 3NFQA 1X22A 4ZNCA 3FWNA 1EDJA 1AVOA 3D6ZA 1HF9A 2I1KA 3B5NC 3HUSA 3RK2D 4OGQB 4PD4H 3CC7P 4OWFA 4Y99B 4EOTA 2R5BA 2VRSA 1RHZB 3RK3B 1T2KC 1BGYE 1SQQK 3WU2H 1NU1K 2WSFH 2IYPA 1PPJG 4I6MC 2QJYC 1LTJB 1KTMA 4IFMA 2K88A 1SQVE 1JTHB 1SQQJ 3E1RA 3L73E 2OTLP 1S5LE 1NYHA 3H1KJ 3IN6A 4H0LC 1M90Q 1NTZJ 2W6AA 3V2QA 3V5BA 2HR3A 2YKQA 4RKUJ 3B5NB 1KV4A 3VMZA 1SFCB 2FYUK 5CMZA 1S9KD 2WSCH 4JPZB 3L71D 1KD1Q 5KKZB 1SQBE 1ZW0A 2Y9ZA 1EXIA 5CCGD 1FBMA 5AW8B 3GG2A 2KS1B 3OA7A 5KLVG 1FOSE 3R4YA 1OVUA 2WTYA 4Z1MH 1YIJP 3MZWB 4WVZA 2R3CA 1JUNA 1UIXA 3LIDA 2B9BA 3M9BA 1KQGB 1NU1D 4XA4A 2JR8A 1HJ0A 5APYA 3D71A 1NWQA 1IK7A 1FZFA 2QIWA 1SFCC 1FZAA 3TF5A 2Y9YA 1T8ZA 5K5GB 3MUDA 3KZIH 3PRJA 1RQUA 1XTGB 2IBZI 2M3BA 2ZYDA 4GT1A 2FYNC 4C46A 5B5EE 1LTBC 2JWAA 5E79H 1LTTC 2YNYA 3BVHA 3VN0A 2QM7A 1FDMA 1BCCG 3BCCJ 4D6TD 3PHLA 4PD4E 4U3FE 1YQ3C 3IF4A 1VL2A 4H0LB 2FXMA 1RE3A 3L74D 2A45I 3RL0C 3SWKA 2IX7C 4DJGA 3TGUE 1PP9J 4MN4C 1OW7A 3H1IJ 2E74C 1K8AQ 2FYUJ 2WZ7A 1SQVD 3L73D 1JY3O 4KT0J 1NTMK 5AVTB 3TYYA 1NO4A 3AE8C 4I7ZC 1SS1A 1UIIA 1NTZK 1W5CE 3A0BE 3CWBE 3G4SP 4EDFA 1ZP0C 1L0ND 2BCCD 3CXHE 3AEDC 2A06E 5APWA 2Q3EA 2QJPC 4HKZH 1KORA 2H89C 1N86A 4GODA 4K3AA 1S1CX 3U59A 3HRNA 3NTNA 2CK3H 2H43A 2O1JA 3L75G 1ZR2A 3CXHI 1RY3A 3GHGC 1MFZA 2MJZA 3KDPB 3T97A 3TNUA 3JSVC 3EFGA 2QM8A 2JJLA 1AVYA 3H1KG 3V6IA 4H13D 4H44C 3WUUA 1JMMA 1PV3A 2QVAA 3F89A 5KJ7A 1LP1A 2BCCJ 1J1DC 1MKMA 5APSA 2YO3A 1NTZE 4HB1A 1G1JA 4ZKUA 1NTME 2JWDA 2PP6A 5AVYB 3IAOA 2OYIC 3BRTB 1L4AA 3AE3C 4JYCA 4RJTA 2ITAA 2FY8A 4PD4I 1RF1B 1FZCC 1PP9D 1OX3A 4OVNF 2Z5IA 1W2EA 1GD2E 1DD4A 2O01J 3AE7C 1L0NJ 4PD4D 1VF5D 3HTKA 5GTIH 1KILB 1OW8A 2IBZE 1X79B 2KP8A 1BGYD 4PJ0E 3B4SA 1VQ7P 4D6TJ 1OWAA 2RH0A 3Q5PA 2D2CC 3G9RA 1SQQG 3H1JD 1P84I 3I5CA 5CCGA 2Q9IA 2QJPB 1AQ5A 1QVGO 3Q1MA 3H1HE 2OYIA 3L70J 3KPEA 1SQXJ 1L0LE 3G6EP 2XNXA 2WVRA 3L70G 2M8RA 3II6A 4C7NB 3AEEC 2KZIA 1FDOA 1NTKD 3RK2C 1JCCA 1P84D 