1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUT3
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
molecule tags Transcription regulation
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
3IN6A 1OMIA 1HWTC 3EWKA 1WMKA 2P10A 1F4SP 1AJYA 3ALCA 1D66A 2G8YA 1FDOA 3O6QA 1PYCA 2ERGA 1QP9A 3COQA 1PYIA 2EREA 2HAPC 3H25A 2ALCA 2ER8A 1F5EP 1AW6A 1ZMEC 1FDIA
chains in the Genus database with same CATH superfamily
3RK3E 1VF5B 3MZWB 3P8CE 4IOIH 4WVZA 3W68A 5B5EE 2WSEH 4EDFA 3ITKA 2ER8A 2FYNC 3A0BE 3FXDA 3H1JJ 1M90Q 1FS0E 3B71A 1IFPA 5H2FE 4D6TD 3R4YA 1NTKG 4DCKA 5K5GB 1DH3A 3MIWA 2C0XA 1L0LJ 3L75G 1PYCA 4PD4E 1Y47A 1UIXA 1NTMK 4WY4D 2KNCA 1J1EB 1JY2N 3BRVB 4UB6E 3H1JD 3HE4A 1N7SB 2HG5D 3MTUE 3CC2P 3B4SA 1HWTC 1PFIA 1JY2O 1OXZA 1HJBA 2O1KA 2HR3A 1Q7YQ 2JR8A 1L0LD 3WUUA 3NMDA 2IYPA 4N78D 5BU8B 3CPWO 1NYHA 3L73G 4WY4C 4H0LB 2IFNA 3V2PA 1N73A 1WMKA 1YHQP 4NPEA 3QH9A 1IFJA 3G4SP 3BRTB 1NHLA 3V2NA 1AQ5A 4DT0A 2M3EA 5APTA 3CXHH 2ZVOB 4CPGA 5AW7B 1RF1A 1PP9D 2JDIH 5CCHD 1SQPE 4XE5B 1L0ND 1VQ9P 1HGZA 3LW5J 1WT6A 1JY2P 1PP9G 4ZKUA 2B88A 1YJ9P 2WT7A 1RE4A 1L0NG 1Q82Q 2ZT9B 1D66A 1ZP0C 1QP9A 1FAVA 2NRGA 4H44D 2QSIA 5KKZB 3L36A 3PP5A 1NO4A 1RY3A 1KILD 5CCHC 1USDA 5AW4B 1KYOE 2XNDH 2M3BA 1BGYD 4L76A 5KLIC 3CCRP 4H44C 5CMZA 3H1KD 2OYIA 2KS1A 1BGYG 1A02F 1LWUA 1QGKB 3R2PA 1S4XA 3GHGB 5AVZB 1T2KD 1RE3C 2L91A 3O6QA 1S2EA 1NTME 2QJPC 3H1KG 1LT9B 1OX3A 3RL0D 1DIPA 1NAFA 1KILC 1ZN5A 2A06E 1P84I 1KZUB 5KLVD 4IL6X 1VQ6P 4BXLA 5KLVG 2HYNA 3RK3B 3KZIE 1SVFA 2OTKE 2FKWB 2IBZD 5TISH 1T2KC 2QJYB 3L4FA 1ZLLA 4RESB 2IBZG 1VL2A 3TGUJ 2J5UA 3VTPC 3AE2C 3CC4P 1EXJA 3AE1C 2N9YB 3AEAC 2R3CA 4ZMDA 1PPJE 4DOJA 1VF5D 1SQXJ 1NJIQ 2YKPA 3D6ZA 2XZRA 2W27A 4W80A 3CLQA 1QL2A 2KSEA 1EZVD 2P10A 2E5YA 5CJ0A 3P7KA 4HKZH 5AW5B 4N3YB 1EZVG 2HLOA 5B66E 3PH0A 1ZMEC 3H6PA 1VF5C 1DD4A 2RMZA 1ZR4A 2XNXA 1OIPA 1PV3A 4LLHA 1KORA 1NTZG 2GM4A 4Y99B 5AW0B 1FOSE 4N6JA 1GU5A 2ALCA 2QEXP 2K9JA 2LR2A 1H88A 2Z4EA 2N1TA 5GTIE 1SQVD 4PJ0E 1HVVA 4BRYA 3JC22 5APUA 1ZRTE 1GW4A 1SQVG 1OVRA 2WPRA 4H0LD 4O9BA 1MFZA 1S5LH 3GF7A 3H1ID 5C39A 1VPCA 4BWNA 3KYQA 3CC7P 2Y9YA 5KJ7A 4UB8H 1JM0A 3H1IG 1Z56A 2Z5IA 3EQ2A 1KN7A 1XTCC 2A45G 3V2QA 3UIAA 1U57A 3GW6A 2CPSA 1BE3E 1KQGB 3JSVC 2B87A 3KQGA 2I1JA 3GLMA 3L70E 3H1HJ 5KAFE 2QG4A 3TNUA 3T97A 1X0TA 2WWWA 2ZJSE 3OJAB 3AEEC 1W2EA 1W2BO 2FFDA 1JY3N 1HTLC 2JJLA 3EFGA 3L74D 4B86A 1NKZB 4NPFX 1E79H 4WY4B 1N73C 3TGUE 4AUWA 1JY3O 2PGDA 3L74G 1RQUA 3H1HD 4WWIA 3L72J 2C9LY 1GL2B 3CX5E 3BCCE 2E76C 3GG2A 3FGAD 4YXWH 2DW3A 1URQA 2WSSH 1QVGO 2WSFH 2ZVNB 1KV4A 1Q86Q 3TSIA 3F5HA 3L72D 2GA1A 1K8AQ 3RK3D 5DJUB 2IPPA 