5B66E

Crystal structure analysis of photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 21
structure length 78
sequence length 78
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b66E00
4IL6E 5TISE 5GTIE 1W5CE 4UB6E 3WU2E 1S5LE 5E79E 3A0HE 3KZIE 5KAIE 4PJ0E 5B66E 5GTHE 4UB8E 5B5EE 5H2FE 5KAFE 2AXTE 3JCUE 3A0BE
chains in the Genus database with same CATH superfamily
1BDCA 1NTMK 2G8YA 2E75C 3BCCD 1URQD 1SQBG 1EZVE 5CCHA 1J2JB 2WTYA 1SQVJ 2BASA 4GOEA 1GDTA 2L5GB 2ZYGA 1T3JA 4H44B 1N7LA 1SQPE 4BRYA 3MZWB 1LTJC 1FDMA 2GM4A 4R4LA 3N7NA 3L73G 3VP9A 1LT1A 3M0AA 2JDIH 2ZXXA 4U3FG 1LGHB 4M3LA 3GMAA 1ZOYC 1YJNP 1NKNA 3M0DC 1EDJA 1PGPA 2MJZA 1T6AA 2H89C 1NTKD 2KNCB 1KB9I 4C46A 1EXIA 1BCCE 1HJBA 1PL5A 2N9YB 4EOTA 2BCCE 4GODA 5KKZC 3CI9A 1SQPG 1JMMA 2Q1KA 1L4AC 1ZR4A 1FE6A 3GHGA 1KYOE 2M0BA 3LIEA 1EXJA 3L74D 1SFCD 2AEMA 3P8CE 5GTHH 4U7JA 1BCCG 1P84H 1S72P 3L71E 1RE4C 2N1TD 2O1KA 3KDPB 1FC2C 2BCCG 3NFQA 2CPSA 5CJ4A 3PJSK 4OGQC 3A3YB 3NMDA 3L70D 4KJMA 4EYYQ 2JEEA 1NKZB 1RY3A 4BXLA 2E74C 4EI2A 1AVOA 5APWA 1QLED 1KILA 1ZRTE 1YQ3C 4PD4E 1JY2O 2B88A 3VMZA 1EQ7A 2OTLP 2Y0EA 1RF0A 5AVYB 4JF7A 4YPCA 3V6IA 4C7NA 1RHZB 3G9RA 3CMAP 3L71G 4PD4H 3B4SA 3W68A 4N78E 1EZVI 3L74J 3AE2C 2YNYA 2NPSC 2QJYC 1RF1C 4KHXA 1DD4A 2E76B 1VQ4P 1CSBA 1Y9BA 4N3YB 4DJGA 1URQA 3HRNA 1OZHA 4K3AA 3L70J 1PFIA 1YJWP 3AE4C 1W5CE 5AVXB 3M9HA 3AEBC 1BE3J 3V5BA 2KLUA 2SPZA 1H88A 1SP4A 1NH4A 1DD3A 4D6TD 1LTJA 5KJ7C 3LW5J 1QL1A 4UB8H 2H43A 2QRXA 2K3RA 4BWNA 3JC22 2A45H 1HTLC 1KMIZ 3GHGB 3Q1MA 3M0DA 1ZXGA 1GMJA 1KQFB 3HUSC 2LR2A 1N8RQ 1YJ9P 4IFMA 2KI7B 3N4XA 3B5ND 1VPCA 1KYOI 1P84D 5KLVD 3L35A 2KS1A 1FDOA 3BRVB 1L4AA 4O9BA 2JJLA 3L37A 1DIPA 1JY2N 3PHLA 1R8EA 2E43A 3R4YA 4D6TJ 4H44C 1Q82Q 3GW6A 1Q81Q 3CLQA 1KILB 2VRSA 2I1JA 2XNXA 1IJDB 3TK1A 2WVRA 1N2DC 4PD4I 4C7NB 3RK3B 3CPWO 3OAKA 2H8PD 2J5UA 1R5SA 5KLVJ 1L0NE 1FZAA 3SWFA 3MHVA 2K9YA 3LIDA 3MTUE 3RK2D 1NU1K 1URQB 2XV5A 5B5EH 3VOPA 3CCRP 2O01H 1VQ7P 3W67A 1USEA 3IF4A 1FZEA 3RL0D 2IPPA 1A02J 1SQQD 1AVYA 1S3JA 2IZ0A 1NTZG 1LTJB 2DW3A 1T3UA 2Q3EA 1L0NG 3H6PA 1OFCX 1OW8A 3S9OA 4IL6H 2KIKA 1CI6A 3CCVP 2AEJA 2YKPA 2IYPA 3WMM0 2RMZA 3CXHH 1YIJP 2G3AA 1GTWA 3CCLP 2YKQA 4IFFA 1TU3F 5L8RJ 1NU1J 2QJPB 2WPSA 5KJ7A 1S2EA 4N6JA 1Y8AA 2KS1B 5CCHC 2P7JA 3A7OA 1VQOP 5AW2B 1SQQJ 3I5CA 1VQMP 1OVUA 2I8DA 4AQRD 3HUSA 2W6BA 1KILE 2C0XA 2WPQA 1L0LK 3RL0g 2E76C 1PGJA 2XKMA 4I6MC 2K88A 5APVA 1BGYE 1L0LD 1NTZK 2P2UA 1GZLA 1LTAC 4QMAA 3A0HH 1BSHA 3D6YA 3RK3E 3SWKA 1LTIC 1PPJE 2RKLA 3IN6A 1KN7A 3HTKB 3OA7A 5KAIE 1SQVG 3D71A 2FYZA 1QX8A 5TISH 4AYCA 3H1IJ 1VQ5P 4H13D 1YTZT 2Z4EA 5KAIH 2IBZG 5M1BA 4K35A 2YMKA 5BU5A 1PGQA 4NPFX 1JMBA 3TGUJ 1T8ZA 1MV8A 3BASA 3GHGC 4L76A 1W2EA 4IL6X 3H25A 