3WU2H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3wu2H01
5TISH 4UB8H 3KZIH 3A0BH 5GTIH 5KAIH 3WU2H 5KAFH 5E79H 3A0HH 2AXTH 3JCUH 5B66H 5GTHH 4IL6H 1S5LH 4PJ0H 5B5EH 4UB6H 5H2FH
chains in the Genus database with same CATH superfamily
1S1CX 3H1ID 2Q3EA 1A02F 1S4XA 3CLQA 3PLNA 1LTJA 1RF1A 3CI9A 2HYNA 1BCCJ 5KLVE 1AV1A 1LP1B 2Y0CA 1N7SA 3HD7B 3RK2C 4H0LC 5L8RJ 4CPGA 1BE3G 1NU1K 2QJPC 3TDKA 1T6AA 5CBOA 2W6BA 4D6TG 3S1KA 1IFIA 3D6YA 5AW5B 3L73D 3MIWA 2E42A 1KQLA 1NU1E 1LP1A 2BASA 1PP9G 1OWAA 2YMYA 3A2AA 3IN6A 5KLIC 2WITA 1AVYA 1URQB 3EFGA 2B89A 1JTHB 3HD7A 1RF0A 2IBZG 1MFZA 1JY2P 2YIUC 3KQGA 2RN0A 1XTGB 2Q6QA 2FYZA 3GW6A 2POHA 2WWWA 1L4AC 1OMIA 1N2DC 5KAFH 2WSCJ 5CCHA 1LTIC 5GTHH 4WY4A 2D2CB 2QEXP 2M3BA 3V2PA 1FZCB 2JKVA 1BDCA 1WMKA 3B5NC 1NVOA 2QE7H 1SQXG 1SQPJ 1Z56A 2IBZI 3JCUE 1BGYG 2KUBA 3Q5RA 1CI6B 2JEEA 1SVFA 2FYUK 3ZDMA 3MGNA 3N4XA 3L74J 1M57D 2FYUE 3CMAP 3LIDA 3W68A 3EQ2A 4TT3H 5AVXB 3CX5H 3AEBC 2KB7P 1HTLC 1FAVA 2Z4EA 2WSEH 3U59A 1HUCA 1JY3O 1SQPD 3NXSA 1IFNA 2HODA 1WT6A 4L75A 3L37A 4N78E 2QJKB 1KILB 3GHGC 4IL6X 2JWAA 1QL2A 1JUNA 3L75E 3I56P 1YTZT 3H25A 1ZR2A 3L71G 2W27A 2Y0DA 3CC7P 3CX5I 5H2FE 2KK7A 5CCGA 3AE5C 3L72J 2C9NY 1LTTC 3L74D 2H43A 3VYIA 1LT1A 5EFWB 4EIJA 1VQ5P 1NKNA 3AEAC 4DT0A 1N8RQ 3SWYA 3Q2YA 1N86A 2E75C 2IYOA 3CD6P 1IFJA 2WPVB 3V4QA 2NPSD 3CWBJ 1MZ9A 3H1IE 3H1JG 5KAIH 1DEEG 2M5AA 5APTA 1J1DC 4WB4A 3L70J 4OGQB 3CCVP 2W6AA 2P10A 1S5LH 3VP9A 3M0DA 4EYYQ 4Y99C 3L72D 2E76C 1LGHB 1OW7A 1U7JA 2E74B 1W2BO 1YIJP 2NZ2A 1CW5A 1JY3P 1GL2B 3RL0B 2J5UA 2ZXEB 2OYIA 1FC2C 1W5CE 2W8ZA 4U3FD 4PJ0E 5AW2B 1HJBA 2QJYB 3GLMA 1E79H 3H1LD 3L73E 3IF4A 3L70D 3H32A 3RK3D 2XU6A 2ZVNB 2R32A 1T2KD 1GL2A 3C1LA 1M1KQ 2LR2A 4NPEA 4C46A 3A0BH 1RY3A 5KJ7A 5BU8B 1MFTA 1YJNP 5CCHD 2OTJP 4WY4D 3M06A 1NTZJ 5AW7B 5AW6B 3G71P 2PGDA 2Y0EA 1ZRTD 1L0LG 1KC8Q 1N7SC 1GW3A 2IFNA 2G8YA 4PD4H 4MN4C 5AW4B 1KYOH 1M8OB 3H1KJ 1JO5A 1SQVD 4I7ZC 2KP8A 1N73B 1GD2E 2HR3A 1VQ4P 5BVZA 3PHLA 5AW0B 1LTAC 1T3JA 2ZYGA 2ZT9D 3T97B 3JC22 1KYOI 1FZBA 1QEXA 1DH3A 5CJ4A 1NTZD 1SQPK 1KN7A 4RESB 1KV4A 1LTGC 2I8DA 3HD7C 4UB6H 1RF0C 4JF7A 1KB9H 3AEGC 3FXDA 1QVGO 4LC1A 2N9BA 4HKZH 1N73A 1YBKA 5GTIE 1HGVA 1RE4A 3H1KD 1SQPE 3M9BA 3KHUA 1SFCA 5E79H 3A0HH 4N3YB 2BEZF 2P67A 1BE3J 3T97A 1RE3A 4ZKUA 2HFED 4D6TJ 4JYCA 4WY4C 5CCGD 1ZR4A 4BXLA 1KB9I 3N7NA 3TGUG 3M0AA 1URQC 1G2CB 3UIAA 1JM0A 3CCLP 3V6IA 4ASVA 3L74E 2QRXA 1PP9J 4YTPC 4PV1D 4XA4A 1KZUB 4UB6E 3OAKA 1JCDA 2WT7B 1FJPA 2M3EA 1P84I 4ZKPA 3JSVC 1K05A 1VQ8P 3TF5A 5APYA 2D2CC 1G2CA 1OFCX 4D6TD 3O6QB 3MTUE 3QWOC 3BCCG 2ZYAA 3O8ZA 1PPJG 3V5BA 4HH2A 1NH4A 3L72E 1PP9D 3KXDA 3CXHH 1R5LA 2WT7A 5AW8B 1IFPA 1Q7YQ 4XE5B 1SQXJ 1EZVE 1HJ0A 3RBXA 