4UB6H

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
total genus 13
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4ub6H01
5E79H 2AXTH 4PJ0H 5B5EH 3A0HH 5TISH 1S5LH 3A0BH 3KZIH 5KAIH 4UB8H 5H2FH 3WU2H 5GTIH 3JCUH 5GTHH 5B66H 4UB6H 5KAFH 4IL6H
chains in the Genus database with same CATH superfamily
2J58A 3MUDA 2QEXP 2ZXEB 3AE2C 1ZR4A 1HH0A 3I55P 2M3EA 1IFMA 4H44B 1WT6A 1K73Q 2OYHB 3CWBE 3M0DA 1LTIC 1AQ5A 3W68A 3TYYA 1MV8A 4WVZA 3U1CA 2BCCG 1JTHA 3O8ZA 1GL2C 1KB9I 1FZBA 3AECC 3E1RA 1EDIA 2K9YA 3HTKB 2FYUJ 2KXPB 1VDFA 1MFTA 3L75J 1KQGB 3KXDA 1AV1A 2K3RA 1LWUA 1NU1E 3CCJP 4ZMDA 4D6TE 2KOGA 1JNMA 1ZMEC 1NTZK 3SWYA 5CBNA 2Y9ZA 3L72D 1YHQP 2HYNA 1FE6A 2B88A 1SP4A 2I8DA 1U7JA 1S5LX 1BGYE 1X22A 2KUBA 1BSNA 4IFDK 2E76C 3O6QB 3L4FA 4C7NB 5CCHA 2HODA 1LTJA 1SQBJ 3L35A 3BRTB 5AVYB 1RF1B 3VYIA 4AQRD 4I2LC 1U57A 1NTKK 4H13D 1LGHB 3Q2YA 4EI2A 1NTZG 1ZW0A 4HYTB 4R4MA 4L76A 3M0DC 4H0LD 1JOCA 2KZJA 1IFJA 4OWFA 3L74G 4KJMA 4WY4D 2A45I 3GF3A 2LR2A 1P84E 2XV5A 1NTMJ 2M8RA 1NAFA 1NTKG 1SQPD 4NPFX 5AW0B 2AXTE 3HD7A 1R5LA 1LWUC 3HUSA 1YQ4C 1JM0A 1M1KQ 2WPRA 1RH5B 1RQVA 3A2AA 1LT9A 1E79H 5AVQB 2WTYA 1BE3D 5B5EE 3H1HJ 1KORA 1YIJP 3PP5A 3VOPA 3VP8A 1KFNA 4PJ0H 1XTCC 5AW6B 1LTJC 4KHXA 4JF7A 2E74D 4IFFA 1SS1A 2E75D 4PJ0E 1PP9G 2V7QJ 5CHXA 1YJNP 1L0LE 1WRGA 5AVWB 1BDDA 3B5ND 1JEKA 5K5GB 1OW7A 3GMAA 3HE5B 4RO0A 2P67A 2FYUK 3CXHH 2OYHA 5H2FE 2OTLP 2JDIH 2N1TD 2WSCJ 1L0NE 4ASWA 1ZLLA 4D6TD 3A0HE 3L72J 2QJPB 2O01H 3AE3C 1Z56A 5KKZC 1KYOH 1GU5A 4MN4C 3SFEC 3D70A 2AEMA 3JCUE 2WPVB 1T2KD 1DD3A 4BRYB 1KYOE 2K9JB 1KILB 2ITAA 3HD7C 3HTKA 2L91A 1L4AB 3HUSC 3BCCJ 3V2PA 4YXDC 1SQQJ 2FYUG 3GW6A 2YMYA 1LT9C 2IFNA 1N7SB 1NHLA 1URQB 2R44A 1SQXJ 1S5LH 4DZOA 1EZVD 2W6JH 3L70E 1Q90D 2KK7A 1HTLC 4M3LA 4A7PA 3KQGA 1HUCA 3MTUE 1VQ4P 4I1LA 3O6QA 4EOTA 5KAFE 4C7NA 1XTGB 1QX8A 3CCSP 4U3FJ 5KLIB 2JWDA 3KZIH 1RF1A 1GL2D 1J1EC 3C1LA 1PPJD 5CCGC 5APYA 1VQPP 3KZIE 2OYHC 1JUNA 2W27A 2BEZF 2PAJA 2R32A 2RH0A 4OGQC 4PD4E 2ZJSE 5TISH 3KYQA 1BE3J 1VQKP 3CMAP 1DH3A 3CWBJ 3M06A 1QL1A 1KB9H 5CJ0A 4EDFA 1GW4A 2K1AA 2ZAEB 3FGAD 2N9BA 4RESB 3IN6A 5AVUB 1EZVI 3H25A 1JCCA 3H1JE 3U1AA 4WB4A 2J59M 3Q3DA 1MUUA 3V5BA 3WU2H 1SFCB 2E76D 5CBOA 5APTA 1HBWA 2BEQD 2P7JA 1LJ2A 4N78D 1N73B 3CD6P 1CSBA 3S1KA 5APSA 2HG5D 1FZCB 2IYOA 3CX5H 3CL3D 3H1LE 3PHLA 3T97B 1YTZT 3L71E 3B71A 2KYVA 1L0ND 4D6TJ 2WVRA 1DEBA 1R8EA 1HWTC 1S2EA 1AQTA 2Y0EA 1SQVE 1FDMA 2OTKE 2QJYB 2V4HA 3L73E 1RF1C 1BGYJ 2FYZA 2YIUB 2WT7B 1QL2A 3MD0A 1T6AA 4IL6X 3HE5A 3QH9A 3Q5RA 3Q5PA 4HH2A 1YJ9P 3L75D 2SPZA 2A45G 4XA4A 3AEGC 2KSJA 2Q9IA 2QVAA 2A45H 1PGQA 3RK2B 2LKMA 2JWAA 4R4LA 4HB1A 1LTTC 1J1DB 4DT0A 3H1KE 3H1IE 3PRJA 1OVUA 5B66E 2WSFH 1OMIA 4XE5B 4GOEA 