5B66H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b66H01
5H2FH 2AXTH 4IL6H 5GTIH 5KAFH 5GTHH 5KAIH 3JCUH 3KZIH 3WU2H 5E79H 4UB6H 5B5EH 4PJ0H 3A0BH 4UB8H 1S5LH 3A0HH 5B66H 5TISH
chains in the Genus database with same CATH superfamily
3V2PA 1BSHA 2RKLA 3MD0A 3G3ZA 3HUSA 1SQXJ 3T97A 4C46A 3KPEA 3JCUE 3HUSB 3L71G 3T97B 1KC8Q 4JQ0D 1N7SA 1RH5B 5BVZA 3L72G 5DJTB 4IFDK 2Y0DA 3KHUA 4PD4I 1HGZA 1N7SB 4OVNF 4I1LA 1NWQA 1OMIA 1M1JC 1N86A 1BGYE 2P10A 3WU2E 1HVVA 3L71D 3W68A 1VF5C 1VF5D 4PJ0E 1NYHA 1IZNB 3LIEA 2OQQA 1HJBA 1SQQJ 3LW5H 3VTPC 3MUDA 1NU1G 1DEEG 1VQ9P 3CC2P 1N2DC 4OH8B 3BCCD 3G71P 2GUVA 3FX0A 1NTZK 1BDDA 1YITP 3L70J 1ZW0A 1NTMG 5TJHA 3VYIA 1N73B 3GG2A 2HFED 1QVFO 1L0NE 3M0DA 2OYIA 3H6PA 1U57A 4WBAA 2NPSA 3CCQP 2O01J 2LXBA 2WSFJ 3A0HH 2PP6A 2OYIB 1JOCA 2KSEA 3EQ2A 1VQ7P 1IFIA 1KQGB 2E75B 5E79H 1OFCX 4ZMDA 4I6MC 1SQPE 1CI6A 3Q2YA 1X8YA 2IBZG 2YNYA 2ZXEB 4DJGA 2O01N 2YKOA 3G9RA 5CJ0A 1CI6B 1GU4A 2OTKE 4AQRD 1WRGA 2IFNA 3D71A 2KK7A 1Q90D 3PH0A 1SQXG 3H1KJ 2A06G 1E5WA 1L4AA 1LTJA 2YKQA 4JYBA 3K5BA 1KORA 3Q5RA 3H1LD 1PIXA 5KLVE 2QJPB 3UIAA 2FY8A 1L4AB 1LTJB 2FXPA 3L73J 1J2JB 3RBXA 4LGDE 2WVRA 2FYZA 1VQ8P 1NJIQ 3NXSA 3SWYA 3HE4A 1DD3A 2H88C 1LTBC 5GTIH 2GA1A 1NTKG 1NAFA 4CPGA 3V2QA 3HD7A 2HODA 1SQQG 1OVRA 3HE4B 1FS0E 1P84E 1YYCA 1D7MA 3HD7B 2HODB 1L0NK 2ZYDA 1RE3A 1KILA 1NTKD 2K9JA 5AW6B 3L70G 3L75J 5GTHE 2K9JB 3GLMA 2QRXA 1FZCC 1T8ZA 1SQPK 1OWAA 1IFPA 5B66H 1A02J 1RQVA 2ZVNB 3IN6A 2Y0CA 1R8EA 1LTAC 1S5LE 3H1JE 2L91A 3WUTA 2QJKB 3H1HE 1M7LA 2OTJP 3LIDA 2BCCD 4WB4A 4QMAA 2L5GB 3L72E 3P8CE 1FDIA 2OTLP 1BE3D 1ZN5A 2A45H 3VMXA 1SQVE 1URQB 1U7MA 2FYNC 1QL1A 3H1KG 3TNUA 3U59A 1SQBD 5KAIH 3JC22 1S9KD 1BCCD 2J59M 4HJGH 3TNUB 5AVZB 1LTIC 3L73G 1KQLA 3CXHD 2ZT9D 4EOTA 3H1KD 5KJ7A 1NOHA 2A45G 1G2CA 1Q2NA 1KYOH 2C9NY 2N9YB 1GW3A 2Z5IA 1PGPA 1MKMA 3H1IE 1G2CB 4I7ZC 1DH3A 1RF0A 2YMYA 3AE4C 2WTYA 5H2FH 1FJKA 1M1JA 3RK3C 2P58A 4C7RA 4W80A 3RK3D 2IPPA 1FJPA 2JEEA 5CCGC 4H13C 2BEZF 5CCGD 4H13D 1KQFB 3TK1A 2ZVOB 1M56D 2AEFA 1M1JB 2IBZE 1HTLC 1VF5B 3V2NA 5CBNA 4GDOA 3L75G 3CCVP 3CWBJ 1AA0A 1IO4A 1FE6A 1JY2O 4RJTA 1ZRTE 1JY2N 3H32A 1RY3A 4WY4C 4WY4D 2AXTH 1FZAA 1DD4A 2DW3A 4ASVA 1SQVK 1XTGB 3H32B 2C0XA 4TT3H 1BGYD 4HKZH 2YMKA 4PD4H 3KZIE 2JO1A 5M1BA 3M0AA 1WT6A 1NAYA 1SFCC 1W5CE 1SFCD 1NU1K 4EIJA 3I56P 2QA4P 3CXHI 2FFDA 2Z5HA 1GL2C 1SQQE 1GL2D 1RF1C 1NTMK 4U3FE 2FFDB 5AVRB 2BEQD 1KTMA 1K8AQ 3C9IA 1JO5A 5AW5B 1PP9E 4XA4A 1FOSE 1EXJA 3L70E 1RQUA 2NRGA 2Z4EA 3BCCJ 2W6AA 1FZFA 2G3AA 2WPVB 1OX3A 4R4MA 4EDFA 3TGUD 3M9HA 2QJYC 4JYCA 3E1IA 4N3YB 3AE7C 3VP9A 3CD6P 3OJAB 3VMZA 3CX5E 2FYUG 1FDMA 4IOIH 3L74D 1T3UA 2MJZA 1SQXK 1HBWA 5B66E 1G1JA 2KS1A 4HH2A 4Y99C 3U1AA 2K1AA 