5B5EE

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b5eE00
3WU2E 4PJ0E 5B66E 1S5LE 2AXTE 1W5CE 5GTIE 4IL6E 5TISE 5GTHE 3JCUE 3KZIE 5KAFE 4UB8E 5KAIE 5B5EE 3A0HE 5H2FE 3A0BE 4UB6E 5E79E
chains in the Genus database with same CATH superfamily
1FZGA 1GU5A 3I55P 1HTLC 3LW5H 1ZN5A 1MZ9A 4PV1D 2OYOA 5CCGC 5APTA 3L72J 3AE9C 1ZW0A 3L72G 3P8CD 2W8ZA 3CXHE 3CCJP 1NU1J 2FYNB 1W5CE 1SQPK 2JDIH 3AE3C 2W6AA 2WSFH 4L73A 1H88A 1NU1E 1L0LK 1JTHA 1MFZA 2OYHC 3USSA 2NPSC 2IZ0A 1URQB 3CWBJ 3P8CE 1MV8A 5KKZC 5AVQB 3P8MC 1FDOA 3CWBE 1N73B 3CD6P 1YI2P 4OGQD 4JQ0D 3AE5C 2ZYAA 5CBOA 1JY2N 1SFCC 1JM0A 3CCSP 3V6IA 1SQQK 1PPJD 3CCVP 1DIPA 3H1KD 1YJNP 1FU1A 3RBXA 3VMZA 2QM8A 1ZRTD 2W83C 1YITP 2ZVOB 2IBZD 4XE5B 2H89C 1N7SC 2BCCD 4B86A 1NTKJ 1PPJG 4UB6H 2WPSA 3OJAB 3H1KG 3RBZA 2XDJA 1L0NE 2WTYA 1FBMA 1NTKE 2V7QH 1AVYA 1ZR4A 3NMDA 2IBZG 3HUSB 2BCCG 3M0AA 1X0TA 1IFMA 2WSCH 1JY3N 1LWUB 1JCCA 1KYOD 1P84H 5KLVJ 3ITKA 1LNQA 2J58A 5KLVE 1KTMA 1P84I 2B88A 2NRGA 4BRYA 1SQXK 2FYNC 1PGOA 1BE3J 3U59A 3LIDA 1OIPA 2XKMA 1BE3E 3S9OA 3CCMP 3TYYA 2JR8A 1XTCC 1T3JA 5AVRB 3L75D 2N9BA 4W80A 3MTUE 1GD2E 4CPGA 1VF5B 3AE8C 3GMAA 2C9LY 3II6A 1KQSO 2AEMA 2QJYB 2ZXEB 4GT1A 3U1AA 1SQQD 4C7NA 1PP9D 1RF1B 1IFNA 1KB9E 3L75G 5L8RJ 2QVAA 2K9YA 3RK2B 1EDJA 2WZ7A 3G6EP 3W68A 2BEZF 3CLQA 4H44C 4EDFA 1SQQG 1PP9G 3L4FA 1Y47A 4PJ0E 2R44A 5AVTB 5GTIE 1QL1A 4EIJA 4YTPC 3CMAP 1DD3A 3L73D 1JY2O 3KZIH 3CC7P 2I1JA 1LWUC 3HE4A 2L5GB 1L4AB 3L70J 2C0XA 1HBWA 1EXJA 2W90A 2QJPC 2C9NY 5AW2B 2QJKB 3L73J 3L73G 3M06A 3L70E 1J1DB 4KJMA 5AVWB 1N8RQ 3V2RA 1NO4A 1LTAC 4XFJA 3U1CA 1YJWP 2E74D 4DT0A 4YXDC 1U7JA 1SQVD 3ABVC 4ASWA 1Q81Q 1M57D 1FDIA 3H6PA 1ZOYC 2AXCA 1X9VA 1ZR2A 2XZRA 1SQVG 2QEXP 1S5LE 4H0LD 1VF5C 4PD4D 3A5TA 1KV4A 1W2EA 5AW1B 2WSSH 3A3YB 4DCKA 2QJYC 3BVHA 4Y99B 2E42A 2O3JA 1JTHB 3A2AA 1HF9A 2W6JH 3CCRP 3VYIA 3RK3B 1OW6A 2IYPA 3RK2C 1S72P 5APYA 1NGMB 3HD7C 2H88C 2FKWB 2A06E 1BDCA 1FZBA 3F5HA 2N1TC 3SSUA 4IFFA 3VMYA 5KAIH 2C0WA 1BGYE 1NTMJ 4A7PA 5CHXA 5APXA 2IDBA 1E5WA 1AV1A 3BRTB 1QLED 1NTME 1NH4A 4O9BA 5M1BA 1AJYA 1FJPA 1NVOA 1EZVE 4PV1B 2LR2A 3WUVA 2LKMA 1S4XA 1S2EA 3H1ID 2R5DA 2Q3EA 1M8OB 2JWAA 3PTZA 1QGKB 1BCCD 4UB8H 5AW5B 2RN0A 2CPSA 4H13D 1IFIA 3H1IG 3M0DA 2DW3A 2QM7A 3KHUA 4IL6H 1IFDA 1M90Q 1BCCG 1NJIQ 4BRYB 2R3CA 1JMMA 1LTBC 5KTBA 1BDDA 2WPQA 1RF0C 2ZYGA 5AVYB 3L35A 2ZT9D 1MKMA 4Y99C 2RH0A 1VQ9P 3RK3C 3V4QA 5AW9B 4OWFA 1IFPA 3N7NA 2WWWA 5AW0B 5KKZB 3O6QA 3VP8A 1VQ6P 1GW4A 1HGVA 2KS1A 5B5EE 4C7RA 1LTGC 2IZ1A 2KP8A 1Z56A 1SP4A 2QSIA 2KZIA 1SFCB 1OVUA 2POHA 3H32A 4WWIA 1K05A 3JCUE 2WQYC 1NAYA 4I7ZC 3LW5J 4JBZA 4W7ZA 2CK3H 1SQBJ 2Q1KA 2B87A 2P58A 4PV1C 4N78D 1SQBE 2I8DA 2FFDA 4RJTA 3D6YA 3H1HJ 1GDTA 1M7LA 