3H32B 2K9JA 1KILA 2PRRA 3CCRP 3AE5C 4UB6H 1L4AA 4BWNA 2P58A 3ZDMA 1N7SA 1SQPK 4UB6E 3TGUG 5KLVE 1URQA 2Y0DA 5AVXB 5APWA 2KLVA 3VMXA 5APUA 3CCLP 2YKOA 1YQ3C 1IFPA 3L37A 3TNUB 2WQYC 3VMYA 4NPDA 3N4XA 2H7HA 2IBZD 5DJUB 2FKWB 4Y28J 1H0TB 1NTMD 1SQPG 3CCUP 1FU1A 2OARA 3HD7D 1L0LJ 2W6BA 1X0TA 1NO4A 1YI2P 4IOIH 3F5HA 5BVZA 1HJ0A 2QJPC 2KNCB 3IAOA 1BE3G 1FBMA 1ZRTE 3RGUA 1GTWA 1OW8A 1L0NJ 3ABVC 3H1HD 4AUWA 3L71D 4OH8B 2ZYAA 2AEJA 3WMM0 1DD4A 3RL0g 1L4AC 1SFCA 2XNDH 2R5DA 3HE4B 1G1IA 3L73D 3CCQP 2ZT9C 1N7SC 1N73A 1KZUB 1URQC 1VF5B 1VL2A 2IBZI 4N3YB 1DEEG 1JB0J 1QLED 2BCCE 2NPSC 5AVSB 3WUUA 1T8ZA 5CCGD 2ZVNB 2OTJP 2QJKB 3T97A 2IYPA 3I5CA 4OGQD 1U7MA 3BVHA 5DJTB 5L8RJ 2Q3IA 2ZVOB 2XU6A 1D7MA 4H13B 1M1JB 3H1ID 1J2JB 3A0BH 3MUDC 4IL6H 4U7JA 1A02F 1BDCA 2I1KA 1X9VA 4N6JA 4JYBA 1KD1Q 3MP7B 3BCCD 2LXCB 4WY4B 1SQQD 3CCEP 1K9MQ 3LW5J 2PP6A 5EFWB 1T3UA 1SQXD 1EZVG 3V2QA 2Z4EA 3VMZA 1RQUA 3QWOC 4GODA 2C0WA 2IX7C 2QE7H 3V2RA 2IZ1A 1SFCC 2A06D 1KILE 1M8OB 2C9LY 3M9QA 3AE8C 1EDKA 3L74E 3PTZA 3PLNA 1N73C 1PGPA 1RE3A 2WSEJ 1IFIA 4U3FD 3H1JJ 1PPJG 1NKZB 2OGUA 1IZNB 2CK3H 1GU4A 4DCKA 3SSUA 2QSIA 1NTKE 3P8MC 3AEDC 2QRXA 2JP3A 2E74B 4W80A 4W7ZA 2WZ7A 2QIWA 3C8VA 2E75B 2Z5HA 2CPBA 1PGJA 1N7LA 3CWBD 3H1LJ 1KQFB 5APVA 3L71J 1VQNP 1AVOA 3G9RA 1FJPA 2JEEA 1KFMA 2YNYA 1H0TA 1OIPA 2OYIA 5CCHC 1SQVJ 3D6YA 4GIFA 2N1TB 1USDA 3L73J 1OX3A 5AW9B 1JY2O 4PV1B 1Y9BA 1KV4A 1Y47A 3RK2C 5AW5B 3V4WA 2KNCA 2YO2A 1IK7A 2E5TA 1J1DC 3B8EB 1PP9E 3WUTA 5CMZA 4B86A 2FYNB 1NU1D 1L0NG 3CXHE 3KPEA 1S3JA 4WBAA 2C0XA 4LLHA 2GUVA 3H1KJ 3H1IJ 4YTPC 3HE4A 1RE3C 2WMMA 1JY3P 3BRVB 2WWWA 1BGYD 1PGOA 1HJBA 2W8ZA 1N8RQ 1M56D 2JR8A 1SQBK 1MZ9A 4C46A 3L75G 3P32A 2BASA 5KLVJ 3AEAC 2OQQA 3P8CE 1FDOA 1KTMA 4JQ0D 4DJGA 3Q1MA 1HGVA 3RL0C 3TSIA 4XFJA 1EXJA 1DIPA 1S5LE 1M1JA 2G8YA 2OYIC 1AJYA 1EXIA 2W83C 2ZFCA 2B9BA 3CC4P 1LNQA 1SVFA 3AE9C 1P84D 1OZHA 1KC8Q 1L4AD 4H44C 1SQBG 1NTMK 1VPCA 2Q1KA 5E79H 2G3AA 2ZT9D 1IO4A 1N7SD 1URQD 2HFED 5AW3B 1HGZA 2NPSD 5E79E 5AVTB 3CMEP 2WPSA 1ZP0C 4IFMA 1KN7A 2KP8A 2XKMA 5AW2B 1ZXGA 2QM7A 5TISE 2E76B 3G71P 2L5GB 4O9BA 3FXEA 1ZR2A 1JY2P 2ZYDA 1S9KE 2IBZG 1VQ9P 5AW8B 3E1IA 4I7ZB 1KB9E 1IK9A 1VF5C 1S72P 1NTMG 3IFMA 2HR3A 2PFXA 5GTHH 4Y99B 1BCCE 1QVFO 2QJKC 2W6AA 2HPCB 1K05A 3WU2E 2XNXA 3G3ZA 2P1JA 3MIWA 1VQ7P 1L0LD 3JSVC 2BCCJ 3RK3B 3R4YA 1P84I 1LTAC 2UWJE 1E5WA 2XDJA 2Y0CA 3AE1C 3SWFA 1G1JA 4RJTA 1NU1J 1M1JC 1Q82Q 3H1HG 3M0AA 3CCVP 3CX5E 1LTSC 2P2UA 4QMAA 3A3YB 5C39A 4Z1MH 4YXWH 1LWUB 5KAIH 1QEXA 2QM8A 3C9IA 4HJGH 3CLQA 2KS1B 3VMAA 1JMBA 5KAIE 1KYOD 3MZWB 2B89A 2V7QH 2Q6QA 2YKQA 2KB7P 1SQQK 3UIAA 5AVZB 1KMIZ 5AW4B 2H88C 3MHVA 1FZFA 2R3SA 1MKMA 3P8CD 1JO5A 1SQXK 2HODB 2WSCH 4L75A 3L72G 1S1CX 