3P8CD 1N7LA 3HTKA 1K73Q 3MUDA 3M06A 1HF9A 1JY3P 2AEJA 3MGNA 1M7LA 1VDFA 1EZVI 2M5AB 1VQKP 5KLIB 1CSBA 3RK3C 4H44B 4PD4D 2OYIC 5GTHE 1LWUC 3RBZA 3HUSB 3VOPA 3SSUA 2QJPB 3EFFK 1OZHA 1SQBG 3VP8A 2PAJA 2HPCA 1BDCA 2YO3A 1QLED 1SQPJ 4YTPC 1KB9E 1FZFA 3G6EP 3VYIA 1FJKA 1J1DC 1CW5A 3PJSK 1VQ7P 2BCCE 2OQQA 1LNQA 3BATA 4ASVA 3VP9A 1SQPD 1HBWA 1X79B 3PLNA 3KDPB 3A0HE 2JO1A 1VQ5P 4Y28J 4XA4A 2E74C 2A45I 4IL6H 3B8EB 1KC8Q 4Y99C 2YMKA 2AXTH 2W83C 5E79E 2N1TD 3S1KA 2QM8A 4AYCA 2G3AA 1YIJP 3NTNA 1IFMA 2QIWA 1NTMJ 2Y0CA 1KYOD 2WZ7A 1PGQA 2Q9IA 2PRRA 2XU6A 1DEEG 1JMBA 2HFED 5APYA 2KI7B 1JTHA 3A7OA 4I7ZC 3HRNA 1EC5A 2N1TC 1H0TA 2R5DA 3PTZA 1U7JA 1VQ4P 2E42A 3N4XA 4KJMA 4U3FE 1T6AA 4D6TG 3E7KA 1G1JA 2Q5UA 2A06D 2R44A 2XDJA 5AVTB 2ZYDA 2KUBA 1LTJA 2O01H 1GL2D 2P67A 1NTKK 3RBXA 2KLVA 2WMMA 2YO2A 3H1JG 5KJ7C 4PV1B 3MHVA 1AV1A 3HE5A 1QL1A 1IFIA 2IX7C 3AE9C 1L0LG 4HH2A 2H89C 2KNCB 3S9OA 4WBAA 1PPJD 3CXHI 2WPSA 4IFDK 1FZCA 2L5GB 1PGOA 1GL2C 2XV5A 3E1RA 1YJWP 1NAYA 1U7MA 3JCUE 5B5EH 1RF0A 2KOGA 1VQNP 1GU4A 2Q1KA 3A0BH 2JP3A 3WUTA 2AXCA 1L4AA 2FFDC 3IN6A 1Q2NA 3K5BA 2Z5HA 1N73B 1JCCA 4PD4H 1SFCA 2OTLP 5TJHA 4KT0J 1FZEA 4UB6H 4RKUJ 1P84E 3CWBE 1RF1B 2E76B 1EDJA 1F4SP 1NH4A 3C9IA 3SWYA 1FU1A 1W5CE 4DJGA 3RL0g 4W7ZA 2EREA 3F89A 1HUCA 2WT7B 1K9MQ 1CI6A 4YPCA 1OW6A 2Y0EA 4OVNF 1K04A 1IFNA 1ZRTD 4ASWA 1PGPA 3AEGC 1NGMB 3HUSC 2KIKA 2J58A 3H32A 2YXRB 2ZAEB 2R5BA 1BE3J 1YTZT 1NOHA 1NTKE 2E43A 2KSJA 3L70J 5DJTB 2Q7CA 1BCCJ 3L75E 1GK4A 1AA0A 5AVQB 3B5NA 4RO0A 4XFJA 2OYIB 2KS1B 1LWUB 1IO4A 3RK2D 3O6QB 2OYHA 1JCDA 1BE3D 4W7YA 1JO5A 2SPZA 3L70D 1FC2C 5CBNA 3G9RA 3LIDA 4TT3H 1MV8A 3BCCJ 1KYOH 3USSA 5AVWB 2KZJA 3L73E 3RK2C 3TGUD 3EWKA 5APXA 1J1DB 2OGUA 2B89A 1SP4A 3CX5D 5BU5A 5L8RJ 2LXCB 3TGUG 2JEEA 4JYBA 1SQXD 2FYUK 2Y0DA 2CK3H 2XKMA 1SQXG 2MJZA 4GKGA 2K88A 2E74B 3L37A 1KD1Q 2IZ1A 4NPDA 3AEBC 3KZIH 3AE4C 1KQFB 3TDKA 1MFTA 1VQOP 4PV1D 1MUUA 3CI9A 4R4MA 3D6YA 3BASA 1NTZK 2QVAA 3FWNA 1KQSO 2LXBA 3SWFA 1YQ3C 1N8RQ 3AEFC 5APVA 1YJNP 2AEMA 2K9JB 4I7ZB 1RQVA 4PV1C 2N1TB 2H7HA 1YI2P 4BRYB 4GODA 3I5CA 4IFMA 2WQYC 3HD7A 1F5EP 5B66H 2BCCJ 3CCMP 2HODA 1LTJC 2H88C 1M8OB 1VQLP 3L35A 1LP1A 3IR9A 2RKLA 1KB9D 5AW2B 3LW5H 2E76D 1BCCE 2Q3EA 1OW8A 1L4AD 5AVRB 2H43A 3ZDMA 1D7MA 3SWKA 1R5LA 5GTIH 3OA7A 2KZIA 2P1JA 2BCCD 1OMIA 2QRXA 3CCUP 2ZXXA 2FXMA 4PJ0H 2N9BA 3D70A 2FYUE 2B87B 2YNYA 1X9VA 2JWDA 1G1IA 3AECC 4AQRD 1RF0C 2IYOA 1RF1C 3H1HG 3TNUB 1KFNA 3T97B 1L4AC 2KB7P 1FOSF 2NPSA 2FFDB 3U59A 1K05A 4I6MC 1RE4C 4C7NB 1ZW0A 2IBZI 5CCGA 5APWA 1ZXGA 5AW1B 3W67A 1SFCC 1TU3F 2IFMA 1QVFO 2JKVA 4U3FJ 5CCHA 3L72G 1NTZE 2O1JA 1CZQA 2ZXEB 3N7NA 