3GF3A 1BGYJ 1DEBA 3Q1MA 4B86A 1G1JA 3SFEC 3CWBE 1NTKG 2J58A 2GM4A 1Q86Q 1L0NG 3U1CA 3L70E 2OYHA 3RK3E 2C9LY 1USDA 2IZ0A 4BRYA 3SSUA 2YMKA 1KMIZ 2H88C 3RL0g 3TNUB 1HF9A 1GW4A 2A06G 2QJKC 3BATA 1KILC 1OVUA 1KQGB 2PRRA 3BVHA 2W83C 1NTMG 3L75D 5KJ7D 2OARA 4H13D 2R3SA 3MHVA 2XNXA 2NPSB 2RKLA 1BGYD 1LTJB 1RF1B 2YO3A 3RGUA 2FFDB 2N1TA 3FXEA 3EWKA 3L71J 2K88A 3M0DC 1ZRTE 3VOPA 2OTLP 5APUA 2YO2A 3CX5D 1JY2O 5AVRB 3TNUA 1YQ3C 4I7ZB 1RQVA 1J2JB 1AVOA 2B87A 1M90Q 3HRNA 3Q5PA 2KZJA 1SQQG 2NPSA 3VTPC 1MV8A 1IJDB 4WWIA 1NTZK 1NO4A 2ZVOB 4OGQC 2FFDA 2YNYA 3GF7A 3H1JJ 4Y28J 1NOHA 3I5CA 1NTZE 5K5GB 2E74C 3L71D 3RK3B 2HLOA 2WPQA 1OXZA 1GL2C 3RL0C 1SFCD 4AQRD 2HPCA 1K8AQ 2K9YA 2OGUA 5B66H 3H1KE 2QJYC 4WBAA 1KORA 1NAFA 4WY4B 1VQOP 1X79B 1BCCD 2H7HA 2ITAA 2QSIA 1E5WA 4EI2A 2JJLA 5AVSB 3OA7A 3M9HA 3BRVB 3AE4C 5DJTB 5APWA 4IFMA 3L36A 2KS1A 1VF5D 1XTCC 5B66E 2L5GB 4YXWH 1X8YA 1BE3E 2ZT9B 1PIXA 4D6TE 3GMAA 3KZIH 3C8VA 1L0LJ 5CHXA 3D70A 1PP9E 4K35A 4I6MC 4L74A 1N73C 3TSIA 3ITKA 2R5DA 1RE4C 2HODB 1GMJA 1SFCC 4HJGH 4IFFA 3KDPB 2ZAEB 1PGJA 1RE3C 4TLFA 1LT9A 3R4YA 5KAFE 2WTYA 1N7LA 2IYPA 3CCUP 2JO1A 1S3JA 5GTHE 2XZRA 4LLHA 1AA0A 2P58A 3F89A 3MD0A 1QVFO 2O3JA 1USEA 3B71A 3TYYA 4PD4D 5APVA 1HH0A 1KYOD 1SQXK 2YKQA 4PV1B 1EC5A 1JCCA 1JOCA 3C9IA 4NPDA 4IL6H 1DD3A 1SQXE 1IZNB 2IZ1A 4W7YA 3FWLA 5TJHA 1GK6A 1FDMA 1PL5A 1ZV8A 2M5AB 3AE8C 2N1TD 1BGYE 2P7JA 1PFIA 1Q2NA 2O1KA 3MZWB 2E43A 3TGUJ 1TU3F 1KB9D 5AW3B 3CX5E 1T3UA 5TISH 2WVRA 4AYCA 2OYIB 4UB8H 2YKPA 3A3YB 2AXTH 1X22A 2B88A 3Q3DA 3IAOA 4L76A 5AVQB 1AJYA 1JMMA 3H32B 4YXDC 2O01H 2RH0A 1ZMEC 3BRTB 3M9QA 1NHLA 2M0BA 4M3LA 3L71E 2LXBA 3BCCJ 1EZVD 4RO0A 3LW5H 2L91A 4W80A 4OH8B 4H13B 4QMAA 3CWBD 4UB8E 2DW3A 4GOFA 1KTMA 2VRSA 5KAIE 3WU2H 5KKZB 2WQYC 1KD1Q 1BCCE 1GTWA 1S5LE 2UWJE 1NTKJ 3H1JE 3MUDA 3P8CD 2G3AA 3S9OA 1L0NJ 3CXHD 3BCCD 3NMDA 4OWFA 1KFNA 1BDDA 3A7OA 4DCKA 1M1JA 4EOTA 2NPSC 3CMEP 1LTJC 1NTMJ 1RF1C 1LWUB 2FFDC 2ZXXA 2MJZA 5CJ0A 3HTKA 2JDIH 4WVZA 4H44D 4ASWA 2R3CA 1VQ7P 1NTKD 3CCJP 1DD4A 1L0ND 1LNQA 2E5YA 3AECC 3AEFC 3P32A 3WUVA 1SFCB 1CSBA 1K73Q 1OW8A 1R8EA 4Z1MH 3E1IA 3U1AA 1FZGA 3OJAB 3A0BE 1LWUA 4L73A 3PH0A 1OX3A 1FOSF 2FKWB 4DZOA 1SQQJ 2QM8A 4IFDK 2FYNB 1AQTA 3RK3C 5AVUB 3HUSA 1L0LK 3P8MC 2CPSA 4PD4E 1T2KC 1KYOE 1UIXA 3H1HG 1L0LE 2MKVA 1IK9A 3VMZA 1FU1A 3B5NA 5CCHC 1P84H 1VF5B 5DJUB 2YKOA 4GODA 4C7NB 1VQPP 1H8AA 1K9MQ 4HB1A 3TK1A 1PGPA 1ZOYC 1KB9E 1SQBG 2JR8A 1YI2P 2KXPB 2BCCG 1FJKA 3D71A 2Q1KA 1H88A 5E79E 4U3FG 3A0HE 1BE3D 2ZT9C 3B4SA 3H1LG 2AEFA 4C7NA 5B5EH 2OYHB 3AE1C 1K04A 4GIFA 1ZLLA 4BRYB 3SWFA 1H0TA 2FXOA 1G1IA 3QH9A 2LXCB 3BASA 3TGUE 2H89C 1VPCA 1QL1A 2IBZD 3HE5A 4GKGA 3SFDC 1D7MA 3P7KA 2P2UA 1AFOA 2QIWA 5CCGC 