1PPJG 1L0LJ 2KNCA 3HD7D 4PJ0H 1SQXD 3CX5E 1GL2A 1K04A 4HH2A 3AEAC 1LTSC 1YBKA 1HVVA 2E42A 3JCUE 3CXHD 2NRGA 2PFXA 1SQVK 3HE4A 4UB6E 2JO1A 3KPEA 3JCUH 1N7SA 3QWOC 4UB6H 1LT9B 2HG5D 3Q3DA 1KILC 2KLVA 3IAOA 5CCGD 3KXDA 2W27A 2HPCA 1NJIQ 2HYNA 3H1JD 1VQ6P 4YXWH 4L75A 4RKUJ 1LTTC 3RK3C 1ZR2A 4HB1A 1SVFA 2W90A 3FXDA 3B5NB 2QM8A 4HYTB 3BVHA 3SSUA 1URQC 3L70E 3FX0A 4U3FE 4JQ0D 3RBZA 4I7ZB 1GD2E 1K8AQ 2FYUD 1BE3E 3CWBD 5KAFE 2WSFH 2WSEH 1KQSO 1EDLA 3L74G 1KD1Q 2GUSA 2PAJA 2KXPB 1WRGA 1KTMA 3L72D 5BVZA 3H1JJ 2Y0DA 2HLOA 1GK6A 1J1DB 4EIJA 3AEDC 3V2NA 1T2KC 4OH8B 3L70G 1M90Q 1NTKK 1IFMA 4GDOA 1KB9D 2IDBA 1E79H 1VF5D 3AEEC 4CPGA 1BE3G 1GL2B 1NGMB 2IFNA 2QJPC 3H1KD 2WPRA 2Q9IA 3BCCJ 3CX5I 2FYUJ 2Y9ZA 3CWBJ 5KTBA 1VQPP 3HE4B 3WUVA 2QG4A 4ZMDA 1EDKA 1N7SB 1SFCC 2M3BA 3FXEA 3KYQA 3CL3D 1KYOH 3BRTB 2NZ2A 4GKGA 2V7QJ 1SQBD 5CBNA 1S4XA 2XU6A 1PV3A 2ZFCA 2HPCB 2YKOA 1NTKJ 5CBOA 3O6QA 5KLVE 3F5HA 1LNQA 1UIXA 2ZVOB 3VMAA 2JR8A 1IFPA 3VP8A 3L4FA 3HE5A 1H8AA 1GU5A 3M06A 2C9NY 1SLQA 2JP3A 4PV1B 1YI2P 1OW6A 4B86A 1IC2A 3T97A 2O01N 1EZVD 1UIIA 3V4QA 1QEXA 2OYIB 3H32A 4A7PA 5AW4B 3CCUP 1HH0A 2HR3A 2WT7B 5AW8B 1JNMA 5KLVG 3V2PA 1M7LA 4JBZA 1LWUB 1MZ9A 1DEEG 1A02F 2B87A 2OYOA 1USDA 1FJKA 1ZLLA 2NPSD 1E5WA 1PZQA 2Y9YA 3FWNA 1NU1E 2YO3A 2ZT9B 1LT9C 3A5TA 1M8OB 1MKMA 1BCCD 1IFDA 2LXCB 3II6A 3V2RA 2YMYA 1HBWA 1MFTA 1YHQP 1X8YA 3SWYA 1M57D 3E1IA 1AQTA 1OVVA 3B5NC 2AXTE 2KB7P 4MN4C 1KYOD 5KLVK 2XDJA 2XZRA 1NU1G 3KZIE 2FXOA 4I7ZC 3P8CD 1HJ0A 1QL2A 4I1LA 3L71D 3H1IE 4RJTA 3O6QB 3P7KA 2P67A 2WPVB 1JY3O 1SQQG 3E1RA 3KQGA 3A2AA 1BCCJ 4XE5B 2AXCA 5AVQB 2OARA 3CMEP 1SFCA 1KFMA 2N1TA 2OTKE 3H1HD 5CJ0A 3TGUE 1J1DC 5C39A 3HE5B 5H2FE 4WB4A 4PD4D 5AW5B 3HTKA 1JOCA 1L0LE 3WU2E 3L75D 1JY3P 3T97B 1KV4A 1N73B 2BEQD 3AE1C 2IFMA 1NTZE 1W2BO 1IK9A 4H44D 3H32B 3H1IG 1GL2C 3VTPC 5DJTB 5AVWB 1FZBA 3CC2P 2OQQA 2D2CD 3GF3A 4W80A 4Y99B 3AE8C 2IYOA 2B87B 3TGUG 1BSNA 3TNUB 3VN0A 2WSCH 3TYYA 1SQQK 3VYIA 3G4SP 1N7SC 3H1HJ 1L0LG 1GK4A 3H1LD 3B71A 1VQ9P 2V4HA 1FOSE 1M56D 1JTHB 1LP1B 1S5LE 2HFED 3IR9A 4WY4D 1VDFA 1RQVA 3L75J 4RO0A 4DT0A 1Q90D 3GG2A 2PRRA 4IFDK 1FS0E 1VF5B 2P1JA 2M3EA 3S4RA 1ZMEC 1FOSF 2WITA 2FY8A 2POHA 4ASVA 4EDFA 1LT9A 3P8MC 5B66E 4XFJA 2A06D 1OVRA 2FFDA 5APXA 1SQVE 4C7RA 4PV1C 3C1LA 3H1LJ 2IBZE 2OYIC 4L73A 1Q86Q 1HUCA 3B5NA 1BDDA 1IO4A 2OGUA 2R3CA 1SFCB 1LTBC 1YTZI 4H0LD 2N1TB 1VQLP 1KQLA 1LWUC 4TT3H 1AA0A 5CCHD 5CHXA 5EFWB 4Y28J 3CD6P 1G2CB 5APQA 3L36A 2UWJE 2JWAA 2KYVA 2ZT9C 3AEGC 3BCCE 4YTPC 1RE3C 3MGNA 4OWFA 2I1KA 1IFIA 2FYUE 2Z5IA 5GTIE 3CWBE 4OVNF 3AE7C 3H1JG 1NYHA 2J59M 2ZAEB 3AE9C 1WT6A 1H0TB 1ZN5A 3AECC 3CCMP 2P58A 1PIXA 1NVOA 1FDIA 1SQXK 1S9KD 1S5LX 2M8RA 2Y0CA 2YXRB 2WQYC 1G1JA 3AE5C 1EDIA 2PP6A 