1LTAC 5KAIE 3TK1A 1GD2E 1URQB 5KAFH 1NU1K 2V4HA 1MZ9A 5M1BA 3CCQP 4U3FD 3B5ND 4JYCA 1LTSC 3CX5I 1S1CX 2OTJP 1KILA 1SQQK 1AVOA 5AVUB 1JMMA 3SFDC 4IFFA 3CX5H 3WU2E 3H1LJ 1QEXA 2W8ZA 2I1KA 5EFWB 1KQLA 3L71J 3U1CA 3Q1MA 1ZR2A 1JOCA 1JUNA 4ZKPA 2WPQA 4M3LA 4EI2A 3B5NC 2YKQA 2E74D 1JEKA 2OYHC 1SQBK 2QJKC 1USEA 3VMZA 1FZAA 1YTZI 3G71P 2HPCB 2E75D 5CBOA 4R4LA 2MKVA 3CWBJ 1M1JA 1R5SA 3SFEC 1FDMA 1G2CA 1SQPG 1RH5B 1PL5A 1ZV8A 4LC1A 1T8ZA 3RK2B 3CMEP 2V7QJ 2ERGA 3G3ZA 2KP8A 3VN0A 3O8ZA 1P84D 3CWBD 2GUSA 4A7PA 4C46A 2E75C 2D2CD 1WRGA 1OW7A 2NZ2A 3CWBG 4EIJA 5AVSB 1IC2A 3BVHA 3KHUA 1NU1E 3V4WA 3WMM0 1NTKJ 2WSCJ 1GDTA 5AVVB 1KB9H 5AVYB 1GW3A 1S72P 3L75J 5KJ7D 2YIUC 1YITP 3AE5C 2VRSA 1NTMD 3CCEP 1SQQE 3IAOA 2D2CC 1Y8AA 3CXHE 1N86A 3HD7D 1Q81Q 1N7SA 1NTMG 3M0DA 3C8VA 1NTKD 3AE8C 1S3JA 5AW9B 2FBWC 2WTYA 1FDIA 3A0HH 2A06G 3L75D 3M9HA 2Y9ZA 2W6AA 5AW8B 3NFQA 1KFMA 1JTHB 1AFOA 1EDLA 1H0TB 3L73J 3Q5PA 3AE6C 5E79H 3E1IA 2FXPA 1SQBE 3HD7C 1Q90D 2YMYA 4Z1MH 1BDDA 3H1LE 1VQMP 1AJYA 5APQA 3HE4B 2Q6QA 1LTJB 3KXDA 3L71E 2B9BA 1X8YA 2K3RA 1NWQA 1PP9J 3L73D 5AVXB 2FYZA 2H8PD 1PPJG 3OAKA 2KYVA 1L0NJ 1E5WA 3CCSP 1N2DC 1AW6A 4HB1A 4JPZB 1L0LK 3HE5B 1URQD 2NPSD 1LJ2A 2GUVA 4C7RA 4EYYQ 5H2FH 4PD4I 2C9NY 5AW6B 5CCGD 1HH0A 2HAPC 4OWFA 1DD3A 4U7JA 2FY8A 3VMYA 1FZCB 3M91A 1S9KE 3AE3C 3NXSA 4ZNCA 4GOFA 2UWJE 3GF3A 2YXQB 2P7JA 1L0NK 4L75A 3M0AA 1URQC 2NPSC 1L4AB 3V6IA 1XTGB 4H13B 5TISE 1BGYJ 2I8DA 2R3SA 5CCGC 1R8EA 4L73A 2KLUA 3FX0A 3GHGA 3H1KJ 1FZBA 1M57D 1SFCB 3V4QA 1LT9A 1LTTC 5AW3B 4JQ0D 3V2RA 4L74A 3WUVA 3MUDC 1EQ7A 2IZ0A 2RN0A 2J59M 5KLVJ 1GMJA 3JCUH 2WSFJ 1KTMA 2OYOA 1EDIA 3D71A 3TYYA 1CI6B 4RJTA 1HJ0A 4D6TE 1LT1A 1IFDA 1DEBA 3H32B 4KHXA 3H1JE 1P84H 3LIEA 3P32A 1KYOI 2FYUJ 1BE3G 5KLVK 1EXIA 2RH0A 1BCCD 1AQTA 3CCJP 3FWLA 1LGHB 3L70G 1T3UA 2M8RA 1LTGC 1BCCG 1L0LE 3B5NB 2LKMA 2K1AA 2OARA 2V7QH 3RL0C 4N78E 2OYHB 1GK6A 2ZYAA 2QJKB 2FYUD 4JBZA 1S5LE 2O01N 2O3JA 2Q3IA 3PHLA 3BCCD 2FYUG 1H8AA 2P58A 1NTZJ 1LTIC 3Q2YA 1M1KQ 1M1JC 3C1LA 1PP9E 1GZLA 3BCCG 4WB4A 4UB8E 2WSCH 1L0NE 1JNMA 2POHA 4GOEA 4OGQB 1SS1A 4I1LA 2WPVB 1YBKA 1IJDB 3CCLP 1BSNA 2PFXA 2BEZF 1Y9BA 1SQVJ 3VMXA 1NTZD 1PGJA 4GIFA 4LGDE 1SQXK 2E75B 4DZOA 2BASA 1MKMA 2R32A 1N7SD 2K9YA 1KILE 1FJPA 3A2AA 3H1IJ 3AE7C 1HGVA 2ZYGA 1BGYE 1SLQA 2YIUB 1IK9A 3H1KE 1SQVK 1J1EC 1T3JA 5KTBA 2D2CB 2ITAA 1N7SC 2W90A 3M0DC 1NVOA 1FE6A 2FYNB 3Q3DA 5APSA 3IFMA 5KLVE 3M9BA 2WSEJ 2G8YA 1OFCX 4EOTA 3MP7B 3CL3D 4TLFA 2ZT9D 2IBZE 4H0LC 1VQPP 4WY4A 4H13D 3CCVP 3A3YB 3L74J 2QA4P 3HD7B 1AVYA 2ZFCA 1GL2A 3ALCA 2QE7H 1PZQA 1SFCD 5CJ4A 3A5TA 2HODB 2BCCG 2O01J 1YYCA 1FZCC 1LP1B 3KPEA 2K37A 