1EDIA 1VQNP 2N1TB 3G3ZA 4N6JA 3RBZA 1U57A 1QX8A 2AXCA 1FOSE 1OVRA 3WMM0 2R44A 1VQ6P 4PV1C 2V7QH 3P8CE 1SQVG 3CXHE 1VQMP 3R2PA 3BCCE 2GUVA 1SQXD 4O9BA 1PPJE 2B87B 1GZLA 5AVVB 3CC2P 1RHZB 3RK2D 4H0LD 1FBMA 5AW9B 1GK4A 4XFJA 2Y9YA 5KLVG 1RQUA 2WSFJ 1NTKK 4IOIH 3KYQA 2KSJA 1L0NK 2O1JA 1S72P 2Q9IA 1BSNA 1YJ9P 2K9JB 1NTKE 1NWQA 2OYIC 3FX0A 3USSA 2HPCB 1L0NE 2H8PD 3OW2O 1NTMK 1Y9BA 1NGMB 3AEEC 1NU1G 2FXPA 2Q7CA 2A06E 1L4AD 1NTME 1Q81Q 4JQ0D 2O01J 3D6ZA 3WUTA 2Y9ZA 5AW1B 3VN0A 3MUDC 1IO4A 2K9JA 2V4HA 3LW5J 2A45G 5APSA 3B5ND 1KQFB 3VMAA 1M1JC 5KJ7C 4H13C 1JY3N 5M1BA 2KS1B 2OYOA 1FDIA 4K3AA 1SQQK 2FBWC 4R4LA 2A45H 4KJMA 5KKZC 1MKMA 3CL3D 2IPPA 1LJ2A 3H1JD 1SQQE 2WZ7A 3Q5SA 4GT1A 1T8ZA 4H44B 3V2RA 1PV3A 4I1LA 2A45I 2J59M 4BWNA 1VDFA 1YQ4C 2KLUA 1IC2A 5APXA 3JCUH 5CBNA 1LWUC 2W90A 3L35A 1QGKB 2K37A 1J1EB 1LT9B 1KILE 2FYUG 1Y8AA 4YPCA 3II6A 3HUSC 5AVTB 4JBZA 2QG4A 2YXQB 1ZXGA 4JYBA 1URQA 2Z5HA 3AE9C 1JTHA 3LIEA 1SP4A 3H6PA 2GA1A 2M8RA 3L75G 2LKMA 1W2EA 2IBZE 1CZQA 4A7PA 3VP8A 4NPFX 5AVZB 2E75D 2FYNC 1H89A 1VQLP 1FS0E 5H2FH 3SWKA 3AE3C 1DIPA 3KZIE 2WMMA 1L0LD 1S2EA 1FZCA 1PGOA 3F5HA 2E76D 4ZMDA 3H1IG 1VF5C 3H1HJ 4AUWA 2I1JA 5AVYB 2KOGA 1YHQP 3CC4P 1CI6A 1GU4A 2WSFH 2N9YB 1HGZA 1QLED 1JMBA 3WUUA 4OVNF 3E1RA 3PJSK 1SLQA 1IFMA 2WPRA 4EDFA 3K5BA 4DJGA 1OZHA 1ZP0C 1SQBJ 2JWDA 1RH5B 3CCQP 3L73G 2BCCJ 4IL6E 3HE4B 3H1HD 1KQSO 1P84D 1HVVA 2BEQD 2PAJA 1L2PA 4PJ0H 5KTBA 1KILA 4U3FJ 1GU5A 1MUUA 1NJIQ 1BCCG 3H1LJ 2OYHC 1DX7A 1EXIA 3PTZA 3VMYA 1HBWA 2ZFCA 1NAYA 2KLVA 2KYVA 3FGAD 3TGUD 2AEMA 1S5LX 1N7SD 1FZAA 2K3RA 4I2LC 5TISE 1IK7A 3B8EB 1M1JB 3HE4A 1NKZB 1SQBD 3RK2B 3IFMA 2NRGA 4H0LB 2BCCD 2XKMA 2N1TC 2AXTE 2QJPB 1JEKA 2WPSA 5APQA 4JPZB 3HTKB 1BSHA 1X9VA 2V7QJ 5CMZA 1EQ7A 4ZNCA 1JB0J 2O01N 3KPEA 1PPJD 5KLIB 3HD7D 3A5TA 1VQ9P 1SQVJ 1SS1A 1EDKA 3AE2C 3G4SP 2YIUB 2PP6A 1GDTA 1Y47A 2ZYDA 3WU2E 1L4AB 5KLVJ 3HUSB 1VL2A 1KFMA 2WSCH 1S9KD 1SQPG 1URQD 2HG5D 3G6EP 2C0WA 3W67A 2AEJA 2P1JA 1FE6A 1U7MA 2QVAA 1FDOA 2IX7C 3AEDC 3B5NB 5GTIH 4GDOA 2XV5A 2W6JH 4U7JA 2A06D 1ZN5A 3M91A 1NTMD 1L4AA 1NU1J 3L74G 1IFDA 1ZW0A 2D2CD 2OQQA 2OTKE 5KLVD 4PD4I 2KIKA 1M56D 1YJWP 4RJTA 4KT0J 1VQKP 2Q5UA 1LTSC 4W7ZA 2WSSH 2R5BA 2IFMA 1PZQA 1SQQD 2IDBA 1UIIA 3GHGB 1NU1D 3V2NA 3AE7C 2B9BA 3L72G 3CCEP 2FY8A 4H44C 4HYTB 2RMZA 1FZFA 1H0TB 2XNDH 1WRGA 1EZVG 3CPWO 1Q90D 4R4MA 1JY2N 1PGQA 2Z5IA 2XDJA 3S4RA 3CCRP 3HE5B 2I1KA 1J1EC 1LT9C 2KZIA 3CWBG 4DOJA 1KILD 3H1HE 1P84E 3GHGA 3PRJA 2E75B 2QA4P 3NFQA 1EDLA 2E5TA 3L70G 2PFXA 1OW6A 1LTBC 2FYUJ 3ABVC 1A02J 3I55P 1FZCC 2Q3IA 1J1DB 3FWNA 4C7RA 1EZVI 1SQBK 2SPZA 1R5SA 3PP5A 4Y99B 2E76B 1NYHA 1YTZI 1OVVA 2JP3A 1YYCA 3MP7B 1SQBE 3L75J 2BCCE 3E7KA 3G9RA 5B5EE 2ZJSE 1Q82Q 4U3FE 2K1AA 4OGQD 2KNCB 3EFFK 3H1LE 3O6QA 1OIPA 2FYUD 1JNMA 1M7LA 2KSEA 3CXHI 3L4FA 2E74D 5AVWB 4LGDE 3NTNA 3VMXA 2WSEJ 1X0TA 1GL2D 3RL0D 5C39A 4N78D 3H1IJ 1EXJA 2CPBA 1NTZG 2C0XA 3V2QA 1EDJA 2KNCA 3CCMP 2YXRB 5BU5A 4KHXA 3CCSP 1S9KE 3H1KG 1HWTC 3GG2A 1SQVK 1N7SB 1YITP 1FZEA 3V4WA 2GUSA 2QM7A 2FXMA 4GOEA 3IR9A 2CK3H 1SQVE 3AE6C 1AQ5A 2KI7B 4RKUJ 3L73J 5KLVK