1IJDB 3GW6A 1M1JC 2XV5A 3IFMA 3L71E 4OH8B 1TU3F 5AW0B 3WUVA 4ZMDA 1U7JA 2Z5HA 2XDJA 1U7MA 3EFFK 1LWUA 1MZ9A 2QJYB 1BE3G 3D70A 3KHUA 1EDIA 3PTZA 2QEXP 1VQMP 2NPSA 3CX5D 3FWLA 3S4RA 1GTWA 2H7HA 1Q86Q 1EZVD 2QJKC 3M0AA 1JO5A 3M0DA 2KYVA 2XU6A 1KQFB 2ZYGA 1VQ9P 2WSEH 5APTA 5AW4B 4ASWA 5CCHC 1T6AA 1GW3A 1JCDA 4IL6E 3M06A 2FBWC 2B87B 1NTZD 2ZT9C 5AW6B 2B88A 3B71A 1URQC 3FXEA 1RF0A 1PPJD 1LT1A 5AVUB 1S2EA 5BU8B 3MIWA 3BATA 3L72G 1IK9A 1KZUB 1E79H 3GF3A 1RE3C 2NPSB 4WB4A 3CX5H 2CPBA 2K9YA 2E75D 1OVVA 2HFED 1L4AC 1MUUA 4GIFA 5AVXB 3HD7C 1FE6A 2FKWB 4M3LA 3VP8A 4L75A
chains in the Genus database with same CATH topology
4BRYB 3F5HA 3E1RA 2ZXXA 1UIIA 2Q6QA 4BRYA 3WUVA 3WUUA 2WVRA 3WUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRY B;  3F5H A;  3E1R A;  2ZXX A;  1UII A;  2Q6Q A;  4BRY A;  3WUV A;  3WUU A;  2WVR A;  3WUT A; 
#chains in the Genus database with same CATH topology
 3V4Q A;  3H1H D;  2KNC A;  2JP3 A;  1PGJ A;  1L0N E;  1ZN5 A;  2KXP B;  3T97 B;  3I55 P;  1NJI Q;  1K73 Q;  2OYI B;  1VQ4 P;  3N4X A;  4XE5 B;  4AUW A;  2NPS C;  1PL5 A;  5KJ7 D;  1NU1 G;  3ABV C;  2IZ1 A;  5BU5 A;  4EI2 A;  2QRX A;  1CI6 A;  1LWU C;  3CCV P;  2FFD B;  1IFM A;  2FYN B;  4U7J A;  1SQX E;  3AEG C;  5TIS E;  3RGU A;  1RQV A;  4NPF X;  1PGQ A;  2JDI H;  2YIU B;  3H1H J;  3WUT A;  1ZXG A;  3P8C E;  4GOF A;  1NGM B;  1Q82 Q;  4N6J A;  2KI7 B;  4BRY A;  1BCC D;  1ZRT E;  3NMD A;  4N78 D;  4QMA A;  3VMA A;  3LW5 J;  2OAR A;  2WSC J;  2AXC A;  1R5S A;  1GU4 A;  1KYO H;  2IFN A;  2V7Q H;  1NTM D;  1H8A A;  1DH3 A;  2WPS A;  3L74 G;  5AVZ B;  2WQY C;  2Q5U A;  3MTU E;  2C9L Y;  2AXT E;  4U3F J;  2HG5 D;  2A45 H;  4L76 A;  1VF5 B;  2WMM A;  1ZR4 A;  3AEA C;  1SQV G;  3L73 G;  4W7Z A;  1J1E B;  3V2P A;  1M1K Q;  3HD7 D;  1FOS F;  1R5L A;  3HE4 A;  1N7S D;  3HTK B;  3MD0 A;  1VQO P;  2M3E A;  3N7N A;  2PAJ A;  4YTP C;  4DOJ A;  1S72 P;  3CC4 