3WU2E

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3wu2E00
3WU2E 5KAFE 3A0BE 4UB8E 3A0HE 1W5CE 3KZIE 4IL6E 5H2FE 5B66E 5TISE 5KAIE 4PJ0E 5GTIE 4UB6E 2AXTE 1S5LE 5B5EE 3JCUE 5GTHE 5E79E
chains in the Genus database with same CATH superfamily
1VQ9P 1RF1B 2N9YB 2QEXP 4EI2A 1SQXD 1CW5A 3TNUB 2KS1A 1L0LJ 2N1TB 2B87A 1SFCC 1KC8Q 1DEEG 1KQFB 2B87B 2WTYA 2FYUG 1QVFO 1X9VA 3BATA 2FKWB 1KB9H 1KQLA 2C9NY 4PD4I 1MV8A 1BE3E 1T3JA 3L75E 5M1BA 1NTKE 4EDFA 3V2QA 2LR2A 3VN0A 4AYCA 2M5AA 1VQNP 1IO4A 2M5AB 1KILC 1P84D 1ZRTD 3L35A 1PFIA 5AVWB 2KIKA 3ITKA 2KI7B 4Y99C 1W5CE 5APWA 1Y9BA 5KJ7C 2QSIA 3CXHH 2RH0A 1MKMA 3H25A 1N7SA 1EDLA 1N7SB 3K5BA 2WPVB 1GD2E 5APSA 3H32B 2QJPB 1Q86Q 1VQ4P 1LTIC 2FBWC 1JY3O 3SFEC 1AFOA 3D70A 2WPRA 1N73A 2PAJA 1H0TA 2QJYC 3CWBJ 1LT9C 1N73B 1W2EA 4IL6H 1H0TB 3TYYA 1SFCB 1VQOP 2W27A 1KYOH 1OW7A 2KLVA 4H13D 1BSNA 3V2PA 1L0NE 1WMKA 2Z4EA 3RBZA 2A06E 2FFDA 3TGUG 1RHZB 1KILA 3NXSA 2L91A 1KILB 1SQPG 4ZMDA 1QLED 2P67A 1A02F 4Y99B 1EDIA 1JTHA 2CK3H 1U7JA 1MZ9A 3CD6P 2N9BA 1URQC 2ZXEB 5AVSB 2H43A 3GW6A 3L4FA 1EXJA 1IFMA 4U7JA 3Q5SA 2FXMA 2KLUA 5B5EE 2C0XA 4TT3H 3CPWO 1NTZK 3H1HD 4GDOA 3HE4A 2QJYB 1YIJP 3GF3A 3H1ID 4JBZA 5CCGC 3AEBC 3AE2C 4L76A 4I7ZC 3RL0g 1S72P 5AVZB 1J1DC 1BGYJ 1EZVD 2RMZA 3MGNA 1YBKA 2E75C 4CPGA 3FXEA 1SQBE 1NTZJ 2FYUE 1SQQG 2OGUA 3NTNA 3H1JJ 3L74D 2W8ZA 1JMBA 3VP9A 3HE5A 4RO0A 2XZRA 4MN4C 3D71A 3M9BA 3A2AA 5B66H 1HUCA 5CMZA 1SQXJ 1URQB 5H2FE 1HGZA 3CCJP 2DW3A 1BCCD 5CCHC 2P58A 3CL3D 5GTHE 1VQLP 1EDJA 1EZVE 3KZIH 5AW4B 1L4AA 3GHGC 1RQUA 3GF7A 1E79H 1ZLLA 3FXDA 1GW4A 3U1AA 2XKMA 3PH0A 3B5ND 1S4XA 4DZOA 5CCGA 1OW8A 3A0HH 5E79E 1FC2C 2WPSA 1VQKP 2OYHA 2ZXXA 3M0DA 2BCCD 4I7ZB 2H88C 2C0WA 1LJ2A 3CXHI 3M9QA 2E75B 2Y9ZA 3WMM0 5AW2B 1JY2N 1GTWA 1U7MA 2Y0DA 2M3EA 3N4XA 3AEGC 3JC22 3UIAA 2OTLP 3TGUE 2AXCA 2RKLA 2JEEA 1G1JA 1SQPE 2E76D 3CC2P 1DIPA 2ZYGA 5CCHA 2KK7A 3L72G 3RK2D 3WUUA 2V4HA 3HUSC 4AQRD 3GHGA 1OW6A 4JYCA 2K88A 1RE3A 3GHGB 4HB1A 1M7LA 1BDCA 1YITP 1E5WA 2FYZA 5CHXA 4UB6E 1PP9D 2AXTE 1MFTA 4Y28J 1VPCA 1EDKA 2GA1A 1SQBK 3CCEP 3EWKA 2HODB 2FYUK 2Q6QA 3JCUH 5AVUB 2B89A 3IAOA 5KTBA 1M90Q 4N78E 2WT7A 1FAVA 1R5LA 2OYIA 1HTLC 1GW3A 3A5TA 1LTTC 1RQVA 2NRGA 3L70D 1BGYG 1OVRA 1IK9A 2J5UA 2KOGA 2WPQA 2ZT9C 1SS1A 1T6AA 2E74C 4KJMA 2LKMA 1HBWA 3H1HJ 3CMAP 4UB8E 1RH5B 3IR9A 1ZW0A 1FDIA 3H1IJ 1HF9A 1SQXG 3HUSB 1YTZT 4WY4C 1T2KD 1GL2C 1VQ7P 3QH9A 1PPJE 1P84H 2OARA 1NTMG 3F5HA 3L74J 2WSSH 3O6QA 1YYCA 2XDJA 3HTKA 3P8CE 1S9KE 3O6QB 4U3FE 3C8VA 3KXDA 1FS0E 3RL0C 2SPZA 1IK7A 2N1TD 3L73D 3MTUE 1FZFA 1IFJA 4ASWA 3PJSK 1EC5A 2PGDA 2XV5A 1DD3A 2E5YA 1BCCJ 4RESB 1FDOA 1SQPK 5KLVG 5AVQB 2W6AA 3KDPB 2CPSA 1IJDB 1LTJA 1NU1E 2E74B 4JYBA 2WSCJ 3SFDC 