1N86A 3NFQA 3L70D 4CPGA 5TJHA 3G6EP 3S9OA 1M90Q 1CW5A 3D71A 2IPPA 3R2PA 4BRYA 3PJSK 1OW6A 5CCHD 3L74J 3BCCG 3I56P 1SQQG 3TDKA 3CPWO 2D2CB 3OAKA 4K3AA 1KQSO 1SQXG 3RK2D 3AE4C 5KKZB 4PD4D 1GMJA 1OVRA 3P7KA 1KYOI 2E5YA 3TGUE 1NGMB 5BU5A 1FDIA 2IZ0A 4EYYQ 2A06G 1AA0A 2YXQB 1GK6A 3HUSB 1LTBC 4UB8H 2FBWC 1LP1B 4PV1C 1LT9B 4GDOA 1RF0A 2FXOA 1GD2E 2NRGA 4U3FG 2WITA 4NPEA 4LGDE 3GHGB 3H1JD 1IFDA 1EDJA 1PV3A 1Q7YQ 3V2NA 1BCCD 2JJLA 2FYNC 2H43A 1CI6B 1NWQA 1SLQA 1SQPE 2MKVA 3CC2P 5KJ7A 1NYHA 2Q7CA 2NZ2A 2GA1A 2Z5IA 1W5CE 1PP9J 4JYCA 3CWBG 3H1LD 1NU1K 1J1EB 4BXLA 3RL0D 2OYOA 3CX5D 1KILC 1BE3E 3CCMP 4PD4I 1SQVD 3G4SP 2FFDB 4OGQB 2FXMA 1IFNA 2O01J 1Q86Q 3IF4A 1QGKB 2HPCA 3OA7A 4GT1A 3S4RA 4H44D 1FJKA 3VP9A 1VQ5P 1FZCA 2MJZA 2POHA 1VQ8P 4I6MC 1NU1G 2FY8A 1HVVA 1FS0E 2KLUA 4D6TG 2M5AB 1MFZA 3L70J 1Y8AA 1LTGC 1ZN5A 5KLIC 1RF0C 3H1KD 1TU3F 1JY3N 2O1KA 2YMKA 1FOSF 5APXA 1BGYG 1OWAA 2O3JA 1LT1A 2WT7A 1VF5D 2KS1A 4H0LB 2J5UA 1RE4A 3A0BE 4IL6E 3BATA 3RBXA 1NAYA 3CX5I 2AEFA 1Q81Q 3M91A 3SWKA 1Q2NA 5KJ7C 4C7RA 1JY3O 5KLVD 3LIDA 4LC1A 2LXBA 5AW7B 4I7ZC 1YYCA 1NOHA 3TGUD 1W2EA 3M9BA 3VTPC 1NTZE 2C9NY 3H6PA 1M7LA 3H32A 3HRNA 1EZVE 4Y99C 3EWKA 3CC7P 1NH4A 1P84H 3RK3C 3SFDC 1FZCC 5GTIH 2E42A 2KIKA 1BCCJ 3FWLA 2PGDA 3TK1A 1H88A 1PIXA 2ZYGA 2AXTH 1PL5A 2XZRA 5GTIE 1L0LK 1NJIQ 1PPJE 3TNUA 1GK4A 3Q5SA 1ZV8A 2QJYC 1GW3A 1ZRTD 3FXDA 1JY2N 1L0NK 3B5NB 1LP1A 3D6ZA 2YIUC 5B5EH 2YO3A 1RE4C 4TT3H 4AYCA 3GHGA 1FAVA 3USSA 1JCDA 3V4QA 3NXSA 1CI6A 1GDTA 4ZKPA 1L0LG 1ZOYC 4WWIA 2BCCD 1QVGO 3L36A 4N78E 3TF5A 2FXPA 2I1JA 5CJ4A 2QG4A 1A02J 1IC2A 5H2FH 5APQA 3NTNA 3IR9A 1K8AQ 5CCGA 1VQLP 1VQMP 1BSHA 3A0HH 2FFDA 4W7YA 1EQ7A 4PV1D 2D2CC 3EFGA 1R5SA 2KZIA 1S4XA 3RK3E 2WSFJ 3JCUH 2JO1A 1FZEA 4TLFA 1NKNA 1H8AA 4OVNF 2K88A 3OJAB 2R5BA 2FYUE 2M5AA 3L75E 1W2BO 1GL2B 3EQ2A 3TGUJ 2O01N 3L70G 1PFIA 2ZT9B 2B87B 2WPQA 2WSSH 2RMZA 2H8PD 1NTZD 3GHGC 2NPSB 2RN0A 1KILD 1VQ6P 2M0BA 3KDPB 1G2CB 3L74D 5BU8B 3MGNA 1GZLA 4WY4A 3AE7C 5KAFH 4ASVA 3M9HA 3GG2A 2ZXXA 1SQBE 4YPCA 3II6A 3W67A 2KI7B 1SQPJ 3LW5H 1NTKD 3K5BA 4PD4H 1K04A 2VRSA 2FFDC 3E7KA 1HF9A 1EC5A 2IFMA 1CZQA 3AEBC 4K35A 1RHZB 2O1JA 4KT0J 2KSEA 1SQVK 3H1JG 2IBZE 1M57D 2WSEH 1FZAA 3GF7A 3A5TA 4JBZA 1BCCG 1VQOP 1NTME 3U59A 1KQLA 5GTHE 3VN0A 3JC22 2IDBA 4GKGA 5KJ7D 3WUVA 1JTHB 5AW1B 4ZKUA 4DOJA 4H13C 1PP9D 3H1LG 3B5NA 3L71G 2CPSA 3CXHD 3KHUA 1IJDB 4H0LC 2E43A 3CI9A 2N1TA 2YXRB 1SQVG 1SFCD 3H1HE 5M1BA 4WY4C 3L73G 1USEA 2GM4A 4L74A 1X8YA 2H89C 1AFOA 2DW3A 2YKPA 4EIJA 5AVVB 3RK3D 2JKVA 1OVVA 1DX7A 1JMMA 1FOSE 1RY3A 2N9YB 3OW2O 3FWNA 1L2PA 3GLMA 1FZGA 5KLVK 1LTJB 1YBKA 1UIIA 3EFFK 2FYUD 3A7OA 1UIXA 2P10A 3H1KG 1OXZA 1PZQA 2AXCA 3H1IG 4JPZB 1EDLA 1NTZJ 4ZNCA 3LIEA 3L72E 