3IF4A 3P8MC 3CD6P 3MD0A 2W6JH 2AEFA 2ZT9C 4C7NA 2WITA 1NU1J 1BSHA 4MN4C 4H13C 1FDOA 1EZVE 5KKZC 1OVUA 3S4RA 5BVZA 1SQXE 1SQQJ 1H89A 1OVVA 2KXPB 1QX8A 1IZNB 4I2LC 1J2JB 1NU1D 1NKNA 1FBMA 3VMAA 3Q5SA 3RGUA 2BEQD 1NU1G 2IDBA 2NPSB 2M5AA 2JWAA 4QMAA 4YXDC 1A02J 3GHGC 1SQQD 3HUSA 1RE3A 2E5TA 2PP6A 3CXHD 1LT9C 1SQVE 3HTKB 1SQBJ 1SQQG 3COQA 4U3FG 1PIXA 4JF7A 1EDKA 2YKOA 1VQ8P 4IL6E 3H1IE 2FXOA 3ABVC 2C0WA 1ZOYC 3TF5A 3CMAP 2AXTE 2QJYC 1SQBD 3H25A 2M0BA 3Q5RA 1KILB 4OGQD 1M56D 1RHZB 1X22A 1KMIZ 3H1LD 1DX7A 4HYTB 3L71D 4GDOA 4OH8B 3GMAA 3H1LG 1LTBC 5KAIH 3U1AA 3L71G 4HJGH 1FZGA 1GTWA 1IK7A 3FXEA 3RL0B 2QM7A 4OGQC 1UIIA 3I55P 1L2PA 3L74E 1S5LX 5GTHH 4K3AA 2CPBA 1JB0J 1S9KD 3H1HE 3WU2H 1SQPK 3QWOC 1M1JB 3V5BA 2WVRA 1OWAA 2P2UA 2W6BA 1G2CB 1KB9I 2A45H 3M9QA 5CHXA 1PYIA 1YQ4C 3AEDC 3OW2O 3PRJA 3I56P 4GT1A 4D6TJ 4K35A 3II6A 2KK7A 3L72E
chains in the Genus database with same CATH topology
3T97B 3RK3E 2QJKC 3S9OA 3LW5J 1VF5B 3ABVC 4R4MA 1HF9A 3AE2C 1ZOYC 1K05A 3D6YA 1EXJA 2ZT9B 3ALCA 1ZP0C 2YMKA 3AE1C 1D66A 3AEAC 4OGQB 2QJYC 4XFJA 1QP9A 2E75D 1VF5D 2O01J 3Q5PA 3AE6C 4H44D 3H25A 2WPVB 2QSIA 1YQ3C 1U57A 4R4LA 2FXPA 2MKVA 3AEFC 2ER8A 1GMJA 2FYNC 2WSFJ 3D6ZA 3Q5RA 1KTMA 1TU3F 1Y9BA 2BEZF 4OGQD 2JP3A 2G3AA 3B71A 1KMIZ 1Q90D 3SFEC 3D71A 2QIWA 2ZT9C 3R4YA 3IN6A 1PL5A 4I7ZB 4Z1MH 1KQGB 2E75B 1RQVA 4PV1C 1HJ0A 2P10A 1MKMA 4H44B 4GDOA 1AJYA 3G9RA 4H13C 1FDOA 3GMAA 3GLMA 2K9YA 4TT3H 1PYCA 2V7QJ 2ERGA 1KILE 5KKZC 1UIXA 2WQYC 3AE7C 1IK7A 1F5EP 1AW6A 4KT0J 3AEEC 1ZMEC 5KLIC 4I7ZC 2E75C 1VF5C 1DD4A 2D2CD 4H44C 4RKUJ 5M1BA 1OW7A 2NZ2A 1HWTC 3EWKA 2E76B 1F4SP 2H88C 4OGQC 3Q5SA 1PV3A 3O6QA 1EXIA 1KORA 1S1CX 2QJPC 3RL0g 1S5LX 2BEQD 5L8RJ 1RQUA 2EREA 2HAPC 2D2CB 1DIPA 2E76D 2IDBA 3SFDC 4YTPC 2WSCJ 2ALCA 1JB0J 1DD3A 4U7JA 1OW8A 4YXDC 1OW6A 4IL6X 3AE3C 2E76C 3FGAD 1NYHA 2YIUC 1K04A 3Q3DA 3AE5C 4H0LB 1OMIA 3GF3A 3Q1MA 1WMKA 2WSEJ 2E74B 3AEGC 2OQQA 2G8YA 2D2CC 3IAOA 4PV1B 1NGMB 1ZRTE 3AEBC 4H13B 3D70A 3COQA 4H0LD 3AE4C 1YQ4C 1PIXA 1PYIA 1KQFB 3AEDC 2E74D 2ZT9D 3AE9C 3C8VA 3AE8C 3GF7A 4PV1D 1R8EA 3AECC 2FBWC 4H0LC 3Q2YA 1FDIA 4H13D 2JO1A 4Y28J 1VL2A 2H89C 2E74C 2J5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IN6 A;  1OMI A;  1HWT C;  3EWK A;  1WMK A;  2P10 A;  1F4S P;  1AJY A;  3ALC A;  1D66 A;  2G8Y A;  1FDO A;  3O6Q A;  1PYC A;  2ERG A;  1QP9 A;  3COQ A;  1PYI A;  2ERE A;  2HAP C;  3H25 A;  2ALC A;  2ER8 A;  1F5E P;  1AW6 A;  1ZME C;  1FDI A; 
#chains in the Genus database with same CATH topology