2ZFCA 4PD4D 2NPSC 4YPCA 1YI2P 4HKZH 2C9LY 5TISH 1KQSO 2Q1KA 4WY4A 3CCLP 2HPCA 1L2PA 2R5BA 3I55P 2BCCJ 4WY4B 2W83C 1GL2B 1JY3P 2XNDH 1BE3D 1N7SD 2HLOA 2O1KA 5TJHA 3L75D 4K35A 1NTKD 3CCRP 2QJPC 2OTJP 1FOSE 1LWUA 2NZ2A 2QJKC 1M8OB 2R32A 3BCCG 3RL0B 2L5GB 1NAFA 3H1KG 3AEFC 4I6MC 4PD4E 1N73C 2ZJSE 2KS1B 1SFCD 4N6JA 1FDMA 1J1EC 2ZAEB 2KP8A 1QL2A 2K1AA 3GG2A 1H89A 3AE9C 5AW0B 4YXWH 3G6EP 3D6ZA 3I5CA 1PP9J 1PV3A 2FFDC 3FWNA 1KILD 1M1JC 3B71A 1KZUB 2NPSA 1EXIA 1NO4A 3H1LG 2NPSB 3NFQA 2I1KA 3L71E 5APQA 5KJ7D 1EQ7A 1KQGB 1JOCA 1HWTC 3M9HA 4HYTB 1L0ND 4NPFX 2A06D 2D2CC 4W7ZA 3L70J 5DJTB 1YJWP 2G8YA 5AVYB 3Q1MA 1KILE 2QJKB 3AEAC 1NTME 2M8RA 3TSIA 4U3FJ 3EFGA 1NVOA 3S1KA 4OGQD 3VP8A 3GMAA 2HG5D 2K9YA 4WB4A 2P10A 1NU1K 3Q5RA 1J1EB 2Y0EA 1JM0A 1N86A 1K8AQ 1YQ3C 3Q5PA 2WSCH 4B86A 4WVZA 3G71P 3OA7A 1AQ5A 3ZDMA 5KLVE 1M1JA 2FFDB 2PFXA 1M1JB 1P84I 2JJLA 1FZBA 1LTAC 3VMYA 5GTIE 3VYIA 2M0BA 2YXRB 3C9IA 4LGDE 1IC2A 3L73J 1URQD 1SQVG 1JTHB 1HVVA 4AUWA 5KAFE 4D6TG 2R3CA 2QRXA 1S3JA 2OTKE 1SQBD 2BCCG 2FYUD 2P7JA 3RK3C 1R8EA 2D2CB 1L4AC 2YMKA 2OQQA 1AA0A 3P7KA 3OAKA 2A45H 3CCQP 4PJ0H 1JY2O 1ZMEC 2GUVA 1LNQA 1YHQP 5CCGD 1NTKK 2FYNC 3HE4B 3A7OA 3AEEC 3BCCE 3A0BH 1S5LE 3H1KE 4H44C 1L0LG 1S5LX 1HGVA 2OYHC 2IBZG 1UIXA 3M0DC 5AW5B 1GK4A 2A45G 1KMIZ 2RN0A 3WUTA 2E75D 4ZNCA 3RK3E 3AE1C 5AW3B 3M0AA 1NJIQ 3CX5E 1BE3J 3L75J 2WMMA 1W2BO 3CLQA 1NTKJ 3WU2H 4ZKPA 3D6YA 1GK6A 3HE5B 1T3UA 3CX5I 4H0LC 3V2NA 1QGKB 2KB7P 3SWKA 2JKVA 1U57A 3G3ZA 3USSA 1OVVA 2LXCB 3H1LE 5EFWB 1KB9E 3E7KA 1NTMK 3MZWB 5CCHD 3V4QA 1ZV8A 2K37A 3KQGA 1Q90D 5AW8B 4W7YA 3AE6C 1FOSF 4GODA 3RK3B 5AW9B 1KB9I 1L4AB 1RE3C 2YIUC 5L8RJ 4WWIA 3O8ZA 2WSEJ 2YNYA 1XTGB 3AECC 3M91A 1Q81Q 3L70G 3FWLA 1L0NK 3TGUD 3CMEP 2FYNB 5KLVK 3CXHE 1SQPD 1FZEA 2JP3A 1ZOYC 3CWBG 4H44B 4BXLA 1OMIA 1GU4A 1RF0C 2OYHB 2IYPA 4YXDC 2OYIC 1X0TA 2J59M 2QM7A 2Q9IA 4RKUJ 3AE3C 3VMZA 1L0NJ 3N7NA 2B88A 1QX8A 2ZVNB 2Q5UA 1VQMP 2I8DA 2IZ1A 4IL6E 2WVRA 1ZN5A 3LIDA 4IL6X 3SSUA 1PL5A 2M3BA 4H0LB 1KYOE 3T97A 3MUDC 1Y47A 3HD7C 1LP1A 4N78D 1SQVE 1Y8AA 3LIEA 1KYOI 4D6TE 2WWWA 3HRNA 2FXPA 2AEJA 1Q7YQ 2YIUB 3PP5A 2UWJE 1AQTA 2E42A 1SQQD 1VQ8P 1X22A 2IPPA 1OIPA 1VQPP 1FU1A 4IOIH 1M56D 2KXPB 2YXQB 3FX0A 1RF0A 1QVGO 1OWAA 1JUNA 5BU5A 1VF5C 3E1RA 3BVHA 3CI9A 5AVTB 2BASA 2WT7B 1NYHA 2OYIB 2WSFJ 2IBZE 5KKZC 2WZ7A 1PPJD 2ITAA 2KSEA 3PRJA 1SQBJ 5KAIE 2FYUJ 1PZQA 2ZT9D 2W6BA 4IFDK 1NWQA 1NTZG 3VMAA 2E74D 3P8CD 1SQQE 3L75G 3H1JG 1S9KD 4PV1C 3B8EB 4U3FD 1LTJC 4DOJA 1N8RQ 2IBZI 1SLQA 2A45I 4C7RA 2LXBA 3MUDA 3HD7A 1IFDA 4M3LA 3HD7B 2QA4P 4GKGA 2G3AA 1GL2D 2WSEH 4I1LA 1SVFA 2BEQD 3AE8C 3U1CA 3I56P 3OW2O 1S1CX 5AVXB 1G2CA 1X8YA 2CPBA 5B66E 1CZQA 1G2CB 1NU1D 4DT0A 3RBXA 3KHUA 