1EDJA

Staphylococcal protein a e-domain (180), nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
b'AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL PROTEIN A
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 18
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edjA00
1Q2NA 2KZJA 2RKLA 1EDJA 1LP1A 1NVOA 1JMBA 3MHVA 4HB1A 1JM0A 5K5GB 1FC2C 3FXDA 4HKZH 3FXEA 5DJTB 3PH0A 1ZW0A 2Q1KA 2UWJE 2LXCB 1OVRA 1U7JA 4NPFX 4EYYQ 2M5AB 4GOFA 2KUBA 2WMMA 4ASVA 2HR3A 2B88A 2LXBA 4NPEA 2QRXA 1OVUA 2P58A 2K3RA 2KI7B 4WWIA 1X0TA 4ZNCA 3QWOC 4CPGA 1H0TA 5DJUB 4GOEA 3RGUA 2R44A 4IOIH 2KZIA 2B87A 4JBZA 1EDKA 4K3AA 2JWDA 2ZAEB 4BXLA 5CBOA 1LP1B 2SPZA 4ASWA 2QVAA 1MFTA 1S3JA 4KJMA 1EC5A 1SS1A 5C39A 2I8DA 2M0BA 4MN4C 4HJGH 1LT1A 4NPDA 3ZDMA 1H0TB 1Y47A 2B89A 4K35A 3MZWB 1U7MA 5CBNA 5EFWB 4GODA 2B87B 1BDDA 1EDLA 2M5AA 2KIKA 2LR2A 1ZXGA 1DEEG 2OTKE 4ZMDA 2KS1B 1OVVA 1EDIA 1BDCA 3S1KA
chains in the Genus database with same CATH superfamily
2YIUC 2AXTH 3A0BE 1KYOH 1BE3J 1KB9I 3NTNA 2P1JA 1PPJE 2MKVA 4DT0A 1CW5A 2LXCB 1LNQA 3L72D 2ZXXA 2GUVA 1S1CX 3G71P 1RH5B 4LC1A 5TISE 3V2NA 1FZCA 3I5CA 1HWTC 1ZR2A 3CMEP 2WZ7A 3I56P 2FY8A 5AVXB 4OH8B 4JYCA 3CWBJ 1Y8AA 4ZNCA 3HE4A 3H1JJ 3M9HA 3H1HE 3TGUG 5AW9B 2JR8A 3IAOA 2E76B 4TT3H 3RK2C 3MIWA 2FYUE 1VQ4P 3SFDC 2QJYB 2HODB 4I2LC 3AE1C 1YQ3C 3CCUP 2XNXA 1SQXG 3VP8A 4K3AA 1EDKA 1BGYG 1HVVA 1SQXJ 3Q5RA 3L70E 4RJTA 4Y99C 1NU1K 4PV1C 1LT9A 4MN4C 3VMAA 1KILB 3W68A 1FOSE 4H0LD 4K35A 3G9RA 3HUSB 1GK4A 3CMAP 5AVVB 1L0LE 1DD4A 3R2PA 2KIKA 3A7OA 1PIXA 1RHZB 3N7NA 5APSA 1R5LA 2WSSH 2M8RA 1OWAA 4IL6H 2WSEH 2KSJA 2KP8A 1L4AB 1NTKD 1SQVJ 1PP9G 3AE5C 1VQ7P 3HE5B 4GT1A 1PP9J 3CC2P 1GK6A 3FWLA 3H1IJ 3TF5A 5KAFH 1EQ7A 4GOFA 3TDKA 1RQUA 2HR3A 1BCCE 1KILE 1ZP0C 3V4WA 4O9BA 1LWUB 1SQQD 2BEQD 3RBXA 1RE4A 1VQMP 4CPGA 1KD1Q 5AW8B 2BCCG 2GA1A 1S2EA 4LGDE 1VQPP 2WSFJ 3O8ZA 1DH3A 2BCCJ 1YBKA 1Q82Q 2P67A 4JF7A 1HBWA 2N1TB 1TU3F 3CXHE 1QGKB 2Q3IA 3CCLP 1JTHA 1JY2O 2Z5HA 5KLIB 3JSVC 3L74E 2OYOA 2QJPB 1M8OB 1XTCC 3B4SA 1EC5A 3LIDA 3PRJA 3CCVP 1NTMG 1L2PA 4U3FG 2H88C 3ZDMA 2FBWC 1FDMA 3VP9A 1FZCB 1NTKK 2JWAA 5CBNA 1N7LA 1CZQA 1U57A 2KLUA 2B87B 1J2JB 1K9MQ 3BCCD 1FU1A 2YKOA 3RK3C 3Q3DA 4ZKPA 1VQOP 1JCDA 3H1LE 1IK9A 5KLVD 1IC2A 3RK3D 3RL0C 1KV4A 2O1JA 1USDA 3FWNA 1SQQK 1FE6A 1PFIA 3RL0D 2IBZI 1FOSF 3LIEA 3CCSP 1M1KQ 2IBZG 1LT9B 4I6MC 2WITA 1AQTA 3JCUH 5B5EH 2P58A 3BVHA 3KZIE 2OARA 1MUUA 4JPZB 2Q6QA 1OIPA 4YPCA 3L71G 3L72E 2BEZF 4H0LB 3L71J 3KYQA 2HLOA 3Q2YA 5KKZB 1IZNB 2PGDA 1VPCA 5CBOA 1QLED 1H88A 1BE3E 1USEA 2PRRA 3O6QB 2I8DA 1JY3N 1PPJG 5KAIH 1M90Q 1G1IA 1LT1A 3B71A 4Z1MH 2I1KA 3F89A 2ZYDA 5KLVK 1M1JC 5APXA 4AYCA 2E5YA 1BDDA 3SWFA 1JNMA 1ZXGA 1VQLP 1G2CB 1ZRTD 3CWBE 3OJAB 1L0ND 3H1JE 4TLFA 1GW3A 5AW7B 1VQ8P 2RKLA 3H1HG 2E42A 1EZVI 3FXDA 1M1JA 4HKZH 3L73D 3CCQP 2FYUG 2ZT9B 2QJKC 2FYUJ 4DCKA 1PV3A 3L75D 3A2AA 2DW3A 3L70G 3CI9A 3MTUE 4OVNF 1JUNA 3QH9A 1FS0E 2ZFCA 3L70J 4BRYA 1M57D 1NTKE 1ZMEC 4B86A 1SQBJ 3D6ZA 3GG2A 2K88A 4UB8H 2NZ2A 1L0LG 1L0LJ 1PGJA 1KB9H 1KTMA 1VQKP 