chains in the Genus database with same CATH topology
5TISH 4UB8H 3KZIH 3A0BH 5GTIH 5KAIH 3WU2H 5KAFH 5E79H 3A0HH 2AXTH 3JCUH 5B66H 5GTHH 4IL6H 1S5LH 4PJ0H 5B5EH 4UB6H 5H2FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS H;  4UB8 H;  3KZI H;  3A0B H;  5GTI H;  5KAI H;  3WU2 H;  5KAF H;  5E79 H;  3A0H H;  2AXT H;  3JCU H;  5B66 H;  5GTH H;  4IL6 H;  1S5L H;  4PJ0 H;  5B5E H;  4UB6 H;  5H2F H; 
#chains in the Genus database with same CATH topology
 1S1C X;  3H1I D;  2Q3E A;  1A02 F;  1S4X A;  3CLQ A;  3PLN A;  1LTJ A;  1RF1 A;  3CI9 A;  2HYN A;  1BCC J;  5KLV E;  1AV1 A;  1LP1 B;  2Y0C A;  1N7S A;  3HD7 B;  3RK2 C;  4H0L C;  5L8R J;  4CPG A;  1BE3 G;  1NU1 K;  2QJP C;  3TDK A;  1T6A A;  5CBO A;  2W6B A;  4D6T G;  3S1K A;  1IFI A;  3D6Y A;  5AW5 B;  3L73 D;  3MIW A;  2E42 A;  1KQL A;  1NU1 E;  1LP1 A;  2BAS A;  1PP9 G;  1OWA A;  2YMY A;  3A2A A;  3IN6 A;  5KLI C;  2WIT A;  1AVY A;  1URQ B;  3EFG A;  2B89 A;  1JTH B;  3HD7 A;  1RF0 A;  2IBZ G;  1MFZ A;  1JY2 P;  2YIU C;  3KQG A;  2RN0 A;  1XTG B;  2Q6Q A;  2FYZ A;  3GW6 A;  2POH A;  2WWW A;  1L4A C;  1OMI A;  1N2D C;  5KAF H;  2WSC J;  5CCH A;  1LTI C;  5GTH H;  4WY4 A;  2D2C B;  2QEX P;  2M3B A;  3V2P A;  1FZC B;  2JKV A;  1BDC A;  1WMK A;  3B5N C;  1NVO A;  2QE7 H;  1SQX G;  1SQP J;  1Z56 A;  2IBZ I;  3JCU E;  1BGY G;  2KUB A;  3Q5R A;  1CI6 B;  2JEE A;  1SVF A;  2FYU K;  3ZDM A;  3MGN A;  3N4X A;  3L74 J;  1M57 D;  2FYU E;  3CMA P;  3LID A;  3W68 A;  3EQ2 A;  4TT3 H;  5AVX B;  3CX5 H;  3AEB C;  2KB7 P;  1HTL C;  1FAV A;  2Z4E A;  2WSE H;  3U59 A;  1HUC A;  1JY3 O;  1SQP D;  3NXS A;  1IFN A;  2HOD A;  1WT6 A;  4L75 A;  3L37 A;  4N78 E;  2QJK B;  1KIL B;  3GHG C;  4IL6 X;  2JWA A;  1QL2 A;  1JUN A;  3L75 E;  3I56 P;  1YTZ T;  3H25 A;  1ZR2 A;  3L71 G;  2W27 A;  2Y0D A;  3CC7 P;  3CX5 I;  5H2F E;  2KK7 A;  5CCG A;  3AE5 C;  3L72 J;  2C9N Y;  1LTT C;  3L74 D;  2H43 A;  3VYI A;  1LT1 A;  5EFW B;  4EIJ A;  1VQ5 P;  1NKN A;  3AEA C;  4DT0 A;  1N8R Q;  3SWY A;  3Q2Y A;  1N86 A;  2E75 C;  2IYO A;  3CD6 P;  1IFJ A;  2WPV B;  3V4Q A;  2NPS D;  3CWB J;  1MZ9 A;  3H1I E;  3H1J G;  5KAI H;  1DEE G;  2M5A A;  5APT A;  1J1D C;  4WB4 A;  3L70 J;  4OGQ B;  3CCV P;  2W6A A;  2P10 A;  1S5L H;  3VP9 A;  3M0D A;  4EYY Q;  4Y99 C;  3L72 D;  2E76 C;  