3RK2B 2YO2A 3RL0D 1Q82Q 3HTKB 2W90A 1LWUC 1YJ9P 1MFZA 2R3SA 1VF5B 2KYVA 4K3AA 4Z1MH 4L74A 3KZIE 2YKOA 4XA4A 2GM4A 3M06A 2FXOA 3GLMA 4XE5B 3L72D 5KKZB 3CC4P 5K5GB 2AEMA 1DH3A 3VTPC 1NKZB 3A0HE 3TF5A 5CJ4A 4PV1B 1GDTA 1LTJB 1NAYA 1PGPA 2A06G 2HYNA 2NPSD 4I2LC 3TGUJ 1G1IA 1Q2NA 1SQPJ 1FZCA 1USEA 2QG4A 1H88A 1FZAA 5B5EH 2HPCB 1RE4C 3L72E 3W68A 1YQ4C 3G4SP 2QE7H 1J2JB 1SP4A 2IFNA 1JO5A 3G9RA 2WITA 3AE4C 1OX3A 5APXA 1X79B 1LWUB 2IFMA 3L71D 2WSFH 1LT1A 1SQQK 1ZP0C 1RF1A 3B4SA 3TNUA 1UIIA 5KLIC 2N1TA 1XTCC 4GT1A 4OVNF 3P8MC 5DJUB 3IF4A 3CCMP 2O01J 3S9OA 3F89A 4N3YB 3JCUE 1SQBG 1BGYE 1NTMD 1SQQJ 5H2FH 3R4YA 4NPEA 3V6IA 1NTZE 3H1JE 1ZXGA 3VOPA 2V7QJ 5GTHH 3H1HG 1LGHB 3H1IG 1RE4A 5APVA 2ZYDA 1PGQA 5AW6B 1A02J 1SQXE 1OZHA 1IFNA 4OWFA 5AVRB 2D2CD 1JY2P 5KLVD 2MKVA 1DD4A 3WUVA 5E79H 1EZVG 2W6JH 3A3YB 1LTGC 1BDDA 3L74G 2O1JA 3H32A 4O9BA 3ABVC 4DJGA 4WBAA 4QMAA 1H8AA 1KD1Q 3AE7C 1NKNA 1GZLA 5KLIB 1P84E 1ZRTE 3IN6A 4GIFA 1SFCA 4EYYQ 4OGQC 1BCCG 1PGJA 3MHVA 5APYA 2JR8A 4W80A 4DCKA 2XU6A 1LTBC 1K05A 4IFFA 2MJZA 1NU1J 3CCUP 4H13C 3L36A 3BCCD 2Y9YA 3H1KD 4NPDA 2J58A 3MIWA 4UB6H 1D7MA 2AXTH 1VQ6P 2PRRA 2O3JA 2Q3IA 3RK3D 3CX5D 2IYOA 1L4AD 3L72J 4KT0J 5KJ7A 1RY3A 2P2UA 4R4MA 3MP7B 1PGOA 1OXZA 1QEXA 2Q3EA 1KFNA 2H89C 1JCCA 4BRYA 2K9JA 4TLFA 4BRYB 5CBOA 2K9JB 5TISE 4L73A 4H44D 3H1LD 3SWFA 1KB9D 3Q3DA 2O01H 5KAIH 1T8ZA 2YKQA 4LLHA 1LT9A 3C1LA 1LT9B 1TU3F 2OYOA 4OGQB 3BRTB 1K04A 2YKPA 2POHA 4UB8H 2V7QH 1KORA 1FZGA 1FBMA 1JEKA 1SQXK 3W67A 4H13B 1PP9G 2ZYAA 1K73Q 1JY3N 4H0LD 1GMJA 3CXHD 3FGAD 2QVAA 1DEBA 3L71J 2KSJA 1AVYA 3EQ2A 3QWOC 1BSHA 3H1HE 5AW7B 3H1IE 3KPEA 5BVZA 1URQA 2H7HA 3RGUA 1VQ5P 3Q2YA 2KZIA 3KYQA 1NGMB 1PPJG 5C39A 1NTMJ 2JWDA 1KYOD 2QIWA 1AJYA 1DX7A 4U3FG 3L74E 2I1JA 4C46A 1FJPA 1M57D 4C7NA 1HJBA 2K3RA 1EZVI 1SQVD 4C7NB 1AV1A 5BU8B 3EFFK 3B5NC 2Y0CA 4D6TD 4A7PA 3TDKA 4HH2A 1WRGA 1PIXA 1KFMA 5KLVJ 2R5DA 1K9MQ 1BCCE 4XFJA 1J1DB 5AVVB 3CC7P 3AEDC 1CI6A 3PTZA 1KN7A 1KTMA 3V2RA 1CI6B 4JF7A 1NU1G 1JNMA 3HD7D 2ZVOB 1NHLA 3OJAB 2AEFA 4OH8B 3T97B 2YMYA 3L73G 1LP1B 4KHXA 3PHLA 4RJTA 1L0LD 3BASA 2IBZD 4BWNA 1IZNB 3SWYA 2E76C 2IX7C 4PD4H 1Z56A 2BCCE 3LW5J 1OFCX 3RK2C 1MUUA 4ASVA 3L37A 3S4RA 2KUBA 4ZKUA 1N2DC 1VF5D 3V5BA 3PLNA 3BCCJ 3H1KJ 1ZR4A 2HODA 3B5NA 1ZR2A 3BRVB 3VMXA 3B5NB 4JQ0D 1L0LE 1OVUA 1FJKA 1NOHA 1IFIA 1YTZI 4PJ0E 1NH4A 3IFMA 5CJ0A 1BE3G 2JDIH 4HJGH 4PV1D 1NTKG 4GOFA 3NMDA 4L75A 3A0BE 1R5SA 1WT6A 1QL1A 1AVOA 1PP9E 4LC1A 1FE6A 3H1LJ 4R4LA 1VL2A 4WY4D 1YJNP 1FZCC 3L71G 2JWAA 3H6PA 1CSBA 3CWBD 4IFMA 3WU2E 5AW1B 2E76B 1HH0A 2E5TA 1IFPA 1S2EA 4EOTA 3HUSA 1HJ0A 2XNXA 4YTPC 2QM8A 1T2KC 2R44A 3CCSP 3L70E 2Q7CA 2H8PD 3JSVC 2B9BA 2IZ0A 1RF1C 5APTA 2KNCA 3TK1A 1LTSC 4JPZB 3P32A 2KNCB 3CWBE 1GU5A 2VRSA 2GUSA 3U59A 2N1TC 4GOEA 5GTIH 1N7LA 1SQVK 1VDFA 1L0NG 1JMMA 2KZJA 2HFED 5KAFH 3II6A 3CCVP 1KV4A 2ZT9B 2HR3A 3R2PA 1JCDA 2Z5HA 2Z5IA 1FZCB 3V4WA 2O01N 4EIJA 3E1IA 1SQVJ 5APUA 3LW5H 2E43A 2P1JA 3MD0A 4D6TJ 3L73E 1USDA 2YO3A 2BEZF 1M1KQ 1GL2A 1BGYD 1L0LK 5CBNA 3AE5C 2JO1A 1S5LH 2FY8A 1NTZD 2PP6A 1N7SC 3H1JD 1JB0J 2IDBA 2WQYC 3CX5H