3IN6A 2A06D 2OYIC 3BATA 1YI2P 4KJMA 2PAJA 3AE9C 1SQVE 3MGNA 1SQQE 4XE5B 1L0NK 4NPDA 4QMAA 3H1IE 2LKMA 2QSIA 2OYHB 1KQLA 1U7MA 4IL6X 4LLHA 2OYIA 1JOCA 2WT7B 2E76C 1BCCG 4ZMDA 4XA4A 1S5LH 5KTBA 1BCCJ 1G1JA 3KXDA 1PGPA 1SQPD 1IO4A 2W6AA 2E76D 2K1AA 3MHVA 2BCCE 1JY2N 1KN7A 1FBMA 3L35A 1JCCA 2Q1KA 1AQ5A 2HODA 3GF3A 5GTIE 3L74G 3JC22 4KT0J 1QVGO 4D6TJ 1AVOA 1NOHA 1N2DC 4DOJA 1Q90D 4L73A 3M0AA 1LTJC 3RK3E 4PD4I 1GW4A 1D7MA 1YJNP 3SFEC 1RE3C 5APUA 3V2RA 2W6BA 4KHXA 3W67A 1LTTC 1X9VA 2E43A 3H1LG 4JBZA 3TSIA 2KYVA 4N3YB 1MKMA 1LTJA 4R4MA 3H1LJ 1OX3A 3H6PA 4RO0A 1HGVA 5APQA 1M1JB 1RE3A 2XKMA 1SQPK 4AQRD 1NKZB 3HE5A 4EIJA 1QVFO 1FZEA 1J1DB 3A0HH 3C9IA 3GF7A 1NU1J 5CJ0A 3HTKB 2N1TC 1K73Q 5E79E 2R3SA 1Q2NA 5KLIC 2ZYGA 2YXRB 1N8RQ 2QJPC 2QG4A 3U59A 3PJSK 3L72G 3FXEA 3GLMA 5AVZB 4DJGA 1DIPA 3L72J 4GIFA 3VYIA 2IYOA 2N1TA 4I1LA 1FZCC 3OAKA 1BE3G 4A7PA 1ZRTE 1LTIC 1K05A 5BVZA 1OW8A 1OXZA 3N4XA 2GUSA 1X0TA 3M9QA 5CHXA 1N86A 4WY4C 5APWA 2IPPA 4GOEA 1JY3O 4HH2A 2OYIB 2RH0A 3H1KD 4IOIH 1PGQA 2J59M 1LTSC 2B87A 4WY4D 1KFMA 3CC4P 5AVTB 4R4LA 3CWBG 3H1JG 1VQ5P 1JO5A 5H2FE 1P84H 1ZN5A 4WY4A 4N78E 2Q7CA 1YJWP 5AVWB 1LT9C 1WRGA 3TNUA 4IL6E 4UB6H 2B89A 1EZVE 1BSHA 3BASA 2P10A 3UIAA 3CX5H 4H0LC 3M91A 2CK3H 1YQ4C 1NTKG 5KKZC 1S9KE 4H13C 1SQBE 3A0BH 2MJZA 1LP1A 2YXQB 4YXWH 4HYTB 4HB1A 1NTKJ 4OGQB 1NYHA 1FC2C 4I7ZC 1GZLA 2AXCA 2M3BA 1IFNA 4H13D 3CC7P 1E5WA 3B5NC 1OVRA 2KSEA 3MP7B 1Z56A 2KK7A 5TISH 1K04A 1LTJB 2E75C 3TGUD 2O01J 3SSUA 3C8VA 2O01N 1SQVG 3B5ND 1SQQG 2BASA 2Y0DA 1Q81Q 1SQPE 2KNCB 2E75D 3O6QA 1SQQJ 2N9YB 1YITP 2CPBA 3H1IG 2Q9IA 3B5NA 1CI6B 1BGYD 1RE4C 3RGUA 3KHUA 2QEXP 3M0DC 1K8AQ 3AEFC 3CCRP 2G8YA 2ZT9C 1G2CA 2XZRA 1LJ2A 4C7RA 4JYBA 5C39A 2ZT9D 3AEGC 3M0DA 1H0TB 3MZWB 2Y9YA 1T3JA 1H89A 2H43A 5EFWB 4D6TE 3BCCJ 5AW2B 4GKGA 1ZOYC 1LTAC 1HGZA 5KLVG 1GL2B 2V7QJ 5KLVJ 2FKWB 1Q86Q 1QL2A 3CD6P 4PD4E 1ZW0A 1IJDB 2OYHC 3SWKA 4WY4B 3BRVB 2B88A 1OVUA 3TNUB 3E1RA 3FGAD 1DEBA 4H44B 3G6EP 1JB0J 4EDFA 2OYHA 2ZVNB 2XNDH 1NU1E 1GDTA 1W5CE 1KC8Q 3EQ2A 2NPSC 1NTMD 1VL2A 3CXHH 4U3FD 3V6IA 2WT7A 2IFMA 1SVFA 2HFED 4BXLA 1LP1B 1AA0A 2ZYAA 2YNYA 2I1JA 3VMYA 2NPSD 2H8PD 2W8ZA 3RL0g 3PLNA 3D70A 1KYOD 1NTZD 2NPSA 1T3UA 3EWKA 3LW5H 4H13B 2E5TA 2FYNC 5AW1B 1KZUB 4I7ZB 2KS1B 4PJ0H 3VN0A 1L0NJ 3B5NB 1JMMA 1NVOA 5K5GB 2E75B 1P84D 2A45I 2YKQA 3L73J 2KOGA 2A45G 3L75G 3L75J 2POHA 3NMDA 2RN0A 1J1DC 2FFDB 2Y0EA 2WMMA 3VTPC 1NTMK 1N7SB 3CX5D 4NPEA 1RY3A 1AFOA 2OTJP 1PGOA 2K3RA 3Q5SA 3KZIH 1VQNP 2WSCJ 1EZVG 4OWFA 2CPSA 2WSEJ 5AVQB 1NTZK 2JJLA 3PHLA 3I55P 2PP6A 3HTKA 3D71A 1SQBG 1YJ9P 5KJ7C 1HJ0A 3D6YA 3CPWO 1OZHA 3AE3C 5KJ7D 2Q5UA 3AE4C 3H1HD 3R4YA 1IFIA 1FZFA 3AEDC 5GTHH 1N73B 1FDIA 5KJ7A 1SQPG 3H32B 1FJPA 1BDCA 3OA7A 1NKNA 2HYNA 3WU2E 1SQPJ 2WPRA 4W7ZA 2H7HA 3EFGA 4EOTA 4C46A 3MUDC 2WVRA 4ZKUA 5AW5B 5B66E 1SFCB 2IZ0A 2Q3EA 1FZGA 2IDBA 2QRXA 4RESB 1IK7A 1HH0A 2NPSB 1ZLLA 2WQYC 2JP3A 1UIXA 3MUDA 1S4XA 1NO4A 4D6TG 3BCCE 5AVRB 4OGQC 3EFFK 3CCMP 2P2UA 1BSNA 1LGHB 2O1KA 2O01H 3M06A 2JWDA 4OGQD 5KLVE 3HD7D 2YO3A 5CJ4A 1T8ZA 