1LGH B;  1OW7 A;  1U7J A;  2E74 B;  1W2B O;  1YIJ P;  2NZ2 A;  1CW5 A;  1JY3 P;  1GL2 B;  3RL0 B;  2J5U A;  2ZXE B;  2OYI A;  1FC2 C;  1W5C E;  2W8Z A;  4U3F D;  4PJ0 E;  5AW2 B;  1HJB A;  2QJY B;  3GLM A;  1E79 H;  3H1L D;  3L73 E;  3IF4 A;  3L70 D;  3H32 A;  3RK3 D;  2XU6 A;  2ZVN B;  2R32 A;  1T2K D;  1GL2 A;  3C1L A;  1M1K Q;  2LR2 A;  4NPE A;  4C46 A;  3A0B H;  1RY3 A;  5KJ7 A;  5BU8 B;  1MFT A;  1YJN P;  5CCH D;  2OTJ P;  4WY4 D;  3M06 A;  1NTZ J;  5AW7 B;  5AW6 B;  3G71 P;  2PGD A;  2Y0E A;  1ZRT D;  1L0L G;  1KC8 Q;  1N7S C;  1GW3 A;  2IFN A;  2G8Y A;  4PD4 H;  4MN4 C;  5AW4 B;  1KYO H;  1M8O B;  3H1K J;  1JO5 A;  1SQV D;  4I7Z C;  2KP8 A;  1N73 B;  1GD2 E;  2HR3 A;  1VQ4 P;  5BVZ A;  3PHL A;  5AW0 B;  1LTA C;  1T3J A;  2ZYG A;  2ZT9 D;  3T97 B;  3JC2 2;  1KYO I;  1FZB A;  1QEX A;  1DH3 A;  5CJ4 A;  1NTZ D;  1SQP K;  1KN7 A;  4RES B;  1KV4 A;  1LTG C;  2I8D A;  3HD7 C;  4UB6 H;  1RF0 C;  4JF7 A;  1KB9 H;  3AEG C;  3FXD A;  1QVG O;  4LC1 A;  2N9B A;  4HKZ H;  1N73 A;  1YBK A;  5GTI E;  1HGV A;  1RE4 A;  3H1K D;  1SQP E;  3M9B A;  3KHU A;  1SFC A;  5E79 H;  3A0H H;  4N3Y B;  2BEZ F;  2P67 A;  1BE3 J;  3T97 A;  1RE3 A;  4ZKU A;  2HFE D;  4D6T J;  4JYC A;  4WY4 C;  5CCG D;  1ZR4 A;  4BXL A;  1KB9 I;  3N7N A;  3TGU G;  3M0A A;  1URQ C;  1G2C B;  3UIA A;  1JM0 A;  3CCL P;  3V6I A;  4ASV A;  3L74 E;  2QRX A;  1PP9 J;  4YTP C;  4PV1 D;  4XA4 A;  1KZU B;  4UB6 E;  3OAK A;  1JCD A;  2WT7 B;  1FJP A;  2M3E A;  1P84 I;  4ZKP A;  3JSV C;  1K05 A;  1VQ8 P;  3TF5 A;  5APY A;  2D2C C;  1G2C A;  1OFC X;  4D6T D;  3O6Q B;  3MTU E;  3QWO C;  3BCC G;  2ZYA A;  3O8Z A;  1PPJ G;  3V5B A;  4HH2 A;  1NH4 A;  3L72 E;  1PP9 D;  3KXD A;  3CXH H;  1R5L A;  2WT7 A;  5AW8 B;  1IFP A;  1Q7Y Q;  4XE5 B;  1SQX J;  1EZV E;  1HJ0 A;  3RBX A;  3GF3 A;  1BGY J;  1DEB A;  3Q1M A;  4B86 A;  1G1J A;  3SFE C;  3CWB E;  1NTK G;  2J58 A;  2GM4 A;  1Q86 Q;  1L0N G;  3U1C A;  3L70 E;  2OYH A;  3RK3 E;  2C9L Y;  1USD A;  2IZ0 A;  4BRY A;  3SSU A;  2YMK A;  1KMI Z;  2H88 C;  3RL0 g;  3TNU B;  1HF9 A;  1GW4 A;  2A06 G;  2QJK C;  3BAT A;  1KIL C;  1OVU A;  1KQG B;  2PRR A;  3BVH A;  2W83 C;  1NTM G;  3L75 D;  5KJ7 D;  2OAR A;  4H13 D;  2R3S A;  3MHV A;  2XNX A;  2NPS B;  2RKL A;  1BGY D;  1LTJ B;  1RF1 B;  2YO3 A;  3RGU A;  2FFD B;  2N1T A;  3FXE A;  3EWK A;  3L71 J;  2K88 A;  3M0D C;  1ZRT E;  3VOP A;  2OTL P;  5APU A;  2YO2 A;  3CX5 D;  1JY2 O;  5AVR B;  3TNU A;  1YQ3 C;  4I7Z B;  1RQV A;  1J2J B;  1AVO A;  2B87 A;  1M90 Q;  3HRN A;  3Q5P A;  2KZJ A;  1SQQ G;  2NPS A;  3VTP C;  1MV8 A;  1IJD B;  4WWI A;  1NTZ K;  1NO4 A;  2ZVO B;  4OGQ C;  2FFD A;  2YNY A;  3GF7 A;  3H1J J;  