chains in the Genus database with same CATH topology
3WU2E 5KAFE 3A0BE 4UB8E 3A0HE 1W5CE 3KZIE 4IL6E 5H2FE 5B66E 5TISE 5KAIE 4PJ0E 5GTIE 4UB6E 2AXTE 1S5LE 5B5EE 3JCUE 5GTHE 5E79E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 E;  5KAF E;  3A0B E;  4UB8 E;  3A0H E;  1W5C E;  3KZI E;  4IL6 E;  5H2F E;  5B66 E;  5TIS E;  5KAI E;  4PJ0 E;  5GTI E;  4UB6 E;  2AXT E;  1S5L E;  5B5E E;  3JCU E;  5GTH E;  5E79 E; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  1RF1 B;  2N9Y B;  2QEX P;  4EI2 A;  1SQX D;  1CW5 A;  3TNU B;  2KS1 A;  1L0L J;  2N1T B;  2B87 A;  1SFC C;  1KC8 Q;  1DEE G;  1KQF B;  2B87 B;  2WTY A;  2FYU G;  1QVF O;  1X9V A;  3BAT A;  2FKW B;  1KB9 H;  1KQL A;  2C9N Y;  4PD4 I;  1MV8 A;  1BE3 E;  1T3J A;  3L75 E;  5M1B A;  1NTK E;  4EDF A;  3V2Q A;  2LR2 A;  3VN0 A;  4AYC A;  2M5A A;  1VQN P;  1IO4 A;  2M5A B;  1KIL C;  1P84 D;  1ZRT D;  3L35 A;  1PFI A;  5AVW B;  2KIK A;  3ITK A;  2KI7 B;  4Y99 C;  1W5C E;  5APW A;  1Y9B A;  5KJ7 C;  2QSI A;  3CXH H;  2RH0 A;  1MKM A;  3H25 A;  1N7S A;  1EDL A;  1N7S B;  3K5B A;  2WPV B;  1GD2 E;  5APS A;  3H32 B;  2QJP B;  1Q86 Q;  1VQ4 P;  1LTI C;  2FBW C;  1JY3 O;  3SFE C;  1AFO A;  3D70 A;  2WPR A;  1N73 A;  2PAJ A;  1H0T A;  2QJY C;  3CWB J;  1LT9 C;  1N73 B;  1W2E A;  4IL6 H;  1H0T B;  3TYY A;  1SFC B;  1VQO P;  2W27 A;  1KYO H;  1OW7 A;  2KLV A;  4H13 D;  1BSN A;  3V2P A;  1L0N E;  1WMK A;  2Z4E A;  3RBZ A;  2A06 E;  2FFD A;  3TGU G;  1RHZ B;  1KIL A;  3NXS A;  2L91 A;  1KIL B;  1SQP G;  4ZMD A;  1QLE D;  2P67 A;  1A02 F;  4Y99 B;  1EDI A;  1JTH A;  2CK3 H;  1U7J A;  1MZ9 A;  3CD6 P;  2N9B A;  1URQ C;  2ZXE B;  5AVS B;  2H43 A;  3GW6 A;  3L4F A;  1EXJ A;  1IFM A;  4U7J A;  3Q5S A;  2FXM A;  2KLU A;  5B5E E;  2C0X A;  4TT3 H;  3CPW O;  1NTZ K;  3H1H D;  4GDO A;  3HE4 A;  2QJY B;  1YIJ P;  3GF3 A;  3H1I D;  4JBZ A;  5CCG C;  3AEB C;  3AE2 C;  4L76 A;  4I7Z C;  3RL0 g;  1S72 P;  5AVZ B;  1J1D C;  1BGY J;  1EZV D;  2RMZ A;  3MGN A;  1YBK A;  2E75 C;  4CPG A;  3FXE A;  1SQB E;  1NTZ J;  2FYU E;  1SQQ G;  2OGU A;  3NTN A;  3H1J J;  3L74 D;  2W8Z A;  1JMB A;  3VP9 A;  3HE5 A;  4RO0 A;  2XZR A;  4MN4 C;  3D71 A;  3M9B A;  3A2A A;  5B66 H;  1HUC A;  5CMZ A;  1SQX J;  1URQ B;  5H2F E;  1HGZ A;  3CCJ P;  2DW3 A;  1BCC D;  5CCH C;  2P58 A;  