3B8EB 3A0BH 4JF7A 1HGVA 1NTZE 5CJ4A 2FYUD 3CCRP 2KS1B 5AW0B 1IFNA 5KLVD 5CMZA 2JWAA 1Z56A 2K3RA 5APVA 1JTHA 2GM4A 4U7JA 4IL6E 3HTKA 1NO4A 1QLED 4JPZB 1JTHB 3H1LJ 1L0LD 1SQQK 1K04A 1SS1A 3AE9C 3AEDC 1GK6A 2FKWB 2BASA 3HTKB 3FXEA 1JB0J 3BRVB 1H8AA 2K88A 1PGOA 2O1KA 2QM7A 5CBOA 5KAIE 1KV4A 2Q3EA 4W7ZA 3CPWO 3BVHA 2E74C 3NMDA 1YIJP 1ZP0C 1JCCA 2O3JA 1R5SA 1KYOE 5B5EH 1GU5A 3CCSP 3OAKA 1MFZA 3L75E 4UB6E 3F5HA 1NTKJ 3BCCG 1VQOP 1M1KQ 3W67A 5KLIB 5H2FE 3H1HD 2YO2A 2ZT9B 2KZJA 1KZUB 4WWIA 3WUUA 1KB9E 1NGMB 3C1LA 1Y47A 3V5BA 2XKMA 1N73A 1YJWP 3SFEC 5CCHA 3P8CD 1LGHB 3R4YA 1KQSO 4I7ZB 4H44C 3GHGA 4H44D 2CK3H 2Q9IA 2BCCJ 2WZ7A 1S3JA 1LNQA 3RK3B 3MTUE 3GHGB 2JP3A 2Q6QA 1USEA 2E76C 4DZOA 2YIUC 2E76D 2B89A 2E42A 3II6A 4TLFA 1BE3J 1GW4A 2N9BA 1NKZB 1PPJE 3B5NC 1SQBJ 3B5ND 1KILE 1DEBA 3H1LG 5AW7B 2N1TC 4GKGA 2AEJA 1BCCJ 3AE8C 4WY4A 2N1TD 3IF4A 2P7JA 5L8RJ 1X0TA 3CCMP 3S1KA 4HB1A 1J1EC 1J1DB 2I1JA 3CCUP 4WY4B 1JY3P 2W90A 1VPCA 4RKUJ 1VL2A 2WITA 1FAVA 3R2PA 1X22A 5AVUB 1SFCB 1GL2A 3BRTB 1EDIA 4D6TE 4RO0A 1M8OB 1USDA 2VRSA 3I5CA 2OYHA 3CWBE 1EZVD 1GL2B 1ZRTD 1CSBA 3PJSK 2QEXP 5K5GB 2XNDH 5KTBA 1K9MQ 1LT9C 2OYHB 2KYVA 1T6AA 4ZNCA 3AE5C 2I1KA 2E5YA 2D2CC 3B4SA 1N7LA 3S4RA 2D2CD 3EFFK 4AYCA 2WSSH 5AVTB 3V2RA 3EFGA 4NPFX 4KT0J 2BCCG 3CMAP 2ZAEB 3KDPB 3V4WA 4O9BA 1KFNA 3P32A 1BGYJ 4KJMA 5TISE 3D6YA 5APQA 2CPBA 3CXHH 4H0LC 4U3FD 2Q1KA 4H0LD 1BE3G 4JBZA 1JCDA 3L71E 1LWUC 4ASWA 1RE4C 2KUBA 1PP9D 1SQBG 2M0BA 2W6BA 1URQA 3L35A 1BCCG 1T3JA 1AV1A 3CC4P 2KIKA 1AQTA 3O6QA 2IDBA 1YJNP 3BCCE 4GIFA 3O8ZA 3WMM0 4GODA 1HF9A 3O6QB 1MV8A 1Y9BA 2JR8A 1HJ0A 1NU1E 3MP7B 1JEKA 3CMEP 1EZVI 3PLNA 2ZXXA 2ZYAA 1IJDB 3TGUJ 1BSNA 2HG5D 5AVYB 2KI7B 1NTME 3JCUH 5AVSB 5AVQB 5APXA 1NTZD 4L74A 3L74J 1EC5A 2XV5A 3A3YB 4N78E 1OVVA 4C7NA 1MFTA 2OYOA 3SFDC 3WU2H 2MKVA 3Q3DA 2WPRA 1LTGC 3AEBC 2YXQB 1YTZT 4PJ0H 2FYUJ 2WSCJ 4C7NB 1S5LX 5KLVJ 3I55P 2K37A 3M0DC 3TYYA 2OYIC 4L73A 4DOJA 3A0HE 2NPSC 4HYTB 2KP8A 2E75C 2NPSD 4K35A 2WWWA 3HRNA 1HUCA 4EYYQ 1BGYG 1L0LJ 1CW5A 3D70A 1H89A 5E79E 1SQXE 4ZKPA 2A06E 1VQ6P 5APSA 4ZKUA 1Q81Q 3CCLP 3M06A 3P7KA 4H44B 1YHQP 1M57D 2QM8A 2FBWC 2B9BA 3IR9A 3CC7P 3KQGA 1VQKP 2YXRB 4GOEA 1W2EA 1PGJA 1NTKE 2QJPC 1NHLA 2PAJA 2CPSA 2M3EA 1L4AC 1LTJC 2QG4A 4W7YA 1L4AD 3VN0A 3GW6A 2R3CA 3E7KA 4XE5B 3AE6C 3H1JJ 1GZLA 2N1TB 2QSIA 1OXZA 1KMIZ 3A5TA 3H1HJ 3NFQA 2OGUA 1PV3A 3TGUG 3VP8A 2UWJE 2QVAA 1L0ND 1J1EB 2YKPA 1HWTC 5GTIE 1HH0A 2K9YA 2LKMA 2WSCH 2PFXA 1DX7A 3VMAA 1SVFA 1EXIA 2Q5UA 3JSVC 3L74G 3VMYA 2XNXA 1SQPD 2LXCB 4KHXA 1PPJD 4DCKA 1IFJA 3VOPA 3ZDMA 1RE3C 1MUUA 1KILC 3V4QA 1KILD 3SWFA 3BASA 2H43A 3Q5SA 5KLVG 1P84H 1SQBE 3HE5A 1NH4A 2QJKC 1S9KE 2C0WA 3PTZA 3HE5B 2W27A 1L0LG 