2L91A 3BCCG 1NTKE 4YXDC 4W7ZA 3CX5H 1FJPA 5K5GB 2FYUG 3CWBG 1VQKP 3AEFC 1KORA 4DOJA 1R5LA 2W6JH 2KK7A 1X22A 3VMYA 2AEFA 1FZFA 2O01J 2K37A 2WZ7A 2KZIA 2FFDB 3A0BE 3C8VA 3GLMA 3GF7A 5KLIB 3CCEP 1XTCC 2H88C 1SQXJ 3L74E 1NTKG 5APYA 1N73C 4WWIA 2CPBA 2IBZI 1NAFA 1FU1A 3ITKA 1KILD 4HKZH 1G1IA 3MD0A 2W83C 1PP9D 1BGYD 2YO2A 2FYUK 4Y99C 1AQ5A 3RK3D 3IFMA 3Q5RA 2CK3H 5AVSB 1J1EB 2OYIA 2WT7A 1AV1A 1MFZA 2K1AA 2QJKB 4NPEA 5KAFH 1NTMD 2E75D 2FXMA 2JWDA 4TLFA 1LWUA 3LW5H 1D7MA 1CZQA 2Z5HA 3CCSP 4GIFA 1VF5C 4IOIH 2KZJA 5AW6B 2B89A 5AVUB 3JSVC 4AUWA 1PP9J 1BGYJ 2M5AA 1RE3A 4KT0J 3RK2B 2D2CB 3PRJA 3VMXA 3CX5D 1RQUA 3TDKA 2ZVNB 1T2KD 4R4MA 1EZVG 4D6TE 3HD7A 3RL0B 1NHLA 2W8ZA 3L72J 1GU4A 1JO5A 1NTMJ 3PP5A 5AW3B 3I56P 3NXSA 3ABVC 4WY4B 2N1TC 1AJYA 1JCCA 1SQBK 2OYHB 5AVZB 2KOGA 1L4AD 1U7MA 2QA4P 3R2PA 2FYNB 2H7HA 5AVTB 2KP8A 1LJ2A 5GTHE 1OMIA 3MP7B 1P84E 3H1KJ 2RN0A 2ZJSE 3I55P 4Z1MH 4D6TG 3TSIA 1M1JB 3L73D 5CCGA 2QIWA 4LGDE 3WUUA 1K73Q 3MUDC 1Z56A 1OXZA 2QVAA 4U3FD 1FZCA 4RESB 4DCKA 4OGQD 3H1HE 2WWWA 1N73A 4W7YA 3RBXA 1BE3D 4DZOA 2K9JA 1Q7YQ 4NPDA 2E74D 4H0LB 1JB0J 5APUA 1SQPK 1SQBJ 2R3SA 3L75E 1SQPD 1DH3A 2FKWB 1U7JA 3FWLA 1N86A 3M9QA 1DX7A 1YITP 1FBMA 3UIAA 4BRYB 1CW5A 1OIPA 4H13B 3TNUA 3L73J 1MUUA 2M5AB 3EFGA 1JY2P 3H1HG 5BU8B 1JTHA 1LP1A 4U3FJ 1K9MQ 4GOFA 2FFDC 2LKMA 2WSFJ 1FAVA 2WSEJ 2GA1A 2BCCD 1SQQE 3H1LE 3L75G 5KLIC 4HJGH 2WMMA 3BATA 4UB8E 3HD7B 2Q5UA 1SQPJ 5KJ7D 1AFOA 3Q5PA 1IK7A 2AXTH 3USSA 1HGVA 1GW4A 2O3JA 3PTZA 2MKVA 3G3ZA 4JYBA 3KZIH 2A06E 3EWKA 3G6EP 1XTGB 2RH0A 1IZNB 3OJAB 1H89A 3CCJP 1Y47A 3H1LG 1J1EC 3RGUA 1P84I 3U59A 2QJKC 1NAYA 2BCCJ 1JEKA 5APTA 1KQGB 5AW9B 4LC1A 1LTGC 2A45G 1PGOA 2B9BA 2Q7CA 1FZCB 1ZRTD 3PLNA 5H2FH 1G2CA 1QGKB 1HWTC 2K9JB 3CC4P 2A06G 4N78D 3WU2H 3RK2C 2D2CC 2PGDA 2KUBA 2FBWC 3EQ2A 3Q2YA 5AVVB 1RE4A 2YIUB 3K5BA 4ASWA 3L71J 2N9BA 3MUDA 3G71P 3M9BA 1H0TA 1NOHA 1ZW0A 5E79E 2GUVA 1ZV8A 2J58A 2QSIA 3CC7P 3RL0C 3V2QA 3WUTA 5B5EE 4JYCA 5E79H 1HF9A 2KSEA 1GL2D 2QM7A 1DEBA 2BEZF 2E75B 4WY4C 3D6ZA 1NU1D 2OYHC 2JKVA 5TJHA 1S9KE 1FZGA 1SQXE 3MIWA 2FYNC 3P32A 1S5LH 1YYCA 2NPSA 1RF1A 1SS1A 2C9LY 2R44A 4IL6E 1QVGO 1N7SD 3ZDMA 1JY3N 1HGZA 2KSJA 2FXPA 1M1JC 3E7KA 1JCDA 2ZYAA 3CXHE 1U57A 2HODA 4ZKUA 1KC8Q 2E5TA 2A45I 1JUNA 2XNDH 3B8EB 5AVRB 1RH5B 1EC5A 5B66H 1QVFO 1SQXG 3H1ID 4H0LC 5KKZB 3H1JE 3TF5A 2R32A 1L4AB 4ZNCA 3CCQP 1KFNA 3EFFK 4WBAA 4LLHA 4ZKPA 4PV1D 2QE7H 3TGUD 4XA4A 3A0HE 3OW2O 2WSSH 1VQ8P 4H13C 1X79B 1PP9E 1KZUB 2E76D 3S1KA 1NTZD 1L0NK 3SFDC 1JM0A 1X0TA 2R5BA 5TISE 3QH9A 2Q6QA 1L0ND 4WVZA 3O8ZA 3NTNA 3AE6C 3SFEC 1Q2NA 4OGQB 5GTIH 3D70A 3L72E 1NTME 1X9VA 3HD7C 1YQ4C 5AW0B 2E74B 2ZT9D 1ZP0C 1IFNA 1NO4A 1PP9G 1BGYG 2ZYDA 4PJ0E 1GW3A 2P10A 1KB9E 3Q5SA 