P;  1N73 B;  5KLV D;  1T3J A;  3NXS A;  3H1J E;  3HE4 B;  4YPC A;  3U1A A;  1VQ6 P;  1ZME C;  2KSE A;  1JY2 P;  1OZH A;  3GF7 A;  5H2F E;  5CBO A;  1IO4 A;  2WWW A;  3CMA P;  1DEB A;  1KQL A;  1IFD A;  2M5A B;  2L91 A;  3S9O A;  2OYH C;  1VPC A;  5CJ0 A;  4EIJ A;  2E42 A;  3A7O A;  3A0H E;  3L75 D;  1QL2 A;  2PGD A;  2Q6Q A;  2K3R A;  3A5T A;  1EDK A;  1KQS O;  1FJK A;  3CCM P;  1LP1 B;  1URQ D;  4WY4 A;  5L8R J;  3H1K D;  2OGU A;  3CXH H;  2XND H;  3JCU E;  2LXC B;  5TJH A;  2HPC B;  1AFO A;  5DJT B;  3HUS B;  1S3J A;  1RE4 A;  3E7K A;  3M91 A;  1PP9 E;  4KJM A;  4U3F D;  4CPG A;  2P58 A;  1SQP G;  5AW3 B;  1SQX D;  2FYU E;  5H2F H;  4AYC A;  2OYH B;  3M9H A;  3CL3 D;  1RH5 B;  1IZN B;  2O3J A;  1M7L A;  3H1L G;  2QG4 A;  3P8C D;  2W27 A;  4JYB A;  3OJA B;  5APU A;  5AVS B;  4C7N A;  1GZL A;  1VQ5 P;  1T2K D;  2P10 A;  1GW4 A;  2KLV A;  3H25 A;  1BGY J;  1SQV K;  1IFP A;  1SFC D;  1MFT A;  2C0X A;  2L5G B;  1LTA C;  3QWO C;  4IFF A;  1BGY G;  2AEJ A;  2WPR A;  2YXR B;  5AW9 B;  3GMA A;  5KLI C;  3KYQ A;  1N73 C;  2BCC E;  3CXH D;  3LW5 H;  3HE5 B;  1CI6 B;  1VQK P;  4IFD K;  1YBK A;  2WSS H;  2YMY A;  4D6T E;  2QJK B;  1FZC A;  1G1I A;  1NH4 A;  3MHV A;  1OVR A;  1CSB A;  3PLN A;  3H32 A;  5AW7 B;  3TDK A;  2FFD C;  4OGQ D;  1M8O B;  3SWY A;  1K05 A;  1RE4 C;  3AEF C;  1NTK G;  1KIL E;  5AW5 B;  4LGD E;  3RK3 D;  3VP9 A;  1Q90 D;  4A7P A;  1LJ2 A;  2QE7 H;  1SQB G;  4H44 B;  3Q5R A;  5CCH D;  2YO2 A;  4PV1 D;  2JEE A;  4DZO A;  5KLI B;  1SFC A;  5M1B A;  1Q7Y Q;  1HTL C;  2WPV B;  1GMJ A;  1ZOY C;  3CWB J;  1BE3 D;  3AE9 C;  2XZR A;  1GL2 A;  3E1I A;  1VQP P;  2ZYA A;  1BSN A;  4PV1 C;  2OYH A;  1GK4 A;  2E5Y A;  4R4M A;  4DCK A;  1JTH A;  1JMB A;  2KSJ A;  1DEE G;  2FXO A;  1FZC B;  1PPJ E;  2QSI A;  1Z56 A;  4K35 A;  3TGU J;  1L4A D;  2AEM A;  3F5H A;  5KAF E;  3WMM 0;  4AQR D;  1NTZ G;  1OIP A;  4PJ0 H;  4I7Z