2O01N 5KAFE 3H1JJ 3FXDA 3AEAC 1Q86Q 2K9JB 2FYUJ 2WSFJ 1L0NK 2A45I 1YYCA 3CX5E 3H1HE 1NTKK 3RK3E 3CCUP 4I6MC 2B89A 3H1JE 3HE4B 2FYUE 3MP7B 2KIKA 4OH8B 4DZOA 2NZ2A 3BRVB 3SWYA 3OA7A 1LP1A 5BVZA 2KB7P 4BXLA 2WSEH 3CC2P 2QA4P 1N7LA 2KSEA 3JC22 2FXOA 2ZYDA 2CPBA 3L72E 3P32A 4OGQC 1RF0A 1EC5A 5B66H 5CCHD 2WPRA 1Q7YQ 4KT0J 3AE2C 3RL0D 1HH0A 2K37A 1FZAA 3WU2E 1TU3F 1YJ9P 3GHGA 1VQ4P 1KMIZ 1DEEG 1NTZD 3Q3DA 1P84D 1K04A 3HE5A 3M9HA 1IJDB 3TSIA 4UB6E 3CMEP 2E75D 2V7QJ 3E1IA 2RKLA 2YNYA 3NFQA 1S5LX 1NTZJ 1GK4A 3B4SA 2WSCJ 1NTZG 3CXHH 1G2CB 3PH0A 1HVVA 5CJ0A 1VQPP 4AYCA 4H44B 1NHLA 3CXHI 3A7OA 3I56P 1QX8A 2HFED 4OVNF 3L74G 2PRRA 1EDLA 2Z5HA 2YXQB 4M3LA 3RL0g 5TISE 3H1KJ 3K5BA 3B5ND 1N2DC 2E74B 1WT6A 1PPJE 1DX7A 1S3JA 1Q2NA 3VMXA 2M5AA 3SFEC 3H1KE 4GIFA 3WUUA 4AUWA 2BCCJ 2ZXXA 5CCHA 1KILD 1ZRTE 3PRJA 3QH9A 1QVGO 1VQKP 1K9MQ 1FE6A 1T6AA 2AXTE 3C8VA 2HODA 1LTSC 4IL6X 2IBZE 2BCCE 5GTHE 4EOTA 3MGNA 2D2CD 2QJPB 1PGPA 1SQPD 4MN4C 3FWNA 2G8YA 1FOSF 3T97A 3VOPA 2GA1A 2GUVA 1L0LD 4DOJA 4LC1A 1VQ7P 1VPCA 3SWFA 2XV5A 1KYOE 1SQPG 2W6BA 4L74A 1LJ2A 1KC8Q 3H25A 1ZMEC 3MUDA 1JNMA 2K3RA 1YQ4C 1L0LG 1DH3A 3A0HH 5KJ7D 2JP3A 1S9KD 1YTZI 4RKUJ 2K88A 3NXSA 5K5GB 1GL2C 1FZCA 2KK7A 2QIWA 1FJKA 1M1JA 1LTTC 3HTKB 1SLQA 4U7JA 4JYBA 4RESB 1LT9C 3L75J 1RE4A 3B5NA 2LXBA 1GTWA 1JUNA 4C46A 3O6QB 3Q5RA 2O1KA 1EXIA 3L75E 3MD0A 2YMYA 2KS1B 1SQQJ 3HD7B 1KILA 2E5YA 1PP9J 2KNCB 2UWJE 3C1LA 2N1TB 1GL2D 1Q82Q 5E79E 1SQQE 1Y9BA 3BCCD 3KQGA 3L36A 3JSVC 3V2QA 5H2FH 1PP9E 4ZKUA 3H32B 1LTJA 3GLMA 1T2KD 1KYOI 3E7KA 2E74C 1GK6A 4H13B 1H8AA 3WMM0 2AEFA 1RHZB 1OX3A 1NTMK 4EI2A 2KLVA 2YO2A 3BCCG 3G71P 2RMZA 2YKOA 1KZUB 1KQGB 1USDA 1HWTC 1KB9H 1DD4A 1SQXD 3SWKA 2YXRB 1T3UA 4H0LC 5KJ7A 1OVVA 2E5TA 4HJGH 1KB9I 3L73E 3H1LD 1VQ5P 3L37A 4DJGA 2ZT9B 5KLIB 1K73Q 3M91A 4NPDA 2I1KA 2H43A 3QWOC 4PJ0H 1SQXG 3M0DC 3KPEA 3UIAA 5GTIH 1J1EC 3GW6A 1NKNA 4NPEA 1QVFO 3H1LJ 1JY3O 3H1LG 1R5SA 4HB1A 4L76A 4WBAA 5APUA 5TJHA 1G1IA 1SQVJ 4JPZB 2P10A 3AECC 1GZLA 3MIWA 4WY4C 1SQVE 2YKQA 1IFJA 1M1KQ 1YHQP 1GL2A 3V4WA 3Q1MA 1GU4A 4TT3H 2B9BA 1R5LA 1LT9A 1OVRA 5AW3B 3CPWO 5CJ4A 4PD4E 3HE5B 1M56D 3AE1C 1FZFA 1N73A 2Z4EA 2KUBA 4WY4D 2J5UA 3L71D 4R4MA 3EQ2A 3P7KA 3HRNA 1GW3A 2E43A 2WVRA 1S5LH 1FC2C 4H13C 1E79H 4AQRD 4I7ZB 3SFDC 3CCLP 1SS1A 3D71A 1S1CX 3L71G 2Q9IA 2FFDC 3VN0A 2ZVNB 2KYVA 1PIXA 2OARA 2M5AB 1MUUA 1JMBA 3Q5PA 4I1LA 5EFWB 4WB4A 3HUSA 2AEJA 5KLIC 2ZT9C 1KQFB 2HODB 1RE3A 3H1IJ 3F89A 2FYUK 2OYIC 1X8YA 1KFMA 1IZNB 4ASVA 3H1IE 1BCCJ 3T97B 2KLUA 5APWA 5CMZA 3S4RA 1BCCE 3A0BH 3AEGC 1HJBA 5AVSB 3G9RA 1VDFA 4OGQB 2E75B 1LTIC 4WY4A 3D70A 1L4AD 2G3AA 4N6JA 2O1JA 3RGUA 1NU1K 3GHGC 3TNUA 2M3EA 1EZVI 1AVOA 1ZV8A 2Q6QA 2KSJA 2A45G 2P7JA 