5B5EH

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b5eH01
5B5EH 4UB8H 1S5LH 5GTHH 5B66H 3A0BH 3KZIH 4IL6H 5H2FH 5E79H 5KAFH 3JCUH 3WU2H 4UB6H 5TISH 2AXTH 5GTIH 3A0HH 4PJ0H 5KAIH
chains in the Genus database with same CATH superfamily
1OZHA 4IL6E 2RN0A 4I2LC 4U7JA 2QM8A 1LT9B 3AE5C 2E74C 3M91A 3JCUH 1VL2A 1IFNA 3TNUB 1EDLA 1JEKA 3CPWO 3V2PA 1QGKB 4N3YB 1L4AA 1EZVE 1Y9BA 2IPPA 3KXDA 1LT9C 2Q3IA 1VF5D 3VMXA 1S72P 4NPEA 3H1LG 1BSNA 3H1JD 2J59M 1Y8AA 2FKWB 1NTZG 1Q90D 2BEQD 3TGUD 1H0TA 1GU4A 4BRYA 1OVUA 1HUCA 1NTKE 1S5LE 1JOCA 1GU5A 5M1BA 2V4HA 1VQ8P 1N7SD 2KK7A 3RK3B 1J2JB 5KAIE 3AEAC 3L4FA 5TISH 5APUA 3BASA 4C46A 2WSSH 3PRJA 4YXDC 3RL0B 2OTJP 2XZRA 2W90A 1NVOA 1BGYJ 1URQD 4RJTA 2R5DA 2RMZA 3Q5RA 1SFCA 3RK3C 1D7MA 2CK3H 1PP9J 3VN0A 3H1JG 1KFNA 5AW6B 2E74D 3L72E 1H88A 2E43A 3RL0C 3G6EP 4BWNA 2FXOA 3BATA 2KNCB 3A0HE 2M5AA 3AEDC 2OYHB 5KJ7A 3CWBJ 1RE3C 1KYOH 1FZCB 5CMZA 1SQBE 2ITAA 1YITP 1NU1E 3TF5A 4GOFA 2IBZE 2OYHC 1FDIA 3P7KA 1L4AB 1A02J 3L73J 1HGVA 1OW7A 2LKMA 1SQQK 2W8ZA 1FZCC 1KYOD 3II6A 3NFQA 2KYVA 1EQ7A 1W5CE 3H32A 2Y0DA 3I5CA 4W7YA 2Y0CA 1SQPG 4PJ0E 3RK2B 1GD2E 1X8YA 2OQQA 2M3EA 1JY3P 1EZVI 2R3SA 1X79B 1AVYA 1YJNP 1L0LE 3Q1MA 2PP6A 1SQVE 4BRYB 4YPCA 1SQXK 2AXTE 1MFZA 2ZYDA 3V2QA 3PH0A 3RK2C 2O1JA 1EXIA 2AEFA 1DX7A 1IJDB 1JY3O 1KILE 1VDFA 1LWUB 4N78D 1JM0A 3RK3D 5CCGC 1WRGA 4IL6X 2E76B 4DT0A 1RHZB 3CCJP 2K88A 2E42A 1FU1A 1LJ2A 2P1JA 1MKMA 1WT6A 1BE3G 3I55P 2XDJA 4D6TE 3RL0D 2WT7B 2KLUA 2H8PD 5B5EE 3D71A 4IFMA 1LWUC 3U59A 3H1JJ 2E76C 1X0TA 3TGUJ 4H0LB 2NPSB 3L74G 3KDPB 1EDIA 4PV1B 3L71G 5KTBA 3B71A 4EIJA 2K3RA 1JMMA 2M5AB 3IFMA 4H0LC 2E75C 2XNDH 2NPSC 3OJAB 1VQ7P 2KLVA 5APQA 3NXSA 1IFJA 1SP4A 3VP8A 1ZW0A 2FXMA 3PP5A 1S5LX 1R5SA 2A06G 4PV1C 3CMEP 2I1JA 3H1HD 5DJTB 3AE3C 1KQLA 4UB8H 2Q1KA 2OYIA 4IOIH 3WU2E 3M06A 2BCCG 5KJ7C 3QH9A 4YXWH 2O1KA 1GZLA 1SQQD 4DZOA 1FZFA 1JTHB 1L0NG 3TDKA 1OFCX 2B87A 3RK2D 2QRXA 3M0AA 2ZFCA 2IBZI 3MZWB 5CCGD 4I7ZB 1P84E 2PRRA 3AE2C 5TJHA 1Z56A 3GF3A 1RE4A 3B4SA 1SVFA 2LXCB 1SQXD 4ASVA 4LGDE 2E76D 1Y47A 3AE9C 1VQ5P 2HPCA 1LTAC 5GTIH 2QE7H 5AVXB 4GDOA 4U3FG 1R5LA 3AE1C 3H1IE 5B66H 3O8ZA 2WPSA 3KPEA 5AW5B 1XTGB 3L70G 2FXPA 3H1KE 5E79H 1BCCE 1PFIA 3ZDMA 3M0DC 1BDCA 5EFWB 3L74J 1NTME 4H0LD 1IFMA 1GK4A 2E75D 2NPSD 3HTKB 3KZIE 5AW0B 1NTKK 3A5TA 4PV1D 1YTZI 1R8EA 5KJ7D 2Y9ZA 4HKZH 2OTLP 2K1AA 3Q2YA 5H2FE 5CCHA 1YI2P 1LTJA 1KILA 1LNQA 1M1JA 4WY4A 2M8RA 3AE7C 4NPDA 1RF1B 3A3YB 2Q5UA 2OYIB 3M9BA 5BU8B 3V6IA 3P8CD 2WSEJ 4H44B 3VOPA 2MKVA 2XKMA 4C7NA 1VQNP 1FZGA 2IFMA 3S4RA 2FBWC 1HWTC 2B87B 3WMM0 3AE4C 1RF1C 1N2DC 1SS1A 5KLVG 2OYIC 3L75D 5CJ4A 1PGQA 2JDIH 2I1KA 1NYHA 1NGMB 5AVRB 4H44C 1VQ4P 3HD7A 1T6AA 2YIUB 2WSFJ 