3A2AA 3GF3A 3RBZA 3U1CA 3H1KE 3AE1C 3SWKA 3H1IJ 1FZCA 5AVXB 5GTHH 2D2CB 5APYA 1PL5A 3AEAC 3MZWB 2XU6A 3M9BA 4D6TD 2V4HA 1NTKK 1FZCB 3L73E 1S5LH 2J5UA 4WVZA 1FZEA 1U7JA 1WMKA 2YO3A 4NPEA 1M90Q 1LWUA 3RL0C 1P84D 1KN7A 2PGDA 3RL0D 5C39A 1OZHA 2I8DA 5AW4B 1VQLP 1ZV8A 1KFMA 5AW3B 1LWUB 2OARA 1S72P 2E74D 1LT1A 2M8RA 3H1JG 3RL0g 2KOGA 3H1HG 2M3BA 5KJ7C 1FBMA 2KLVA 5KJ7D 1BDCA 1JNMA 5APWA 1X79B 5BU5A 2XDJA 2FYNB 1VQ5P 3RGUA 1VDFA 1Y8AA 2AXCA 3H1JD 2HR3A 1K05A 3PRJA 5APTA 1RF0C 3KYQA 3AE2C 3GMAA 1PFIA 1SQBK 2PRRA 1JY3O 1JY3N 1SQVG 3NTNA 1QX8A 3F89A 4Z1MH 5BU8B 3TSIA 3L72D 3CL3D 1PZQA 4U3FJ 1OIPA 4BWNA 1PGQA 5CCGA 1K73Q 1X9VA 1SQVD 1JMMA 4L75A 1AFOA 2W8ZA 1ZLLA 1PP9J 2JJLA 1LP1A 4IL6X 4H13B 2JWDA 1FOSF 1NU1D 2IFMA 2AXTE 3H1IG 1LP1B 1Q82Q 1FU1A 1TU3F 4UB8H 1YQ3C 3FGAD 2R44A 1GMJA 1P84I 3N7NA 4PD4E 1NTMD 2WT7A 2NPSB 2KXPB 1AVYA 3TGUE 3S9OA 2P1JA 3H1ID 2HPCA 3ABVC 3TDKA 4K3AA 4NPDA 1VQ4P 2WT7B 1XTCC 2FXOA 2WSEJ 3FXDA 2FFDC 4N78D 2HPCB 3L74E 2B87A 2J58A 3AEEC 1SFCA 3L4FA 4BXLA 1NTZJ 4R4LA 3KZIH 1SLQA 1EZVG 1W2BO 2IBZD 4OGQC 4OGQD 1OW7A 2V7QJ 2B87B 3RK2C 1JM0A 2HLOA 2NZ2A 4PV1C 3RK2D 4PV1D 2FYUE 1RF1A 3QWOC 2WPQA 2Y0EA 3CI9A 1QEXA 1RF1B 1SQXD 2A06D 2E43A 1OW6A 5AW8B 1UIXA 2E5TA 1YJ9P 3D6ZA 1L0LE 1GD2E 1ZXGA 2P2UA 3AE3C 3EWKA 5AVVB 2ZJSE 2ZYGA 1IK7A 1Q7YQ 5KAFH 4GOFA 3CCEP 1EDKA 2Y9YA 3OW2O 1ZR2A 1QL2A 1DIPA 2O01H 4U3FG 2WSFH 3L36A 2Y9ZA 3H25A 1LJ2A 1YBKA 3A0BE 2IZ0A 1FDOA 4GT1A 4YXDC 1SQQD 1PP9G 2QJYB 2RN0A 3B71A 1KD1Q 1ZMEC 2IYOA 3CX5H 1ZR4A 1EDJA 1KILB 5KKZC 2WSEH 4OWFA 1S1CX 2SPZA 1NKNA 1YI2P 1A02F 3L70D 3WUVA 2RMZA 4Y99B 1VQMP 3AEFC 4XFJA 2V7QH 2LR2A 2WPSA 3Q5PA 3HUSC 2IBZI 2WMMA 4IL6H 1L0NJ 2FYUK 2IYPA 2AEMA 4N6JA 1NTZG 5KLVK 1QVGO 3CX5D 1N7SC 1N7SD 4L76A 5B5EE 3IAOA 2KB7P 4A7PA 1T2KC 1SQPJ 1T2KD 2KLUA 4I2LC 3RL0B 5KLIC 1L0LK 4LC1A 1VQPP 1S4XA 1NVOA 2H7HA 2ZT9C 1EDLA 5DJUB 3FWLA 3MUDC 3FWNA 2E74B 4Y28J 2W6JH 2JKVA 2KSJA 2QE7H 1VQNP 5CHXA 1H0TA 3IFMA 1AQ5A 1OVUA 2ZFCA 2JDIH 1JMBA 5AW1B 4UB6H 3L73D 1N73C 1SP4A 5CCHC 1H0TB 5CCHD 2QIWA 2R5BA 3G4SP 5AVWB 5AW2B 1QGKB 2RH0A 3GHGC 3H1LE 1KB9H 2R32A 2HYNA 4D6TJ 2H89C 2E75D 1L2PA 4LLHA 4YXWH 1AJYA 4AUWA 3QH9A 1H88A 3BATA 2O1JA 5EFWB 2FXMA 3G6EP 1IK9A 4UB8E 4MN4C 1S2EA 1KYOD 1EZVE 2KZIA 1EQ7A 3C8VA 1YQ4C 4YTPC 1J1DC 3L75D 1OW8A 3AEGC 3MHVA 1E79H 4DT0A 1N8RQ 2E76B 2YIUB 3CX5I 4YPCA 3L37A 3MIWA 3B5NA 1GDTA 3E1RA 1L0NG 3GF7A 1KB9D 2N1TA 3SSUA 1YTZI 3A7OA 2C9LY 4IFFA 3B5NB 2IZ1A 2M5AA 2R3SA 3N4XA 1MZ9A 1FZBA 2GUSA 1LTSC 2M5AB 1SQPG 3CLQA 1PPJG 2IX7C 3L71J 4IFMA 4B86A 2OYHC 3MGNA 3L72J 1IFDA 2Q7CA 3ITKA 3HD7C 2W83C 3HD7D 3PP5A 2BCCE 4OGQB 2A45I 3OA7A 1FC2C 1JY2P 1SQVJ 2KNCA 2P67A 5KAFE 3RK2B 4PV1B 2ITAA 1BE3E 4PD4D 3USSA 4RESB 4BRYA 2KNCB 1RHZB 1LT9A 1LTTC 5APUA 1NU1J 3AECC 1CZQA 2Q3IA 1UIIA 3Q1MA 3M9QA 4BRYB 1BCCE 3V6IA 1LT9B 1IC2A 4D6TG 1GTWA 3KXDA 1KYOI 4M3LA 2R5DA 1NTMJ 3CCJP 3CXHE 3CWBG 3LW5J 3M91A 1FZGA 1JUNA 1ZOYC 2POHA 2G8YA 1R5LA 2B88A 5AW9B 5TISH 1URQC 3P8MC 3CWBD 1KB9I 1G1IA 1URQD 1Q86Q 3PHLA 2H8PD 3RK3E 1GK4A 3TF5A 2XZRA 1RE4A 4H0LB 4EI2A 5KKZB 2WQYC 1IFMA 1AVOA