1S3JA 3P8CD 2FYNB 1KQGB 5CCHC 1QX8A 3II6A 3NFQA 1MV8A 3IR9A 2IYPA 2FYZA 1VQ6P 1IFJA 1PZQA 5AVSB 1GU5A 1FZBA 3FX0A 5CCHD 3CXHD 2WTYA 1IFDA 2KNCA 3AE7C 2KZJA 2IFNA 2AXTE 5CCHA 1KYOE 1JM0A 3L74D 2WSFH 1CI6A 1NTZE 1OFCX 1NU1G 5DJTB 5APVA 1T2KD 1U7JA 2L91A 4EYYQ 5GTIH 2JKVA 2KXPB 2XU6A 1LTGC 1VF5B 1M7LA 1GMJA 3S4RA 3U1AA 1WMKA 1OW7A 1GL2C 1X8YA 2E74D 1H0TA 2H89C 3V2PA 3H1KJ 1GL2D 2N9BA 2R5DA 3C1LA 1L0NE 1HJBA 2ZAEB 1DX7A 1GL2A 1X22A 4BWNA 3L73E 5APYA 1VDFA 3KDPB 2JEEA 3HRNA 3IFMA 1URQB 1CSBA 3L75E 1RQVA 2WPVB 4H44C 1HTLC 1EDLA 3VMZA 2PFXA 2FXPA 2OTLP 1RF1B 3KQGA 5E79H 4H44D 1RF0C 2W6JH 1PL5A 2XDJA 3TYYA 1BE3D 1NAYA 4GDOA 3Q1MA 5CMZA 3PH0A 3VOPA 2UWJE 3OW2O 4AUWA 1NWQA 3L37A 1XTGB 2A06E 1KB9D 2W27A 3TGUJ 2M5AB 5KAFE 1RF0A 1Q7YQ 4M3LA 3BRTB 3MD0A 3HD7B 3G4SP 3RK2D 5AW3B 1Y9BA 2R5BA 2RMZA 3CWBD 2HPCA 1BGYJ 1X79B 3H1JD 1YHQP 2JO1A 3AEEC 2A45H 1J1EB 2W90A 4IFDK 4PV1D 3F5HA 3V4QA 2KS1A 1WT6A 5H2FH 1GD2E 3B8EB 4W7YA 2QVAA 1SQXD 3GHGB 4U7JA 3GW6A 1SS1A 3M9BA 3T97B 2FFDC 2WSCH 1N7SC 2QM7A 3NXSA 2YO2A 3GMAA 1N7SD 1JY2P 5BU5A 4YXDC 4WB4A 1DEEG 2FFDA 1YTZI 3E7KA 1N7SA 3P8CE 4IFFA 2ZVOB 1S5LX 3Q5PA 1JMBA 2IX7C 4W80A 4DZOA 3CL3D 3BCCG 1SQVD 5AW4B 1FAVA 2ZXEB 2E74B 2QM8A 2K9JA 1PP9D 3USSA 2B9BA 1FDOA 4NPFX 3H1ID 3P8MC 3L36A 4C7NA 1ZR4A 2Y0CA 1N73C 2VRSA 3JCUE 5B5EE 3G3ZA 2KI7B 1SQXK 1JEKA 2O3JA 5AW0B 2R44A 2BCCD 1NTMJ 2KZIA 2FXOA 4U3FJ 5APTA 1N73A 4WVZA 1KYOI 3ITKA 3H32A 2YIUB 2YKPA 2P7JA 1MFTA 1SFCC 4PJ0E 5AVYB 2OGUA 1NTZG 2M0BA 5KAIE 3HE4B 2D2CC 2KB7P 3CCEP 2QE7H 1NTZJ 2ITAA 1W2BO 1E79H 1SFCD 3H25A 1OW6A 2OQQA 2AEFA 1SQVK 1ZV8A 4GODA 1R8EA 2D2CD 2LR2A 1H8AA 1A02F 1P84I 1M56D 1SFCA 5TJHA 1GTWA 2HPCB 3U1CA 3IF4A 3WUTA 3AECC 3H1KE 3RK2B 2C0WA 2WPQA 4PD4H 2GM4A 3CX5I 3WUVA 3P32A 1L0NG 3A3YB 1W2EA 2WWWA 4Y99B 3KPEA 4PV1B 2Z4EA 3L73G 5L8RJ 1IFPA 2L5GB 2IBZD 2AEMA 4WWIA 5DJUB 1HUCA 1AVYA 1YIJP 4UB8E 2R32A 1KB9E 4L74A 3L71D 1KORA 1GU4A 1MFZA 5AVUB 2Y9ZA 3WUUA 3RBZA 2SPZA 5GTHE 4ASWA 1YTZT 2KLVA 1EXIA 1VF5C 3AEBC 4HJGH 1QEXA 2K9JB 1PPJD 2A06G 1VF5D 5M1BA 3TGUE 3H1HJ 2R3CA 4N6JA 3P7KA 1SP4A 4C7NB 1KMIZ 4JQ0D 1JTHB 2OTKE 4L76A 1S5LE 1EDIA 1SQXE 1OMIA 4Y28J 1BGYE 3V5BA 1T6AA 2V4HA 2K9YA 1S72P 4N78D 2Z5IA 1IFMA 1A02J 2WPSA 2XV5A 1R5SA 2NRGA 4EI2A 1EXJA 2FYUD 1EZVD 1URQC 3WMM0 3AEAC 1NHLA 1FZAA 2KUBA 4ASVA 2LXBA 5BU8B 1URQD 3L70D 1RF1C 4RKUJ 1VQ9P 1QL1A 3QWOC 2J5UA 1S9KD 1SQBD 1URQA 1KQSO 4XFJA 1KFNA 1PP9E 2M3EA 3RK3B 1L0LD 2JDIH 1NH4A 2D2CB 2QIWA 1RF1A 2YMKA 3AE8C 1SLQA 5AW6B 3CCJP 3PTZA 3RL0B 2QJYC 2QA4P 3AE6C 3V2QA 3HD7C 3K5BA 3PP5A 1DD3A 3CXHI 1AJYA 3L4FA 3A0HE 2IZ1A 1KILC 2M5AA 1OVVA 1AV1A 2FYUK 3HUSC 3S1KA 3WU2H 1J1EC 1NJIQ 4YTPC 1BCCD 3HD7A 1KILD 2G3AA 1EDJA 3AE2C 3L74J 3SWYA 3VMXA 3GHGC 3CLQA 5CCGC 1NTME 1KILA 4U3FE 2K37A 1SQBK 1L4AC 3HUSA 5B66H 3LW5J 5CCGD 1LTBC 3S9OA 1L0LK 4D6TD 1T2KC 3GHGA 1L4AD 5CCGA 3T97A 1NGMB 1L4AA 1UIIA 1LWUC 1YYCA 4PD4D 2E74C 1MZ9A 3E1IA 2AEJA 2V7QH 1P84E 3H1LD 2FXMA 3H1KG 2ZJSE 2IBZE 4IFMA 4BRYB 2J58A 2QJKB 1JY3P 1Y47A 2C9LY 4WBAA 1LWUA 4UB6E 3A5TA 4L75A 2HG5D 2N1TD 3L71E 2W83C 1HF9A 1FJKA 2C0XA 2YMYA 3CX5E 1NAFA 3ABVC 1NU1D 3TK1A 2C9NY 1KQFB