2HLOA 2ZAEB 3V5BA 3AE4C 3GF7A 3VTPC 4U3FD 4C7NB 1W2BO 1RF1A 3B5NB 4D6TD 3TGUD 3LIEA 3R4YA 2XNXA 5APVA 1YTZT 1KILB 4JYCA 4U3FG 1A02F 2WPVB 4D6TG 1EDKA 3VP9A 2WSEJ 5DJTB 3TGUG 2WT7A 2A45H 1LTJB 3Q2YA 4Z1MH 2PP6A 1UIXA 1Q90D 1OFCX 1NOHA 1QL2A 5CCHC 3GF3A 5B5EH 2M8RA 1SVFA 1H0TA 1IK7A 1L4AA 4W7YA 2OQQA 3RL0C 2OGUA 3NTNA 1FDMA 3AE7C 4N78E 2OYIA 3CXHD 4HH2A 2E76D 1RQUA 3BATA 3FGAD 5KLVK 4R4LA 1U57A 1BSNA 1NU1D 5AW8B 2O01H 4N3YB 2YIUB 2E75C 1A02J 4ZNCA 2JO1A 3MUDC 5KAFH 1PGJA 2M3BA 1JCDA 3CX5H 1NU1G 1FZCC 2ZJSE 3CWBD 1M1JC 1GL2B 4NPFX 3EFGA 2Q7CA 3CX5I 3C9IA 1RE4C 3B5NC 1UIIA 2R3SA 1LT9B 1IC2A 4RO0A 3W67A 5CCGD 3CWBG 2Y9ZA 3Q5SA 3L74D 1KILC 2GUSA 2Y0DA 1MFTA 1NTZE 4IFMA 4GOEA 3G3ZA 2D2CC 1P84E 3OAKA 1RY3A 1NAFA 1QEXA 1FS0E 1L0ND 1LTJC 1LGHB 4ZMDA 4K3AA 3L74J 2K1AA 2OTLP 1NTKD 4TLFA 3WU2H 3IF4A 1FAVA 4GKGA 2NPSD 1VQ8P 3L74E 2KZJA 1CI6A 4KHXA 3WUTA 1WRGA 2JWDA 5AVZB 5BU8B 3TK1A 1L0NJ 3MZWB 1L0NG 1NTKG 5KLVD 1AFOA 5APSA 3IFMA 3CI9A 1SFCD 5KJ7C 3OW2O 1AQ5A 4H0LB 3A0HE 2HPCA 2Y0EA 1VQLP 2OYHA 1D7MA 2HYNA 2LXCB 4GDOA 5KLVG 1KILE 2YIUC 1BE3D 1SQPJ 4GODA 1HJ0A 4IOIH 1N7SD 3R2PA 2ZFCA 1J1EB 5TISH 1NKZB 2PFXA 5CCGA 1OW8A 4YXWH 1SQPE 5DJUB 2OTKE 1WMKA 4HYTB 2IFNA 5CBNA 1L0LJ 5BU5A 1ZLLA 2IPPA 1PV3A 1BE3G 3EFFK 1LT1A 4WY4B 1L0LE 2AXTH 1IK9A 1KQLA 2JKVA 1IO4A 5GTHH 1JOCA 1KB9D 1SQVK 5AVXB 2J59M 2GM4A 1DEBA 5H2FE 1T2KC 3PHLA 3TNUB 5AW4B 1URQC 5C39A 3B71A 2NPSA 1OW7A 1CSBA 2IBZI 1K8AQ 3KZIE 1S9KE 1N73C 3KYQA 3S1KA 3TF5A 1KYOH 2V4HA 1JB0J 1G1JA 2VRSA 3CCQP 1HGZA 1SFCA 1FOSE 1PL5A 1PFIA 1NWQA 3V2NA 3MHVA 1URQD 2FXPA 3O8ZA 4EYYQ 3BASA 2B87B 3BCCJ 3M9BA 2WT7B 3FX0A 5AW6B 1N7SA 3D6ZA 2PAJA 4YPCA 2FFDB 3L70D 3BCCE 1YIJP 2R32A 1KD1Q 2K9JA 2JJLA 3HUSC 4I2LC 1H0TB 4BWNA 1RE3C 2XNDH 4H44D 3L70G 5E79H 1SQXJ 3CCEP 2OYIB 1LP1B 2KI7B 2PGDA 1SQXE 3CL3D 1AQTA 2P67A 1RH5B 3ZDMA 3IAOA 3I5CA 1PGQA 1KORA 2Z5IA 1CW5A 2Q3IA 1OMIA 3H1LE 1OWAA 2FY8A 5KAIE 2XU6A 1X22A 1KN7A 3GHGB 4LGDE 2YO3A 1URQA 2QE7H 2FXMA 1XTGB 2A06D 2Q5UA 1ZXGA 1JY2P 3IN6A 1FZEA 2Y0CA 2P2UA 1BGYD 1RF1C 4Y28J 4XA4A 1JO5A 2HG5D 3PLNA 3IR9A 1CZQA 3FXEA 2A06G 1USEA 1NTMD 1Y8AA 2QRXA 1G2CA 2FYZA 2H7HA 1NYHA 1VL2A 3PP5A 1OZHA 3E1RA 1BGYJ 4UB8E 1BGYG 1EZVD 1VF5D 2YKPA 3AE6C 3KXDA 2IYOA 2QG4A 1YBKA 3L71J 3KDPB 5AW7B 1AA0A 1OXZA 1NTMG 4IL6E 2E76B 2M0BA 1VQOP 3L71E 1SQBK 1JY3P 1EZVG 1CI6B 2ITAA 3A0BE 3RK2D 1VQNP 4PD4H 3B8EB 2MKVA 1L4AC 3HD7D 2SPZA 1LWUA 2YMKA 2BASA 2N1TD 2QJKC 3RL0B 3EWKA 3AEDC 4PD4I 1J1DC 2WMMA 1T8ZA 2HPCB 2IFMA 3PJSK 2OYHB 2H8PD 4LLHA 3AEEC 3N4XA 1VQMP 2P1JA 2KXPB 4QMAA 4JF7A 2FBWC 1ZP0C 3FWLA 5AVVB 1L2PA 4HKZH 1FZCB 1H89A 2KOGA 1M1JB 1GMJA 2IX7C 3HTKA 2R5BA 3TDKA 1JEKA 1U7MA 2NPSB 2W27A 1HUCA 3AEFC 3G4SP 4IFDK 4K35A 4U3FJ 4ZKPA 3HD7A 2OTJP 2BEQD 4D6TJ 2KNCA 1SQBD 2N1TA 4L75A 1NTZK 4GOFA 2D2CB 3TGUJ 1BSHA 2L91A 4U3FE 2E76C 4D6TE 3TGUE 2Y9YA 3CX5D 2O01J 3V2PA 3H1HD 3CC4P 1YQ3C 3RK3D 3H1JD 2WITA 1EQ7A 2FYUD 1SQBG 1X79B 5AVUB 3VMAA 1N7SB 5B66E 3M9QA 2HR3A 1PZQA 1RQVA 2JEEA 3AEBC 3H1HG 3GG2A 1EDIA 3H1JG 1N86A 4WVZA 1J2JB 2FYUG 3JCUH 1KFNA 1R8EA 5APQA 2N9YB 2MJZA 3L72D