2O1JA 2V7QH 3H1KE 2NPSB 1KB9H 2QJYB 1RF1B 1NTZJ 3M91A 1VL2A 1VQNP 3L72G 1L0NJ 1NTMG 4GT1A 3FGAD 5AW1B 5CCGC 2HODB 4WY4A 1CI6B 2R5DA 2OYHA 2E5YA 2WSCJ 3CXHI 3C9IA 2Q3IA 4I2LC 1FZCC 1NWQA 3U1AA 1OWAA 1SQVD 1L2PA 2ITAA 5CMZA 2LXBA 3A0BH 2IZ1A 2QEXP 2ZXEB 1IFJA 1SQBE 1OX3A 4JPZB 5APSA 2IBZD 3H1KG 2YXQB 1S1CX 2OTJP 3PH0A 2C0WA 2YIUC 3U1CA 1M1JA 1WMKA 1RF0C 2W6AA 3F89A 4L74A 5DJUB 3KHUA 1M1KQ 3HUSB 3L73E 1PPJD 1K05A 1OW7A 5AW7B 3AE3C 3V4WA 2IX7C
chains in the Genus database with same CATH topology
4IL6E 5TISE 5GTIE 1W5CE 4UB6E 3WU2E 1S5LE 5E79E 3A0HE 3KZIE 5KAIE 4PJ0E 5B66E 5GTHE 4UB8E 5B5EE 5H2FE 5KAFE 2AXTE 3JCUE 3A0BE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 E;  5TIS E;  5GTI E;  1W5C E;  4UB6 E;  3WU2 E;  1S5L E;  5E79 E;  3A0H E;  3KZI E;  5KAI E;  4PJ0 E;  5B66 E;  5GTH E;  4UB8 E;  5B5E E;  5H2F E;  5KAF E;  2AXT E;  3JCU E;  3A0B E; 
#chains in the Genus database with same CATH topology
 1BDC A;  1NTM K;  2G8Y A;  2E75 C;  3BCC D;  1URQ D;  1SQB G;  1EZV E;  5CCH A;  1J2J B;  2WTY A;  1SQV J;  2BAS A;  4GOE A;  1GDT A;  2L5G B;  2ZYG A;  1T3J A;  4H44 B;  1N7L A;  1SQP E;  4BRY A;  3MZW B;  1LTJ C;  1FDM A;  2GM4 A;  4R4L A;  3N7N A;  3L73 G;  3VP9 A;  1LT1 A;  3M0A A;  2JDI H;  2ZXX A;  4U3F G;  1LGH B;  4M3L A;  3GMA A;  1ZOY C;  1YJN P;  1NKN A;  3M0D C;  1EDJ A;  1PGP A;  2MJZ A;  1T6A A;  2H89 C;  1NTK D;  2KNC B;  1KB9 I;  4C46 A;  1EXI A;  1BCC E;  1HJB A;  1PL5 A;  2N9Y B;  4EOT A;  2BCC E;  4GOD A;  5KKZ C;  3CI9 A;  1SQP G;  1JMM A;  2Q1K A;  1L4A C;  1ZR4 A;  1FE6 A;  3GHG A;  1KYO E;  2M0B A;  3LIE A;  1EXJ A;  3L74 D;  1SFC D;  2AEM A;  3P8C E;  5GTH H;  4U7J A;  1BCC G;  1P84 H;  1S72 P;  3L71 E;  1RE4 C;  2N1T D;  2O1K A;  3KDP B;  1FC2 C;  2BCC G;  3NFQ A;  2CPS A;  5CJ4 A;  3PJS K;  4OGQ C;  3A3Y B;  3NMD A;  3L70 D;  4KJM A;  4EYY Q;  2JEE A;  1NKZ B;  1RY3 A;  4BXL A;  2E74 C;  4EI2 A;  1AVO A;  5APW A;  1QLE D;  1KIL A;  1ZRT E;  1YQ3 C;  4PD4 E;  1JY2 O;  2B88 A;  3VMZ A;  1EQ7 A;  2OTL P;  2Y0E A;  1RF0 A;  5AVY B;  4JF7 A;  4YPC A;  3V6I A;  4C7N A;  1RHZ B;  3G9R A;  3CMA P;  3L71 G;  4PD4 H;  3B4S A;  3W68 A;  4N78 E;  1EZV I;  3L74 J;  3AE2 C;  2YNY A;  2NPS C;  2QJY C;  1RF1 C;  4KHX A;  1DD4 A;  2E76 B;  1VQ4 P;  1CSB A;  1Y9B A;  4N3Y B;  4DJG A;  1URQ A;  3HRN A;  1OZH A;  4K3A A;  3L70 J;  1PFI A;  1YJW P;  3AE4 C;  1W5C E;  5AVX B;  3M9H A;  3AEB C;  1BE3 J;  3V5B A;  2KLU A;  2SPZ A;  1H88 A;  1SP4 A;  1NH4 A;  1DD3 A;  4D6T D;  1LTJ A;  5KJ7 C;  3LW5 J;  1QL1 A;  4UB8 H;  2H43 A;  2QRX A;  2K3R A;  4BWN A;  3JC2 2;  2A45 H;  1HTL C;  1KMI Z;  3GHG B;  3Q1M A;  3M0D A;  1ZXG A;  1GMJ A;  1KQF B;  3HUS C;  2LR2 A;  