2QA4P 3FX0A 5B66H 3N7NA 2HLOA 2M3BA 1YTZI 3CXHI 2Y9YA 3AE6C 1T3JA 2E74C 1FC2C 5AVRB 2E75C 5KLVG 1NVOA 2W90A 1WMKA 4GOFA 3BCCE 1H89A 1GL2A 1SQBD 1SQQE 3B5NC 1NTKJ 2R3CA 2GUSA 2B87A 2Q5UA 1AVYA 3V6IA 4HKZH 1SQXE 2N1TC 3HD7B 2Q3EA 2NPSA 2K37A 1YJWP 1OFCX 4L73A 5KTBA 1S9KD 2RKLA 3ITKA 3AEEC 1G2CA 1KB9D 3BASA 4UB8E 2A06E 3F89A 1X79B 1YITP 2D2CD 1N2DC 4RKUJ 3AEFC 3NMDA 1T2KC 3B4SA 3PH0A 3RL0B 4U3FE 3RBZA 2OYIB
chains in the Genus database with same CATH topology
5E79H 2AXTH 4PJ0H 5B5EH 3A0HH 5TISH 1S5LH 3A0BH 3KZIH 5KAIH 4UB8H 5H2FH 3WU2H 5GTIH 3JCUH 5GTHH 5B66H 4UB6H 5KAFH 4IL6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 H;  2AXT H;  4PJ0 H;  5B5E H;  3A0H H;  5TIS H;  1S5L H;  3A0B H;  3KZI H;  5KAI H;  4UB8 H;  5H2F H;  3WU2 H;  5GTI H;  3JCU H;  5GTH H;  5B66 H;  4UB6 H;  5KAF H;  4IL6 H; 
#chains in the Genus database with same CATH topology
 2J58 A;  3MUD A;  2QEX P;  2ZXE B;  3AE2 C;  1ZR4 A;  1HH0 A;  3I55 P;  2M3E A;  1IFM A;  4H44 B;  1WT6 A;  1K73 Q;  2OYH B;  3CWB E;  3M0D A;  1LTI C;  1AQ5 A;  3W68 A;  3TYY A;  1MV8 A;  4WVZ A;  3U1C A;  2BCC G;  1JTH A;  3O8Z A;  1GL2 C;  1KB9 I;  1FZB A;  3AEC C;  3E1R A;  1EDI A;  2K9Y A;  3HTK B;  2FYU J;  2KXP B;  1VDF A;  1MFT A;  3L75 J;  1KQG B;  3KXD A;  1AV1 A;  2K3R A;  1LWU A;  1NU1 E;  3CCJ P;  4ZMD A;  4D6T E;  2KOG A;  1JNM A;  1ZME C;  1NTZ K;  3SWY A;  5CBN A;  2Y9Z A;  3L72 D;  1YHQ P;  2HYN A;  1FE6 A;  2B88 A;  1SP4 A;  2I8D A;  1U7J A;  1S5L X;  1BGY E;  1X22 A;  2KUB A;  1BSN A;  4IFD K;  2E76 C;  3O6Q B;  3L4F A;  4C7N B;  5CCH A;  2HOD A;  1LTJ A;  1SQB J;  3L35 A;  3BRT B;  5AVY B;  1RF1 B;  3VYI A;  4AQR D;  4I2L C;  1U57 A;  1NTK K;  4H13 D;  1LGH B;  3Q2Y A;  4EI2 A;  1NTZ G;  1ZW0 A;  4HYT B;  4R4M A;  4L76 A;  3M0D C;  4H0L D;  1JOC A;  2KZJ A;  1IFJ A;  4OWF A;  3L74 G;  4KJM A;  4WY4 D;  2A45 I;  3GF3 A;  2LR2 A;  1P84 E;  2XV5 A;  1NTM J;  2M8R A;  1NAF A;  1NTK G;  1SQP D;  4NPF X;  5AW0 B;  2AXT E;  3HD7 A;  1R5L A;  1LWU C;  3HUS A;  1YQ4 C;  1JM0 A;  1M1K Q;  2WPR A;  1RH5 B;  1RQV A;  3A2A A;  1LT9 A;  1E79 H;  5AVQ B;  2WTY A;  1BE3 D;  5B5E E;  3H1H J;  1KOR A;  1YIJ P;  3PP5 A;  3VOP A;  3VP8 A;  1KFN A;  4PJ0 H;  1XTC C;  5AW6 B;  1LTJ C;  4KHX A;  4JF7 A;  2E74 D;  4IFF A;  1SS1 A;  2E75 D;  4PJ0 E;  1PP9 G;  2V7Q J;  5CHX A;  1YJN P;  1L0L E;  1WRG A;  5AVW B;  1BDD A;  3B5N D;  1JEK A;  5K5G B;  1OW7 A;  3GMA A;  3HE5 B;  4RO0 A;  2P67 A;  2FYU K;  3CXH H;  2OYH A;  5H2F E;  2OTL P;  2JDI H;  2N1T D;  2WSC J;  1L0N E;  4ASW A;  1ZLL A;  4D6T D;  3A0H E;  3L72 J;  2QJP B;  2O01 H;  3AE3 C;  1Z56 A;  5KKZ C;  1KYO H;  1GU5 A;  4MN4 C;  3SFE C;  3D70 A;  