chains in the Genus database with same CATH topology
5H2FH 2AXTH 4IL6H 5GTIH 5KAFH 5GTHH 5KAIH 3JCUH 3KZIH 3WU2H 5E79H 4UB6H 5B5EH 4PJ0H 3A0BH 4UB8H 1S5LH 3A0HH 5B66H 5TISH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F H;  2AXT H;  4IL6 H;  5GTI H;  5KAF H;  5GTH H;  5KAI H;  3JCU H;  3KZI H;  3WU2 H;  5E79 H;  4UB6 H;  5B5E H;  4PJ0 H;  3A0B H;  4UB8 H;  1S5L H;  3A0H H;  5B66 H;  5TIS H; 
#chains in the Genus database with same CATH topology
 3V2P A;  1BSH A;  2RKL A;  3MD0 A;  3G3Z A;  3HUS A;  1SQX J;  3T97 A;  4C46 A;  3KPE A;  3JCU E;  3HUS B;  3L71 G;  3T97 B;  1KC8 Q;  4JQ0 D;  1N7S A;  1RH5 B;  5BVZ A;  3L72 G;  5DJT B;  4IFD K;  2Y0D A;  3KHU A;  4PD4 I;  1HGZ A;  1N7S B;  4OVN F;  4I1L A;  1NWQ A;  1OMI A;  1M1J C;  1N86 A;  1BGY E;  2P10 A;  3WU2 E;  1HVV A;  3L71 D;  3W68 A;  1VF5 C;  1VF5 D;  4PJ0 E;  1NYH A;  1IZN B;  3LIE A;  2OQQ A;  1HJB A;  1SQQ J;  3LW5 H;  3VTP C;  3MUD A;  1NU1 G;  1DEE G;  1VQ9 P;  3CC2 P;  1N2D C;  4OH8 B;  3BCC D;  3G71 P;  2GUV A;  3FX0 A;  1NTZ K;  1BDD A;  1YIT P;  3L70 J;  1ZW0 A;  1NTM G;  5TJH A;  3VYI A;  1N73 B;  3GG2 A;  2HFE D;  1QVF O;  1L0N E;  3M0D A;  2OYI A;  3H6P A;  1U57 A;  4WBA A;  2NPS A;  3CCQ P;  2O01 J;  2LXB A;  2WSF J;  3A0H H;  2PP6 A;  2OYI B;  1JOC A;  2KSE A;  3EQ2 A;  1VQ7 P;  1IFI A;  1KQG B;  2E75 B;  5E79 H;  1OFC X;  4ZMD A;  4I6M C;  1SQP E;  1CI6 A;  3Q2Y A;  1X8Y A;  2IBZ G;  2YNY A;  2ZXE B;  4DJG A;  2O01 N;  2YKO A;  3G9R A;  5CJ0 A;  1CI6 B;  1GU4 A;  2OTK E;  4AQR D;  1WRG A;  2IFN A;  3D71 A;  2KK7 A;  1Q90 D;  3PH0 A;  1SQX G;  3H1K J;  2A06 G;  1E5W A;  1L4A A;  1LTJ A;  2YKQ A;  4JYB A;  3K5B A;  1KOR A;  3Q5R A;  3H1L D;  1PIX A;  5KLV E;  2QJP B;  3UIA A;  2FY8 A;  1L4A B;  1LTJ B;  2FXP A;  3L73 J;  1J2J B;  3RBX A;  4LGD E;  2WVR A;  2FYZ A;  1VQ8 P;  1NJI Q;  3NXS A;  3SWY A;  3HE4 A;  1DD3 A;  2H88 C;  1LTB C;  5GTI H;  2GA1 A;  1NTK G;  1NAF A;  4CPG A;  3V2Q A;  3HD7 A;  2HOD A;  1SQQ G;  1OVR A;  3HE4 B;  1FS0 E;  1P84 E;  1YYC A;  1D7M A;  3HD7 B;  2HOD B;  1L0N K;  2ZYD A;  1RE3 A;  1KIL A;  1NTK D;  2K9J A;  5AW6 B;  3L70 G;  3L75 J;  5GTH E;  2K9J B;  3GLM A;  2QRX A;  1FZC C;  1T8Z A;  1SQP K;  1OWA A;  1IFP A;  5B66 H;  1A02 J;  1RQV A;  2ZVN B;  3IN6 A;  2Y0C A;  1R8E A;  