chains in the Genus database with same CATH topology
1Q2NA 2KZJA 2RKLA 1EDJA 1LP1A 1NVOA 1JMBA 3MHVA 4HB1A 1JM0A 5K5GB 1FC2C 3FXDA 4HKZH 3FXEA 5DJTB 3PH0A 1ZW0A 2Q1KA 2UWJE 2LXCB 1OVRA 1U7JA 4NPFX 4EYYQ 2M5AB 4GOFA 2KUBA 2WMMA 4ASVA 2HR3A 2B88A 2LXBA 4NPEA 2QRXA 1OVUA 2P58A 2K3RA 2KI7B 4WWIA 1X0TA 4ZNCA 3QWOC 4CPGA 1H0TA 5DJUB 4GOEA 3RGUA 2R44A 4IOIH 2KZIA 2B87A 4JBZA 1EDKA 4K3AA 2JWDA 2ZAEB 4BXLA 5CBOA 1LP1B 2SPZA 4ASWA 2QVAA 1MFTA 1S3JA 4KJMA 1EC5A 1SS1A 5C39A 2I8DA 2M0BA 4MN4C 4HJGH 1LT1A 4NPDA 3ZDMA 1H0TB 1Y47A 2B89A 4K35A 3MZWB 1U7MA 5CBNA 5EFWB 4GODA 2B87B 1BDDA 1EDLA 2M5AA 2KIKA 2LR2A 1ZXGA 1DEEG 2OTKE 4ZMDA 2KS1B 1OVVA 1EDIA 1BDCA 3S1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2N A;  2KZJ A;  2RKL A;  1EDJ A;  1LP1 A;  1NVO A;  1JMB A;  3MHV A;  4HB1 A;  1JM0 A;  5K5G B;  1FC2 C;  3FXD A;  4HKZ H;  3FXE A;  5DJT B;  3PH0 A;  1ZW0 A;  2Q1K A;  2UWJ E;  2LXC B;  1OVR A;  1U7J A;  4NPF X;  4EYY Q;  2M5A B;  4GOF A;  2KUB A;  2WMM A;  4ASV A;  2HR3 A;  2B88 A;  2LXB A;  4NPE A;  2QRX A;  1OVU A;  2P58 A;  2K3R A;  2KI7 B;  4WWI A;  1X0T A;  4ZNC A;  3QWO C;  4CPG A;  1H0T A;  5DJU B;  4GOE A;  3RGU A;  2R44 A;  4IOI H;  2KZI A;  2B87 A;  4JBZ A;  1EDK A;  4K3A A;  2JWD A;  2ZAE B;  4BXL A;  5CBO A;  1LP1 B;  2SPZ A;  4ASW A;  2QVA A;  1MFT A;  1S3J A;  4KJM A;  1EC5 A;  1SS1 A;  5C39 A;  2I8D A;  2M0B A;  4MN4 C;  4HJG H;  1LT1 A;  4NPD A;  3ZDM A;  1H0T B;  1Y47 A;  2B89 A;  4K35 A;  3MZW B;  1U7M A;  5CBN A;  5EFW B;  4GOD A;  2B87 B;  1BDD A;  1EDL A;  2M5A A;  2KIK A;  2LR2 A;  1ZXG A;  1DEE G;  2OTK E;  4ZMD A;  2KS1 B;  1OVV A;  1EDI A;  1BDC A;  3S1K A; 
#chains in the Genus database with same CATH topology
 2YIU C;  2AXT H;  3A0B E;  1KYO H;  1BE3 J;  1KB9 I;  3NTN A;  2P1J A;  1PPJ E;  2MKV A;  4DT0 A;  1CW5 A;  2LXC B;  1LNQ A;  3L72 D;  2ZXX A;  2GUV A;  1S1C X;  3G71 P;  1RH5 B;  4LC1 A;  5TIS E;  3V2N A;  1FZC A;  3I5C A;  1HWT C;  1ZR2 A;  3CME P;  2WZ7 A;  3I56 P;  2FY8 A;  5AVX B;  4OH8 B;  4JYC A;  3CWB J;  1Y8A A;  4ZNC A;  3HE4 A;  3H1J J;  3M9H A;  3H1H E;  3TGU G;  5AW9 B;  2JR8 A;  3IAO A;  2E76 B;  4TT3 H;  3RK2 C;  3MIW A;  2FYU E;  1VQ4 P;  3SFD C;  2QJY B;  2HOD B;  4I2L C;  3AE1 C;  1YQ3 C;  3CCU P;  2XNX A;  1SQX G;  3VP8 A;  4K3A A;  1EDK A;  1BGY G;  1HVV A;  1SQX J;  3Q5R A;  3L70 E;  4RJT A;  4Y99 C;  1NU1 K;  4PV1 C;  1LT9 A;  4MN4 C;  3VMA A;  1KIL B;  3W68 A;  1FOS E;  4H0L D;  4K35 A;  3G9R A;  3HUS B;  1GK4 A;  3CMA P;  5AVV B;  1L0L E;  1DD4 A;  3R2P A;  2KIK A;  3A7O A;  1PIX A;  1RHZ B;  3N7N A;  5APS A;  1R5L A;  2WSS H;  2M8R A;  1OWA A;  4IL6 H;  2WSE H;  2KSJ A;  2KP8 A;  1L4A B;  1NTK D;  1SQV J;  1PP9 G;  3AE5 C;  1VQ7 P;  3HE5 B;  4GT1 A;  1PP9 J;  3CC2 P;  1GK6 A;  3FWL A;  3H1I J;  3TF5 A;  5KAF H;  1EQ7 A;  4GOF A;  3TDK A;  1RQU A;  2HR3 A;  1BCC E;  1KIL E;  1ZP0 C;  3V4W A;  4O9B A;  1LWU B;  1SQQ D;  2BEQ D;  