2AEM A;  3JCU E;  2WPV B;  1T2K D;  1DD3 A;  4BRY B;  1KYO E;  2K9J B;  1KIL B;  2ITA A;  3HD7 C;  3HTK A;  2L91 A;  1L4A B;  3HUS C;  3BCC J;  3V2P A;  4YXD C;  1SQQ J;  2FYU G;  3GW6 A;  2YMY A;  1LT9 C;  2IFN A;  1N7S B;  1NHL A;  1URQ B;  2R44 A;  1SQX J;  1S5L H;  4DZO A;  1EZV D;  2W6J H;  3L70 E;  1Q90 D;  2KK7 A;  1HTL C;  4M3L A;  4A7P A;  3KQG A;  1HUC A;  3MTU E;  1VQ4 P;  4I1L A;  3O6Q A;  4EOT A;  5KAF E;  4C7N A;  1XTG B;  1QX8 A;  3CCS P;  4U3F J;  5KLI B;  2JWD A;  3KZI H;  1RF1 A;  1GL2 D;  1J1E C;  3C1L A;  1PPJ D;  5CCG C;  5APY A;  1VQP P;  3KZI E;  2OYH C;  1JUN A;  2W27 A;  2BEZ F;  2PAJ A;  2R32 A;  2RH0 A;  4OGQ C;  4PD4 E;  2ZJS E;  5TIS H;  3KYQ A;  1BE3 J;  1VQK P;  3CMA P;  1DH3 A;  3CWB J;  3M06 A;  1QL1 A;  1KB9 H;  5CJ0 A;  4EDF A;  1GW4 A;  2K1A A;  2ZAE B;  3FGA D;  2N9B A;  4RES B;  3IN6 A;  5AVU B;  1EZV I;  3H25 A;  1JCC A;  3H1J E;  3U1A A;  4WB4 A;  2J59 M;  3Q3D A;  1MUU A;  3V5B A;  3WU2 H;  1SFC B;  2E76 D;  5CBO A;  5APT A;  1HBW A;  2BEQ D;  2P7J A;  1LJ2 A;  4N78 D;  1N73 B;  3CD6 P;  1CSB A;  3S1K A;  5APS A;  2HG5 D;  1FZC B;  2IYO A;  3CX5 H;  3CL3 D;  3H1L E;  3PHL A;  3T97 B;  1YTZ T;  3L71 E;  3B71 A;  2KYV A;  1L0N D;  4D6T J;  2WVR A;  1DEB A;  1R8E A;  1HWT C;  1S2E A;  1AQT A;  2Y0E A;  1SQV E;  1FDM A;  2OTK E;  2QJY B;  2V4H A;  3L73 E;  1RF1 C;  1BGY J;  2FYZ A;  2YIU B;  2WT7 B;  1QL2 A;  3MD0 A;  1T6A A;  4IL6 X;  3HE5 A;  3QH9 A;  3Q5R A;  3Q5P A;  4HH2 A;  1YJ9 P;  3L75 D;  2SPZ A;  2A45 G;  4XA4 A;  3AEG C;  2KSJ A;  2Q9I A;  2QVA A;  2A45 H;  1PGQ A;  3RK2 B;  2LKM A;  2JWA A;  4R4L A;  4HB1 A;  1LTT C;  1J1D B;  4DT0 A;  3H1K E;  3H1I E;  3PRJ A;  1OVU A;  5B66 E;  2WSF H;  1OMI A;  4XE5 B;  4GOE A;  3H32 B;  2K9J A;  1KIL A;  2PRR A;  3CCR P;  3AE5 C;  4UB6 H;  1L4A A;  4BWN A;  2P58 A;  3ZDM A;  1N7S A;  1SQP K;  4UB6 E;  3TGU G;  5KLV E;  1URQ A;  2Y0D A;  5AVX B;  5APW A;  2KLV A;  3VMX A;  5APU A;  3CCL P;  2YKO A;  1YQ3 C;  1IFP A;  3L37 A;  3TNU B;  2WQY C;  3VMY A;  4NPD A;  3N4X A;  2H7H A;  2IBZ D;  5DJU B;  2FKW B;  4Y28 J;  1H0T B;  1NTM D;  1SQP G;  3CCU P;  1FU1 A;  2OAR A;  3HD7 D;  1L0L J;  2W6B A;  1X0T A;  1NO4 A;  1YI2 P;  4IOI H;  3F5H A;  5BVZ A;  1HJ0 A;  2QJP C;  2KNC B;  3IAO A;  1BE3 G;  1FBM A;  1ZRT E;  3RGU A;  1GTW A;  1OW8 A;  1L0N J;  3ABV C;  3H1H D;  4AUW A;  3L71 D;  4OH8 B;  2ZYA A;  2AEJ A;  3WMM 0;  1DD4 A;  3RL0 g;  1L4A C;  1SFC A;  2XND H;  2R5D A;  3HE4 B;  1G1I A;  3L73 D;  3CCQ P;  2ZT9 C;  1N7S C;  1N73 A;  1KZU B;  1URQ C;  1VF5 B;  1VL2 A;  2IBZ I;  4N3Y B;  1DEE G;  1JB0 J;  1QLE D;  2BCC E;  2NPS C;  5AVS B;  3WUU A;  1T8Z A;  5CCG D;  