1LTA C;  1S5L E;  3H1J E;  2L91 A;  3WUT A;  2QJK B;  3H1H E;  1M7L A;  2OTJ P;  3LID A;  2BCC D;  4WB4 A;  4QMA A;  2L5G B;  3L72 E;  3P8C E;  1FDI A;  2OTL P;  1BE3 D;  1ZN5 A;  2A45 H;  3VMX A;  1SQV E;  1URQ B;  1U7M A;  2FYN C;  1QL1 A;  3H1K G;  3TNU A;  3U59 A;  1SQB D;  5KAI H;  3JC2 2;  1S9K D;  1BCC D;  2J59 M;  4HJG H;  3TNU B;  5AVZ B;  1LTI C;  3L73 G;  1KQL A;  3CXH D;  2ZT9 D;  4EOT A;  3H1K D;  5KJ7 A;  1NOH A;  2A45 G;  1G2C A;  1Q2N A;  1KYO H;  2C9N Y;  2N9Y B;  1GW3 A;  2Z5I A;  1PGP A;  1MKM A;  3H1I E;  1G2C B;  4I7Z C;  1DH3 A;  1RF0 A;  2YMY A;  3AE4 C;  2WTY A;  5H2F H;  1FJK A;  1M1J A;  3RK3 C;  2P58 A;  4C7R A;  4W80 A;  3RK3 D;  2IPP A;  1FJP A;  2JEE A;  5CCG C;  4H13 C;  2BEZ F;  5CCG D;  4H13 D;  1KQF B;  3TK1 A;  2ZVO B;  1M56 D;  2AEF A;  1M1J B;  2IBZ E;  1HTL C;  1VF5 B;  3V2N A;  5CBN A;  4GDO A;  3L75 G;  3CCV P;  3CWB J;  1AA0 A;  1IO4 A;  1FE6 A;  1JY2 O;  4RJT A;  1ZRT E;  1JY2 N;  3H32 A;  1RY3 A;  4WY4 C;  4WY4 D;  2AXT H;  1FZA A;  1DD4 A;  2DW3 A;  4ASV A;  1SQV K;  1XTG B;  3H32 B;  2C0X A;  4TT3 H;  1BGY D;  4HKZ H;  2YMK A;  4PD4 H;  3KZI E;  2JO1 A;  5M1B A;  3M0A A;  1WT6 A;  1NAY A;  1SFC C;  1W5C E;  1SFC D;  1NU1 K;  4EIJ A;  3I56 P;  2QA4 P;  3CXH I;  2FFD A;  2Z5H A;  1GL2 C;  1SQQ E;  1GL2 D;  1RF1 C;  1NTM K;  4U3F E;  2FFD B;  5AVR B;  2BEQ D;  1KTM A;  1K8A Q;  3C9I A;  1JO5 A;  5AW5 B;  1PP9 E;  4XA4 A;  1FOS E;  1EXJ A;  3L70 E;  1RQU A;  2NRG A;  2Z4E A;  3BCC J;  2W6A A;  1FZF A;  2G3A A;  2WPV B;  1OX3 A;  4R4M A;  4EDF A;  3TGU D;  3M9H A;  2QJY C;  4JYC A;  3E1I A;  4N3Y B;  3AE7 C;  3VP9 A;  3CD6 P;  3OJA B;  3VMZ A;  3CX5 E;  2FYU G;  1FDM A;  4IOI H;  3L74 D;  1T3U A;  2MJZ A;  1SQX K;  1HBW A;  5B66 E;  1G1J A;  2KS1 A;  4HH2 A;  4Y99 C;  3U1A A;  2K1A A;  3B8E B;  3A0B H;  4JF7 A;  1HGV A;  1NTZ E;  5CJ4 A;  2FYU D;  3CCR P;  2KS1 B;  5AW0 B;  1IFN A;  5KLV D;  5CMZ A;  2JWA A;  1Z56 A;  2K3R A;  5APV A;  1JTH A;  2GM4 A;  4U7J A;  4IL6 E;  3HTK A;  1NO4 A;  1QLE D;  4JPZ B;  1JTH B;  3H1L J;  1L0L D;  1SQQ K;  1K04 A;  1SS1 A;  3AE9 C;  3AED C;  1GK6 A;  2FKW B;  2BAS A;  3HTK B;  3FXE A;  1JB0 J;  3BRV B;  1H8A A;  2K88 A;  1PGO A;  2O1K A;  2QM7 A;  5CBO A;  5KAI E;  1KV4 A;  2Q3E A;  4W7Z A;  3CPW O;  3BVH A;  2E74 C;  3NMD A;  1YIJ P;  1ZP0 C;  1JCC A;  2O3J A;  1R5S A;  1KYO E;  5B5E H;  1GU5 A;  3CCS P;  3OAK A;  1MFZ A;  3L75 E;  4UB6 E;  3F5H A;  1NTK J;  3BCC G;  1VQO P;  1M1K Q;  3W67 A;  5KLI B;  5H2F E;  3H1H D;  2YO2 A;  2ZT9 B;  2KZJ A;  1KZU B;  4WWI A;  3WUU A;  1KB9 E;  1NGM B;  3C1L A;  1Y47 A;  3V5B A;  2XKM A;  1N73 A;  1YJW P;  3SFE C;  5CCH A;  