 3RK3 E;  1VF5 B;  3MZW B;  3P8C E;  4IOI H;  4WVZ A;  3W68 A;  5B5E E;  2WSE H;  4EDF A;  3ITK A;  2ER8 A;  2FYN C;  3A0B E;  3FXD A;  3H1J J;  1M90 Q;  1FS0 E;  3B71 A;  1IFP A;  5H2F E;  4D6T D;  3R4Y A;  1NTK G;  4DCK A;  5K5G B;  1DH3 A;  3MIW A;  2C0X A;  1L0L J;  3L75 G;  1PYC A;  4PD4 E;  1Y47 A;  1UIX A;  1NTM K;  4WY4 D;  2KNC A;  1J1E B;  1JY2 N;  3BRV B;  4UB6 E;  3H1J D;  3HE4 A;  1N7S B;  2HG5 D;  3MTU E;  3CC2 P;  3B4S A;  1HWT C;  1PFI A;  1JY2 O;  1OXZ A;  1HJB A;  2O1K A;  2HR3 A;  1Q7Y Q;  2JR8 A;  1L0L D;  3WUU A;  3NMD A;  2IYP A;  4N78 D;  5BU8 B;  3CPW O;  1NYH A;  3L73 G;  4WY4 C;  4H0L B;  2IFN A;  3V2P A;  1N73 A;  1WMK A;  1YHQ P;  4NPE A;  3QH9 A;  1IFJ A;  3G4S P;  3BRT B;  1NHL A;  3V2N A;  1AQ5 A;  4DT0 A;  2M3E A;  5APT A;  3CXH H;  2ZVO B;  4CPG A;  5AW7 B;  1RF1 A;  1PP9 D;  2JDI H;  5CCH D;  1SQP E;  4XE5 B;  1L0N D;  1VQ9 P;  1HGZ A;  3LW5 J;  1WT6 A;  1JY2 P;  1PP9 G;  4ZKU A;  2B88 A;  1YJ9 P;  2WT7 A;  1RE4 A;  1L0N G;  1Q82 Q;  2ZT9 B;  1D66 A;  1ZP0 C;  1QP9 A;  1FAV A;  2NRG A;  4H44 D;  2QSI A;  5KKZ B;  3L36 A;  3PP5 A;  1NO4 A;  1RY3 A;  1KIL D;  5CCH C;  1USD A;  5AW4 B;  1KYO E;  2XND H;  2M3B A;  1BGY D;  4L76 A;  5KLI C;  3CCR P;  4H44 C;  5CMZ A;  3H1K D;  2OYI A;  2KS1 A;  1BGY G;  1A02 F;  1LWU A;  1QGK B;  3R2P A;  1S4X A;  3GHG B;  5AVZ B;  1T2K D;  1RE3 C;  2L91 A;  3O6Q A;  1S2E A;  1NTM E;  2QJP C;  3H1K G;  1LT9 B;  1OX3 A;  3RL0 D;  1DIP A;  1NAF A;  1KIL C;  1ZN5 A;  2A06 E;  1P84 I;  1KZU B;  5KLV D;  4IL6 X;  1VQ6 P;  4BXL A;  5KLV G;  2HYN A;  3RK3 B;  3KZI E;  1SVF A;  2OTK E;  2FKW B;  2IBZ D;  5TIS H;  1T2K C;  2QJY B;  3L4F A;  1ZLL A;  4RES B;  2IBZ G;  1VL2 A;  3TGU J;  2J5U A;  3VTP C;  3AE2 C;  3CC4 P;  1EXJ A;  3AE1 C;  2N9Y B;  3AEA C;  2R3C A;  4ZMD A;  1PPJ E;  4DOJ A;  1VF5 D;  1SQX J;  1NJI Q;  2YKP A;  3D6Z A;  2XZR A;  2W27 A;  4W80 A;  3CLQ A;  1QL2 A;  2KSE A;  1EZV D;  2P10 A;  2E5Y A;  5CJ0 A;  3P7K A;  4HKZ H;  5AW5 B;  4N3Y B;  1EZV G;  2HLO A;  5B66 E;  3PH0 A;  1ZME C;  3H6P A;  1VF5 C;  1DD4 A;  2RMZ A;  1ZR4 A;  2XNX A;  1OIP A;  1PV3 A;  4LLH A;  1KOR A;  1NTZ G;  2GM4 A;  4Y99 B;  5AW0 B;  1FOS E;  4N6J A;  1GU5 A;  2ALC A;  2QEX P;  2K9J A;  2LR2 A;  1H88 A;  2Z4E A;  2N1T A;  5GTI E;  1SQV D;  4PJ0 E;  1HVV A;  4BRY A;  3JC2 2;  5APU A;  1ZRT E;  1GW4 A;  1SQV G;  1OVR A;  2WPR A;  4H0L D;  4O9B A;  1MFZ A;  1S5L H;  3GF7 A;  3H1I D;  5C39 A;  1VPC A;  4BWN A;  3KYQ A;  3CC7 P;  2Y9Y A;  5KJ7 A;  4UB8 H;  1JM0 A;  3H1I G;  1Z56 A;  2Z5I A;  3EQ2 A;  1KN7 A;  1XTC C;  2A45 G;  3V2Q A;  3UIA A;  1U57 A;  3GW6 A;  2CPS A;  1BE3 E;  1KQG B;  3JSV C;  2B87 A;  3KQG A;  2I1J A;  3GLM A;  3L70 