2ZVN B;  2OTJ P;  2QJK B;  3T97 A;  2IYP A;  3I5C A;  4OGQ D;  1U7M A;  3BVH A;  5DJT B;  5L8R J;  2Q3I A;  2ZVO B;  2XU6 A;  1D7M A;  4H13 B;  1M1J B;  3H1I D;  1J2J B;  3A0B H;  3MUD C;  4IL6 H;  4U7J A;  1A02 F;  1BDC A;  2I1K A;  1X9V A;  4N6J A;  4JYB A;  1KD1 Q;  3MP7 B;  3BCC D;  2LXC B;  4WY4 B;  1SQQ D;  3CCE P;  1K9M Q;  3LW5 J;  2PP6 A;  5EFW B;  1T3U A;  1SQX D;  1EZV G;  3V2Q A;  2Z4E A;  3VMZ A;  1RQU A;  3QWO C;  4GOD A;  2C0W A;  2IX7 C;  2QE7 H;  3V2R A;  2IZ1 A;  1SFC C;  2A06 D;  1KIL E;  1M8O B;  2C9L Y;  3M9Q A;  3AE8 C;  1EDK A;  3L74 E;  3PTZ A;  3PLN A;  1N73 C;  1PGP A;  1RE3 A;  2WSE J;  1IFI A;  4U3F D;  3H1J J;  1PPJ G;  1NKZ B;  2OGU A;  1IZN B;  2CK3 H;  1GU4 A;  4DCK A;  3SSU A;  2QSI A;  1NTK E;  3P8M C;  3AED C;  2QRX A;  2JP3 A;  2E74 B;  4W80 A;  4W7Z A;  2WZ7 A;  2QIW A;  3C8V A;  2E75 B;  2Z5H A;  2CPB A;  1PGJ A;  1N7L A;  3CWB D;  3H1L J;  1KQF B;  5APV A;  3L71 J;  1VQN P;  1AVO A;  3G9R A;  1FJP A;  2JEE A;  1KFM A;  2YNY A;  1H0T A;  1OIP A;  2OYI A;  5CCH C;  1SQV J;  3D6Y A;  4GIF A;  2N1T B;  1USD A;  3L73 J;  1OX3 A;  5AW9 B;  1JY2 O;  4PV1 B;  1Y9B A;  1KV4 A;  1Y47 A;  3RK2 C;  5AW5 B;  3V4W A;  2KNC A;  2YO2 A;  1IK7 A;  2E5T A;  1J1D C;  3B8E B;  1PP9 E;  3WUT A;  5CMZ A;  4B86 A;  2FYN B;  1NU1 D;  1L0N G;  3CXH E;  3KPE A;  1S3J A;  4WBA A;  2C0X A;  4LLH A;  2GUV A;  3H1K J;  3H1I J;  4YTP C;  3HE4 A;  1RE3 C;  2WMM A;  1JY3 P;  3BRV B;  2WWW A;  1BGY D;  1PGO A;  1HJB A;  2W8Z A;  1N8R Q;  1M56 D;  2JR8 A;  1SQB K;  1MZ9 A;  4C46 A;  3L75 G;  3P32 A;  2BAS A;  5KLV J;  3AEA C;  2OQQ A;  3P8C E;  1FDO A;  1KTM A;  4JQ0 D;  4DJG A;  3Q1M A;  1HGV A;  3RL0 C;  3TSI A;  4XFJ A;  1EXJ A;  1DIP A;  1S5L E;  1M1J A;  2G8Y A;  2OYI C;  1AJY A;  1EXI A;  2W83 C;  2ZFC A;  2B9B A;  3CC4 P;  1LNQ A;  1SVF A;  3AE9 C;  1P84 D;  1OZH A;  1KC8 Q;  1L4A D;  4H44 C;  1SQB G;  1NTM K;  1VPC A;  2Q1K A;  5E79 H;  2G3A A;  2ZT9 D;  1IO4 A;  1N7S D;  1URQ D;  2HFE D;  5AW3 B;  1HGZ A;  2NPS D;  5E79 E;  5AVT B;  3CME P;  2WPS A;  1ZP0 C;  4IFM A;  1KN7 A;  2KP8 A;  2XKM A;  5AW2 B;  1ZXG A;  2QM7 A;  5TIS E;  2E76 B;  3G71 P;  2L5G B;  4O9B A;  3FXE A;  1ZR2 A;  1JY2 P;  2ZYD A;  1S9K E;  2IBZ G;  1VQ9 P;  5AW8 B;  3E1I A;  4I7Z B;  1KB9 E;  1IK9 A;  1VF5 C;  1S72 P;  1NTM G;  3IFM A;  2HR3 A;  2PFX A;  5GTH H;  4Y99 B;  1BCC E;  1QVF O;  2QJK C;  2W6A A;  2HPC B;  1K05 A;  3WU2 E;  2XNX A;  3G3Z A;  2P1J A;  3MIW A;  1VQ7 P;  1L0L D;  3JSV C;  2BCC J;  3RK3 B;  3R4Y A;  1P84 I;  1LTA C;  2UWJ E;  1E5W A;  2XDJ A;  2Y0C A;  3AE1 C;  3SWF A;  1G1J A;  4RJT A;  1NU1 J;  1M1J C;  1Q82 Q;  3H1H G;  3M0A A;  3CCV P;  3CX5 