B;  5KTB A;  2R44 A;  1QLE D;  5APV A;  2E76 D;  1SP4 A;  2FYU D;  3AE5 C;  1BCC E;  3L4F A;  1U57 A;  4N78 E;  1HJB A;  1CZQ A;  1A02 J;  2Q1K A;  2ZJS E;  3CLQ A;  2C0W A;  3L72 D;  2MKV A;  2WT7 B;  1AJY A;  3KXD A;  1KMI Z;  3CC2 P;  4IOI H;  2P67 A;  3V2N A;  5KLV E;  3L37 A;  2WT7 A;  1LT9 A;  3RK3 C;  5CHX A;  3CCL P;  2N1T B;  3SSU A;  1DX7 A;  3H1I E;  1KN7 A;  2KUB A;  2ZVO B;  3MP7 B;  4NPE A;  1Y9B A;  1BCC J;  1S5L X;  3IR9 A;  2P2U A;  3HUS C;  2W6B A;  2IDB A;  1Y8A A;  3LIE A;  3H1L J;  3H1H G;  3V4W A;  5AW1 B;  2Y0D A;  1JY3 P;  1YI2 P;  2YKP A;  1LTG C;  1NOH A;  5TIS H;  3CX5 E;  2A06 G;  3BCC E;  4B86 A;  1SQP J;  1YJW P;  1EZV E;  1NTK K;  3VTP C;  1H88 A;  1OMI A;  4WY4 C;  1AV1 A;  1NU1 J;  2E75 C;  3BRV B;  1OW6 A;  2SPZ A;  4C7R A;  1T3U A;  1E5W A;  2M5A A;  2N1T C;  3L75 E;  2J59 M;  4WWI A;  2E43 A;  4BRY B;  1USD A;  1W2B O;  2YXQ B;  2ZT9 B;  1VQ8 P;  3H1K E;  3AE1 C;  1JY3 N;  5EFW B;  3A0B H;  1PIX A;  4YXW H;  2OQQ A;  3BAS A;  4UB6 E;  3TSI A;  2P1J A;  1R8E A;  2ZVN B;  3TGU G;  1HH0 A;  1RF1 A;  1QL1 A;  4GKG A;  4N3Y B;  5KAI E;  1H0T A;  2O1K A;  1X9V A;  1GDT A;  1AQT A;  1NTM G;  2E76 B;  3H6P A;  3KQG A;  4ASV A;  1YTZ T;  5GTH E;  1HBW A;  4Y99 C;  3W68 A;  1BE3 J;  1X0T A;  3CI9 A;  3CCR P;  1KB9 D;  1ZLL A;  1J1E C;  1H89 A;  3CWB G;  1YQ4 C;  1LNQ A;  4JBZ A;  1HWT C;  2GUV A;  1SLQ A;  2E5T A;  1GL2 D;  2K37 A;  3RL0 g;  5B66 E;  2ZAE B;  2Q3I A;  2WPQ A;  1URQ A;  4WY4 D;  2HYN A;  4ZKP A;  1NKN A;  1S5L H;  2GM4 A;  1JEK A;  2IBZ G;  2Y0C A;  2KZJ A;  1X8Y A;  5C39 A;  1N7L A;  1KB9 I;  1SQQ E;  1SQV J;  3HE5 A;  3L73 J;  2AXT H;  1Y47 A;  4DT0 A;  3GLM A;  3H1I D;  1FZE A;  1YTZ I;  2HLO A;  2OYO A;  2P7J A;  3GHG B;  3EWK A;  3A3Y B;  4UB6 H;  5GTH H;  3VYI A;  1L0L G;  3H32 B;  2BEZ F;  3FGA D;  3D6Y A;  2KB7 P;  2RKL A;  4GDO A;  3CME P;  3PH0 A;  2YIU C;  