5AVVB 1ZOYC 3H25A 4GIFA 1RF0A 2RKLA 1FOSE 4R4LA 3HUSB 5AW1B 1SQBK 3MD0A 1WMKA 1NJIQ 2WPRA 1BGYG 4GOEA 1NU1K 3V4WA 1M7LA 3AEFC 2HPCB 3H1HJ 1P84I 2PAJA 1PP9G 4RKUJ 4IFFA 1S2EA 2YIUC 1USEA 1EZVD 2IX7C 3RBZA 1KFMA 3HUSC 3P32A 1IO4A 4K35A 1S5LH 1SQQJ 2KUBA 2BASA 3LIDA 5APWA 3QWOC 5C39A 3CWBG 2POHA 3F5HA 1L0LK 1LGHB 2QIWA 3N4XA 1SQVK 5KAIH 2FYUK 1U57A 4AYCA 3H1LE 1NTKD 1U7JA 1NTZE 3PJSK 3L73G 4L75A 1SQXJ 2QEXP 3E1RA 3D6YA 1KILB 1DEEG 2W6JH 3NTNA 5AVQB 2IYOA 2FY8A 1IK9A 2Q6QA 3CCUP 3CCSP 2JWDA 2P67A 2QJKB 2JJLA 4QMAA 1KTMA 4TT3H 4H44D 1AVOA 3A0HH 1KILC 4HJGH 1JY2N 2A45G 1CSBA 3WUUA 3JSVC 5KLVJ 2O01H 2CPBA 1TU3F 2ZAEB 3AE8C 1FOSF 3L72D 3CCLP 2WMMA 2XV5A 2OGUA 3BCCE 4NPFX 1EDKA 1EXJA 1PV3A 3KHUA 1YJ9P 2J58A 1MV8A 1FBMA 1JO5A 3N7NA 1SQBD 5APXA 4KT0J 3C9IA 4PJ0H 3A2AA 3TGUG 1NU1D 1EDJA 2IBZD 4BXLA 1RF0C 1S9KE 3C8VA 3B5NB 1N73B 1A02F 4B86A 2HFED 1ZLLA 1NKNA 1E5WA 2AXTH 2KOGA 3LW5H 3FWNA 4DCKA 3SWKA 1FAVA 3Q5PA 4RESB 5AW3B 3L75J 1JUNA 4UB6E 3L72G 2WWWA 2Y0EA 2PFXA 3CX5H 1L0LD 1ZRTE 2P7JA 3B5NC 1N73C 3KQGA 1SQVD 3MIWA 2N1TA 3TSIA 1T3JA 5APYA 5AVUB 2FYUD 1AFOA 5B5EH 1SQPE 3H6PA 5DJUB 3VP9A 3FGAD 4ZKPA 1KILD 3T97A 3CC2P 1KC8Q 3CX5D 1L4AC 4D6TD 1H0TB 2VRSA 3E7KA 1OIPA 3IR9A 1KN7A 1KQFB 2MJZA 3CMAP 3BVHA 1NTMK 5AW4B 2FYUE 2KB7P 3CLQA 1Q7YQ 3MTUE 1BE3E 2ZXEB 1GK6A 1G1JA 2R3CA 3RL0g 1BSHA 1MFTA 2L91A 2Z5IA 5AW8B 1PGPA 2KZIA 3CX5E 3IN6A 1NTKJ 3MGNA 3WU2H 1ZXGA 2HODA 3G3ZA 2HLOA 2QSIA 3Q5SA 2ZXXA 1OVVA 3L74E 2HR3A 2WTYA 4R4MA 1SFCB 1Q82Q 2HYNA 3L71E 2B88A 2M3BA 3L37A 4XFJA 1QL1A 1P84H 3CC4P 5KKZB 1H8AA 3B5ND 1SFCC 3U1AA 2A06E 1GW4A 3CI9A 2PGDA 2FFDA 3L72J 4A7PA 2BCCE 5GTHE 2IDBA 3LIEA 2JP3A 3HE4A 5KKZC 4Y99B 1P84D 1HGZA 1L4AD 2N1TB 1OWAA 3GF7A 1NAFA 1L0NE 4KHXA 3GLMA 2NRGA 2FYZA 2O01J 2QVAA 4Z1MH 2C9LY 1K04A 1LTIC 3CXHE 1SQBJ 3H32B 4EDFA 4ZNCA 4Y99C 2H43A 1JNMA 4IFDK 3KZIH 2YMKA 1NU1J 4HH2A 3H1ID 2QG4A 2JEEA 3V2NA 3H1KD 1BCCD 1N7SA 1W2EA 3GG2A 1HBWA 4C7RA 1YJWP 4JF7A 1NTMD 5H2FH 1G1IA 1IZNB 4U3FE 1T3UA 4JBZA 4GKGA 1AQ5A 1K9MQ 2AXCA 2H89C 4I7ZC 3U1CA 1L0LJ 3L70E 1NTZK 2QJYB 1SQVJ 3H1HG 1K05A 1URQA 3EWKA 3TYYA 2YKOA 3LW5J 2WVRA 2KI7B 1FJKA 1VQ6P 1GMJA 1VQPP 1LTSC 1FZEA 2Y9YA 1DD3A 1SFCD 2ZVNB 3D6ZA 3O6QA 1ZMEC 1UIIA 1SQQG 3CX5I 2QJYC 2J5UA 1JMBA 4D6TJ 2CPSA 1E79H 5AW9B 2N9BA 3AEBC 2YKQA 1HJBA 2XU6A 1VPCA 1PPJD 4OVNF 2W83C 4JYBA 2YXRB 1X22A 1H89A 1Q81Q 3EQ2A 2FFDB 2C0XA 5KAFE 3B8EB 1SQXG 1YTZT 1KB9E 1NHLA 2LXBA 3AE6C 2LR2A 2KZJA 3FXEA 1KV4A 2KS1A 1RH5B 2BEZF 3G71P 1LP1A 4Y28J 1SLQA 3CD6P 2FFDC 4ASWA 3Q3DA 2YKPA 2OYOA 3I56P 1JCCA 1PPJE 3R2PA 5CJ0A 1FJPA 2G3AA 2DW3A 1EC5A 1NH4A 2JR8A 3VMZA 4DJGA 1AJYA 3SFDC 1BGYE 1AQTA 4JQ0D 2WPVB 3CXHI 1CI6A 3GHGA 1PP9E 2WSCH 2JKVA 