3P8C D;  1LGH B;  3R4Y A;  1KQS O;  4I7Z B;  4H44 C;  3GHG A;  4H44 D;  2CK3 H;  2Q9I A;  2BCC J;  2WZ7 A;  1S3J A;  1LNQ A;  3RK3 B;  3MTU E;  3GHG B;  2JP3 A;  2Q6Q A;  1USE A;  2E76 C;  4DZO A;  2YIU C;  2E76 D;  2B89 A;  2E42 A;  3II6 A;  4TLF A;  1BE3 J;  1GW4 A;  2N9B A;  1NKZ B;  1PPJ E;  3B5N C;  1SQB J;  3B5N D;  1KIL E;  1DEB A;  3H1L G;  5AW7 B;  2N1T C;  4GKG A;  2AEJ A;  1BCC J;  3AE8 C;  4WY4 A;  2N1T D;  3IF4 A;  2P7J A;  5L8R J;  1X0T A;  3CCM P;  3S1K A;  4HB1 A;  1J1E C;  1J1D B;  2I1J A;  3CCU P;  4WY4 B;  1JY3 P;  2W90 A;  1VPC A;  4RKU J;  1VL2 A;  2WIT A;  1FAV A;  3R2P A;  1X22 A;  5AVU B;  1SFC B;  1GL2 A;  3BRT B;  1EDI A;  4D6T E;  4RO0 A;  1M8O B;  1USD A;  2VRS A;  3I5C A;  2OYH A;  3CWB E;  1EZV D;  1GL2 B;  1ZRT D;  1CSB A;  3PJS K;  2QEX P;  5K5G B;  2XND H;  5KTB A;  1K9M Q;  1LT9 C;  2OYH B;  2KYV A;  1T6A A;  4ZNC A;  3AE5 C;  2I1K A;  2E5Y A;  2D2C C;  3B4S A;  1N7L A;  3S4R A;  2D2C D;  3EFF K;  4AYC A;  2WSS H;  5AVT B;  3V2R A;  3EFG A;  4NPF X;  4KT0 J;  2BCC G;  3CMA P;  2ZAE B;  3KDP B;  3V4W A;  4O9B A;  1KFN A;  3P32 A;  1BGY J;  4KJM A;  5TIS E;  3D6Y A;  5APQ A;  2CPB A;  3CXH H;  4H0L C;  4U3F D;  2Q1K A;  4H0L D;  1BE3 G;  4JBZ A;  1JCD A;  3L71 E;  1LWU C;  4ASW A;  1RE4 C;  2KUB A;  1PP9 D;  1SQB G;  2M0B A;  2W6B A;  1URQ A;  3L35 A;  1BCC G;  1T3J A;  1AV1 A;  3CC4 P;  2KIK A;  1AQT A;  3O6Q A;  2IDB A;  1YJN P;  3BCC E;  4GIF A;  3O8Z A;  3WMM 0;  4GOD A;  1HF9 A;  3O6Q B;  1MV8 A;  1Y9B A;  2JR8 A;  1HJ0 A;  1NU1 E;  3MP7 B;  1JEK A;  3CME P;  1EZV I;  3PLN A;  2ZXX A;  2ZYA A;  1IJD B;  3TGU J;  1BSN A;  2HG5 D;  5AVY B;  2KI7 B;  1NTM E;  3JCU H;  5AVS B;  5AVQ B;  5APX A;  1NTZ D;  4L74 A;  3L74 J;  1EC5 A;  2XV5 A;  3A3Y B;  4N78 E;  1OVV A;  4C7N A;  1MFT A;  2OYO A;  3SFD C;  3WU2 H;  2MKV A;  3Q3D A;  2WPR A;  1LTG C;  3AEB C;  2YXQ B;  1YTZ T;  4PJ0 H;  2FYU J;  2WSC J;  4C7N B;  1S5L X;  5KLV J;  3I55 P;  2K37 A;  3M0D C;  3TYY A;  2OYI C;  4L73 A;  4DOJ A;  3A0H E;  2NPS C;  4HYT B;  2KP8 A;  2E75 C;  2NPS D;  4K35 A;  2WWW A;  3HRN A;  1HUC A;  4EYY Q;  1BGY G;  1L0L J;  1CW5 A;  3D70 A;  1H89 A;  5E79 E;  1SQX E;  4ZKP A;  2A06 E;  1VQ6 P;  5APS A;  4ZKU A;  1Q81 Q;  3CCL P;  3M06 A;  3P7K A;  4H44 B;  1YHQ P;  1M57 D;  2QM8 A;  2FBW C;  2B9B A;  3IR9 A;  3CC7 P;  3KQG A;  1VQK P;  2YXR B;  4GOE A;  1W2E A;  1PGJ A;  1NTK E;  2QJP C;  1NHL A;  2PAJ A;  2CPS A;  2M3E A;  1L4A C;  1LTJ C;  2QG4 A;  4W7Y A;  1L4A D;  3VN0 A;  3GW6 A;  2R3C A;  3E7K A;  4XE5 B;  3AE6 C;  3H1J J;  1GZL A;  2N1T B;  2QSI A;  1OXZ A;  1KMI Z;  3A5T A;  3H1H J;  3NFQ A;  2OGU A;  1PV3 A;  3TGU G;  3VP8 