3RBX A;  1RE4 A;  1VQM P;  4CPG A;  1KD1 Q;  5AW8 B;  2BCC G;  2GA1 A;  1S2E A;  4LGD E;  1VQP P;  2WSF J;  3O8Z A;  1DH3 A;  2BCC J;  1YBK A;  1Q82 Q;  2P67 A;  4JF7 A;  1HBW A;  2N1T B;  1TU3 F;  3CXH E;  1QGK B;  2Q3I A;  3CCL P;  1JTH A;  1JY2 O;  2Z5H A;  5KLI B;  3JSV C;  3L74 E;  2OYO A;  2QJP B;  1M8O B;  1XTC C;  3B4S A;  1EC5 A;  3LID A;  3PRJ A;  3CCV P;  1NTM G;  1L2P A;  4U3F G;  2H88 C;  3ZDM A;  2FBW C;  1FDM A;  3VP9 A;  1FZC B;  1NTK K;  2JWA A;  5CBN A;  1N7L A;  1CZQ A;  1U57 A;  2KLU A;  2B87 B;  1J2J B;  1K9M Q;  3BCC D;  1FU1 A;  2YKO A;  3RK3 C;  3Q3D A;  4ZKP A;  1VQO P;  1JCD A;  3H1L E;  1IK9 A;  5KLV D;  1IC2 A;  3RK3 D;  3RL0 C;  1KV4 A;  2O1J A;  1USD A;  3FWN A;  1SQQ K;  1FE6 A;  1PFI A;  3RL0 D;  2IBZ I;  1FOS F;  3LIE A;  3CCS P;  1M1K Q;  2IBZ G;  1LT9 B;  4I6M C;  2WIT A;  1AQT A;  3JCU H;  5B5E H;  2P58 A;  3BVH A;  3KZI E;  2OAR A;  1MUU A;  4JPZ B;  2Q6Q A;  1OIP A;  4YPC A;  3L71 G;  3L72 E;  2BEZ F;  4H0L B;  3L71 J;  3KYQ A;  2HLO A;  3Q2Y A;  5KKZ B;  1IZN B;  2PGD A;  1VPC A;  5CBO A;  1QLE D;  1H88 A;  1BE3 E;  1USE A;  2PRR A;  3O6Q B;  2I8D A;  1JY3 N;  1PPJ G;  5KAI H;  1M90 Q;  1G1I A;  1LT1 A;  3B71 A;  4Z1M H;  2I1K A;  3F89 A;  2ZYD A;  5KLV K;  1M1J C;  5APX A;  4AYC A;  2E5Y A;  1BDD A;  3SWF A;  1JNM A;  1ZXG A;  1VQL P;  1G2C B;  1ZRT D;  3CWB E;  3OJA B;  1L0N D;  3H1J E;  4TLF A;  1GW3 A;  5AW7 B;  1VQ8 P;  2RKL A;  3H1H G;  2E42 A;  1EZV I;  3FXD A;  1M1J A;  4HKZ H;  3L73 D;  3CCQ P;  2FYU G;  2ZT9 B;  2QJK C;  2FYU J;  4DCK A;  1PV3 A;  3L75 D;  3A2A A;  2DW3 A;  3L70 G;  3CI9 A;  3MTU E;  4OVN F;  1JUN A;  3QH9 A;  1FS0 E;  2ZFC A;  3L70 J;  4BRY A;  1M57 D;  1NTK E;  1ZME C;  4B86 A;  1SQB J;  3D6Z A;  3GG2 A;  2K88 A;  4UB8 H;  2NZ2 A;  1L0L G;  1L0L J;  1PGJ A;  1KB9 H;  1KTM A;  1VQK P;  3IN6 A;  2A06 D;  2OYI C;  3BAT A;  1YI2 P;  4KJM A;  2PAJ A;  3AE9 C;  1SQV E;  3MGN A;  1SQQ E;  4XE5 B;  1L0N K;  4NPD A;  4QMA A;  3H1I E;  2LKM A;  2QSI A;  2OYH B;  1KQL A;  1U7M A;  4IL6 X;  4LLH A;  2OYI A;  1JOC A;  2WT7 B;  2E76 C;  1BCC G;  4ZMD A;  4XA4 A;  1S5L H;  5KTB A;  1BCC J;  1G1J A;  3KXD A;  1PGP A;  1SQP D;  1IO4 A;  2W6A A;  2E76 D;  2K1A A;  3MHV A;  2BCC E;  1JY2 N;  1KN7 A;  1FBM A;  3L35 A;  1JCC A;  2Q1K A;  1AQ5 A;  2HOD A;  3GF3 A;  5GTI E;  3L74 G;  3JC2 2;  4KT0 J;  1QVG O;  4D6T J;  1AVO A;  1NOH A;  1N2D C;  4DOJ A;  1Q90 D;  4L73 A;  3M0A A;  1LTJ C;  3RK3 E;  4PD4 I;  1GW4 A;  1D7M A;  1YJN P;  3SFE C;  1RE3 C;  5APU A;  3V2R A;  2W6B A;  4KHX A;  3W67 A;  1LTT C;  1X9V A;  2E43 A;  3H1L G;  4JBZ A;  3TSI A;  2KYV A;  4N3Y B;  1MKM A;  1LTJ A;  4R4M A;  3H1L J;  1OX3 A;  3H6P A;  4RO0 A;  1HGV A;  5APQ A;  1M1J B;  1RE3 A;  2XKM A;  1SQP K;  4AQR D;  1NKZ B;  3HE5 A;  4EIJ A;  1QVF O;  1FZE A;  1J1D B;  3A0H H;  3C9I A;  3GF7 A;  1NU1 J;  5CJ0 A;  3HTK B;  2N1T C;  1K73 Q;  5E79 E;  2R3S A;  1Q2N A;  5KLI C;  2ZYG A;  2YXR B;  1N8R Q;  2QJP C;  2QG4 A;  3U59 A;  3PJS K;  3L72 G;  