4OWFA 1NWQA 5APVA 1AA0A 2H88C 4W7ZA 1KQSO 1AV1A 1JY2P 2Q9IA 1SQPK 3R4YA 1QEXA 3H1LD 1RE4C 4WWIA 1NTZD 1GDTA 2KSJA 3CWBE 1GL2A 1IFPA 2G8YA 1RE3A 3K5BA 2Z4EA 3CC7P 1KZUB 1ZP0C 1RQVA 1X9VA 4XE5B 2KNCA 1KQGB 3NMDA 3L75G 2XNXA 3A0BE 3H1IJ 2OYHA 3AECC 3L73E 3RGUA 4YTPC 3H1KJ 1FZBA 1FZCA 1BCCJ 2FYNB 1NTMJ 2P10A 5KLIB 3IF4A 1LTJB 1PIXA 3MHVA 1M1JB 2K9JA 4WY4B 1CW5A 3L35A 4HB1A 3CCQP 4PD4E 2FYNC 2KS1B 4OH8B 1N8RQ 1PL5A 4ZMDA 5K5GB 1FDOA 3G9RA 2GM4A 1EZVG 1LP1B 5APTA 1MZ9A 1OXZA 3BCCD 5CCHC 5KLIC 2KSEA 1LTJC 1M1JC 1KB9I 3JC22 4WY4C 4C7NB 1T8ZA 5CCGA 1FDMA 1FE6A 1BDDA 3OW2O 1HTLC 5CBOA 1PZQA 2GUSA 2Z5HA 1S1CX 4UB6H 2QJKC 1KORA 3SSUA 4M3LA 1S9KD 3AEEC 3IAOA 3HD7B 2R44A 2H7HA 2P58A 1FZAA 1LWUA 5AVZB 3JCUE 1NTKG 1CI6B 1NKZB 1HVVA 3H1JE 3WUTA 3GHGB 4N6JA 2AEMA 3FXDA 3TGUE 1VQOP 4LLHA 5CBNA 2NZ2A 4L73A 3SFEC 2QA4P 5AW2B 2WT7A 2D2CB 1L0NK 1DEBA 1IFDA 1ZRTD 3HD7C 1ZR2A 1W2BO 3A7OA 3S9OA 2Q3EA 1HF9A 2WPQA 2W6BA 1J1EB 3GHGC 1SQPD 1ZN5A 1GL2B 4KJMA 1FC2C 1VQKP 3BCCG 2NPSA 3V5BA 2D2CC 5AVYB 2WITA 3V2RA 1PGJA 3VTPC 1J1EC 1OW6A 3PLNA 2N9YB 3MP7B 1GL2C 2K37A 4EYYQ 4DOJA 1ZV8A 3VYIA 3VMAA 1OVRA 1DD4A 3CCEP 1BE3D 5CCHD 1QX8A 5TISE 2GA1A 1VQ9P 3MUDA 4WY4D 2K9JB 3HRNA 2ZJSE 3BRVB 1SQBG 3L36A 3H1LJ 1QVGO 1K73Q 1NTZJ 1NU1G 1IC2A 2IBZG 3CCRP 2P2UA 1JTHA 2WSCJ 1L2PA 1T2KC 4L74A 1YQ4C 3GMAA 3L74D 1HJ0A 3L71D 2R5BA 1VQMP 2B9BA 2IZ0A 4PD4I 2A45I 2GUVA 3RBXA 5GTHH 3CL3D 4EOTA 2WZ7A 4WB4A 3SWYA 3M9QA 1UIXA 1L0LG 1KYOE 3USSA 3HD7D 2W27A 2ZVOB 1USDA 1SQVG 2WSEH 1YBKA 2ZT9B 2A06D 3W68A 2FYUG 3M0DA 1LTTC 4WBAA 2O3JA 1KMIZ 3EFFK 1JCDA 2BCCD 1YHQP 3CXHH 2C9NY 1YYCA 2D2CD 3PTZA 1S4XA 1DIPA 2V7QH 3P8MC 5BVZA 5APSA 2ZT9C 5KLVK 4D6TG 4H13B 1L0ND 1GTWA 2WSFH 2ZYGA 3C1LA 2YO2A 3BCCJ 1GW3A 2QJPB 1GL2D 4EI2A 2E75B 3HTKA 4N78E 1XTCC 1G2CA 3RK3E 4K3AA 3TK1A 3CXHD 3F89A 1IK7A 3FWLA 4HYTB 4RO0A 4XA4A 1QLED 2JWAA 1MUUA 3ABVC 4H13C 3ITKA 3FX0A 2IYPA 1JY3N 2QJPC 4AQRD 2RH0A 3S1KA 4OGQB 1S3JA 3CCMP 3HE5A 1ZR4A 1T2KD 3AEGC 3OA7A 4I6MC 3UIAA 1RF1A 4U3FD 1YIJP 3T97B 4AUWA 1RQUA 5AVSB 5AVTB 2IFNA 3L70D 4GT1A 1VQLP 2N1TC 4OGQC 1Q86Q 1YQ3C 2E5TA 1SQPJ 5CHXA 2JO1A 2UWJE 1M57D 3MUDC 2OARA 3V4QA 1IFIA 5L8RJ 2KIKA 3H1HE 5KAFH 3WUVA 1LT1A 1PGOA 4LC1A 3D70A 4L76A 1KB9H 3EFGA 3PHLA 3HUSA 1DH3A 2FYUJ 2ZT9D 2HODB 1SQQE 2W6AA 1BE3J 2YO3A 1M1KQ 4UB8E 2IZ1A 1OMIA 1RY3A 1M8OB 1KB9D 2KP8A 2KXPB 1KYOI 2QM7A 1N86A 5AW7B 4H13D 3CCVP 1LT9A 3H1IG 2YMYA 1N7LA 3GW6A 1SQXE 2C0WA 5KLVD 1J1DB 3H1KG 3L71J 1G2CB 1Q2NA 2ZYAA 4W80A 1U7MA 1BCCG 3TNUA 1M90Q 2AEJA 1NTMG 2E5YA 2K9YA 1NOHA 3BRTB 3VMYA 3HE4B 1VF5B 2N1TD 1K8AQ 1J1DC 1BGYD 4OGQD 5BU5A 2B89A 4GODA 5AVWB 3OAKA 3HE5B 1PP9D 5KLVE 1OX3A 5GTIE 2BCCJ 2O01N 5B66E 4O9BA 1VF5C 4WVZA 1NAYA 2M0BA 2I8DA 5E79E 1L0NJ 3A0BH 1LTBC 3KYQA 3W67A 1OW8A 4JPZB 4IL6H 1HH0A 3CWBD 3SWFA 1N7SB 3G4SP 2YXQB 1PPJG 1JB0J 1NO4A 2V7QJ 4ZKUA 1LTGC 2WQYC 2L5GB 1M56D 3L73D 4PD4H 3P8CE 3M9HA 2A45H 1URQB 1KD1Q 2SPZA 2OTKE 1N7SC 4TLFA 1CZQA 4I1LA 1QL2A 4U3FJ 1FS0E 3E1IA 3L75E 2E74B 3O6QB 2YNYA 4CPGA 1JY2O 4MN4C 3L70J 4PD4D 1URQC 2Q7CA 1QVFO 3B5NA 1N73A 2R32A 2HG5D 4JYCA