4Y28 J;  1NOH A;  3I5C A;  1NTZ E;  5K5G B;  2E74 C;  3L71 D;  3RK3 B;  2HLO A;  2WPQ A;  1OXZ A;  1GL2 C;  3RL0 C;  1SFC D;  4AQR D;  2HPC A;  1K8A Q;  2K9Y A;  2OGU A;  5B66 H;  3H1K E;  2QJY C;  4WBA A;  1KOR A;  1NAF A;  4WY4 B;  1VQO P;  1X79 B;  1BCC D;  2H7H A;  2ITA A;  2QSI A;  1E5W A;  4EI2 A;  2JJL A;  5AVS B;  3OA7 A;  3M9H A;  3BRV B;  3AE4 C;  5DJT B;  5APW A;  4IFM A;  3L36 A;  2KS1 A;  1VF5 D;  1XTC C;  5B66 E;  2L5G B;  4YXW H;  1X8Y A;  1BE3 E;  2ZT9 B;  1PIX A;  4D6T E;  3GMA A;  3KZI H;  3C8V A;  1L0L J;  5CHX A;  3D70 A;  1PP9 E;  4K35 A;  4I6M C;  4L74 A;  1N73 C;  3TSI A;  3ITK A;  2R5D A;  1RE4 C;  2HOD B;  1GMJ A;  1SFC C;  4HJG H;  4IFF A;  3KDP B;  2ZAE B;  1PGJ A;  1RE3 C;  4TLF A;  1LT9 A;  3R4Y A;  5KAF E;  2WTY A;  1N7L A;  2IYP A;  3CCU P;  2JO1 A;  1S3J A;  5GTH E;  2XZR A;  4LLH A;  1AA0 A;  2P58 A;  3F89 A;  3MD0 A;  1QVF O;  2O3J A;  1USE A;  3B71 A;  3TYY A;  4PD4 D;  5APV A;  1HH0 A;  1KYO D;  1SQX K;  2YKQ A;  4PV1 B;  1EC5 A;  1JCC A;  1JOC A;  3C9I A;  4NPD A;  4IL6 H;  1DD3 A;  1SQX E;  1IZN B;  2IZ1 A;  4W7Y A;  3FWL A;  5TJH A;  1GK6 A;  1FDM A;  1PL5 A;  1ZV8 A;  2M5A B;  3AE8 C;  2N1T D;  1BGY E;  2P7J A;  1PFI A;  1Q2N A;  2O1K A;  3MZW B;  2E43 A;  3TGU J;  1TU3 F;  1KB9 D;  5AW3 B;  3CX5 E;  1T3U A;  5TIS H;  2WVR A;  4AYC A;  2OYI B;  4UB8 H;  2YKP A;  3A3Y B;  2AXT H;  1X22 A;  2B88 A;  3Q3D A;  3IAO A;  4L76 A;  5AVQ B;  1AJY A;  1JMM A;  3H32 B;  4YXD C;  2O01 H;  2RH0 A;  1ZME C;  3BRT B;  3M9Q A;  1NHL A;  2M0B A;  4M3L A;  3L71 E;  2LXB A;  3BCC J;  1EZV D;  4RO0 A;  3LW5 H;  2L91 A;  4W80 A;  4OH8 B;  4H13 B;  4QMA A;  3CWB D;  4UB8 E;  2DW3 A;  4GOF A;  1KTM A;  2VRS A;  5KAI E;  3WU2 H;  5KKZ B;  2WQY C;  1KD1 Q;  1BCC E;  1GTW A;  1S5L E;  2UWJ E;  1NTK J;  3H1J E;  3MUD A;  3P8C D;  2G3A A;  3S9O A;  1L0N J;  3CXH D;  3BCC D;  3NMD A;  4OWF A;  1KFN A;  1BDD A;  3A7O A;  4DCK A;  1M1J A;  4EOT A;  2NPS C;  3CME P;  1LTJ C;  1NTM J;  1RF1 C;  1LWU B;  2FFD C;  2ZXX A;  2MJZ A;  5CJ0 A;  3HTK A;  2JDI H;  4WVZ A;  4H44 D;  4ASW A;  2R3C A;  1VQ7 P;  1NTK D;  3CCJ P;  1DD4 A;  1L0N D;  1LNQ A;  2E5Y A;  3AEC C;  3AEF C;  3P32 A;  3WUV A;  1SFC B;  1CSB A;  1K73 Q;  1OW8 A;  1R8E A;  4Z1M H;  3E1I A;  3U1A A;  1FZG A;  3OJA B;  3A0B E;  1LWU A;  4L73 A;  3PH0 A;  1OX3 A;  1FOS F;  2FKW B;  4DZO A;  1SQQ J;  2QM8 A;  4IFD K;  2FYN B;  1AQT A;  3RK3 C;  5AVU B;  3HUS A;  1L0L K;  3P8M C;  2CPS A;  4PD4 E;  1T2K C;  1KYO E;  1UIX A;  3H1H G;  1L0L E;  2MKV A;  1IK9 A;  3VMZ A;  1FU1 A;  3B5N A;  5CCH C;  1P84 H;  1VF5 B;  5DJU B;  2YKO A;  4GOD A;  4C7N B;  1VQP P;  1H8A A;  1K9M Q;  4HB1 