E;  3H1H J;  5KAF E;  2QG4 A;  3TNU A;  3T97 A;  1X0T A;  2WWW A;  2ZJS E;  3OJA B;  3AEE C;  1W2E A;  1W2B O;  2FFD A;  1JY3 N;  1HTL C;  2JJL A;  3EFG A;  3L74 D;  4B86 A;  1NKZ B;  4NPF X;  1E79 H;  4WY4 B;  1N73 C;  3TGU E;  4AUW A;  1JY3 O;  2PGD A;  3L74 G;  1RQU A;  3H1H D;  4WWI A;  3L72 J;  2C9L Y;  1GL2 B;  3CX5 E;  3BCC E;  2E76 C;  3GG2 A;  3FGA D;  4YXW H;  2DW3 A;  1URQ A;  2WSS H;  1QVG O;  2WSF H;  2ZVN B;  1KV4 A;  1Q86 Q;  3TSI A;  3F5H A;  3L72 D;  2GA1 A;  1K8A Q;  3RK3 D;  5DJU B;  2IPP A;  3P8C D;  1N7L A;  3HTK A;  1K73 Q;  3MUD A;  3M06 A;  1HF9 A;  1JY3 P;  2AEJ A;  3MGN A;  1M7L A;  1VDF A;  1EZV I;  2M5A B;  1VQK P;  5KLI B;  1CSB A;  3RK3 C;  4H44 B;  4PD4 D;  2OYI C;  5GTH E;  1LWU C;  3RBZ A;  3HUS B;  3VOP A;  3SSU A;  2QJP B;  3EFF K;  1OZH A;  1SQB G;  3VP8 A;  2PAJ A;  2HPC A;  1BDC A;  2YO3 A;  1QLE D;  1SQP J;  4YTP C;  1KB9 E;  1FZF A;  3G6E P;  3VYI A;  1FJK A;  1J1D C;  1CW5 A;  3PJS K;  1VQ7 P;  2BCC E;  2OQQ A;  1LNQ A;  3BAT A;  4ASV A;  3VP9 A;  1SQP D;  1HBW A;  1X79 B;  3PLN A;  3KDP B;  3A0H E;  2JO1 A;  1VQ5 P;  4Y28 J;  4XA4 A;  2E74 C;  2A45 I;  4IL6 H;  3B8E B;  1KC8 Q;  4Y99 C;  2YMK A;  2AXT H;  2W83 C;  5E79 E;  2N1T D;  3S1K A;  2QM8 A;  4AYC A;  2G3A A;  1YIJ P;  3NTN A;  1IFM A;  2QIW A;  1NTM J;  2Y0C A;  1KYO D;  2WZ7 A;  1PGQ A;  2Q9I A;  2PRR A;  2XU6 A;  1DEE G;  1JMB A;  2HFE D;  5APY A;  2KI7 B;  1JTH A;  3A7O A;  4I7Z C;  3HRN A;  1EC5 A;  2N1T C;  1H0T A;  2R5D A;  3PTZ A;  1U7J A;  1VQ4 P;  2E42 A;  3N4X A;  4KJM A;  4U3F E;  1T6A A;  4D6T G;  3E7K A;  1G1J A;  2Q5U A;  2A06 D;  2R44 A;  2XDJ A;  5AVT B;  2ZYD A;  2KUB A;  1LTJ A;  2O01 H;  1GL2 D;  2P67 A;  1NTK K;  3RBX A;  2KLV A;  2WMM A;  2YO2 A;  3H1J G;  5KJ7 C;  4PV1 B;  3MHV A;  1AV1 A;  3HE5 A;  1QL1 A;  1IFI A;  2IX7 C;  3AE9 C;  1L0L G;  4HH2 A;  2H89 C;  2KNC B;  3S9O A;  4WBA A;  1PPJ D;  3CXH I;  2WPS A;  4IFD K;  1FZC A;  2L5G B;  1PGO A;  1GL2 C;  2XV5 A;  3E1R A;  1YJW P;  1NAY A;  1U7M A;  3JCU E;  5B5E H;  1RF0 A;  2KOG A;  1VQN P;  1GU4 A;  2Q1K A;  3A0B H;  2JP3 A;  3WUT A;  2AXC A;  1L4A A;  2FFD C;  3IN6 A;  1Q2N A;  3K5B A;  2Z5H A;  1N73 B;  1JCC A;  4PD4 H;  1SFC A;  2OTL P;  5TJH A;  4KT0 J;  1FZE A;  4UB6 H;  4RKU J;  1P84 E;  3CWB E;  1RF1 B;  2E76 B;  1EDJ A;  1F4S P;  1NH4 A;  3C9I A;  3SWY A;  1FU1 A;  1W5C E;  4DJG A;  3RL0 g;  4W7Z A;  2ERE A;  3F89 A;  1HUC A;  2WT7 B;  1K9M Q;  1CI6 A;  4YPC A;  1OW6 A;  2Y0E A;  4OVN F;  1K04 A;  1IFN A;  1ZRT D;  4ASW A;  1PGP A;  3AEG C;  1NGM B;  3HUS C;  2KIK A;  2J58 A;  3H32 A;  