E;  1LTS C;  2P2U A;  4QMA A;  3A3Y B;  5C39 A;  4Z1M H;  4YXW H;  1LWU B;  5KAI H;  1QEX A;  2QM8 A;  3C9I A;  4HJG H;  3CLQ A;  2KS1 B;  3VMA A;  1JMB A;  5KAI E;  1KYO D;  3MZW B;  2B89 A;  2V7Q H;  2Q6Q A;  2YKQ A;  2KB7 P;  1SQQ K;  3UIA A;  5AVZ B;  1KMI Z;  5AW4 B;  2H88 C;  3MHV A;  1FZF A;  2R3S A;  1MKM A;  3P8C D;  1JO5 A;  1SQX K;  2HOD B;  2WSC H;  4L75 A;  3L72 G;  1S1C X;  1N86 A;  3NFQ A;  3L70 D;  4CPG A;  5TJH A;  3G6E P;  3S9O A;  1M90 Q;  1CW5 A;  3D71 A;  2IPP A;  3R2P A;  4BRY A;  3PJS K;  1OW6 A;  5CCH D;  3L74 J;  3BCC G;  3I56 P;  1SQQ G;  3TDK A;  3CPW O;  2D2C B;  3OAK A;  4K3A A;  1KQS O;  1SQX G;  3RK2 D;  3AE4 C;  5KKZ B;  4PD4 D;  1GMJ A;  1OVR A;  3P7K A;  1KYO I;  2E5Y A;  3TGU E;  1NGM B;  5BU5 A;  1FDI A;  2IZ0 A;  4EYY Q;  2A06 G;  1AA0 A;  2YXQ B;  1GK6 A;  3HUS B;  1LTB C;  4UB8 H;  2FBW C;  1LP1 B;  4PV1 C;  1LT9 B;  4GDO A;  1RF0 A;  2FXO A;  1GD2 E;  2NRG A;  4U3F G;  2WIT A;  4NPE A;  4LGD E;  3GHG B;  3H1J D;  1IFD A;  1EDJ A;  1PV3 A;  1Q7Y Q;  3V2N A;  1BCC D;  2JJL A;  2FYN C;  2H43 A;  1CI6 B;  1NWQ A;  1SLQ A;  1SQP E;  2MKV A;  3CC2 P;  5KJ7 A;  1NYH A;  2Q7C A;  2NZ2 A;  2GA1 A;  2Z5I A;  1W5C E;  1PP9 J;  4JYC A;  3CWB G;  3H1L D;  1NU1 K;  1J1E B;  4BXL A;  3RL0 D;  2OYO A;  3CX5 D;  1KIL C;  1BE3 E;  3CCM P;  4PD4 I;  1SQV D;  3G4S P;  2FFD B;  4OGQ B;  2FXM A;  1IFN A;  2O01 J;  1Q86 Q;  3IF4 A;  1QGK B;  2HPC A;  3OA7 A;  4GT1 A;  3S4R A;  4H44 D;  1FJK A;  3VP9 A;  1VQ5 P;  1FZC A;  2MJZ A;  2POH A;  1VQ8 P;  4I6M C;  1NU1 G;  2FY8 A;  1HVV A;  1FS0 E;  2KLU A;  4D6T G;  2M5A B;  1MFZ A;  3L70 J;  1Y8A A;  1LTG C;  1ZN5 A;  5KLI C;  1RF0 C;  3H1K D;  1TU3 F;  1JY3 N;  2O1K A;  2YMK A;  1FOS F;  5APX A;  1BGY G;  1OWA A;  2O3J A;  1LT1 A;  2WT7 A;  1VF5 D;  2KS1 A;  4H0L B;  2J5U A;  1RE4 A;  3A0B E;  4IL6 E;  3BAT A;  3RBX A;  1NAY A;  3CX5 I;  2AEF A;  1Q81 Q;  3M91 A;  3SWK A;  1Q2N A;  5KJ7 C;  4C7R A;  1JY3 O;  5KLV D;  3LID A;  4LC1 A;  2LXB A;  5AW7 B;  4I7Z C;  1YYC A;  1NOH A;  3TGU D;  1W2E A;  3M9B A;  3VTP C;  1NTZ E;  2C9N Y;  3H6P A;  1M7L A;  3H32 A;  3HRN A;  1EZV E;  4Y99 C;  3EWK A;  3CC7 P;  1NH4 A;  1P84 H;  3RK3 C;  3SFD C;  1FZC C;  5GTI H;  2E42 A;  2KIK A;  1BCC J;  3FWL A;  2PGD A;  3TK1 A;  1H88 A;  1PIX A;  2ZYG A;  2AXT H;  1PL5 A;  2XZR A;  5GTI E;  1L0L K;  1NJI Q;  1PPJ E;  3TNU A;  1GK4 A;  3Q5S A;  1ZV8 A;  2QJY C;  1GW3 A;  1ZRT D;  3FXD A;  1JY2 N;  1L0N K;  3B5N B;  1LP1 A;  3D6Z A;  2YIU C;  5B5E H;  2YO3 A;  1RE4 C;  4TT3 H;  4AYC A;  3GHG A;  1FAV A;  3USS A;  1JCD A;  3V4Q A;  3NXS A;  1CI6 A;  1GDT A;  4ZKP A;  1L0L G;  1ZOY C;  4WWI A;  2BCC D;  1QVG