3FXE A;  3GLM A;  5AVZ B;  4DJG A;  1DIP A;  3L72 J;  4GIF A;  3VYI A;  2IYO A;  2N1T A;  4I1L A;  1FZC C;  3OAK A;  1BE3 G;  4A7P A;  1ZRT E;  1LTI C;  1K05 A;  5BVZ A;  1OW8 A;  1OXZ A;  3N4X A;  2GUS A;  1X0T A;  3M9Q A;  5CHX A;  1N86 A;  4WY4 C;  5APW A;  2IPP A;  4GOE A;  1JY3 O;  4HH2 A;  2OYI B;  2RH0 A;  3H1K D;  4IOI H;  1PGQ A;  2J59 M;  1LTS C;  2B87 A;  4WY4 D;  1KFM A;  3CC4 P;  5AVT B;  4R4L A;  3CWB G;  3H1J G;  1VQ5 P;  1JO5 A;  5H2F E;  1P84 H;  1ZN5 A;  4WY4 A;  4N78 E;  2Q7C A;  1YJW P;  5AVW B;  1LT9 C;  1WRG A;  3TNU A;  4IL6 E;  4UB6 H;  2B89 A;  1EZV E;  1BSH A;  3BAS A;  2P10 A;  3UIA A;  3CX5 H;  4H0L C;  3M91 A;  2CK3 H;  1YQ4 C;  1NTK G;  5KKZ C;  1S9K E;  4H13 C;  1SQB E;  3A0B H;  2MJZ A;  1LP1 A;  2YXQ B;  4YXW H;  4HYT B;  4HB1 A;  1NTK J;  4OGQ B;  1NYH A;  1FC2 C;  4I7Z C;  1GZL A;  2AXC A;  2M3B A;  1IFN A;  4H13 D;  3CC7 P;  1E5W A;  3B5N C;  1OVR A;  2KSE A;  3MP7 B;  1Z56 A;  2KK7 A;  5TIS H;  1K04 A;  1LTJ B;  2E75 C;  3TGU D;  2O01 J;  3SSU A;  3C8V A;  2O01 N;  1SQV G;  3B5N D;  1SQQ G;  2BAS A;  2Y0D A;  1Q81 Q;  1SQP E;  2KNC B;  2E75 D;  3O6Q A;  1SQQ J;  2N9Y B;  1YIT P;  2CPB A;  3H1I G;  2Q9I A;  3B5N A;  1CI6 B;  1BGY D;  1RE4 C;  3RGU A;  3KHU A;  2QEX P;  3M0D C;  1K8A Q;  3AEF C;  3CCR P;  2G8Y A;  2ZT9 C;  1G2C A;  2XZR A;  1LJ2 A;  4C7R A;  4JYB A;  5C39 A;  2ZT9 D;  3AEG C;  3M0D A;  1H0T B;  3MZW B;  2Y9Y A;  1T3J A;  1H89 A;  2H43 A;  5EFW B;  4D6T E;  3BCC J;  5AW2 B;  4GKG A;  1ZOY C;  1LTA C;  1HGZ A;  5KLV G;  1GL2 B;  2V7Q J;  5KLV J;  2FKW B;  1Q86 Q;  1QL2 A;  3CD6 P;  4PD4 E;  1ZW0 A;  1IJD B;  2OYH C;  3SWK A;  4WY4 B;  3BRV B;  2B88 A;  1OVU A;  3TNU B;  3E1R A;  3FGA D;  1DEB A;  4H44 B;  3G6E P;  1JB0 J;  4EDF A;  2OYH A;  2ZVN B;  2XND H;  1NU1 E;  1GDT A;  1W5C E;  1KC8 Q;  3EQ2 A;  2NPS C;  1NTM D;  1VL2 A;  3CXH H;  4U3F D;  3V6I A;  2WT7 A;  2IFM A;  1SVF A;  2HFE D;  4BXL A;  1LP1 B;  1AA0 A;  2ZYA A;  2YNY A;  2I1J A;  3VMY A;  2NPS D;  2H8P D;  2W8Z A;  3RL0 g;  3PLN A;  3D70 A;  1KYO D;  1NTZ D;  2NPS A;  1T3U A;  3EWK A;  3LW5 H;  4H13 B;  2E5T A;  2FYN C;  5AW1 B;  1KZU B;  4I7Z B;  2KS1 B;  4PJ0 H;  3VN0 A;  1L0N J;  3B5N B;  1JMM A;  1NVO A;  5K5G B;  2E75 B;  1P84 D;  2A45 I;  2YKQ A;  3L73 J;  2KOG A;  2A45 G;  3L75 G;  3L75 J;  2POH A;  3NMD A;  2RN0 A;  1J1D C;  2FFD B;  2Y0E A;  2WMM A;  3VTP C;  1NTM K;  1N7S B;  3CX5 D;  4NPE A;  1RY3 A;  1AFO A;  2OTJ P;  1PGO A;  2K3R A;  3Q5S A;  3KZI H;  1VQN P;  2WSC J;  1EZV G;  4OWF A;  2CPS A;  2WSE J;  5AVQ B;  1NTZ K;  2JJL A;  3PHL A;  3I55 P;  2PP6 A;  3HTK A;  3D71 A;  1SQB G;  1YJ9 P;  5KJ7 C;  1HJ0 A;  3D6Y A;  3CPW O;  1OZH A;  3AE3 C;  5KJ7 D;  2Q5U A;  3AE4 C;  3H1H D;  3R4Y A;  1IFI A;  1FZF A;  3AED C;  5GTH H;  1N73 B;  1FDI A;  5KJ7 A;  1SQP G;  3H32 B;  1FJP A;  1BDC A;  3OA7 A;  1NKN A;  2HYN A;  3WU2 E;  1SQP J;  2WPR A;  4W7Z A;  2H7H A;  3EFG A;  4EOT A;  4C46 A;  3MUD C;  2WVR A;  4ZKU A;  5AW5 B;  5B66 E;  1SFC