A;  2UWJ E;  2QVA A;  1L0N D;  1J1E B;  2YKP A;  1HWT C;  5GTI E;  1HH0 A;  2K9Y A;  2LKM A;  2WSC H;  2PFX A;  1DX7 A;  3VMA A;  1SVF A;  1EXI A;  2Q5U A;  3JSV C;  3L74 G;  3VMY A;  2XNX A;  1SQP D;  2LXC B;  4KHX A;  1PPJ D;  4DCK A;  1IFJ A;  3VOP A;  3ZDM A;  1RE3 C;  1MUU A;  1KIL C;  3V4Q A;  1KIL D;  3SWF A;  3BAS A;  2H43 A;  3Q5S A;  5KLV G;  1P84 H;  1SQB E;  3HE5 A;  1NH4 A;  2QJK C;  1S9K E;  2C0W A;  3PTZ A;  3HE5 B;  2W27 A;  1L0L G;  3A2A A;  3GF3 A;  3RBZ A;  3U1C A;  3H1K E;  3AE1 C;  3SWK A;  3H1I J;  1FZC A;  5AVX B;  5GTH H;  2D2C B;  5APY A;  1PL5 A;  3AEA C;  3MZW B;  2XU6 A;  3M9B A;  4D6T D;  2V4H A;  1NTK K;  1FZC B;  3L73 E;  1S5L H;  2J5U A;  4WVZ A;  1FZE A;  1U7J A;  1WMK A;  2YO3 A;  4NPE A;  1M90 Q;  1LWU A;  3RL0 C;  1P84 D;  1KN7 A;  2PGD A;  3RL0 D;  5C39 A;  1OZH A;  2I8D A;  5AW4 B;  1VQL P;  1ZV8 A;  1KFM A;  5AW3 B;  1LWU B;  2OAR A;  1S72 P;  2E74 D;  1LT1 A;  2M8R A;  3H1J G;  3RL0 g;  2KOG A;  3H1H G;  2M3B A;  5KJ7 C;  1FBM A;  2KLV A;  5KJ7 D;  1BDC A;  1JNM A;  5APW A;  1X79 B;  5BU5 A;  2XDJ A;  2FYN B;  1VQ5 P;  3RGU A;  1VDF A;  1Y8A A;  2AXC A;  3H1J D;  2HR3 A;  1K05 A;  3PRJ A;  5APT A;  1RF0 C;  3KYQ A;  3AE2 C;  3GMA A;  1PFI A;  1SQB K;  2PRR A;  1JY3 O;  1JY3 N;  1SQV G;  3NTN A;  1QX8 A;  3F89 A;  4Z1M H;  5BU8 B;  3TSI A;  3L72 D;  3CL3 D;  1PZQ A;  4U3F J;  1OIP A;  4BWN A;  1PGQ A;  5CCG A;  1K73 Q;  1X9V A;  1SQV D;  1JMM A;  4L75 A;  1AFO A;  2W8Z A;  1ZLL A;  1PP9 J;  2JJL A;  1LP1 A;  4IL6 X;  4H13 B;  2JWD A;  1FOS F;  1NU1 D;  2IFM A;  2AXT E;  3H1I G;  1LP1 B;  1Q82 Q;  1FU1 A;  1TU3 F;  4UB8 H;  1YQ3 C;  3FGA D;  2R44 A;  1GMJ A;  1P84 I;  3N7N A;  4PD4 E;  1NTM D;  2WT7 A;  2NPS B;  2KXP B;  1AVY A;  3TGU E;  3S9O A;  2P1J A;  3H1I D;  2HPC A;  3ABV C;  3TDK A;  4K3A A;  4NPD A;  1VQ4 P;  2WT7 B;  1XTC C;  2FXO A;  2WSE J;  3FXD A;  2FFD C;  4N78 D;  2HPC B;  3L74 E;  2B87 A;  2J58 A;  3AEE C;  1SFC A;  3L4F A;  4BXL A;  1NTZ J;  4R4L A;  3KZI H;  1SLQ A;  1EZV G;  1W2B O;  2IBZ D;  4OGQ C;  4OGQ D;  1OW7 A;  2V7Q J;  2B87 B;  3RK2 C;  1JM0 A;  2HLO A;  2NZ2 A;  4PV1 C;  3RK2 D;  4PV1 D;  2FYU E;  1RF1 A;  3QWO C;  2WPQ A;  2Y0E A;  3CI9 A;  1QEX A;  1RF1 B;  1SQX D;  2A06 D;  2E43 A;  1OW6 A;  5AW8 B;  1UIX A;  2E5T A;  1YJ9 P;  3D6Z A;  1L0L E;  1GD2 E;  1ZXG A;  2P2U A;  3AE3 C;  3EWK A;  5AVV B;  2ZJS E;  2ZYG A;  1IK7 A;  1Q7Y Q;  5KAF H;  4GOF A;  3CCE P;  1EDK A;  2Y9Y A;  3OW2 O;  1ZR2 A;  1QL2 A;  1DIP A;  2O01 H;  4U3F G;  2WSF H;  3L36 A;  2Y9Z A;  3H25 A;  1LJ2 A;  1YBK A;  3A0B E;  2IZ0 A;  1FDO A;  4GT1 A;  4YXD C;  1SQQ D;  1PP9 G;  2QJY B;  2RN0 A;  3B71 