1YYC A;  4JF7 A;  1N8R Q;  1G2C A;  1MV8 A;  3USS A;  1FC2 C;  3BCC D;  2A45 G;  1QEX A;  2W83 C;  1SQB K;  1G2C B;  1ZRT D;  2BAS A;  3A0H H;  3AEB C;  1L0L K;  1KIL A;  4W80 A;  1D7M A;  2FYZ A;  5APQ A;  1KFM A;  1KYO E;  3FX0 A;  3L35 A;  4H13 B;  1NTK J;  4U3F G;  1SQP D;  2E76 C;  1SQX G;  4I2L C;  3HD7 A;  1N7S A;  5APX A;  2Y0E A;  2I8D A;  1WRG A;  3H1L D;  4OGQ C;  2FFD A;  1L4A B;  2YKO A;  5AVV B;  5CCG C;  3R2P A;  1EQ7 A;  3HD7 B;  1YIT P;  1PZQ A;  1FU1 A;  5GTI E;  2H8P D;  3FXD A;  3CX5 I;  3H1J J;  3Q3D A;  5KAF H;  2O01 N;  2N9Y B;  3PP5 A;  2M0B A;  5KLV K;  3P8M C;  3CD6 P;  1VDF A;  3L70 E;  3AE6 C;  4H13 C;  4H44 D;  3C8V A;  1M56 D;  4WY4 B;  1KIL D;  3RK3 E;  1PGP A;  2GA1 A;  1NAF A;  2W8Z A;  3L72 E;  2W90 A;  3L71 G;  3OAK A;  2IPP A;  4PV1 B;  1RF1 C;  2LR2 A;  4LC1 A;  2POH A;  3SWF A;  2OTJ P;  3L36 A;  1QGK B;  4NPD A;  1JM0 A;  2KNC B;  3A2A A;  1LTJ C;  2JO1 A;  2V4H A;  1KIL C;  4TLF A;  1BE3 E;  1Q2N A;  1HGZ A;  2JKV A;  2BEQ D;  3OW2 O;  3RBX A;  1SQB D;  3B5N D;  2D2C B;  2E74 D;  3U1C A;  4YXD C;  1QX8 A;  1EXJ A;  3RBZ A;  3ZDM A;  4I1L A;  4TT3 H;  2IYO A;  1PFI A;  4JQ0 D;  5AW2 B;  1VQL P;  1BDC A;  3CCQ P;  3CCS P;  1NTM J;  1N7S B;  5KKZ C;  1KFN A;  4UB8 E;  3RK2 B;  1EDL A;  5CBN A;  2YMK A;  4RO0 A;  2GUS A;  2KIK A;  1VQN P;  1HVV A;  1IFJ A;  1KYO I;  1L0N K;  1LTJ A;  1LTI C;  2B89 A;  2ZT9 D;  2WIT A;  3O6Q B;  3B8E B;  4HYT B;  1KYO D;  2HOD B;  3ITK A;  4GOE A;  1SQP E;  3W67 A;  5B5E H;  3O6Q A;  1GU5 A;  3MGN A;  2FYU G;  2ZXX A;  5E79 E;  3CPW O;  1L0L J;  1FZB A;  2WSE J;  2Q7C A;  3SFD C;  3H1L E;  4BWN A;  1S9K E;  1LT9 B;  2WSF J;  2NZ2 A;  1NAY A;  2PRR A;  1M57 D;  5AVR B;  3L74 E;  2Z4E A;  1IFI A;  2G3A A;  5KAI H;  3L74 J;  2V7Q J;  3PJS K;  3I56 P;  1KB9 E;  5KLV J;  1LTS C;  3QH9 A;  2KLU A;  1FAV A;  2BCC G;  1L0N G;  1KB9 H;  2K9J B;  2OTK E;  