chains in the Genus database with same CATH topology
5B5EH 4UB8H 1S5LH 5GTHH 5B66H 3A0BH 3KZIH 4IL6H 5H2FH 5E79H 5KAFH 3JCUH 3WU2H 4UB6H 5TISH 2AXTH 5GTIH 3A0HH 4PJ0H 5KAIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E H;  4UB8 H;  1S5L H;  5GTH H;  5B66 H;  3A0B H;  3KZI H;  4IL6 H;  5H2F H;  5E79 H;  5KAF H;  3JCU H;  3WU2 H;  4UB6 H;  5TIS H;  2AXT H;  5GTI H;  3A0H H;  4PJ0 H;  5KAI H; 
#chains in the Genus database with same CATH topology
 1OZH A;  4IL6 E;  2RN0 A;  4I2L C;  4U7J A;  2QM8 A;  1LT9 B;  3AE5 C;  2E74 C;  3M91 A;  3JCU H;  1VL2 A;  1IFN A;  3TNU B;  1EDL A;  1JEK A;  3CPW O;  3V2P A;  1QGK B;  4N3Y B;  1L4A A;  1EZV E;  1Y9B A;  2IPP A;  3KXD A;  1LT9 C;  2Q3I A;  1VF5 D;  3VMX A;  1S72 P;  4NPE A;  3H1L G;  1BSN A;  3H1J D;  2J59 M;  1Y8A A;  2FKW B;  1NTZ G;  1Q90 D;  2BEQ D;  3TGU D;  1H0T A;  1GU4 A;  4BRY A;  1OVU A;  1HUC A;  1NTK E;  1S5L E;  1JOC A;  1GU5 A;  5M1B A;  2V4H A;  1VQ8 P;  1N7S D;  2KK7 A;  3RK3 B;  1J2J B;  5KAI E;  3AEA C;  3L4F A;  5TIS H;  5APU A;  3BAS A;  4C46 A;  2WSS H;  3PRJ A;  4YXD C;  3RL0 B;  2OTJ P;  2XZR A;  2W90 A;  1NVO A;  1BGY J;  1URQ D;  4RJT A;  2R5D A;  2RMZ A;  3Q5R A;  1SFC A;  3RK3 C;  1D7M A;  2CK3 H;  1PP9 J;  3VN0 A;  3H1J G;  1KFN A;  5AW6 B;  2E74 D;  3L72 E;  1H88 A;  2E43 A;  3RL0 C;  3G6E P;  4BWN A;  2FXO A;  3BAT A;  2KNC B;  3A0H E;  2M5A A;  3AED C;  2OYH B;  5KJ7 A;  3CWB J;  1RE3 C;  1KYO H;  1FZC B;  5CMZ A;  1SQB E;  2ITA A;  1YIT P;  1NU1 E;  3TF5 A;  4GOF A;  2IBZ E;  2OYH C;  1FDI A;  3P7K A;  1L4A B;  1A02 J;  3L73 J;  1HGV A;  1OW7 A;  2LKM A;  1SQQ K;  2W8Z A;  1FZC C;  1KYO D;  3II6 A;  3NFQ A;  2KYV A;  1EQ7 A;  1W5C E;  3H32 A;  2Y0D A;  3I5C A;  4W7Y A;  2Y0C A;  1SQP G;  4PJ0 E;  3RK2 B;  1GD2 E;  1X8Y A;  2OQQ A;  2M3E A;  1JY3 P;  1EZV I;  2R3S A;  1X79 B;  1AVY A;  1YJN P;  1L0L E;  3Q1M A;  2PP6 A;  1SQV E;  4BRY B;  4YPC A;  1SQX K;  2AXT E;  1MFZ A;  2ZYD A;  3V2Q A;  3PH0 A;  3RK2 C;  2O1J A;  1EXI A;  2AEF A;  1DX7 A;  1IJD B;  1JY3 O;  1KIL E;  1VDF A;  1LWU B;  4N78 D;  1JM0 A;  3RK3 D;  5CCG C;  1WRG A;  4IL6 X;  2E76 B;  4DT0 A;  1RHZ B;  3CCJ P;  2K88 A;  2E42 A;  1FU1 A;  1LJ2 A;  2P1J A;  1MKM A;  1WT6 A;  1BE3 G;  3I55 P;  2XDJ A;  4D6T E;  3RL0 D;  2WT7 B;  2KLU A;  