chains in the Genus database with same CATH topology
3WU2E 4PJ0E 5B66E 1S5LE 2AXTE 1W5CE 5GTIE 4IL6E 5TISE 5GTHE 3JCUE 3KZIE 5KAFE 4UB8E 5KAIE 5B5EE 3A0HE 5H2FE 3A0BE 4UB6E 5E79E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 E;  4PJ0 E;  5B66 E;  1S5L E;  2AXT E;  1W5C E;  5GTI E;  4IL6 E;  5TIS E;  5GTH E;  3JCU E;  3KZI E;  5KAF E;  4UB8 E;  5KAI E;  5B5E E;  3A0H E;  5H2F E;  3A0B E;  4UB6 E;  5E79 E; 
#chains in the Genus database with same CATH topology
 1FZG A;  1GU5 A;  3I55 P;  1HTL C;  3LW5 H;  1ZN5 A;  1MZ9 A;  4PV1 D;  2OYO A;  5CCG C;  5APT A;  3L72 J;  3AE9 C;  1ZW0 A;  3L72 G;  3P8C D;  2W8Z A;  3CXH E;  3CCJ P;  1NU1 J;  2FYN B;  1W5C E;  1SQP K;  2JDI H;  3AE3 C;  2W6A A;  2WSF H;  4L73 A;  1H88 A;  1NU1 E;  1L0L K;  1JTH A;  1MFZ A;  2OYH C;  3USS A;  2NPS C;  2IZ0 A;  1URQ B;  3CWB J;  3P8C E;  1MV8 A;  5KKZ C;  5AVQ B;  3P8M C;  1FDO A;  3CWB E;  1N73 B;  3CD6 P;  1YI2 P;  4OGQ D;  4JQ0 D;  3AE5 C;  2ZYA A;  5CBO A;  1JY2 N;  1SFC C;  1JM0 A;  3CCS P;  3V6I A;  1SQQ K;  1PPJ D;  3CCV P;  1DIP A;  3H1K D;  1YJN P;  1FU1 A;  3RBX A;  3VMZ A;  2QM8 A;  1ZRT D;  2W83 C;  1YIT P;  2ZVO B;  2IBZ D;  4XE5 B;  2H89 C;  1N7S C;  2BCC D;  4B86 A;  1NTK J;  1PPJ G;  4UB6 H;  2WPS A;  3OJA B;  3H1K G;  3RBZ A;  2XDJ A;  1L0N E;  2WTY A;  1FBM A;  1NTK E;  2V7Q H;  1AVY A;  1ZR4 A;  3NMD A;  2IBZ G;  3HUS B;  2BCC G;  3M0A A;  1X0T A;  1IFM A;  2WSC H;  1JY3 N;  1LWU B;  1JCC A;  1KYO D;  1P84 H;  5KLV J;  3ITK A;  1LNQ A;  2J58 A;  5KLV E;  1KTM A;  1P84 I;  2B88 A;  2NRG A;  4BRY A;  1SQX K;  2FYN C;  1PGO A;  1BE3 J;  3U59 A;  3LID A;  1OIP A;  2XKM A;  1BE3 E;  3S9O A;  3CCM P;  3TYY A;  2JR8 A;  1XTC C;  1T3J A;  5AVR B;  3L75 D;  2N9B A;  4W80 A;  3MTU E;  1GD2 E;  4CPG A;  1VF5 B;  3AE8 C;  3GMA A;  2C9L Y;  3II6 A;  1KQS O;  2AEM A;  2QJY B;  2ZXE B;  4GT1 A;  3U1A A;  1SQQ D;  4C7N A;  1PP9 D;  1RF1 B;  1IFN A;  1KB9 E;  3L75 G;  5L8R J;  2QVA A;  2K9Y A;  3RK2 B;  1EDJ A;  2WZ7 A;  3G6E P;  3W68 A;  2BEZ F;  3CLQ A;  4H44 C;  4EDF A;  1SQQ G;  1PP9 G;  3L4F A;  1Y47 A;  4PJ0 E;  2R44 A;  5AVT B;  5GTI E;  1QL1 A;  4EIJ A;  4YTP C;  3CMA P;  1DD3 A;  3L73 D;  1JY2 O;  3KZI H;  3CC7 P;  2I1J A;  1LWU C;  3HE4 A;  2L5G B;  1L4A B;  3L70 J;  2C0X A;  1HBW A;  1EXJ A;  