1YJN P;  4XFJ A;  4EYY Q;  2J58 A;  1CW5 A;  2R5D A;  1NU1 E;  4D6T G;  2LXB A;  1NKZ B;  2ZFC A;  1DD3 A;  1JY2 O;  3MUD C;  4R4L A;  3KZI E;  2IFM A;  4RES B;  3RL0 B;  3P32 A;  3SFE C;  3VMY A;  1GL2 C;  5B66 H;  3C1L A;  3AE2 C;  5KJ7 C;  2A06 D;  3Q5S A;  1DIP A;  2FXP A;  1P84 H;  2E74 B;  1Q81 Q;  1NTK E;  2D2C D;  2NRG A;  5AVW B;  1P84 E;  3C9I A;  1JY2 N;  2HPC A;  3L72 J;  3GHG A;  2B87 A;  5BVZ A;  1YJ9 P;  2NPS D;  1BDD A;  2LKM A;  1SQB J;  2KK7 A;  1WMK A;  3AE4 C;  3VOP A;  2H88 C;  3V2R A;  1A02 F;  1M1J A;  1N2D C;  4L74 A;  1NHL A;  2O01 H;  3S1K A;  2IZ0 A;  2K1A A;  3L75 J;  1ZV8 A;  1NVO A;  4IL6 X;  3WU2 E;  3O8Z A;  1EC5 A;  1H0T B;  1GL2 B;  2W6J H;  3TGU D;  2C9N Y;  3EQ2 A;  3G71 P;  1LT9 C;  1PP9 G;  2DW3 A;  1LWU B;  1SVF A;  3L71 J;  3JC2 2;  2CPS A;  1JOC A;  3K5B A;  4L73 A;  4Y28 J;  5CJ4 A;  1FS0 E;  3TNU B;  3VMX A;  1YHQ P;  1N73 A;  2N1T D;  4BXL A;  1IFN A;  1EZV I;  1SQP K;  5AVQ B;  2XKM A;  1URQ B;  2G8Y A;  2UWJ E;  3CWB D;  2HOD A;  3RL0 D;  3CCU P;  1J1D B;  2RN0 A;  3P7K A;  3Q2Y A;  1OXZ A;  2J5U A;  1S4X A;  1SQQ D;  2KS1 A;  3H1J G;  4WBA A;  2QA4 P;  1BSH A;  1GK6 A;  3JCU H;  4H0L D;  4HJG H;  2IBZ D;  4O9B A;  3AEC C;  1RF0 C;  4HH2 A;  1K04 A;  3CCE P;  1L2P A;  1IC2 A;  1N7S C;  1SQX K;  1USE A;  3B5N A;  3G3Z A;  3L70 D;  2ZXE B;  2N9B A;  1K9M Q;  4UB8 H;  1OFC X;  1AA0 A;  2RMZ A;  5CCH A;  1QVF O;  3CCJ P;  1HGV A;  2E75 B;  1LGH B;  2R32 A;  3H1I G;  1VF5 C;  2I1J A;  1JNM A;  2KOG A;  2K9J A;  1L0L D;  2N1T A;  1KC8 Q;  1FDI A;  3M0D C;  3M9Q A;  1JB0 J;  1M1J B;  2PFX A;  1WT6 A;  1XTC C;  4W7Y A;  4LLH A;  4KHX A;  1PGO A;  5DJU B;  3TK1 A;  4IL6 H;  3BCC G;  1HUC A;  3UIA A;  1J2J B;  1EZV G;  1FJP A;  2R3S A;  2AEF A;  1FZG A;  3NFQ A;  1X22 A;  4ZNC A;  3FWN A;  1EDJ A;  1AVO A;  3D6Z A;  1HF9 A;  2I1K A;  3B5N C;  3HUS A;  3RK2 D;  4OGQ B;  4PD4 H;  