2YXR B;  2ZAE B;  2R5B A;  1BE3 J;  1YTZ T;  1NOH A;  1NTK E;  2E43 A;  2KSJ A;  3L70 J;  5DJT B;  2Q7C A;  1BCC J;  3L75 E;  1GK4 A;  1AA0 A;  5AVQ B;  3B5N A;  4RO0 A;  4XFJ A;  2OYI B;  2KS1 B;  1LWU B;  1IO4 A;  3RK2 D;  3O6Q B;  2OYH A;  1JCD A;  1BE3 D;  4W7Y A;  1JO5 A;  2SPZ A;  3L70 D;  1FC2 C;  5CBN A;  3G9R A;  3LID A;  4TT3 H;  1MV8 A;  3BCC J;  1KYO H;  3USS A;  5AVW B;  2KZJ A;  3L73 E;  3RK2 C;  3TGU D;  3EWK A;  5APX A;  1J1D B;  2OGU A;  2B89 A;  1SP4 A;  3CX5 D;  5BU5 A;  5L8R J;  2LXC B;  3TGU G;  2JEE A;  4JYB A;  1SQX D;  2FYU K;  2Y0D A;  2CK3 H;  2XKM A;  1SQX G;  2MJZ A;  4GKG A;  2K88 A;  2E74 B;  3L37 A;  1KD1 Q;  2IZ1 A;  4NPD A;  3AEB C;  3KZI H;  3AE4 C;  1KQF B;  3TDK A;  1MFT A;  1VQO P;  4PV1 D;  1MUU A;  3CI9 A;  4R4M A;  3D6Y A;  3BAS A;  1NTZ K;  2QVA A;  3FWN A;  1KQS O;  2LXB A;  3SWF A;  1YQ3 C;  1N8R Q;  3AEF C;  5APV A;  1YJN P;  2AEM A;  2K9J B;  4I7Z B;  1RQV A;  4PV1 C;  2N1T B;  2H7H A;  1YI2 P;  4BRY B;  4GOD A;  3I5C A;  4IFM A;  2WQY C;  3HD7 A;  1F5E P;  5B66 H;  2BCC J;  3CCM P;  2HOD A;  1LTJ C;  2H88 C;  1M8O B;  1VQL P;  3L35 A;  1LP1 A;  3IR9 A;  2RKL A;  1KB9 D;  5AW2 B;  3LW5 H;  2E76 D;  1BCC E;  2Q3E A;  1OW8 A;  1L4A D;  5AVR B;  2H43 A;  3ZDM A;  1D7M A;  3SWK A;  1R5L A;  5GTI H;  3OA7 A;  2KZI A;  2P1J A;  2BCC D;  1OMI A;  2QRX A;  3CCU P;  2ZXX A;  2FXM A;  4PJ0 H;  2N9B A;  3D70 A;  2FYU E;  2B87 B;  2YNY A;  1X9V A;  2JWD A;  1G1I A;  3AEC C;  4AQR D;  1RF0 C;  2IYO A;  1RF1 C;  3H1H G;  3TNU B;  1KFN A;  3T97 B;  1L4A C;  2KB7 P;  1FOS F;  2NPS A;  2FFD B;  3U59 A;  1K05 A;  4I6M C;  1RE4 C;  4C7N B;  1ZW0 A;  2IBZ I;  5CCG A;  5APW A;  1ZXG A;  5AW1 B;  3W67 A;  1SFC C;  1TU3 F;  2IFM A;  1QVF O;  2JKV A;  4U3F J;  5CCH A;  3L72 G;  1NTZ E;  2O1J A;  1CZQ A;  2ZXE B;  3N7N A;  1LTA C;  5KAI E;  3TK1 A;  1GD2 E;  1URQ B;  5KAF H;  1NU1 K;  2V4H A;  1MZ9 A;  5M1B A;  3CCQ P;  4U3F D;  3B5N D;  4JYC A;  1LTS C;  3CX5 I;  1S1C X;  2OTJ P;  1KIL A;  1SQQ K;  1AVO A;  5AVU B;  1JMM A;  3SFD C;  4IFF A;  3CX5 H;  3WU2 E;  3H1L J;  1QEX A;  2W8Z A;  2I1K A;  5EFW B;  1KQL A;  3L71 J;  3U1C A;  3Q1M A;  1ZR2 A;  1JOC A;  1JUN A;  4ZKP A;  2WPQ A;  4M3L A;  4EI2 A;  3B5N C;  2YKQ A;  2E74 D;  1JEK A;  2OYH C;  1SQB K;  2QJK C;  1USE A;  3VMZ A;  1FZA A;  1YTZ I;  3G71 P;  2HPC B;  2E75 D;  5CBO A;  4R4L A;  2MKV A;  3CWB J;  1M1J A;  1R5S A;  3SFE C;  1FDM A;  1G2C A;  1SQP G;  1RH5 B;  1PL5 A;  1ZV8 A;  4LC1 A;  1T8Z A;  3RK2 B;  3CME P;  2V7Q J;  2ERG A;  3G3Z A;  2KP8 A;  3VN0 A;  3O8Z A;  1P84 D;  3CWB D;  2GUS A;  