3CL3 D;  5GTH E;  1VQL P;  1EDJ A;  1EZV E;  3KZI H;  5AW4 B;  1L4A A;  3GHG C;  1RQU A;  3GF7 A;  1E79 H;  1ZLL A;  3FXD A;  1GW4 A;  3U1A A;  2XKM A;  3PH0 A;  3B5N D;  1S4X A;  4DZO A;  5CCG A;  1OW8 A;  3A0H H;  5E79 E;  1FC2 C;  2WPS A;  1VQK P;  2OYH A;  2ZXX A;  3M0D A;  2BCC D;  4I7Z B;  2H88 C;  2C0W A;  1LJ2 A;  3CXH I;  3M9Q A;  2E75 B;  2Y9Z A;  3WMM 0;  5AW2 B;  1JY2 N;  1GTW A;  1U7M A;  2Y0D A;  2M3E A;  3N4X A;  3AEG C;  3JC2 2;  3UIA A;  2OTL P;  3TGU E;  2AXC A;  2RKL A;  2JEE A;  1G1J A;  1SQP E;  2E76 D;  3CC2 P;  1DIP A;  2ZYG A;  5CCH A;  2KK7 A;  3L72 G;  3RK2 D;  3WUU A;  2V4H A;  3HUS C;  4AQR D;  3GHG A;  1OW6 A;  4JYC A;  2K88 A;  1RE3 A;  3GHG B;  4HB1 A;  1M7L A;  1BDC A;  1YIT P;  1E5W A;  2FYZ A;  5CHX A;  4UB6 E;  1PP9 D;  2AXT E;  1MFT A;  4Y28 J;  1VPC A;  1EDK A;  2GA1 A;  1SQB K;  3CCE P;  3EWK A;  2HOD B;  2FYU K;  2Q6Q A;  3JCU H;  5AVU B;  2B89 A;  3IAO A;  5KTB A;  1M90 Q;  4N78 E;  2WT7 A;  1FAV A;  1R5L A;  2OYI A;  1HTL C;  1GW3 A;  3A5T A;  1LTT C;  1RQV A;  2NRG A;  3L70 D;  1BGY G;  1OVR A;  1IK9 A;  2J5U A;  2KOG A;  2WPQ A;  2ZT9 C;  1SS1 A;  1T6A A;  2E74 C;  4KJM A;  2LKM A;  1HBW A;  3H1H J;  3CMA P;  4UB8 E;  1RH5 B;  3IR9 A;  1ZW0 A;  1FDI A;  3H1I J;  1HF9 A;  1SQX G;  3HUS B;  1YTZ T;  4WY4 C;  1T2K D;  1GL2 C;  1VQ7 P;  3QH9 A;  1PPJ E;  1P84 H;  2OAR A;  1NTM G;  3F5H A;  3L74 J;  2WSS H;  3O6Q A;  1YYC A;  2XDJ A;  3HTK A;  3P8C E;  1S9K E;  3O6Q B;  4U3F E;  3C8V A;  3KXD A;  1FS0 E;  3RL0 C;  2SPZ A;  1IK7 A;  2N1T D;  3L73 D;  3MTU E;  1FZF A;  1IFJ A;  4ASW A;  3PJS K;  1EC5 A;  2PGD A;  2XV5 A;  1DD3 A;  2E5Y A;  1BCC J;  4RES B;  1FDO A;  1SQP K;  5KLV G;  5AVQ B;  2W6A A;  3KDP B;  2CPS A;  1IJD B;  1LTJ A;  1NU1 E;  2E74 B;  4JYB A;  2WSC J;  3SFD C;  2ZFC A;  4PD4 D;  2NPS C;  4YPC A;  1YI2 P;  4HKZ H;  2C9L Y;  5TIS H;  1KQS O;  2Q1K A;  4WY4 A;  3CCL P;  2HPC A;  1L2P A;  2R5B A;  3I55 P;  2BCC J;  4WY4 B;  2W83 C;  1GL2 B;  1JY3 P;  2XND H;  1BE3 D;  1N7S D;  2HLO A;  2O1K A;  5TJH A;  3L75 D;  4K35 A;  1NTK D;  3CCR P;  2QJP C;  2OTJ P;  1FOS E;  1LWU A;  2NZ2 A;  2QJK C;  1M8O B;  2R32 A;  3BCC G;  3RL0 B;  2L5G B;  1NAF A;  3H1K G;  3AEF C;  4I6M C;  4PD4 E;  1N73 C;  2ZJS E;  2KS1 B;  1SFC D;  4N6J A;  1FDM A;  1J1E C;  2ZAE B;  2KP8 A;  1QL2 A;  2K1A A;  3GG2 A;  1H89 A;  3AE9 C;  5AW0 B;  4YXW H;  3G6E P;  3D6Z A;  3I5C A;  1PP9 J;  1PV3 A;  2FFD C;  3FWN A;  1KIL D;  1M1J C;  3B71 A;  1KZU B;  2NPS A;  1EXI A;  1NO4 A;  3H1L G;  2NPS B;  3NFQ A;  2I1K A;  3L71 E;  5APQ A;  5KJ7 D;  1EQ7 A;  1KQG B;  1JOC A;  1HWT C;  3M9H A;  4HYT B;  1L0N D;  4NPF X;  2A06 D;  2D2C