B;  2IZ0 A;  2Q3E A;  1FZG A;  2IDB A;  2QRX A;  4RES B;  1IK7 A;  1HH0 A;  2NPS B;  1ZLL A;  2WQY C;  2JP3 A;  1UIX A;  3MUD A;  1S4X A;  1NO4 A;  4D6T G;  3BCC E;  5AVR B;  4OGQ C;  3EFF K;  3CCM P;  2P2U A;  1BSN A;  1LGH B;  2O1K A;  2O01 H;  3M06 A;  2JWD A;  4OGQ D;  5KLV E;  3HD7 D;  2YO3 A;  5CJ4 A;  1T8Z A;  1S3J A;  3P8C D;  2FYN B;  1KQG B;  5CCH C;  1QX8 A;  3II6 A;  3NFQ A;  1MV8 A;  3IR9 A;  2IYP A;  2FYZ A;  1VQ6 P;  1IFJ A;  1PZQ A;  5AVS B;  1GU5 A;  1FZB A;  3FX0 A;  5CCH D;  3CXH D;  2WTY A;  1IFD A;  2KNC A;  3AE7 C;  2KZJ A;  2IFN A;  2AXT E;  5CCH A;  1KYO E;  1JM0 A;  3L74 D;  2WSF H;  1CI6 A;  1NTZ E;  1OFC X;  1NU1 G;  5DJT B;  5APV A;  1T2K D;  1U7J A;  2L91 A;  4EYY Q;  5GTI H;  2JKV A;  2KXP B;  2XU6 A;  1LTG C;  1VF5 B;  1M7L A;  1GMJ A;  3S4R A;  3U1A A;  1WMK A;  1OW7 A;  1GL2 C;  1X8Y A;  2E74 D;  1H0T A;  2H89 C;  3V2P A;  3H1K J;  1GL2 D;  2N9B A;  2R5D A;  3C1L A;  1L0N E;  1HJB A;  2ZAE B;  1DX7 A;  1GL2 A;  1X22 A;  4BWN A;  3L73 E;  5APY A;  1VDF A;  3KDP B;  2JEE A;  3HRN A;  3IFM A;  1URQ B;  1CSB A;  3L75 E;  1RQV A;  2WPV B;  4H44 C;  1HTL C;  1EDL A;  3VMZ A;  2PFX A;  2FXP A;  2OTL P;  1RF1 B;  3KQG A;  5E79 H;  4H44 D;  1RF0 C;  2W6J H;  1PL5 A;  2XDJ A;  3TYY A;  1BE3 D;  1NAY A;  4GDO A;  3Q1M A;  5CMZ A;  3PH0 A;  3VOP A;  2UWJ E;  3OW2 O;  4AUW A;  1NWQ A;  3L37 A;  1XTG B;  2A06 E;  1KB9 D;  2W27 A;  3TGU J;  2M5A B;  5KAF E;  1RF0 A;  1Q7Y Q;  4M3L A;  3BRT B;  3MD0 A;  3HD7 B;  3G4S P;  3RK2 D;  5AW3 B;  1Y9B A;  2R5B A;  2RMZ A;  3CWB D;  2HPC A;  1BGY J;  1X79 B;  3H1J D;  1YHQ P;  2JO1 A;  3AEE C;  2A45 H;  1J1E B;  2W90 A;  4IFD K;  4PV1 D;  3F5H A;  3V4Q A;  2KS1 A;  1WT6 A;  5H2F H;  1GD2 E;  3B8E B;  4W7Y A;  2QVA A;  1SQX D;  3GHG B;  4U7J A;  3GW6 A;  1SS1 A;  3M9B A;  3T97 B;  2FFD C;  2WSC H;  1N7S C;  2QM7 A;  3NXS A;  2YO2 A;  3GMA A;  1N7S D;  1JY2 P;  5BU5 A;  4YXD C;  4WB4 A;  1DEE G;  2FFD A;  1YTZ I;  3E7K A;  1N7S A;  3P8C E;  4IFF A;  2ZVO B;  1S5L X;  3Q5P A;  1JMB A;  2IX7 C;  4W80 A;  4DZO A;  3CL3 D;  3BCC G;  1SQV D;  5AW4 B;  1FAV A;  2ZXE B;  2E74 B;  2QM8 A;  2K9J A;  1PP9 D;  3USS A;  2B9B A;  1FDO A;  4NPF X;  3H1I D;  3P8M C;  3L36 A;  4C7N A;  1ZR4 A;  2Y0C A;  1N73 C;  2VRS A;  3JCU E;  5B5E E;  3G3Z A;  2KI7 B;  1SQX K;  1JEK A;  2O3J A;  5AW0 B;  2R44 A;  2BCC D;  1NTM J;  2KZI A;  2FXO A;  4U3F J;  5APT A;  1N73 A;  4WVZ A;  1KYO I;  3ITK A;  3H32 A;  2YIU B;  2YKP A;  2P7J A;  1MFT A;  1SFC C;  4PJ0 E;  5AVY B;  2OGU A;  1NTZ G;  2M0B A;  5KAI E;  3HE4 B;  2D2C C;  2KB7 P;  3CCE P;  2QE7 H;  1NTZ J;  2ITA A;  1W2B O;  1E79 H;  1SFC D;  3H25 A;  1OW6 A;  2OQQ A;  2AEF A;  1SQV K;  1ZV8 A;  4GOD A;  1R8E A;  2D2C D;  2LR2 A;  1H8A A;  1A02 F;  1P84 I;  1M56 D;  1SFC A;  5TJH A;  1GTW A;  2HPC B;  3U1C A;  3IF4 A;  3WUT A;  3AEC C;  3H1K E;  3RK2 B;  2C0W A;  2WPQ A;  4PD4 H;  2GM4 A;  3CX5 I;  3WUV A;  3P32 A;  1L0N G;  3A3Y B;  1W2E A;  2WWW A;  4Y99 B;  3KPE A;  4PV1 B;  