2W90 A;  2QJP C;  2C9N Y;  5AW2 B;  2QJK B;  3L73 J;  3L73 G;  3M06 A;  3L70 E;  1J1D B;  4KJM A;  5AVW B;  1N8R Q;  3V2R A;  1NO4 A;  1LTA C;  4XFJ A;  3U1C A;  1YJW P;  2E74 D;  4DT0 A;  4YXD C;  1U7J A;  1SQV D;  3ABV C;  4ASW A;  1Q81 Q;  1M57 D;  1FDI A;  3H6P A;  1ZOY C;  2AXC A;  1X9V A;  1ZR2 A;  2XZR A;  1SQV G;  2QEX P;  1S5L E;  4H0L D;  1VF5 C;  4PD4 D;  3A5T A;  1KV4 A;  1W2E A;  5AW1 B;  2WSS H;  3A3Y B;  4DCK A;  2QJY C;  3BVH A;  4Y99 B;  2E42 A;  2O3J A;  1JTH B;  3A2A A;  1HF9 A;  2W6J H;  3CCR P;  3VYI A;  3RK3 B;  1OW6 A;  2IYP A;  3RK2 C;  1S72 P;  5APY A;  1NGM B;  3HD7 C;  2H88 C;  2FKW B;  2A06 E;  1BDC A;  1FZB A;  3F5H A;  2N1T C;  3SSU A;  4IFF A;  3VMY A;  5KAI H;  2C0W A;  1BGY E;  1NTM J;  4A7P A;  5CHX A;  5APX A;  2IDB A;  1E5W A;  1AV1 A;  3BRT B;  1QLE D;  1NTM E;  1NH4 A;  4O9B A;  5M1B A;  1AJY A;  1FJP A;  1NVO A;  1EZV E;  4PV1 B;  2LR2 A;  3WUV A;  2LKM A;  1S4X A;  1S2E A;  3H1I D;  2R5D A;  2Q3E A;  1M8O B;  2JWA A;  3PTZ A;  1QGK B;  1BCC D;  4UB8 H;  5AW5 B;  2RN0 A;  2CPS A;  4H13 D;  1IFI A;  3H1I G;  3M0D A;  2DW3 A;  2QM7 A;  3KHU A;  4IL6 H;  1IFD A;  1M90 Q;  1BCC G;  1NJI Q;  4BRY B;  2R3C A;  1JMM A;  1LTB C;  5KTB A;  1BDD A;  2WPQ A;  1RF0 C;  2ZYG A;  5AVY B;  3L35 A;  2ZT9 D;  1MKM A;  4Y99 C;  2RH0 A;  1VQ9 P;  3RK3 C;  3V4Q A;  5AW9 B;  4OWF A;  1IFP A;  3N7N A;  2WWW A;  5AW0 B;  5KKZ B;  3O6Q A;  3VP8 A;  1VQ6 P;  1GW4 A;  1HGV A;  2KS1 A;  5B5E E;  4C7R A;  1LTG C;  2IZ1 A;  2KP8 A;  1Z56 A;  1SP4 A;  2QSI A;  2KZI A;  1SFC B;  1OVU A;  2POH A;  3H32 A;  4WWI A;  1K05 A;  3JCU E;  2WQY C;  1NAY A;  4I7Z C;  3LW5 J;  4JBZ A;  4W7Z A;  2CK3 H;  1SQB J;  2Q1K A;  2B87 A;  2P58 A;  4PV1 C;  4N78 D;  1SQB E;  2I8D A;  2FFD A;  4RJT A;  3D6Y A;  3H1H J;  1GDT A;  1M7L A;  2O01 N;  5KAF E;  3H1J J;  3FXD A;  3AEA C;  1Q86 Q;  2K9J B;  2FYU J;  2WSF J;  1L0N K;  2A45 I;  1YYC A;  3CX5 E;  3H1H E;  1NTK K;  3RK3 E;  3CCU P;  4I6M C;  2B89 A;  3H1J E;  3HE4 B;  2FYU E;  3MP7 B;  2KIK A;  4OH8 B;  4DZO A;  2NZ2 A;  3BRV B;  3SWY A;  3OA7 A;  1LP1 A;  5BVZ A;  2KB7 P;  4BXL A;  2WSE H;  3CC2 P;  2QA4 P;  1N7L A;  2KSE A;  3JC2 2;  2FXO A;  2ZYD A;  2CPB A;  3L72 E;  3P32 A;  4OGQ C;  1RF0 A;  1EC5 A;  5B66 H;  5CCH D;  2WPR A;  1Q7Y Q;  4KT0 J;  3AE2 C;  3RL0 D;  1HH0 A;  2K37 A;  1FZA A;  3WU2 E;  1TU3 F;  1YJ9 P;  3GHG A;  1VQ4 P;  1KMI Z;  1DEE G;  1NTZ D;  3Q3D A;  1P84 D;  1K04 A;  3HE5 A;  3M9H A;  1IJD B;  3TSI A;  4UB6 E;  3CME P;  2E75 D;  2V7Q J;  3E1I A;  2RKL A;  2YNY A;  3NFQ A;  1S5L X;  1NTZ J;  1GK4 A;  3B4S A;  2WSC J;  1NTZ G;  3CXH H;  1G2C B;  3PH0 A;  1HVV A;  5CJ0 A;  1VQP P;  