C;  4W7Z A;  3L70 J;  5DJT B;  1YJW P;  2G8Y A;  5AVY B;  3Q1M A;  1KIL E;  2QJK B;  3AEA C;  1NTM E;  2M8R A;  3TSI A;  4U3F J;  3EFG A;  1NVO A;  3S1K A;  4OGQ D;  3VP8 A;  3GMA A;  2HG5 D;  2K9Y A;  4WB4 A;  2P10 A;  1NU1 K;  3Q5R A;  1J1E B;  2Y0E A;  1JM0 A;  1N86 A;  1K8A Q;  1YQ3 C;  3Q5P A;  2WSC H;  4B86 A;  4WVZ A;  3G71 P;  3OA7 A;  1AQ5 A;  3ZDM A;  5KLV E;  1M1J A;  2FFD B;  2PFX A;  1M1J B;  1P84 I;  2JJL A;  1FZB A;  1LTA C;  3VMY A;  5GTI E;  3VYI A;  2M0B A;  2YXR B;  3C9I A;  4LGD E;  1IC2 A;  3L73 J;  1URQ D;  1SQV G;  1JTH B;  1HVV A;  4AUW A;  5KAF E;  4D6T G;  2R3C A;  2QRX A;  1S3J A;  2OTK E;  1SQB D;  2BCC G;  2FYU D;  2P7J A;  3RK3 C;  1R8E A;  2D2C B;  1L4A C;  2YMK A;  2OQQ A;  1AA0 A;  3P7K A;  3OAK A;  2A45 H;  3CCQ P;  4PJ0 H;  1JY2 O;  1ZME C;  2GUV A;  1LNQ A;  1YHQ P;  5CCG D;  1NTK K;  2FYN C;  3HE4 B;  3A7O A;  3AEE C;  3BCC E;  3A0B H;  1S5L E;  3H1K E;  4H44 C;  1L0L G;  1S5L X;  1HGV A;  2OYH C;  2IBZ G;  1UIX A;  3M0D C;  5AW5 B;  1GK4 A;  2A45 G;  1KMI Z;  2RN0 A;  3WUT A;  2E75 D;  4ZNC A;  3RK3 E;  3AE1 C;  5AW3 B;  3M0A A;  1NJI Q;  3CX5 E;  1BE3 J;  3L75 J;  2WMM A;  1W2B O;  3CLQ A;  1NTK J;  3WU2 H;  4ZKP A;  3D6Y A;  1GK6 A;  3HE5 B;  1T3U A;  3CX5 I;  4H0L C;  3V2N A;  1QGK B;  2KB7 P;  3SWK A;  2JKV A;  1U57 A;  3G3Z A;  3USS A;  1OVV A;  2LXC B;  3H1L E;  5EFW B;  1KB9 E;  3E7K A;  1NTM K;  3MZW B;  5CCH D;  3V4Q A;  1ZV8 A;  2K37 A;  3KQG A;  1Q90 D;  5AW8 B;  4W7Y A;  3AE6 C;  1FOS F;  4GOD A;  3RK3 B;  5AW9 B;  1KB9 I;  1L4A B;  1RE3 C;  2YIU C;  5L8R J;  4WWI A;  3O8Z A;  2WSE J;  2YNY A;  1XTG B;  3AEC C;  3M91 A;  1Q81 Q;  3L70 G;  3FWL A;  1L0N K;  3TGU D;  3CME P;  2FYN B;  5KLV K;  3CXH E;  1SQP D;  1FZE A;  2JP3 A;  1ZOY C;  3CWB G;  4H44 B;  4BXL A;  1OMI A;  1GU4 A;  1RF0 C;  2OYH B;  2IYP A;  4YXD C;  2OYI C;  1X0T A;  2J59 M;  2QM7 A;  2Q9I A;  4RKU J;  3AE3 C;  3VMZ A;  1L0N J;  3N7N A;  2B88 A;  1QX8 A;  2ZVN B;  2Q5U A;  1VQM P;  2I8D A;  2IZ1 A;  4IL6 E;  2WVR A;  1ZN5 A;  3LID A;  4IL6 X;  3SSU A;  1PL5 A;  2M3B A;  4H0L B;  1KYO E;  3T97 A;  3MUD C;  1Y47 A;  3HD7 C;  1LP1 A;  4N78 D;  1SQV E;  1Y8A A;  3LIE A;  1KYO I;  4D6T E;  2WWW A;  3HRN A;  2FXP A;  2AEJ A;  1Q7Y Q;  2YIU B;  3PP5 A;  2UWJ E;  1AQT A;  2E42 A;  1SQQ D;  1VQ8 P;  1X22 A;  2IPP A;  1OIP A;  1VQP P;  1FU1 A;  4IOI H;  1M56 D;  2KXP B;  2YXQ B;  3FX0 A;  1RF0 A;  1QVG O;  1OWA A;  1JUN A;  5BU5 A;  1VF5 C;  3E1R A;  3BVH A;  3CI9 A;  5AVT B;  2BAS A;  2WT7 B;  1NYH A;  2OYI B;  2WSF J;  2IBZ E;  5KKZ C;  2WZ7 A;  1PPJ D;  2ITA A;  2KSE A;  3PRJ A;  1SQB J;  5KAI E;  2FYU J;  1PZQ A;  2ZT9 D;  2W6B A;  