2Z4E A;  3L73 G;  5L8R J;  1IFP A;  2L5G B;  2IBZ D;  2AEM A;  4WWI A;  5DJU B;  1HUC A;  1AVY A;  1YIJ P;  4UB8 E;  2R32 A;  1KB9 E;  4L74 A;  3L71 D;  1KOR A;  1GU4 A;  1MFZ A;  5AVU B;  2Y9Z A;  3WUU A;  3RBZ A;  2SPZ A;  5GTH E;  4ASW A;  1YTZ T;  2KLV A;  1EXI A;  1VF5 C;  3AEB C;  4HJG H;  1QEX A;  2K9J B;  1PPJ D;  2A06 G;  1VF5 D;  5M1B A;  3TGU E;  3H1H J;  2R3C A;  4N6J A;  3P7K A;  1SP4 A;  4C7N B;  1KMI Z;  4JQ0 D;  1JTH B;  2OTK E;  4L76 A;  1S5L E;  1EDI A;  1SQX E;  1OMI A;  4Y28 J;  1BGY E;  3V5B A;  1T6A A;  2V4H A;  2K9Y A;  1S72 P;  4N78 D;  2Z5I A;  1IFM A;  1A02 J;  2WPS A;  2XV5 A;  1R5S A;  2NRG A;  4EI2 A;  1EXJ A;  2FYU D;  1EZV D;  1URQ C;  3WMM 0;  3AEA C;  1NHL A;  1FZA A;  2KUB A;  4ASV A;  2LXB A;  5BU8 B;  1URQ D;  3L70 D;  1RF1 C;  4RKU J;  1VQ9 P;  1QL1 A;  3QWO C;  2J5U A;  1S9K D;  1SQB D;  1URQ A;  1KQS O;  4XFJ A;  1KFN A;  1PP9 E;  2M3E A;  3RK3 B;  1L0L D;  2JDI H;  1NH4 A;  2D2C B;  2QIW A;  1RF1 A;  2YMK A;  3AE8 C;  1SLQ A;  5AW6 B;  3CCJ P;  3PTZ A;  3RL0 B;  2QJY C;  2QA4 P;  3AE6 C;  3V2Q A;  3HD7 C;  3K5B A;  3PP5 A;  1DD3 A;  3CXH I;  1AJY A;  3L4F A;  3A0H E;  2IZ1 A;  1KIL C;  2M5A A;  1OVV A;  1AV1 A;  2FYU K;  3HUS C;  3S1K A;  3WU2 H;  1J1E C;  1NJI Q;  4YTP C;  1BCC D;  3HD7 A;  1KIL D;  2G3A A;  1EDJ A;  3AE2 C;  3L74 J;  3SWY A;  3VMX A;  3GHG C;  3CLQ A;  5CCG C;  1NTM E;  1KIL A;  4U3F E;  2K37 A;  1SQB K;  1L4A C;  3HUS A;  5B66 H;  3LW5 J;  5CCG D;  1LTB C;  3S9O A;  1L0L K;  4D6T D;  1T2K C;  3GHG A;  1L4A D;  5CCG A;  3T97 A;  1NGM B;  1L4A A;  1UII A;  1LWU C;  1YYC A;  4PD4 D;  2E74 C;  1MZ9 A;  3E1I A;  2AEJ A;  2V7Q H;  1P84 E;  3H1L D;  2FXM A;  3H1K G;  2ZJS E;  2IBZ E;  4IFM A;  4BRY B;  2J58 A;  2QJK B;  1JY3 P;  1Y47 A;  2C9L Y;  4WBA A;  1LWU A;  4UB6 E;  3A5T A;  4L75 A;  2HG5 D;  2N1T D;  3L71 E;  2W83 C;  1HF9 A;  1FJK A;  2C0X A;  2YMY A;  3CX5 E;  1NAF A;  3ABV C;  1NU1 D;  3TK1 A;  2C9N Y;  1KQF B; 
#chains in the Genus database with same CATH homology
 1Q2N A;  2KZJ A;  2RKL A;  1EDJ A;  1LP1 A;  1NVO A;  1JMB A;  3MHV A;  4HB1 A;  1JM0 A;  5K5G B;  1FC2 C;  3FXD A;  4HKZ H;  3FXE A;  5DJT B;  3PH0 A;  1ZW0 A;  2Q1K A;  2UWJ E;  2LXC B;  1OVR A;  1U7J A;  4NPF X;  4EYY Q;  2M5A B;  4GOF A;  2KUB A;  2WMM A;  4ASV A;  2HR3 A;  2B88 A;  2LXB A;  4NPE A;  2QRX A;  1OVU A;  2P58 A;  2K3R A;  2KI7 B;  4WWI A;  1X0T A;  4ZNC A;  3QWO C;  4CPG A;  1H0T A;  5DJU B;  4GOE A;  3RGU A;  2R44 A;  4IOI H;  2KZI A;  2B87 A;  4JBZ A;  1EDK A;  4K3A A;  2JWD A;  2ZAE B;  4BXL A;  5CBO A;  1LP1 B;  2SPZ A;  4ASW A;  2QVA A;  1MFT A;  1S3J A;  4KJM A;  1EC5 A;  1SS1 A;  5C39 A;  2I8D A;  2M0B A;  4MN4 C;  4HJG H;  1LT1 A;  4NPD A;  3ZDM A;  1H0T B;  1Y47 A;  2B89 A;  4K35 A;  3MZW B;  1U7M A;  5CBN A;  5EFW B;  4GOD A;  2B87 B;  1BDD A;  1EDL A;  2M5A A;  2KIK A;  2LR2 A;  1ZXG A;  1DEE G;  2OTK E;  4ZMD A;  2KS1 B;  1OVV A;  1EDI A;  1BDC A;  3S1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...