2H8P D;  5B5E E;  3D71 A;  4IFM A;  1LWU C;  3U59 A;  3H1J J;  2E76 C;  1X0T A;  3TGU J;  4H0L B;  2NPS B;  3L74 G;  3KDP B;  1EDI A;  4PV1 B;  3L71 G;  5KTB A;  3B71 A;  4EIJ A;  2K3R A;  1JMM A;  2M5A B;  3IFM A;  4H0L C;  2E75 C;  2XND H;  2NPS C;  3OJA B;  1VQ7 P;  2KLV A;  5APQ A;  3NXS A;  1IFJ A;  1SP4 A;  3VP8 A;  1ZW0 A;  2FXM A;  3PP5 A;  1S5L X;  1R5S A;  2A06 G;  4PV1 C;  3CME P;  2I1J A;  3H1H D;  5DJT B;  3AE3 C;  1KQL A;  4UB8 H;  2Q1K A;  2OYI A;  4IOI H;  3WU2 E;  3M06 A;  2BCC G;  5KJ7 C;  3QH9 A;  4YXW H;  2O1K A;  1GZL A;  1SQQ D;  4DZO A;  1FZF A;  1JTH B;  1L0N G;  3TDK A;  1OFC X;  2B87 A;  3RK2 D;  2QRX A;  3M0A A;  2ZFC A;  2IBZ I;  3MZW B;  5CCG D;  4I7Z B;  1P84 E;  2PRR A;  3AE2 C;  5TJH A;  1Z56 A;  3GF3 A;  1RE4 A;  3B4S A;  1SVF A;  2LXC B;  1SQX D;  4ASV A;  4LGD E;  2E76 D;  1Y47 A;  3AE9 C;  1VQ5 P;  2HPC A;  1LTA C;  5GTI H;  2QE7 H;  5AVX B;  4GDO A;  4U3F G;  1R5L A;  3AE1 C;  3H1I E;  5B66 H;  3O8Z A;  2WPS A;  3KPE A;  5AW5 B;  1XTG B;  3L70 G;  2FXP A;  3H1K E;  5E79 H;  1BCC E;  1PFI A;  3ZDM A;  3M0D C;  1BDC A;  5EFW B;  3L74 J;  1NTM E;  4H0L D;  1IFM A;  1GK4 A;  2E75 D;  2NPS D;  3HTK B;  3KZI E;  5AW0 B;  1NTK K;  3A5T A;  4PV1 D;  1YTZ I;  1R8E A;  5KJ7 D;  2Y9Z A;  4HKZ H;  2OTL P;  2K1A A;  3Q2Y A;  5H2F E;  5CCH A;  1YI2 P;  1LTJ A;  1KIL A;  1LNQ A;  1M1J A;  4WY4 A;  2M8R A;  3AE7 C;  4NPD A;  1RF1 B;  3A3Y B;  2Q5U A;  2OYI B;  3M9B A;  5BU8 B;  3V6I A;  3P8C D;  2WSE J;  4H44 B;  3VOP A;  2MKV A;  2XKM A;  4C7N A;  1VQN P;  1FZG A;  2IFM A;  3S4R A;  2FBW C;  1HWT C;  2B87 B;  3WMM 0;  3AE4 C;  1RF1 C;  1N2D C;  1SS1 A;  5KLV G;  2OYI C;  3L75 D;  5CJ4 A;  1PGQ A;  2JDI H;  2I1K A;  1NYH A;  1NGM B;  5AVR B;  4H44 C;  1VQ4 P;  3HD7 A;  1T6A A;  2YIU B;  2WSF J;  5AVV B;  1ZOY C;  3H25 A;  4GIF A;  1RF0 A;  2RKL A;  1FOS E;  4R4L A;  3HUS B;  5AW1 B;  1SQB K;  3MD0 A;  1WMK A;  1NJI Q;  2WPR A;  1BGY G;  4GOE A;  1NU1 K;  3V4W A;  1M7L A;  3AEF C;  2HPC B;  3H1H J;  1P84 I;  2PAJ A;  1PP9 G;  4RKU J;  4IFF A;  1S2E A;  2YIU C;  1USE A;  1EZV D;  2IX7 C;  3RBZ A;  1KFM A;  3HUS C;  3P32 A;  1IO4 A;  4K35 A;  1S5L H;  1SQQ J;  2KUB A;  2BAS A;  3LID A;  5APW A;  3QWO C;  5C39 A;  3CWB G;  2POH A;  3F5H A;  1L0L K;  1LGH B;  2QIW A;  3N4X A;  1SQV K;  5KAI H;  2FYU K;  1U57 A;  4AYC A;  3H1L E;  1NTK D;  1U7J A;  1NTZ E;  3PJS K;  3L73 G;  4L75 A;  1SQX J;  2QEX P;  3E1R A;  3D6Y A;  1KIL B;  1DEE G;  2W6J H;  3NTN A;  5AVQ B;  2IYO A;  2FY8 A;  1IK9 A;  2Q6Q A;  3CCU P;  3CCS P;  2JWD A;  2P67 A;  2QJK B;  2JJL A;  4QMA A;  1KTM A;  4TT3 H;  4H44 D;  1AVO A;  3A0H H;  1KIL C;  4HJG H;  