O;  3L36 A;  4N78 E;  3TF5 A;  2FXP A;  2I1J A;  5CJ4 A;  2QG4 A;  1A02 J;  1IC2 A;  5H2F H;  5APQ A;  3NTN A;  3IR9 A;  1K8A Q;  5CCG A;  1VQL P;  1VQM P;  1BSH A;  3A0H H;  2FFD A;  4W7Y A;  1EQ7 A;  4PV1 D;  2D2C C;  3EFG A;  1R5S A;  2KZI A;  1S4X A;  3RK3 E;  2WSF J;  3JCU H;  2JO1 A;  1FZE A;  4TLF A;  1NKN A;  1H8A A;  4OVN F;  2K88 A;  3OJA B;  2R5B A;  2FYU E;  2M5A A;  3L75 E;  1W2B O;  1GL2 B;  3EQ2 A;  3TGU J;  2O01 N;  3L70 G;  1PFI A;  2ZT9 B;  2B87 B;  2WPQ A;  2WSS H;  2RMZ A;  2H8P D;  1NTZ D;  3GHG C;  2NPS B;  2RN0 A;  1KIL D;  1VQ6 P;  2M0B A;  3KDP B;  1G2C B;  3L74 D;  5BU8 B;  3MGN A;  1GZL A;  4WY4 A;  3AE7 C;  5KAF H;  4ASV A;  3M9H A;  3GG2 A;  2ZXX A;  1SQB E;  4YPC A;  3II6 A;  3W67 A;  2KI7 B;  1SQP J;  3LW5 H;  1NTK D;  3K5B A;  4PD4 H;  1K04 A;  2VRS A;  2FFD C;  3E7K A;  1HF9 A;  1EC5 A;  2IFM A;  1CZQ A;  3AEB C;  4K35 A;  1RHZ B;  2O1J A;  4KT0 J;  2KSE A;  1SQV K;  3H1J G;  2IBZ E;  1M57 D;  2WSE H;  1FZA A;  3GF7 A;  3A5T A;  4JBZ A;  1BCC G;  1VQO P;  1NTM E;  3U59 A;  1KQL A;  5GTH E;  3VN0 A;  3JC2 2;  2IDB A;  4GKG A;  5KJ7 D;  3WUV A;  1JTH B;  5AW1 B;  4ZKU A;  4DOJ A;  4H13 C;  1PP9 D;  3H1L G;  3B5N A;  3L71 G;  2CPS A;  3CXH D;  3KHU A;  1IJD B;  4H0L C;  2E43 A;  3CI9 A;  2N1T A;  2YXR B;  1SQV G;  1SFC D;  3H1H E;  5M1B A;  4WY4 C;  3L73 G;  1USE A;  2GM4 A;  4L74 A;  1X8Y A;  2H89 C;  1AFO A;  2DW3 A;  2YKP A;  4EIJ A;  5AVV B;  3RK3 D;  2JKV A;  1OVV A;  1DX7 A;  1JMM A;  1FOS E;  1RY3 A;  2N9Y B;  3OW2 O;  3FWN A;  1L2P A;  3GLM A;  1FZG A;  5KLV K;  1LTJ B;  1YBK A;  1UII A;  3EFF K;  2FYU D;  3A7O A;  1UIX A;  2P10 A;  3H1K G;  1OXZ A;  1PZQ A;  2AXC A;  3H1I G;  4JPZ B;  1EDL A;  1NTZ J;  4ZNC A;  3LIE A;  3L72 E;  2QA4 P;  3FX0 A;  5B66 H;  3N7N A;  2HLO A;  2M3B A;  1YTZ I;  3CXH I;  2Y9Y A;  3AE6 C;  1T3J A;  2E74 C;  1FC2 C;  5AVR B;  2E75 C;  5KLV G;  1NVO A;  2W90 A;  1WMK A;  4GOF A;  3BCC E;  1H89 A;  1GL2 A;  1SQB D;  1SQQ E;  3B5N C;  1NTK J;  2R3C A;  2GUS A;  2B87 A;  2Q5U A;  1AVY A;  3V6I A;  4HKZ H;  1SQX E;  2N1T C;  3HD7 B;  2Q3E A;  2NPS A;  2K37 A;  1YJW P;  1OFC X;  4L73 A;  5KTB A;  1S9K D;  2RKL A;  3ITK A;  3AEE C;  1G2C A;  1KB9 D;  3BAS A;  4UB8 E;  2A06 E;  3F89 A;  1X79 B;  1YIT P;  2D2C D;  1N2D C;  4RKU J;  3AEF C;  3NMD A;  1T2K C;  3B4S A;  3PH0 A;  3RL0 B;  4U3F E;  3RBZ A;  2OYI B; 
#chains in the Genus database with same CATH homology
 5E79 H;  2AXT H;  4PJ0 H;  5B5E H;  3A0H H;  5TIS H;  1S5L H;  3A0B H;  3KZI H;  5KAI H;  4UB8 H;  5H2F H;  3WU2 H;  5GTI H;  3JCU H;  5GTH H;  5B66 H;  4UB6 H;  5KAF H;  4IL6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...