4IFD K;  1NWQ A;  1NTZ G;  3VMA A;  2E74 D;  3P8C D;  1SQQ E;  3L75 G;  3H1J G;  1S9K D;  4PV1 C;  3B8E B;  4U3F D;  1LTJ C;  4DOJ A;  1N8R Q;  2IBZ I;  1SLQ A;  2A45 I;  4C7R A;  2LXB A;  3MUD A;  3HD7 A;  1IFD A;  4M3L A;  3HD7 B;  2QA4 P;  4GKG A;  2G3A A;  1GL2 D;  2WSE H;  4I1L A;  1SVF A;  2BEQ D;  3AE8 C;  3U1C A;  3I56 P;  3OW2 O;  1S1C X;  5AVX B;  1G2C A;  1X8Y A;  2CPB A;  5B66 E;  1CZQ A;  1G2C B;  1NU1 D;  4DT0 A;  3RBX A;  3KHU A;  3RK2 B;  2YO2 A;  3RL0 D;  1Q82 Q;  3HTK B;  2W90 A;  1LWU C;  1YJ9 P;  1MFZ A;  2R3S A;  1VF5 B;  2KYV A;  4K3A A;  4Z1M H;  4L74 A;  3KZI E;  2YKO A;  4XA4 A;  2GM4 A;  3M06 A;  2FXO A;  3GLM A;  4XE5 B;  3L72 D;  5KKZ B;  3CC4 P;  5K5G B;  2AEM A;  1DH3 A;  3VTP C;  1NKZ B;  3A0H E;  3TF5 A;  5CJ4 A;  4PV1 B;  1GDT A;  1LTJ B;  1NAY A;  1PGP A;  2A06 G;  2HYN A;  2NPS D;  4I2L C;  3TGU J;  1G1I A;  1Q2N A;  1SQP J;  1FZC A;  1USE A;  2QG4 A;  1H88 A;  1FZA A;  5B5E H;  2HPC B;  1RE4 C;  3L72 E;  3W68 A;  1YQ4 C;  3G4S P;  2QE7 H;  1J2J B;  1SP4 A;  2IFN A;  1JO5 A;  3G9R A;  2WIT A;  3AE4 C;  1OX3 A;  5APX A;  1X79 B;  1LWU B;  2IFM A;  3L71 D;  2WSF H;  1LT1 A;  1SQQ K;  1ZP0 C;  1RF1 A;  3B4S A;  3TNU A;  1UII A;  5KLI C;  2N1T A;  1XTC C;  4GT1 A;  4OVN F;  3P8M C;  5DJU B;  3IF4 A;  3CCM P;  2O01 J;  3S9O A;  3F89 A;  4N3Y B;  3JCU E;  1SQB G;  1BGY E;  1NTM D;  1SQQ J;  5H2F H;  3R4Y A;  4NPE A;  3V6I A;  1NTZ E;  3H1J E;  1ZXG A;  3VOP A;  2V7Q J;  5GTH H;  3H1H G;  1LGH B;  3H1I G;  1RE4 A;  5APV A;  2ZYD A;  1PGQ A;  5AW6 B;  1A02 J;  1SQX E;  1OZH A;  1IFN A;  4OWF A;  5AVR B;  2D2C D;  1JY2 P;  5KLV D;  2MKV A;  1DD4 A;  3WUV A;  5E79 H;  1EZV G;  2W6J H;  3A3Y B;  1LTG C;  1BDD A;  3L74 G;  2O1J A;  3H32 A;  4O9B A;  3ABV C;  4DJG A;  4WBA A;  4QMA A;  1H8A A;  1KD1 Q;  3AE7 C;  1NKN A;  1GZL A;  5KLI B;  1P84 E;  1ZRT E;  3IN6 A;  4GIF A;  1SFC A;  4EYY Q;  4OGQ C;  1BCC G;  1PGJ A;  3MHV A;  5APY A;  2JR8 A;  4W80 A;  4DCK A;  2XU6 A;  1LTB C;  1K05 A;  4IFF A;  2MJZ A;  1NU1 J;  3CCU P;  4H13 C;  3L36 A;  3BCC D;  2Y9Y A;  3H1K D;  4NPD A;  2J58 A;  3MIW A;  4UB6 H;  1D7M A;  2AXT H;  1VQ6 P;  2PRR A;  2O3J A;  2Q3I A;  3RK3 D;  3CX5 D;  2IYO A;  1L4A D;  3L72 J;  4KT0 J;  5KJ7 A;  1RY3 A;  2P2U A;  4R4M A;  3MP7 B;  1PGO A;  1OXZ A;  1QEX A;  2Q3E A;  1KFN A;  2H89 C;  1JCC A;  4BRY A;  2K9J A;  4TLF A;  4BRY B;  5CBO A;  2K9J B;  5TIS E;  4L73 A;  4H44 D;  3H1L D;  3SWF A;  1KB9 D;  3Q3D A;  2O01 H;  5KAI H;  1T8Z A;  2YKQ A;  4LLH A;  1LT9 A;  3C1L A;  1LT9 B;  1TU3 F;  2OYO A;  4OGQ B;  3BRT B;  1K04 A;  2YKP A;  2POH A;  4UB8 H;  2V7Q H;  1KOR A;  1FZG A;  1FBM A;  1JEK A;  1SQX