1N8R Q;  1YJ9 P;  4IFM A;  2KI7 B;  3N4X A;  3B5N D;  1VPC A;  1KYO I;  1P84 D;  5KLV D;  3L35 A;  2KS1 A;  1FDO A;  3BRV B;  1L4A A;  4O9B A;  2JJL A;  3L37 A;  1DIP A;  1JY2 N;  3PHL A;  1R8E A;  2E43 A;  3R4Y A;  4D6T J;  4H44 C;  1Q82 Q;  3GW6 A;  1Q81 Q;  3CLQ A;  1KIL B;  2VRS A;  2I1J A;  2XNX A;  1IJD B;  3TK1 A;  2WVR A;  1N2D C;  4PD4 I;  4C7N B;  3RK3 B;  3CPW O;  3OAK A;  2H8P D;  2J5U A;  1R5S A;  5KLV J;  1L0N E;  1FZA A;  3SWF A;  3MHV A;  2K9Y A;  3LID A;  3MTU E;  3RK2 D;  1NU1 K;  1URQ B;  2XV5 A;  5B5E H;  3VOP A;  3CCR P;  2O01 H;  1VQ7 P;  3W67 A;  1USE A;  3IF4 A;  1FZE A;  3RL0 D;  2IPP A;  1A02 J;  1SQQ D;  1AVY A;  1S3J A;  2IZ0 A;  1NTZ G;  1LTJ B;  2DW3 A;  1T3U A;  2Q3E A;  1L0N G;  3H6P A;  1OFC X;  1OW8 A;  3S9O A;  4IL6 H;  2KIK A;  1CI6 A;  3CCV P;  2AEJ A;  2YKP A;  2IYP A;  3WMM 0;  2RMZ A;  3CXH H;  1YIJ P;  2G3A A;  1GTW A;  3CCL P;  2YKQ A;  4IFF A;  1TU3 F;  5L8R J;  1NU1 J;  2QJP B;  2WPS A;  5KJ7 A;  1S2E A;  4N6J A;  1Y8A A;  2KS1 B;  5CCH C;  2P7J A;  3A7O A;  1VQO P;  5AW2 B;  1SQQ J;  3I5C A;  1VQM P;  1OVU A;  2I8D A;  4AQR D;  3HUS A;  2W6B A;  1KIL E;  2C0X A;  2WPQ A;  1L0L K;  3RL0 g;  2E76 C;  1PGJ A;  2XKM A;  4I6M C;  2K88 A;  5APV A;  1BGY E;  1L0L D;  1NTZ K;  2P2U A;  1GZL A;  1LTA C;  4QMA A;  3A0H H;  1BSH A;  3D6Y A;  3RK3 E;  3SWK A;  1LTI C;  1PPJ E;  2RKL A;  3IN6 A;  1KN7 A;  3HTK B;  3OA7 A;  5KAI E;  1SQV G;  3D71 A;  2FYZ A;  1QX8 A;  5TIS H;  4AYC A;  3H1I J;  1VQ5 P;  4H13 D;  1YTZ T;  2Z4E A;  5KAI H;  2IBZ G;  5M1B A;  4K35 A;  2YMK A;  5BU5 A;  1PGQ A;  4NPF X;  1JMB A;  3TGU J;  1T8Z A;  1MV8 A;  3BAS A;  3GHG C;  4L76 A;  1W2E A;  4IL6 X;  3H25 A;  1PPJ G;  1L0L J;  2KNC A;  3HD7 D;  4PJ0 H;  1SQX D;  3CX5 E;  1GL2 A;  1K04 A;  4HH2 A;  3AEA C;  1LTS C;  1YBK A;  1HVV A;  2E42 A;  3JCU E;  3CXH D;  2NRG A;  2PFX A;  1SQV K;  3HE4 A;  4UB6 E;  2JO1 A;  3KPE A;  3JCU H;  1N7S A;  3QWO C;  4UB6 H;  1LT9 B;  2HG5 D;  3Q3D A;  1KIL C;  2KLV A;  3IAO A;  5CCG D;  3KXD A;  2W27 A;  2HPC A;  1NJI Q;  2HYN A;  3H1J D;  1VQ6 P;  4YXW H;  4L75 A;  4RKU J;  1LTT C;  3RK3 C;  1ZR2 A;  4HB1 A;  1SVF A;  2W90 A;  3FXD A;  3B5N B;  2QM8 A;  4HYT B;  3BVH A;  3SSU A;  1URQ C;  3L70 E;  3FX0 A;  4U3F E;  4JQ0 D;  3RBZ A;  4I7Z B;  1GD2 E;  1K8A Q;  2FYU D;  1BE3 E;  3CWB D;  5KAF E;  2WSF H;  2WSE H;  1KQS O;  1EDL A;  3L74 G;  1KD1 Q;  2GUS A;  2PAJ A;  2KXP B;  1WRG A;  1KTM A;  3L72 D;  5BVZ A;  3H1J J;  2Y0D A;  2HLO A;  1GK6 A;  1J1D B;  4EIJ A;  3AED C;  3V2N A;  1T2K C;  4OH8 B;  3L70 G;  1M90 Q;  1NTK K;  1IFM A;  4GDO A;  1KB9 D;  2IDB A;  1E79 H;  1VF5 D;  3AEE C;  4CPG A;  1BE3 G;  1GL2 B;  1NGM