A;  3TK1 A;  1PGP A;  1ZOY C;  1KB9 E;  1SQB G;  2JR8 A;  1YI2 P;  2KXP B;  2BCC G;  1FJK A;  3D71 A;  2Q1K A;  1H88 A;  5E79 E;  4U3F G;  3A0H E;  1BE3 D;  2ZT9 C;  3B4S A;  3H1L G;  2AEF A;  4C7N A;  5B5E H;  2OYH B;  3AE1 C;  1K04 A;  4GIF A;  1ZLL A;  4BRY B;  3SWF A;  1H0T A;  2FXO A;  1G1I A;  3QH9 A;  2LXC B;  3BAS A;  3TGU E;  2H89 C;  1VPC A;  1QL1 A;  2IBZ D;  3HE5 A;  4GKG A;  3SFD C;  1D7M A;  3P7K A;  2P2U A;  1AFO A;  2QIW A;  5CCG C;  1EDI A;  1VQN P;  2N1T B;  3G3Z A;  4N6J A;  3RBZ A;  1U57 A;  1QX8 A;  2AXC A;  1FOS E;  1OVR A;  3WMM 0;  2R44 A;  1VQ6 P;  4PV1 C;  2V7Q H;  3P8C E;  1SQV G;  3CXH E;  1VQM P;  3R2P A;  3BCC E;  2GUV A;  1SQX D;  4O9B A;  1PPJ E;  2B87 B;  1GZL A;  5AVV B;  3CC2 P;  1RHZ B;  3RK2 D;  4H0L D;  1FBM A;  5AW9 B;  1GK4 A;  4XFJ A;  2Y9Y A;  5KLV G;  1RQU A;  2WSF J;  1NTK K;  4IOI H;  3KYQ A;  2KSJ A;  1L0N K;  2O1J A;  1S72 P;  2Q9I A;  1BSN A;  1YJ9 P;  2K9J B;  1NTK E;  1NWQ A;  2OYI C;  3FX0 A;  3USS A;  2HPC B;  1L0N E;  2H8P D;  3OW2 O;  1NTM K;  1Y9B A;  1NGM B;  3AEE C;  1NU1 G;  2FXP A;  2Q7C A;  2A06 E;  1L4A D;  1NTM E;  1Q81 Q;  4JQ0 D;  2O01 J;  3D6Z A;  3WUT A;  2Y9Z A;  5AW1 B;  3VN0 A;  3MUD C;  1IO4 A;  2K9J A;  2V4H A;  3LW5 J;  2A45 G;  5APS A;  3B5N D;  1KQF B;  3VMA A;  1M1J C;  5KJ7 C;  4H13 C;  1JY3 N;  5M1B A;  2KS1 B;  2OYO A;  1FDI A;  4K3A A;  1SQQ K;  2FBW C;  4R4L A;  2A45 H;  4KJM A;  5KKZ C;  1MKM A;  3CL3 D;  2IPP A;  1LJ2 A;  3H1J D;  1SQQ E;  2WZ7 A;  3Q5S A;  4GT1 A;  1T8Z A;  4H44 B;  3V2R A;  1PV3 A;  4I1L A;  2A45 I;  2J59 M;  4BWN A;  1VDF A;  1YQ4 C;  2KLU A;  1IC2 A;  5APX A;  3JCU H;  5CBN A;  1LWU C;  2W90 A;  3L35 A;  1QGK B;  2K37 A;  1J1E B;  1LT9 B;  1KIL E;  2FYU G;  1Y8A A;  4YPC A;  3II6 A;  3HUS C;  5AVT B;  4JBZ A;  2QG4 A;  2YXQ B;  1ZXG A;  4JYB A;  1URQ A;  2Z5H A;  3AE9 C;  1JTH A;  3LIE A;  1SP4 A;  3H6P A;  2GA1 A;  2M8R A;  3L75 G;  2LKM A;  1W2E A;  2IBZ E;  1CZQ A;  4A7P A;  3VP8 A;  4NPF X;  5AVZ B;  2E75 D;  2FYN C;  1H89 A;  1VQL P;  1FS0 E;  5H2F H;  3SWK A;  3AE3 C;  1DIP A;  3KZI E;  2WMM A;  1L0L D;  1S2E A;  1FZC A;  1PGO A;  3F5H A;  2E76 D;  4ZMD A;  3H1I G;  1VF5 C;  3H1H J;  4AUW A;  2I1J A;  5AVY B;  2KOG A;  1YHQ P;  3CC4 P;  1CI6 A;  1GU4 A;  2WSF H;  2N9Y B;  1HGZ A;  1QLE D;  1JMB A;  3WUU A;  4OVN F;  3E1R A;  3PJS K;  1SLQ A;  1IFM A;  2WPR A;  4EDF A;  3K5B A;  4DJG A;  1OZH A;  1ZP0 C;  1SQB J;  2JWD A;  1RH5 B;  3CCQ P;  3L73 G;  2BCC J;  4IL6 E;  3HE4 B;  3H1H D;  1KQS O;  1P84 D;  1HVV A;  2BEQ D;  2PAJ A;  1L2P A;  4PJ0 H;  5KTB A;  1KIL A;  4U3F J;  1GU5 A;  1MUU A;  1NJI Q;  1BCC G;  3H1L J;  2OYH C;  1DX7 