K;  3W67 A;  4H13 B;  1PP9 G;  2ZYA A;  1K73 Q;  1JY3 N;  4H0L D;  1GMJ A;  3CXH D;  3FGA D;  2QVA A;  1DEB A;  3L71 J;  2KSJ A;  1AVY A;  3EQ2 A;  3QWO C;  1BSH A;  3H1H E;  5AW7 B;  3H1I E;  3KPE A;  5BVZ A;  1URQ A;  2H7H A;  3RGU A;  1VQ5 P;  3Q2Y A;  2KZI A;  3KYQ A;  1NGM B;  1PPJ G;  5C39 A;  1NTM J;  2JWD A;  1KYO D;  2QIW A;  1AJY A;  1DX7 A;  4U3F G;  3L74 E;  2I1J A;  4C46 A;  1FJP A;  1M57 D;  4C7N A;  1HJB A;  2K3R A;  1EZV I;  1SQV D;  4C7N B;  1AV1 A;  5BU8 B;  3EFF K;  3B5N C;  2Y0C A;  4D6T D;  4A7P A;  3TDK A;  4HH2 A;  1WRG A;  1PIX A;  1KFM A;  5KLV J;  2R5D A;  1K9M Q;  1BCC E;  4XFJ A;  1J1D B;  5AVV B;  3CC7 P;  3AED C;  1CI6 A;  3PTZ A;  1KN7 A;  1KTM A;  3V2R A;  1CI6 B;  4JF7 A;  1NU1 G;  1JNM A;  3HD7 D;  2ZVO B;  1NHL A;  3OJA B;  2AEF A;  4OH8 B;  3T97 B;  2YMY A;  3L73 G;  1LP1 B;  4KHX A;  3PHL A;  4RJT A;  1L0L D;  3BAS A;  2IBZ D;  4BWN A;  1IZN B;  3SWY A;  2E76 C;  2IX7 C;  4PD4 H;  1Z56 A;  2BCC E;  3LW5 J;  1OFC X;  3RK2 C;  1MUU A;  4ASV A;  3L37 A;  3S4R A;  2KUB A;  4ZKU A;  1N2D C;  1VF5 D;  3V5B A;  3PLN A;  3BCC J;  3H1K J;  1ZR4 A;  2HOD A;  3B5N A;  1ZR2 A;  3BRV B;  3VMX A;  3B5N B;  4JQ0 D;  1L0L E;  1OVU A;  1FJK A;  1NOH A;  1IFI A;  1YTZ I;  4PJ0 E;  1NH4 A;  3IFM A;  5CJ0 A;  1BE3 G;  2JDI H;  4HJG H;  4PV1 D;  1NTK G;  4GOF A;  3NMD A;  4L75 A;  3A0B E;  1R5S A;  1WT6 A;  1QL1 A;  1AVO A;  1PP9 E;  4LC1 A;  1FE6 A;  3H1L J;  4R4L A;  1VL2 A;  4WY4 D;  1YJN P;  1FZC C;  3L71 G;  2JWA A;  3H6P A;  1CSB A;  3CWB D;  4IFM A;  3WU2 E;  5AW1 B;  2E76 B;  1HH0 A;  2E5T A;  1IFP A;  1S2E A;  4EOT A;  3HUS A;  1HJ0 A;  2XNX A;  4YTP C;  2QM8 A;  1T2K C;  2R44 A;  3CCS P;  3L70 E;  2Q7C A;  2H8P D;  3JSV C;  2B9B A;  2IZ0 A;  1RF1 C;  5APT A;  2KNC A;  3TK1 A;  1LTS C;  4JPZ B;  3P32 A;  2KNC B;  3CWB E;  1GU5 A;  2VRS A;  2GUS A;  3U59 A;  2N1T C;  4GOE A;  5GTI H;  1N7L A;  1SQV K;  1VDF A;  1L0N G;  1JMM A;  2KZJ A;  2HFE D;  5KAF H;  3II6 A;  3CCV P;  1KV4 A;  2ZT9 B;  2HR3 A;  3R2P A;  1JCD A;  2Z5H A;  2Z5I A;  1FZC B;  3V4W A;  2O01 N;  4EIJ A;  3E1I A;  1SQV J;  5APU A;  3LW5 H;  2E43 A;  2P1J A;  3MD0 A;  4D6T J;  3L73 E;  1USD A;  2YO3 A;  2BEZ F;  1M1K Q;  1GL2 A;  1BGY D;  1L0L K;  5CBN A;  3AE5 C;  2JO1 A;  1S5L H;  2FY8 A;  1NTZ D;  2PP6 A;  1N7S C;  3H1J D;  1JB0 J;  2IDB A;  2WQY C;  3CX5 H; 
#chains in the Genus database with same CATH homology
 3WU2 E;  5KAF E;  3A0B E;  4UB8 E;  3A0H E;  1W5C E;  3KZI E;  4IL6 E;  5H2F E;  5B66 E;  5TIS E;  5KAI E;  4PJ0 E;  5GTI E;  4UB6 E;  2AXT E;  1S5L E;  5B5E E;  3JCU E;  5GTH E;  5E79 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...