4AYC A;  4H44 B;  1NHL A;  3CXH I;  3A7O A;  3I56 P;  1QX8 A;  2HFE D;  4OVN F;  3L74 G;  2PRR A;  1EDL A;  2Z5H A;  2YXQ B;  4M3L A;  3RL0 g;  5TIS E;  3H1K J;  3K5B A;  3B5N D;  1N2D C;  2E74 B;  1WT6 A;  1PPJ E;  1DX7 A;  1S3J A;  1Q2N A;  3VMX A;  2M5A A;  3SFE C;  3H1K E;  4GIF A;  3WUU A;  4AUW A;  2BCC J;  2ZXX A;  5CCH A;  1KIL D;  1ZRT E;  3PRJ A;  3QH9 A;  1QVG O;  1VQK P;  1K9M Q;  1FE6 A;  1T6A A;  2AXT E;  3C8V A;  2HOD A;  1LTS C;  4IL6 X;  2IBZ E;  2BCC E;  5GTH E;  4EOT A;  3MGN A;  2D2C D;  2QJP B;  1PGP A;  1SQP D;  4MN4 C;  3FWN A;  2G8Y A;  1FOS F;  3T97 A;  3VOP A;  2GA1 A;  2GUV A;  1L0L D;  4DOJ A;  4LC1 A;  1VQ7 P;  1VPC A;  3SWF A;  2XV5 A;  1KYO E;  1SQP G;  2W6B A;  4L74 A;  1LJ2 A;  1KC8 Q;  3H25 A;  1ZME C;  3MUD A;  1JNM A;  2K3R A;  1YQ4 C;  1L0L G;  1DH3 A;  3A0H H;  5KJ7 D;  2JP3 A;  1S9K D;  1YTZ I;  4RKU J;  2K88 A;  3NXS A;  5K5G B;  1GL2 C;  1FZC A;  2KK7 A;  2QIW A;  1FJK A;  1M1J A;  1LTT C;  3HTK B;  1SLQ A;  4U7J A;  4JYB A;  4RES B;  1LT9 C;  3L75 J;  1RE4 A;  3B5N A;  2LXB A;  1GTW A;  1JUN A;  4C46 A;  3O6Q B;  3Q5R A;  2O1K A;  1EXI A;  3L75 E;  3MD0 A;  2YMY A;  2KS1 B;  1SQQ J;  3HD7 B;  1KIL A;  2E5Y A;  1PP9 J;  2KNC B;  2UWJ E;  3C1L A;  2N1T B;  1GL2 D;  1Q82 Q;  5E79 E;  1SQQ E;  1Y9B A;  3BCC D;  3KQG A;  3L36 A;  3JSV C;  3V2Q A;  5H2F H;  1PP9 E;  4ZKU A;  3H32 B;  1LTJ A;  3GLM A;  1T2K D;  1KYO I;  3E7K A;  2E74 C;  1GK6 A;  4H13 B;  1H8A A;  3WMM 0;  2AEF A;  1RHZ B;  1OX3 A;  1NTM K;  4EI2 A;  2KLV A;  2YO2 A;  3BCC G;  3G71 P;  2RMZ A;  2YKO A;  1KZU B;  1KQG B;  1USD A;  1HWT C;  1KB9 H;  1DD4 A;  1SQX D;  3SWK A;  2YXR B;  1T3U A;  4H0L C;  5KJ7 A;  1OVV A;  2E5T A;  4HJG H;  1KB9 I;  3L73 E;  3H1L D;  1VQ5 P;  3L37 A;  4DJG A;  2ZT9 B;  5KLI B;  1K73 Q;  3M91 A;  4NPD A;  2I1K A;  2H43 A;  3QWO C;  4PJ0 H;  1SQX G;  3M0D C;  3KPE A;  3UIA A;  5GTI H;  1J1E C;  3GW6 A;  1NKN A;  4NPE A;  1QVF O;  3H1L J;  1JY3 O;  3H1L G;  1R5S A;  4HB1 A;  4L76 A;  4WBA A;  5APU A;  5TJH A;  1G1I A;  1SQV J;  4JPZ B;  2P10 A;  3AEC C;  1GZL A;  3MIW A;  4WY4 C;  1SQV E;  2YKQ A;  1IFJ A;  1M1K Q;  1YHQ P;  1GL2 A;  3V4W A;  3Q1M A;  1GU4 A;  4TT3 H;  2B9B A;  1R5L A;  1LT9 A;  1OVR A;  5AW3 B;  3CPW O;  5CJ4 A;  4PD4 E;  3HE5 B;  1M56 D;  3AE1 C;  1FZF A;  1N73 A;  2Z4E A;  2KUB A;  4WY4 D;  2J5U A;  3L71 D;  4R4M A;  3EQ2 A;  3P7K A;  3HRN A;  1GW3 A;  2E43 A;  2WVR A;  1S5L H;  1FC2 C;  4H13 C;  1E79 H;  4AQR D;  4I7Z B;  3SFD C;  3CCL P;  1SS1 A;  3D71 A;  1S1C X;  3L71 G;  2Q9I A;  2FFD C;  3VN0 A;  2ZVN B;  2KYV A;  1PIX A;  2OAR A;  2M5A B;  1MUU A;  1JMB A;  3Q5P A;  4I1L A;  5EFW B;  4WB4 