1JY2 N;  2A45 G;  1CSB A;  3WUU A;  3JSV C;  5KLV J;  2O01 H;  2CPB A;  1TU3 F;  2ZAE B;  3AE8 C;  1FOS F;  3L72 D;  3CCL P;  2WMM A;  2XV5 A;  2OGU A;  3BCC E;  4NPF X;  1EDK A;  1EXJ A;  1PV3 A;  3KHU A;  1YJ9 P;  2J58 A;  1MV8 A;  1FBM A;  1JO5 A;  3N7N A;  1SQB D;  5APX A;  4KT0 J;  3C9I A;  4PJ0 H;  3A2A A;  3TGU G;  1NU1 D;  1EDJ A;  2IBZ D;  4BXL A;  1RF0 C;  1S9K E;  3C8V A;  3B5N B;  1N73 B;  1A02 F;  4B86 A;  2HFE D;  1ZLL A;  1NKN A;  1E5W A;  2AXT H;  2KOG A;  3LW5 H;  3FWN A;  4DCK A;  3SWK A;  1FAV A;  3Q5P A;  4RES B;  5AW3 B;  3L75 J;  1JUN A;  4UB6 E;  3L72 G;  2WWW A;  2Y0E A;  2PFX A;  3CX5 H;  1L0L D;  1ZRT E;  2P7J A;  3B5N C;  1N73 C;  3KQG A;  1SQV D;  3MIW A;  2N1T A;  3TSI A;  1T3J A;  5APY A;  5AVU B;  2FYU D;  1AFO A;  5B5E H;  1SQP E;  3H6P A;  5DJU B;  3VP9 A;  3FGA D;  4ZKP A;  1KIL D;  3T97 A;  3CC2 P;  1KC8 Q;  3CX5 D;  1L4A C;  4D6T D;  1H0T B;  2VRS A;  3E7K A;  1OIP A;  3IR9 A;  1KN7 A;  1KQF B;  2MJZ A;  3CMA P;  3BVH A;  1NTM K;  5AW4 B;  2FYU E;  2KB7 P;  3CLQ A;  1Q7Y Q;  3MTU E;  1BE3 E;  2ZXE B;  1GK6 A;  1G1J A;  2R3C A;  3RL0 g;  1BSH A;  1MFT A;  2L91 A;  2Z5I A;  5AW8 B;  1PGP A;  2KZI A;  3CX5 E;  3IN6 A;  1NTK J;  3MGN A;  3WU2 H;  1ZXG A;  2HOD A;  3G3Z A;  2HLO A;  2QSI A;  3Q5S A;  2ZXX A;  1OVV A;  3L74 E;  2HR3 A;  2WTY A;  4R4M A;  1SFC B;  1Q82 Q;  2HYN A;  3L71 E;  2B88 A;  2M3B A;  3L37 A;  4XFJ A;  1QL1 A;  1P84 H;  3CC4 P;  5KKZ B;  1H8A A;  3B5N D;  1SFC C;  3U1A A;  2A06 E;  1GW4 A;  3CI9 A;  2PGD A;  2FFD A;  3L72 J;  4A7P A;  2BCC E;  5GTH E;  2IDB A;  3LIE A;  2JP3 A;  3HE4 A;  5KKZ C;  4Y99 B;  1P84 D;  1HGZ A;  1L4A D;  2N1T B;  1OWA A;  3GF7 A;  1NAF A;  1L0N E;  4KHX A;  3GLM A;  2NRG A;  2FYZ A;  2O01 J;  2QVA A;  4Z1M H;  2C9L Y;  1K04 A;  1LTI C;  3CXH E;  1SQB J;  3H32 B;  4EDF A;  4ZNC A;  4Y99 C;  2H43 A;  1JNM A;  4IFD K;  3KZI H;  2YMK A;  1NU1 J;  4HH2 A;  3H1I D;  2QG4 A;  2JEE A;  3V2N A;  3H1K D;  1BCC D;  1N7S A;  1W2E A;  3GG2 A;  1HBW A;  4C7R A;  1YJW P;  4JF7 A;  1NTM D;  5H2F H;  1G1I A;  1IZN B;  4U3F E;  1T3U A;  4JBZ A;  4GKG A;  1AQ5 A;  1K9M Q;  2AXC A;  2H89 C;  4I7Z C;  3U1C A;  1L0L J;  3L70 E;  1NTZ K;  2QJY B;  1SQV J;  3H1H G;  1K05 A;  1URQ A;  3EWK A;  3TYY A;  2YKO A;  3LW5 J;  2WVR A;  2KI7 B;  1FJK A;  1VQ6 P;  1GMJ A;  1VQP P;  1LTS C;  1FZE A;  2Y9Y A;  1DD3 A;  1SFC D;  2ZVN B;  3D6Z A;  3O6Q A;  1ZME C;  1UII A;  1SQQ G;  3CX5 I;  2QJY C;  2J5U A;  1JMB A;  4D6T J;  2CPS A;  1E79 H;  5AW9 B;  2N9B A;  3AEB C;  2YKQ A;  1HJB A;  2XU6 A;  1VPC A;  1PPJ D;  4OVN F;  2W83 C;  4JYB A;  2YXR B;  1X22 A;  1H89 A;  1Q81 Q;  3EQ2 A;  2FFD B;  2C0X