3CC7 P;  4OWF A;  4Y99 B;  4EOT A;  2R5B A;  2VRS A;  1RHZ B;  3RK3 B;  1T2K C;  1BGY E;  1SQQ K;  3WU2 H;  1NU1 K;  2WSF H;  2IYP A;  1PPJ G;  4I6M C;  2QJY C;  1LTJ B;  1KTM A;  4IFM A;  2K88 A;  1SQV E;  1JTH B;  1SQQ J;  3E1R A;  3L73 E;  2OTL P;  1S5L E;  1NYH A;  3H1K J;  3IN6 A;  4H0L C;  1M90 Q;  1NTZ J;  2W6A A;  3V2Q A;  3V5B A;  2HR3 A;  2YKQ A;  4RKU J;  3B5N B;  1KV4 A;  3VMZ A;  1SFC B;  2FYU K;  5CMZ A;  1S9K D;  2WSC H;  4JPZ B;  3L71 D;  1KD1 Q;  5KKZ B;  1SQB E;  1ZW0 A;  2Y9Z A;  1EXI A;  5CCG D;  1FBM A;  5AW8 B;  3GG2 A;  2KS1 B;  3OA7 A;  5KLV G;  1FOS E;  3R4Y A;  1OVU A;  2WTY A;  4Z1M H;  1YIJ P;  3MZW B;  4WVZ A;  2R3C A;  1JUN A;  1UIX A;  3LID A;  2B9B A;  3M9B A;  1KQG B;  1NU1 D;  4XA4 A;  2JR8 A;  1HJ0 A;  5APY A;  3D71 A;  1NWQ A;  1IK7 A;  1FZF A;  2QIW A;  1SFC C;  1FZA A;  3TF5 A;  2Y9Y A;  1T8Z A;  5K5G B;  3MUD A;  3KZI H;  3PRJ A;  1RQU A;  1XTG B;  2IBZ I;  2M3B A;  2ZYD A;  4GT1 A;  2FYN C;  4C46 A;  5B5E E;  1LTB C;  2JWA A;  5E79 H;  1LTT C;  2YNY A;  3BVH A;  3VN0 A;  2QM7 A;  1FDM A;  1BCC G;  3BCC J;  4D6T D;  3PHL A;  4PD4 E;  4U3F E;  1YQ3 C;  3IF4 A;  1VL2 A;  4H0L B;  2FXM A;  1RE3 A;  3L74 D;  2A45 I;  3RL0 C;  3SWK A;  2IX7 C;  4DJG A;  3TGU E;  1PP9 J;  4MN4 C;  1OW7 A;  3H1I J;  2E74 C;  1K8A Q;  2FYU J;  2WZ7 A;  1SQV D;  3L73 D;  1JY3 O;  4KT0 J;  1NTM K;  5AVT B;  3TYY A;  1NO4 A;  3AE8 C;  4I7Z C;  1SS1 A;  1UII A;  1NTZ K;  1W5C E;  3A0B E;  3CWB E;  3G4S P;  4EDF A;  1ZP0 C;  1L0N D;  2BCC D;  3CXH E;  3AED C;  2A06 E;  5APW A;  2Q3E A;  2QJP C;  4HKZ H;  1KOR A;  2H89 C;  1N86 A;  4GOD A;  4K3A A;  1S1C X;  3U59 A;  3HRN A;  3NTN A;  2CK3 H;  2H43 A;  2O1J A;  3L75 G;  1ZR2 A;  3CXH I;  1RY3 A;  3GHG C;  1MFZ A;  2MJZ A;  3KDP B;  3T97 A;  3TNU A;  3JSV C;  3EFG A;  2QM8 A;  2JJL A;  1AVY A;  3H1K G;  3V6I A;  4H13 D;  4H44 C;  3WUU A;  1JMM A;  1PV3 A;  