A;  3HUS A;  2AEJ A;  5KLI C;  2ZT9 C;  1KQF B;  2HOD B;  1RE3 A;  3H1I J;  3F89 A;  2FYU K;  2OYI C;  1X8Y A;  1KFM A;  1IZN B;  4ASV A;  3H1I E;  1BCC J;  3T97 B;  2KLU A;  5APW A;  5CMZ A;  3S4R A;  1BCC E;  3A0B H;  3AEG C;  1HJB A;  5AVS B;  3G9R A;  1VDF A;  4OGQ B;  2E75 B;  1LTI C;  4WY4 A;  3D70 A;  1L4A D;  2G3A A;  4N6J A;  2O1J A;  3RGU A;  1NU1 K;  3GHG C;  3TNU A;  2M3E A;  1EZV I;  1AVO A;  1ZV8 A;  2Q6Q A;  2KSJ A;  2A45 G;  2P7J A;  2HLO A;  2ZAE B;  3V5B A;  3AE4 C;  3GF7 A;  3VTP C;  4U3F D;  4C7N B;  1W2B O;  1RF1 A;  3B5N B;  4D6T D;  3TGU D;  3LIE A;  3R4Y A;  2XNX A;  5APV A;  1YTZ T;  1KIL B;  4JYC A;  4U3F G;  1A02 F;  2WPV B;  4D6T G;  1EDK A;  3VP9 A;  2WSE J;  5DJT B;  3TGU G;  2WT7 A;  2A45 H;  1LTJ B;  3Q2Y A;  4Z1M H;  2PP6 A;  1UIX A;  1Q90 D;  1OFC X;  1NOH A;  1QL2 A;  5CCH C;  3GF3 A;  5B5E H;  2M8R A;  1SVF A;  1H0T A;  1IK7 A;  1L4A A;  4W7Y A;  2OQQ A;  3RL0 C;  2OGU A;  3NTN A;  1FDM A;  3AE7 C;  4N78 E;  2OYI A;  3CXH D;  4HH2 A;  2E76 D;  1RQU A;  3BAT A;  3FGA D;  5KLV K;  4R4L A;  1U57 A;  1BSN A;  1NU1 D;  5AW8 B;  2O01 H;  4N3Y B;  2YIU B;  2E75 C;  1A02 J;  4ZNC A;  2JO1 A;  3MUD C;  5KAF H;  1PGJ A;  2M3B A;  1JCD A;  3CX5 H;  1NU1 G;  1FZC C;  2ZJS E;  3CWB D;  1M1J C;  1GL2 B;  4NPF X;  3EFG A;  2Q7C A;  3CX5 I;  3C9I A;  1RE4 C;  3B5N C;  1UII A;  2R3S A;  1LT9 B;  1IC2 A;  4RO0 A;  3W67 A;  5CCG D;  3CWB G;  2Y9Z A;  3Q5S A;  3L74 D;  1KIL C;  2GUS A;  2Y0D A;  1MFT A;  1NTZ E;  4IFM A;  4GOE A;  3G3Z A;  2D2C C;  1P84 E;  3OAK A;  1RY3 A;  1NAF A;  1QEX A;  1FS0 E;  1L0N D;  1LTJ C;  1LGH B;  4ZMD A;  4K3A A;  3L74 J;  2K1A A;  2OTL P;  1NTK D;  4TLF A;  3WU2 H;  3IF4 A;  1FAV A;  4GKG A;  2NPS D;  1VQ8 P;  3L74 E;  2KZJ A;  1CI6 A;  4KHX A;  3WUT A;  1WRG A;  2JWD A;  5AVZ B;  5BU8 B;  3TK1 A;  1L0N J;  3MZW B;  1L0N G;  1NTK G;  5KLV D;  1AFO A;  5APS A;  3IFM A;  3CI9 A;  1SFC D;  5KJ7 C;  3OW2 O;  1AQ5 A;  4H0L B;  3A0H E;  2HPC A;  2Y0E A;  1VQL P;  2OYH A;  1D7M A;  2HYN A;  2LXC B;  4GDO A;  5KLV G;  1KIL E;  2YIU C;  1BE3 D;  1SQP J;  4GOD A;  1HJ0 A;  4IOI H;  1N7S D;  3R2P A;  2ZFC A;  1J1E B;  5TIS H;  1NKZ B;  2PFX A;  5CCG A;  1OW8 A;  4YXW H;  1SQP E;  5DJU B;  2OTK E;  1WMK A;  4HYT B;  2IFN A;  5CBN A;  1L0L J;  5BU5 A;  1ZLL A;  2IPP A;  1PV3 A;  1BE3 G;  3EFF K;  1LT1 A;  4WY4 B;  1L0L E;  2AXT H;  1IK9 A;  1KQL A;  2JKV A;  1IO4 A;  5GTH H;  1JOC A;  1KB9 D;  1SQV K;  5AVX B;  2J59 M;  2GM4 A;  1DEB A;  5H2F E;  1T2K C;  3PHL A;  3TNU B;  5AW4 B;  1URQ C;  5C39 A;  3B71 A;  2NPS A;  1OW7 A;  1CSB A;  2IBZ I;  1K8A Q;  3KZI E;  1S9K E;  1N73 C;  3KYQ A;  3S1K A;  3TF5 A;  