A;  1KD1 Q;  1ZME C;  2IYO A;  3CX5 H;  1ZR4 A;  1EDJ A;  1KIL B;  5KKZ C;  2WSE H;  4OWF A;  1S1C X;  2SPZ A;  1NKN A;  1YI2 P;  1A02 F;  3L70 D;  3WUV A;  2RMZ A;  4Y99 B;  1VQM P;  3AEF C;  4XFJ A;  2V7Q H;  2LR2 A;  2WPS A;  3Q5P A;  3HUS C;  2IBZ I;  2WMM A;  4IL6 H;  1L0N J;  2FYU K;  2IYP A;  2AEM A;  4N6J A;  1NTZ G;  5KLV K;  1QVG O;  3CX5 D;  1N7S C;  1N7S D;  4L76 A;  5B5E E;  3IAO A;  2KB7 P;  4A7P A;  1T2K C;  1SQP J;  1T2K D;  2KLU A;  4I2L C;  3RL0 B;  5KLI C;  1L0L K;  4LC1 A;  1VQP P;  1S4X A;  1NVO A;  2H7H A;  2ZT9 C;  1EDL A;  5DJU B;  3FWL A;  3MUD C;  3FWN A;  2E74 B;  4Y28 J;  2W6J H;  2JKV A;  2KSJ A;  2QE7 H;  1VQN P;  5CHX A;  1H0T A;  3IFM A;  1AQ5 A;  1OVU A;  2ZFC A;  2JDI H;  1JMB A;  5AW1 B;  4UB6 H;  3L73 D;  1N73 C;  1SP4 A;  5CCH C;  1H0T B;  5CCH D;  2QIW A;  2R5B A;  3G4S P;  5AVW B;  5AW2 B;  1QGK B;  2RH0 A;  3GHG C;  3H1L E;  1KB9 H;  2R32 A;  2HYN A;  4D6T J;  2H89 C;  2E75 D;  1L2P A;  4LLH A;  4YXW H;  1AJY A;  4AUW A;  3QH9 A;  1H88 A;  3BAT A;  2O1J A;  5EFW B;  2FXM A;  3G6E P;  1IK9 A;  4UB8 E;  4MN4 C;  1S2E A;  1KYO D;  1EZV E;  2KZI A;  1EQ7 A;  3C8V A;  1YQ4 C;  4YTP C;  1J1D C;  3L75 D;  1OW8 A;  3AEG C;  3MHV A;  1E79 H;  4DT0 A;  1N8R Q;  2E76 B;  2YIU B;  3CX5 I;  4YPC A;  3L37 A;  3MIW A;  3B5N A;  1GDT A;  3E1R A;  1L0N G;  3GF7 A;  1KB9 D;  2N1T A;  3SSU A;  1YTZ I;  3A7O A;  2C9L Y;  4IFF A;  3B5N B;  2IZ1 A;  2M5A A;  2R3S A;  3N4X A;  1MZ9 A;  1FZB A;  2GUS A;  1LTS C;  2M5A B;  1SQP G;  3CLQ A;  1PPJ G;  2IX7 C;  3L71 J;  4IFM A;  4B86 A;  2OYH C;  3MGN A;  3L72 J;  1IFD A;  2Q7C A;  3ITK A;  3HD7 C;  2W83 C;  3HD7 D;  3PP5 A;  2BCC E;  4OGQ B;  2A45 I;  3OA7 A;  1FC2 C;  1JY2 P;  1SQV J;  2KNC A;  2P67 A;  5KAF E;  3RK2 B;  4PV1 B;  2ITA A;  1BE3 E;  4PD4 D;  3USS A;  4RES B;  4BRY A;  2KNC B;  1RHZ B;  1LT9 A;  1LTT C;  5APU A;  1NU1 J;  3AEC C;  1CZQ A;  2Q3I A;  1UII A;  3Q1M A;  3M9Q A;  4BRY B;  1BCC E;  3V6I A;  1LT9 B;  1IC2 A;  4D6T G;  1GTW A;  3KXD A;  1KYO I;  4M3L A;  2R5D A;  1NTM J;  3CCJ P;  3CXH E;  3CWB G;  3LW5 J;  3M91 A;  1FZG A;  1JUN A;  1ZOY C;  2POH A;  2G8Y A;  1R5L A;  2B88 A;  5AW9 B;  5TIS H;  1URQ C;  3P8M C;  3CWB D;  1KB9 I;  1G1I A;  1URQ D;  1Q86 Q;  3PHL A;  2H8P D;  3RK3 E;  1GK4 A;  3TF5 A;  2XZR A;  1RE4 A;  4H0L B;  4EI2 A;  5KKZ B;  2WQY C;  1IFM A;  1AVO A; 
#chains in the Genus database with same CATH homology
 5H2F H;  2AXT H;  4IL6 H;  5GTI H;  5KAF H;  5GTH H;  5KAI H;  3JCU H;  3KZI H;  3WU2 H;  5E79 H;  4UB6 H;  5B5E H;  4PJ0 H;  3A0B H;  4UB8 H;  1S5L H;  3A0H H;  5B66 H;  5TIS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...