B;  2IFN A;  2QJP C;  3H1K D;  2WPR A;  2Q9I A;  3BCC J;  3CX5 I;  2FYU J;  2Y9Z A;  3CWB J;  5KTB A;  1VQP P;  3HE4 B;  3WUV A;  2QG4 A;  4ZMD A;  1EDK A;  1N7S B;  1SFC C;  2M3B A;  3FXE A;  3KYQ A;  3CL3 D;  1KYO H;  3BRT B;  2NZ2 A;  4GKG A;  2V7Q J;  1SQB D;  5CBN A;  1S4X A;  2XU6 A;  1PV3 A;  2ZFC A;  2HPC B;  2YKO A;  1NTK J;  5CBO A;  3O6Q A;  5KLV E;  3F5H A;  1LNQ A;  1UIX A;  2ZVO B;  3VMA A;  2JR8 A;  1IFP A;  3VP8 A;  3L4F A;  3HE5 A;  1H8A A;  1GU5 A;  3M06 A;  2C9N Y;  1SLQ A;  2JP3 A;  4PV1 B;  1YI2 P;  1OW6 A;  4B86 A;  1IC2 A;  3T97 A;  2O01 N;  1EZV D;  1UII A;  3V4Q A;  1QEX A;  2OYI B;  3H32 A;  4A7P A;  5AW4 B;  3CCU P;  1HH0 A;  2HR3 A;  2WT7 B;  5AW8 B;  1JNM A;  5KLV G;  3V2P A;  1M7L A;  4JBZ A;  1LWU B;  1MZ9 A;  1DEE G;  1A02 F;  2B87 A;  2OYO A;  1USD A;  1FJK A;  1ZLL A;  2NPS D;  1E5W A;  1PZQ A;  2Y9Y A;  3FWN A;  1NU1 E;  2YO3 A;  2ZT9 B;  1LT9 C;  3A5T A;  1M8O B;  1MKM A;  1BCC D;  1IFD A;  2LXC B;  3II6 A;  3V2R A;  2YMY A;  1HBW A;  1MFT A;  1YHQ P;  1X8Y A;  3SWY A;  1M57 D;  3E1I A;  1AQT A;  1OVV A;  3B5N C;  2AXT E;  2KB7 P;  4MN4 C;  1KYO D;  5KLV K;  2XDJ A;  2XZR A;  1NU1 G;  3KZI E;  2FXO A;  4I7Z C;  3P8C D;  1HJ0 A;  1QL2 A;  4I1L A;  3L71 D;  3H1I E;  4RJT A;  3O6Q B;  3P7K A;  2P67 A;  2WPV B;  1JY3 O;  1SQQ G;  3E1R A;  3KQG A;  3A2A A;  1BCC J;  4XE5 B;  2AXC A;  5AVQ B;  2OAR A;  3CME P;  1SFC A;  1KFM A;  2N1T A;  2OTK E;  3H1H D;  5CJ0 A;  3TGU E;  1J1D C;  5C39 A;  3HE5 B;  5H2F E;  4WB4 A;  4PD4 D;  5AW5 B;  3HTK A;  1JOC A;  1L0L E;  3WU2 E;  3L75 D;  1JY3 P;  3T97 B;  1KV4 A;  1N73 B;  2BEQ D;  3AE1 C;  2IFM A;  1NTZ E;  1W2B O;  1IK9 A;  4H44 D;  3H32 B;  3H1I G;  1GL2 C;  3VTP C;  5DJT B;  5AVW B;  1FZB A;  3CC2 P;  2OQQ A;  2D2C D;  3GF3 A;  4W80 A;  4Y99 B;  3AE8 C;  2IYO A;  2B87 B;  3TGU G;  1BSN A;  3TNU B;  3VN0 A;  2WSC H;  3TYY A;  1SQQ K;  3VYI A;  3G4S P;  1N7S C;  3H1H J;  1L0L G;  1GK4 A;  3H1L D;  3B71 A;  1VQ9 P;  2V4H A;  1FOS E;  1M56 D;  1JTH B;  1LP1 B;  1S5L E;  2HFE D;  3IR9 A;  4WY4 D;  1VDF A;  1RQV A;  3L75 J;  4RO0 A;  4DT0 A;  1Q90 D;  3GG2 A;  2PRR A;  4IFD K;  1FS0 E;  1VF5 B;  2P1J A;  2M3E A;  3S4R A;  1ZME C;  1FOS F;  2WIT A;  2FY8 A;  2POH A;  4ASV A;  4EDF A;  1LT9 A;  3P8M C;  5B66 E;  4XFJ A;  2A06 D;  1OVR A;  2FFD A;  5APX A;  1SQV E;  4C7R A;  4PV1 C;  3C1L A;  3H1L J;  2IBZ E;  2OYI C;  4L73 A;  1Q86 Q;  1HUC A;  3B5N A;  1BDD A;  1IO4 A;  2OGU A;  2R3C A;  1SFC B;  1LTB C;  1YTZ I;  4H0L D;  2N1T B;  1VQL P;  1KQL A;  1LWU C;  4TT3 H;  1AA0 A;  5CCH D;  5CHX A;  5EFW B;  4Y28 J;  3CD6 P;  1G2C B;  5APQ A;  3L36 A;  2UWJ E;  2JWA A;  2KYV A;  2ZT9 C;  3AEG C;  