1KYO H;  2V4H A;  1JB0 J;  1G1J A;  2VRS A;  3CCQ P;  1HGZ A;  1SFC A;  1FOS E;  1PL5 A;  1PFI A;  1NWQ A;  3V2N A;  3MHV A;  1URQ D;  2FXP A;  3O8Z A;  4EYY Q;  3BAS A;  2B87 B;  3BCC J;  3M9B A;  2WT7 B;  3FX0 A;  5AW6 B;  1N7S A;  3D6Z A;  2PAJ A;  4YPC A;  2FFD B;  3L70 D;  3BCC E;  1YIJ P;  2R32 A;  1KD1 Q;  2K9J A;  2JJL A;  3HUS C;  4I2L C;  1H0T B;  4BWN A;  1RE3 C;  2XND H;  4H44 D;  3L70 G;  5E79 H;  1SQX J;  3CCE P;  2OYI B;  1LP1 B;  2KI7 B;  2PGD A;  1SQX E;  3CL3 D;  1AQT A;  2P67 A;  1RH5 B;  3ZDM A;  3IAO A;  3I5C A;  1PGQ A;  1KOR A;  2Z5I A;  1CW5 A;  2Q3I A;  1OMI A;  3H1L E;  1OWA A;  2FY8 A;  5KAI E;  2XU6 A;  1X22 A;  1KN7 A;  3GHG B;  4LGD E;  2YO3 A;  1URQ A;  2QE7 H;  2FXM A;  1XTG B;  2A06 D;  2Q5U A;  1ZXG A;  1JY2 P;  3IN6 A;  1FZE A;  2Y0C A;  2P2U A;  1BGY D;  1RF1 C;  4Y28 J;  4XA4 A;  1JO5 A;  2HG5 D;  3PLN A;  3IR9 A;  1CZQ A;  3FXE A;  2A06 G;  1USE A;  1NTM D;  1Y8A A;  2QRX A;  1G2C A;  2FYZ A;  2H7H A;  1NYH A;  1VL2 A;  3PP5 A;  1OZH A;  3E1R A;  1BGY J;  4UB8 E;  1BGY G;  1EZV D;  1VF5 D;  2YKP A;  3AE6 C;  3KXD A;  2IYO A;  2QG4 A;  1YBK A;  3L71 J;  3KDP B;  5AW7 B;  1AA0 A;  1OXZ A;  1NTM G;  4IL6 E;  2E76 B;  2M0B A;  1VQO P;  3L71 E;  1SQB K;  1JY3 P;  1EZV G;  1CI6 B;  2ITA A;  3A0B E;  3RK2 D;  1VQN P;  4PD4 H;  3B8E B;  2MKV A;  1L4A C;  3HD7 D;  2SPZ A;  1LWU A;  2YMK A;  2BAS A;  2N1T D;  2QJK C;  3RL0 B;  3EWK A;  3AED C;  4PD4 I;  1J1D C;  2WMM A;  1T8Z A;  2HPC B;  2IFM A;  3PJS K;  2OYH B;  2H8P D;  4LLH A;  3AEE C;  3N4X A;  1VQM P;  2P1J A;  2KXP B;  4QMA A;  4JF7 A;  2FBW C;  1ZP0 C;  3FWL A;  5AVV B;  1L2P A;  4HKZ H;  1FZC B;  1H89 A;  2KOG A;  1M1J B;  1GMJ A;  2IX7 C;  3HTK A;  2R5B A;  3TDK A;  1JEK A;  1U7M A;  2NPS B;  2W27 A;  1HUC A;  3AEF C;  3G4S P;  4IFD K;  4K35 A;  4U3F J;  4ZKP A;  3HD7 A;  2OTJ P;  2BEQ D;  4D6T J;  2KNC A;  1SQB D;  2N1T A;  4L75 A;  1NTZ K;  4GOF A;  2D2C B;  3TGU J;  1BSH A;  2L91 A;  4U3F E;  2E76 C;  4D6T E;  3TGU E;  2Y9Y A;  3CX5 D;  2O01 J;  3V2P A;  3H1H D;  3CC4 P;  1YQ3 C;  3RK3 D;  3H1J D;  2WIT A;  1EQ7 A;  2FYU D;  1SQB G;  1X79 B;  5AVU B;  3VMA A;  1N7S B;  5B66 E;  3M9Q A;  2HR3 A;  1PZQ A;  1RQV A;  2JEE A;  3AEB C;  3H1H G;  3GG2 A;  1EDI A;  3H1J G;  1N86 A;  4WVZ A;  1J2J B;  2FYU G;  3JCU H;  1KFN A;  1R8E A;  5APQ A;  2N9Y B;  2MJZ A;  3L72 D; 
#chains in the Genus database with same CATH homology
 3WU2 E;  4PJ0 E;  5B66 E;  1S5L E;  2AXT E;  1W5C E;  5GTI E;  4IL6 E;  5TIS E;  5GTH E;  3JCU E;  3KZI E;  5KAF E;  4UB8 E;  5KAI E;  5B5E E;  3A0H E;  5H2F E;  3A0B E;  4UB6 E;  5E79 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...