A;  1EXI A;  3PTZ A;  3VMY A;  1HBW A;  2ZFC A;  1NAY A;  2KLV A;  2KYV A;  3FGA D;  3TGU D;  2AEM A;  1S5L X;  1N7S D;  1FZA A;  2K3R A;  4I2L C;  5TIS E;  1IK7 A;  3B8E B;  1M1J B;  3HE4 A;  1NKZ B;  1SQB D;  3RK2 B;  3IFM A;  2NRG A;  4H0L B;  2BCC D;  2XKM A;  2N1T C;  2AXT E;  2QJP B;  1JEK A;  2WPS A;  5APQ A;  4JPZ B;  3HTK B;  1BSH A;  1X9V A;  2V7Q J;  5CMZ A;  1EQ7 A;  4ZNC A;  1JB0 J;  2O01 N;  3KPE A;  1PPJ D;  5KLI B;  3HD7 D;  3A5T A;  1VQ9 P;  1SQV J;  1SS1 A;  1EDK A;  3AE2 C;  3G4S P;  2YIU B;  2PP6 A;  1GDT A;  1Y47 A;  2ZYD A;  3WU2 E;  1L4A B;  5KLV J;  3HUS B;  1VL2 A;  1KFM A;  2WSC H;  1S9K D;  1SQP G;  1URQ D;  2HG5 D;  3G6E P;  2C0W A;  3W67 A;  2AEJ A;  2P1J A;  1FE6 A;  1U7M A;  2QVA A;  1FDO A;  2IX7 C;  3AED C;  3B5N B;  5GTI H;  4GDO A;  2XV5 A;  2W6J H;  4U7J A;  2A06 D;  1ZN5 A;  3M91 A;  1NTM D;  1L4A A;  1NU1 J;  3L74 G;  1IFD A;  1ZW0 A;  2D2C D;  2OQQ A;  2OTK E;  5KLV D;  4PD4 I;  2KIK A;  1M56 D;  1YJW P;  4RJT A;  4KT0 J;  1VQK P;  2Q5U A;  1LTS C;  4W7Z A;  2WSS H;  2R5B A;  2IFM A;  1PZQ A;  1SQQ D;  2IDB A;  1UII A;  3GHG B;  1NU1 D;  3V2N A;  3AE7 C;  2B9B A;  3L72 G;  3CCE P;  2FY8 A;  4H44 C;  4HYT B;  2RMZ A;  1FZF A;  1H0T B;  2XND H;  1WRG A;  1EZV G;  3CPW O;  1Q90 D;  4R4M A;  1JY2 N;  1PGQ A;  2Z5I A;  2XDJ A;  3S4R A;  3CCR P;  3HE5 B;  2I1K A;  1J1E C;  1LT9 C;  2KZI A;  3CWB G;  4DOJ A;  1KIL D;  3H1H E;  1P84 E;  3GHG A;  3PRJ A;  2E75 B;  2QA4 P;  3NFQ A;  1EDL A;  2E5T A;  3L70 G;  2PFX A;  1OW6 A;  1LTB C;  2FYU J;  3ABV C;  1A02 J;  3I55 P;  1FZC C;  2Q3I A;  1J1D B;  3FWN A;  4C7R A;  1EZV I;  1SQB K;  2SPZ A;  1R5S A;  3PP5 A;  4Y99 B;  2E76 B;  1NYH A;  1YTZ I;  1OVV A;  2JP3 A;  1YYC A;  3MP7 B;  1SQB E;  3L75 J;  2BCC E;  3E7K A;  3G9R A;  5B5E E;  2ZJS E;  1Q82 Q;  4U3F E;  2K1A A;  4OGQ D;  2KNC B;  3EFF K;  3H1L E;  3O6Q A;  1OIP A;  2FYU D;  1JNM A;  1M7L A;  2KSE A;  3CXH I;  3L4F A;  2E74 D;  5AVW B;  4LGD E;  3NTN A;  3VMX A;  2WSE J;  1X0T A;  1GL2 D;  3RL0 D;  5C39 A;  4N78 D;  3H1I J;  1EXJ A;  2CPB A;  1NTZ G;  2C0X A;  3V2Q A;  1EDJ A;  2KNC A;  3CCM P;  2YXR B;  5BU5 A;  4KHX A;  3CCS P;  1S9K E;  3H1K G;  1HWT C;  3GG2 A;  1SQV K;  1N7S B;  1YIT P;  1FZE A;  3V4W A;  2GUS A;  2QM7 A;  2FXM A;  4GOE A;  3IR9 A;  2CK3 H;  1SQV E;  3AE6 C;  1AQ5 A;  2KI7 B;  4RKU J;  3L73 J;  5KLV K; 
#chains in the Genus database with same CATH homology
 5TIS H;  4UB8 H;  3KZI H;  3A0B H;  5GTI H;  5KAI H;  3WU2 H;  5KAF H;  5E79 H;  3A0H H;  2AXT H;  3JCU H;  5B66 H;  5GTH H;  4IL6 H;  1S5L H;  4PJ0 H;  5B5E H;  4UB6 H;  5H2F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...