2QVA A;  3F89 A;  5KJ7 A;  1LP1 A;  2BCC J;  1J1D C;  1MKM A;  5APS A;  2YO3 A;  1NTZ E;  4HB1 A;  1G1J A;  4ZKU A;  1NTM E;  2JWD A;  2PP6 A;  5AVY B;  3IAO A;  2OYI C;  3BRT B;  1L4A A;  3AE3 C;  4JYC A;  4RJT A;  2ITA A;  2FY8 A;  4PD4 I;  1RF1 B;  1FZC C;  1PP9 D;  1OX3 A;  4OVN F;  2Z5I A;  1W2E A;  1GD2 E;  1DD4 A;  2O01 J;  3AE7 C;  1L0N J;  4PD4 D;  1VF5 D;  3HTK A;  5GTI H;  1KIL B;  1OW8 A;  2IBZ E;  1X79 B;  2KP8 A;  1BGY D;  4PJ0 E;  3B4S A;  1VQ7 P;  4D6T J;  1OWA A;  2RH0 A;  3Q5P A;  2D2C C;  3G9R A;  1SQQ G;  3H1J D;  1P84 I;  3I5C A;  5CCG A;  2Q9I A;  2QJP B;  1AQ5 A;  1QVG O;  3Q1M A;  3H1H E;  2OYI A;  3L70 J;  3KPE A;  1SQX J;  1L0L E;  3G6E P;  2XNX A;  2WVR A;  3L70 G;  2M8R A;  3II6 A;  4C7N B;  3AEE C;  2KZI A;  1FDO A;  1NTK D;  3RK2 C;  1JCC A;  1P84 D;  1IJD B;  3GW6 A;  1M1J C;  2XV5 A;  3IFM A;  3L71 E;  4OH8 B;  1TU3 F;  5AW0 B;  3WUV A;  4ZMD A;  1U7J A;  2Z5H A;  2XDJ A;  1U7M A;  3EFF K;  1LWU A;  1MZ9 A;  2QJY B;  1BE3 G;  3D70 A;  3KHU A;  1EDI A;  3PTZ A;  2QEX P;  1VQM P;  2NPS A;  3CX5 D;  3FWL A;  3S4R A;  1GTW A;  2H7H A;  1Q86 Q;  1EZV D;  2QJK C;  3M0A A;  1JO5 A;  3M0D A;  2KYV A;  2XU6 A;  1KQF B;  2ZYG A;  1VQ9 P;  2WSE H;  5APT A;  5AW4 B;  4ASW A;  5CCH C;  1T6A A;  1GW3 A;  1JCD A;  4IL6 E;  3M06 A;  2FBW C;  2B87 B;  1NTZ D;  2ZT9 C;  5AW6 B;  2B88 A;  3B71 A;  1URQ C;  3FXE A;  1RF0 A;  1PPJ D;  1LT1 A;  5AVU B;  1S2E A;  5BU8 B;  3MIW A;  3BAT A;  3L72 G;  1IK9 A;  1KZU B;  1E79 H;  3GF3 A;  1RE3 C;  2NPS B;  4WB4 A;  3CX5 H;  2CPB A;  2K9Y A;  2E75 D;  1OVV A;  2HFE D;  1L4A C;  1MUU A;  4GIF A;  5AVX B;  3HD7 C;  1FE6 A;  2FKW B;  4M3L A;  3VP8 A;  4L75 A; 
#chains in the Genus database with same CATH homology
 4BRY B;  3F5H A;  3E1R A;  2ZXX A;  1UII A;  2Q6Q A;  4BRY A;  3WUV A;  3WUU A;  2WVR A;  3WUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...