A;  5KAF E;  3B8E B;  1SQX G;  1YTZ T;  1KB9 E;  1NHL A;  2LXB A;  3AE6 C;  2LR2 A;  2KZJ A;  3FXE A;  1KV4 A;  2KS1 A;  1RH5 B;  2BEZ F;  3G71 P;  1LP1 A;  4Y28 J;  1SLQ A;  3CD6 P;  2FFD C;  4ASW A;  3Q3D A;  2YKP A;  2OYO A;  3I56 P;  1JCC A;  1PPJ E;  3R2P A;  5CJ0 A;  1FJP A;  2G3A A;  2DW3 A;  1EC5 A;  1NH4 A;  2JR8 A;  3VMZ A;  4DJG A;  1AJY A;  3SFD C;  1BGY E;  1AQT A;  4JQ0 D;  2WPV B;  3CXH I;  1CI6 A;  3GHG A;  1PP9 E;  2WSC H;  2JKV A;  4OWF A;  1NWQ A;  5APV A;  1AA0 A;  2H88 C;  4W7Z A;  1KQS O;  1AV1 A;  1JY2 P;  2Q9I A;  1SQP K;  3R4Y A;  1QEX A;  3H1L D;  1RE4 C;  4WWI A;  1NTZ D;  1GDT A;  2KSJ A;  3CWB E;  1GL2 A;  1IFP A;  2G8Y A;  1RE3 A;  3K5B A;  2Z4E A;  3CC7 P;  1KZU B;  1ZP0 C;  1RQV A;  1X9V A;  4XE5 B;  2KNC A;  1KQG B;  3NMD A;  3L75 G;  2XNX A;  3A0B E;  3H1I J;  2OYH A;  3AEC C;  3L73 E;  3RGU A;  4YTP C;  3H1K J;  1FZB A;  1FZC A;  1BCC J;  2FYN B;  1NTM J;  2P10 A;  5KLI B;  3IF4 A;  1LTJ B;  1PIX A;  3MHV A;  1M1J B;  2K9J A;  4WY4 B;  1CW5 A;  3L35 A;  4HB1 A;  3CCQ P;  4PD4 E;  2FYN C;  2KS1 B;  4OH8 B;  1N8R Q;  1PL5 A;  4ZMD A;  5K5G B;  1FDO A;  3G9R A;  2GM4 A;  1EZV G;  1LP1 B;  5APT A;  1MZ9 A;  1OXZ A;  3BCC D;  5CCH C;  5KLI C;  2KSE A;  1LTJ C;  1M1J C;  1KB9 I;  3JC2 2;  4WY4 C;  4C7N B;  1T8Z A;  5CCG A;  1FDM A;  1FE6 A;  1BDD A;  3OW2 O;  1HTL C;  5CBO A;  1PZQ A;  2GUS A;  2Z5H A;  1S1C X;  4UB6 H;  2QJK C;  1KOR A;  3SSU A;  4M3L A;  1S9K D;  3AEE C;  3IAO A;  3HD7 B;  2R44 A;  2H7H A;  2P58 A;  1FZA A;  1LWU A;  5AVZ B;  3JCU E;  1NTK G;  1CI6 B;  1NKZ B;  1HVV A;  3H1J E;  3WUT A;  3GHG B;  4N6J A;  2AEM A;  3FXD A;  3TGU E;  1VQO P;  4LLH A;  5CBN A;  2NZ2 A;  4L73 A;  3SFE C;  2QA4 P;  5AW2 B;  2WT7 A;  2D2C B;  1L0N K;  1DEB A;  1IFD A;  1ZRT D;  3HD7 C;  1ZR2 A;  1W2B O;  3A7O A;  3S9O A;  2Q3E A;  1HF9 A;  2WPQ A;  2W6B A;  1J1E B;  3GHG C;  1SQP D;  1ZN5 A;  1GL2 B;  4KJM A;  1FC2 C;  1VQK P;  3BCC G;  2NPS A;  3V5B A;  2D2C C;  5AVY B;  2WIT A;  3V2R A;  1PGJ A;  3VTP C;  1J1E C;  1OW6 A;  3PLN A;  2N9Y B;  3MP7 B;  1GL2 C;  2K37 A;  4EYY Q;  4DOJ A;  1ZV8 A;  3VYI A;  3VMA A;  1OVR A;  1DD4 A;  3CCE P;  1BE3 D;  5CCH D;  1QX8 A;  5TIS E;  2GA1 A;  1VQ9 P;  3MUD A;  4WY4 D;  2K9J B;  3HRN A;  2ZJS E;  3BRV B;  1SQB G;  3L36 A;  3H1L J;  1QVG O;  1K73 Q;  1NTZ J;  1NU1 G;  1IC2 A;  2IBZ G;  3CCR P;  2P2U A;  1JTH A;  2WSC J;  1L2P A;  1T2K C;  4L74 A;  1YQ4 C;  3GMA A;  3L74 D;  1HJ0 A;  3L71 D;  2R5B A;  1VQM P;  2B9B A;  2IZ0 A;  4PD4 I;  2A45 I;  2GUV A;  3RBX A;  5GTH H;  3CL3 D;  4EOT A;  2WZ7 A;  4WB4 A;  3SWY A;  3M9Q A;  1UIX A;  1L0L G;  1KYO E;  3USS A;  3HD7 D;  2W27 