3BCC E;  4YTP C;  1RE3 C;  3MGN A;  4OWF A;  2I1K A;  1IFI A;  2FYU E;  2Z5I A;  5GTI E;  3CWB E;  4OVN F;  3AE7 C;  3H1J G;  1NYH A;  2J59 M;  2ZAE B;  3AE9 C;  1WT6 A;  1H0T B;  1ZN5 A;  3AEC C;  3CCM P;  2P58 A;  1PIX A;  1NVO A;  1FDI A;  1SQX K;  1S9K D;  1S5L X;  2M8R A;  2Y0C A;  2YXR B;  2WQY C;  1G1J A;  3AE5 C;  1EDI A;  2PP6 A;  2L91 A;  3BCC G;  1NTK E;  4YXD C;  4W7Z A;  3CX5 H;  1FJP A;  5K5G B;  2FYU G;  3CWB G;  1VQK P;  3AEF C;  1KOR A;  4DOJ A;  1R5L A;  2W6J H;  2KK7 A;  1X22 A;  3VMY A;  2AEF A;  1FZF A;  2O01 J;  2K37 A;  2WZ7 A;  2KZI A;  2FFD B;  3A0B E;  3C8V A;  3GLM A;  3GF7 A;  5KLI B;  3CCE P;  1XTC C;  2H88 C;  1SQX J;  3L74 E;  1NTK G;  5APY A;  1N73 C;  4WWI A;  2CPB A;  2IBZ I;  1NAF A;  1FU1 A;  3ITK A;  1KIL D;  4HKZ H;  1G1I A;  3MD0 A;  2W83 C;  1PP9 D;  1BGY D;  2YO2 A;  2FYU K;  4Y99 C;  1AQ5 A;  3RK3 D;  3IFM A;  3Q5R A;  2CK3 H;  5AVS B;  1J1E B;  2OYI A;  2WT7 A;  1AV1 A;  1MFZ A;  2K1A A;  2QJK B;  4NPE A;  5KAF H;  1NTM D;  2E75 D;  2FXM A;  2JWD A;  4TLF A;  1LWU A;  3LW5 H;  1D7M A;  1CZQ A;  2Z5H A;  3CCS P;  4GIF A;  1VF5 C;  4IOI H;  2KZJ A;  5AW6 B;  2B89 A;  5AVU B;  3JSV C;  4AUW A;  1PP9 J;  1BGY J;  2M5A A;  1RE3 A;  4KT0 J;  3RK2 B;  2D2C B;  3PRJ A;  3VMX A;  3CX5 D;  1RQU A;  3TDK A;  2ZVN B;  1T2K D;  4R4M A;  1EZV G;  4D6T E;  3HD7 A;  3RL0 B;  1NHL A;  2W8Z A;  3L72 J;  1GU4 A;  1JO5 A;  1NTM J;  3PP5 A;  5AW3 B;  3I56 P;  3NXS A;  3ABV C;  4WY4 B;  2N1T C;  1AJY A;  1JCC A;  1SQB K;  2OYH B;  5AVZ B;  2KOG A;  1L4A D;  1U7M A;  2QA4 P;  3R2P A;  2FYN B;  2H7H A;  5AVT B;  2KP8 A;  1LJ2 A;  5GTH E;  1OMI A;  3MP7 B;  1P84 E;  3H1K J;  2RN0 A;  2ZJS E;  3I55 P;  4Z1M H;  4D6T G;  3TSI A;  1M1J B;  3L73 D;  5CCG A;  2QIW A;  4LGD E;  3WUU A;  1K73 Q;  3MUD C;  1Z56 A;  1OXZ A;  2QVA A;  4U3F D;  1FZC A;  4RES B;  4DCK A;  4OGQ D;  3H1H E;  2WWW A;  1N73 A;  4W7Y A;  3RBX A;  1BE3 D;  4DZO A;  2K9J A;  1Q7Y Q;  4NPD A;  2E74 D;  4H0L B;  1JB0 J;  5APU A;  1SQP K;  1SQB J;  2R3S A;  3L75 E;  1SQP D;  1DH3 A;  2FKW B;  1U7J A;  3FWL A;  1N86 A;  3M9Q A;  1DX7 A;  1YIT P;  1FBM A;  3UIA A;  4BRY B;  1CW5 A;  1OIP A;  4H13 B;  3TNU A;  3L73 J;  1MUU A;  2M5A B;  3EFG A;  1JY2 P;  3H1H G;  5BU8 B;  1JTH A;  1LP1 A;  4U3F J;  1K9M Q;  4GOF A;  2FFD C;  2LKM A;  2WSF J;  1FAV A;  2WSE J;  2GA1 A;  2BCC D;  1SQQ E;  3H1L E;  3L75 G;  5KLI C;  4HJG H;  2WMM A;  3BAT A;  4UB8 E;  3HD7 B;  2Q5U A;  1SQP J;  5KJ7 D;  1AFO A;  3Q5P A;  1IK7 A;  2AXT H;  3USS A;  1HGV A;  1GW4 A;  2O3J A;  3PTZ A;  2MKV A;  3G3Z A;  4JYB A;  3KZI H;  2A06 E;  3EWK A;  3G6E P;  1XTG B;  2RH0 A;  1IZN B;  3OJA B;  1H89 A;  3CCJ P;  1Y47 A;  3H1L G;  1J1E C;  3RGU A;  1P84 I;  3U59 A;  2QJK C;  1NAY A;  2BCC J;  1JEK A;  5APT A;  1KQG B;  5AW9 B;  4LC1 A;  1LTG C;  2A45 G;  1PGO A;  2B9B A;  2Q7C A;  1FZC B;  1ZRT D;  3PLN A;  5H2F H;  1G2C A;  1QGK B;  1HWT C;  2K9J B;  3CC4 P;  2A06 G;  4N78 D;  3WU2 H;  3RK2 C;  2D2C C;  2PGD A;  2KUB A;  2FBW C;  3EQ2 A;  3Q2Y A;  5AVV B;  1RE4 A;  2YIU B;  3K5B A;  4ASW A;  3L71 J;  2N9B A;  3MUD A;  3G71 P;  3M9B A;  1H0T A;  1NOH A;  1ZW0 A;  5E79 E;  2GUV A;  1ZV8 A;  2J58 A;  2QSI A;  3CC7 P;  3RL0 C;  3V2Q A;  3WUT A;  5B5E E;  4JYC A;  5E79 H;  1HF9 A;  2KSE A;  1GL2 D;  2QM7 A;  1DEB A;  2BEZ F;  2E75 B;  4WY4 C;  3D6Z A;  1NU1 D;  2OYH C;  2JKV A;  5TJH A;  1S9K E;  1FZG A;  1SQX E;  3MIW A;  2FYN C;  3P32 A;  1S5L H;  1YYC A;  2NPS A;  1RF1 A;  1SS1 A;  2C9L Y;  2R44 A;  4IL6 E;  1QVG O;  1N7S D;  3ZDM A;  1JY3 N;  1HGZ A;  2KSJ A;  2FXP A;  1M1J C;  3E7K A;  1JCD A;  2ZYA A;  3CXH E;  1U57 A;  2HOD A;  4ZKU A;  1KC8 Q;  2E5T A;  2A45 I;  1JUN A;  2XND H;  3B8E B;  5AVR B;  1RH5 B;  1EC5 A;  5B66 H;  1QVF O;  1SQX G;  3H1I D;  4H0L C;  5KKZ B;  3H1J E;  3TF5 A;  2R32 A;  1L4A B;  4ZNC A;  3CCQ P;  1KFN A;  3EFF K;  4WBA A;  4LLH A;  4ZKP A;  4PV1 D;  2QE7 H;  3TGU D;  4XA4 A;  3A0H E;  3OW2 O;  2WSS H;  1VQ8 P;  4H13 C;  1X79 B;  1PP9 E;  1KZU B;  2E76 D;  3S1K A;  1NTZ D;  1L0N K;  3SFD C;  1JM0 A;  1X0T A;  2R5B A;  5TIS E;  3QH9 A;  2Q6Q A;  1L0N D;  4WVZ A;  3O8Z A;  3NTN A;  3AE6 C;  3SFE C;  1Q2N A;  4OGQ B;  5GTI H;  3D70 A;  3L72 E;  1NTM E;  1X9V A;  3HD7 C;  1YQ4 C;  5AW0 B;  2E74 B;  2ZT9 D;  1ZP0 C;  1IFN A;  1NO4 A;  1PP9 G;  1BGY G;  2ZYD A;  4PJ0 E;  1GW3 A;  2P10 A;  1KB9 E;  3Q5S A;  2O1J A;  2V7Q H;  3H1K E;  2NPS B;  1KB9 H;  2QJY B;  1RF1 B;  1NTZ J;  3M91 A;  1VL2 A;  1VQN P;  3L72 G;  1L0N J;  1NTM G;  4GT1 A;  3FGA D;  5AW1 B;  5CCG C;  2HOD B;  4WY4 A;  1CI6 B;  2R5D A;  2OYH A;  2E5Y A;  2WSC J;  3CXH I;  3C9I A;  2Q3I A;  4I2L C;  1FZC C;  1NWQ A;  3U1A A;  1OWA A;  1SQV D;  1L2P A;  2ITA A;  5CMZ A;  2LXB A;  3A0B H;  2IZ1 A;  2QEX P;  2ZXE B;  1IFJ A;  1SQB E;  1OX3 A;  4JPZ B;  5APS A;  2IBZ D;  3H1K G;  2YXQ B;  1S1C X;  2OTJ P;  3PH0 A;  2C0W A;  2YIU C;  3U1C A;  1M1J A;  1WMK A;  1RF0 C;  2W6A A;  3F89 A;  4L74 A;  5DJU B;  3KHU A;  1M1K Q;  3HUS B;  3L73 E;  1PPJ D;  1K05 A;  1OW7 A;  5AW7 B;  3AE3 C;  3V4W A;  2IX7 C; 
#chains in the Genus database with same CATH homology
 4IL6 E;  5TIS E;  5GTI E;  1W5C E;  4UB6 E;  3WU2 E;  1S5L E;  5E79 E;  3A0H E;  3KZI E;  5KAI E;  4PJ0 E;  5B66 E;  5GTH E;  4UB8 E;  5B5E E;  5H2F E;  5KAF E;  2AXT E;  3JCU E;  3A0B E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...