A;  2ZVO B;  1USD A;  1SQV G;  2WSE H;  1YBK A;  2ZT9 B;  2A06 D;  3W68 A;  2FYU G;  3M0D A;  1LTT C;  4WBA A;  2O3J A;  1KMI Z;  3EFF K;  1JCD A;  2BCC D;  1YHQ P;  3CXH H;  2C9N Y;  1YYC A;  2D2C D;  3PTZ A;  1S4X A;  1DIP A;  2V7Q H;  3P8M C;  5BVZ A;  5APS A;  2ZT9 C;  5KLV K;  4D6T G;  4H13 B;  1L0N D;  1GTW A;  2WSF H;  2ZYG A;  3C1L A;  2YO2 A;  3BCC J;  1GW3 A;  2QJP B;  1GL2 D;  4EI2 A;  2E75 B;  3HTK A;  4N78 E;  1XTC C;  1G2C A;  3RK3 E;  4K3A A;  3TK1 A;  3CXH D;  3F89 A;  1IK7 A;  3FWL A;  4HYT B;  4RO0 A;  4XA4 A;  1QLE D;  2JWA A;  1MUU A;  3ABV C;  4H13 C;  3ITK A;  3FX0 A;  2IYP A;  1JY3 N;  2QJP C;  4AQR D;  2RH0 A;  3S1K A;  4OGQ B;  1S3J A;  3CCM P;  3HE5 A;  1ZR4 A;  1T2K D;  3AEG C;  3OA7 A;  4I6M C;  3UIA A;  1RF1 A;  4U3F D;  1YIJ P;  3T97 B;  4AUW A;  1RQU A;  5AVS B;  5AVT B;  2IFN A;  3L70 D;  4GT1 A;  1VQL P;  2N1T C;  4OGQ C;  1Q86 Q;  1YQ3 C;  2E5T A;  1SQP J;  5CHX A;  2JO1 A;  2UWJ E;  1M57 D;  3MUD C;  2OAR A;  3V4Q A;  1IFI A;  5L8R J;  2KIK A;  3H1H E;  5KAF H;  3WUV A;  1LT1 A;  1PGO A;  4LC1 A;  3D70 A;  4L76 A;  1KB9 H;  3EFG A;  3PHL A;  3HUS A;  1DH3 A;  2FYU J;  2ZT9 D;  2HOD B;  1SQQ E;  2W6A A;  1BE3 J;  2YO3 A;  1M1K Q;  4UB8 E;  2IZ1 A;  1OMI A;  1RY3 A;  1M8O B;  1KB9 D;  2KP8 A;  2KXP B;  1KYO I;  2QM7 A;  1N86 A;  5AW7 B;  4H13 D;  3CCV P;  1LT9 A;  3H1I G;  2YMY A;  1N7L A;  3GW6 A;  1SQX E;  2C0W A;  5KLV D;  1J1D B;  3H1K G;  3L71 J;  1G2C B;  1Q2N A;  2ZYA A;  4W80 A;  1U7M A;  1BCC G;  3TNU A;  1M90 Q;  2AEJ A;  1NTM G;  2E5Y A;  2K9Y A;  1NOH A;  3BRT B;  3VMY A;  3HE4 B;  1VF5 B;  2N1T D;  1K8A Q;  1J1D C;  1BGY D;  4OGQ D;  5BU5 A;  2B89 A;  4GOD A;  5AVW B;  3OAK A;  3HE5 B;  1PP9 D;  5KLV E;  1OX3 A;  5GTI E;  2BCC J;  2O01 N;  5B66 E;  4O9B A;  1VF5 C;  4WVZ A;  1NAY A;  2M0B A;  2I8D A;  5E79 E;  1L0N J;  3A0B H;  1LTB C;  3KYQ A;  3W67 A;  1OW8 A;  4JPZ B;  4IL6 H;  1HH0 A;  3CWB D;  3SWF A;  1N7S B;  3G4S P;  2YXQ B;  1PPJ G;  1JB0 J;  1NO4 A;  2V7Q J;  4ZKU A;  1LTG C;  2WQY C;  2L5G B;  1M56 D;  3L73 D;  4PD4 H;  3P8C E;  3M9H A;  2A45 H;  1URQ B;  1KD1 Q;  2SPZ A;  2OTK E;  1N7S C;  4TLF A;  1CZQ A;  4I1L A;  1QL2 A;  4U3F J;  1FS0 E;  3E1I A;  3L75 E;  2E74 B;  3O6Q B;  2YNY A;  4CPG A;  1JY2 O;  4MN4 C;  3L70 J;  4PD4 D;  1URQ C;  2Q7C A;  1QVF O;  3B5N A;  1N73 A;  2R32 A;  2HG5 D;  4JYC A; 
#chains in the Genus database with same CATH homology
 5B5E H;  4UB8 H;  1S5L H;  5GTH H;  5B66 H;  3A0B H;  3KZI H;  4IL6 H;  5H2F H;  5E79 H;  5KAF H;  3JCU H;  3WU2 H;  4UB6 H;  5TIS H;  2AXT H;  5GTI H;  3A0H H;  4PJ0 H;  5KAI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...