4A7P A;  4C46 A;  2E75 C;  2D2C D;  1WRG A;  1OW7 A;  2NZ2 A;  3CWB G;  4EIJ A;  5AVS B;  1IC2 A;  3BVH A;  3KHU A;  1NU1 E;  3V4W A;  3WMM 0;  1NTK J;  2WSC J;  1GDT A;  5AVV B;  1KB9 H;  5AVY B;  1GW3 A;  1S72 P;  3L75 J;  5KJ7 D;  2YIU C;  1YIT P;  3AE5 C;  2VRS A;  1NTM D;  3CCE P;  1SQQ E;  3IAO A;  2D2C C;  1Y8A A;  3CXH E;  1N86 A;  3HD7 D;  1Q81 Q;  1N7S A;  1NTM G;  3M0D A;  3C8V A;  1NTK D;  3AE8 C;  1S3J A;  5AW9 B;  2FBW C;  2WTY A;  1FDI A;  3A0H H;  2A06 G;  3L75 D;  3M9H A;  2Y9Z A;  2W6A A;  5AW8 B;  3NFQ A;  1KFM A;  1JTH B;  1AFO A;  1EDL A;  1H0T B;  3L73 J;  3Q5P A;  3AE6 C;  5E79 H;  3E1I A;  2FXP A;  1SQB E;  3HD7 C;  1Q90 D;  2YMY A;  4Z1M H;  1BDD A;  3H1L E;  1VQM P;  1AJY A;  5APQ A;  3HE4 B;  2Q6Q A;  1LTJ B;  3KXD A;  3L71 E;  2B9B A;  1X8Y A;  2K3R A;  1NWQ A;  1PP9 J;  3L73 D;  5AVX B;  2FYZ A;  2H8P D;  1PPJ G;  3OAK A;  2KYV A;  1L0N J;  1E5W A;  3CCS P;  1N2D C;  1AW6 A;  4HB1 A;  4JPZ B;  1L0L K;  3HE5 B;  1URQ D;  2NPS D;  1LJ2 A;  2GUV A;  4C7R A;  4EYY Q;  5H2F H;  4PD4 I;  2C9N Y;  5AW6 B;  5CCG D;  1HH0 A;  2HAP C;  4OWF A;  1DD3 A;  4U7J A;  2FY8 A;  3VMY A;  1FZC B;  3M91 A;  1S9K E;  3AE3 C;  3NXS A;  4ZNC A;  4GOF A;  2UWJ E;  3GF3 A;  2YXQ B;  2P7J A;  1L0N K;  4L75 A;  3M0A A;  1URQ C;  2NPS C;  1L4A B;  3V6I A;  1XTG B;  4H13 B;  5TIS E;  1BGY J;  2I8D A;  2R3S A;  5CCG C;  1R8E A;  4L73 A;  2KLU A;  3FX0 A;  3GHG A;  3H1K J;  1FZB A;  1M57 D;  1SFC B;  3V4Q A;  1LT9 A;  1LTT C;  5AW3 B;  4JQ0 D;  3V2R A;  4L74 A;  3WUV A;  3MUD C;  1EQ7 A;  2IZ0 A;  2RN0 A;  2J59 M;  5KLV J;  1GMJ A;  3JCU H;  2WSF J;  1KTM A;  2OYO A;  1EDI A;  3D71 A;  3TYY A;  1CI6 B;  4RJT A;  1HJ0 A;  4D6T E;  1LT1 A;  1IFD A;  1DEB A;  3H32 B;  4KHX A;  3H1J E;  1P84 H;  3LIE A;  3P32 A;  1KYO I;  2FYU J;  1BE3 G;  5KLV K;  1EXI A;  2RH0 A;  1BCC D;  1AQT A;  3CCJ P;  3FWL A;  1LGH B;  3L70 G;  1T3U A;  2M8R A;  1LTG C;  1BCC G;  1L0L E;  3B5N B;  2LKM A;  2K1A A;  2OAR A;  2V7Q H;  3RL0 C;  4N78 E;  2OYH B;  1GK6 A;  2ZYA A;  2QJK B;  2FYU D;  4JBZ A;  1S5L E;  2O01 N;  2O3J A;  2Q3I A;  3PHL A;  3BCC D;  2FYU G;  1H8A A;  2P58 A;  1NTZ J;  1LTI C;  3Q2Y A;  1M1K Q;  1M1J C;  3C1L A;  1PP9 E;  1GZL A;  3BCC G;  4WB4 A;  4UB8 E;  2WSC H;  1L0N E;  1JNM A;  2POH A;  4GOE A;  4OGQ B;  1SS1 A;  4I1L A;  2WPV B;  1YBK A;  1IJD B;  3CCL P;  1BSN A;  2PFX A;  2BEZ F;  1Y9B A;  1SQV J;  3VMX A;  1NTZ D;  1PGJ A;  4GIF A;  4LGD E;  1SQX K;  2E75 B;  4DZO A;  2BAS A;  1MKM A;  2R32 A;  1N7S D;  2K9Y A;  1KIL E;  1FJP A;  3A2A A;  3H1I J;  3AE7 C;  1HGV A;  2ZYG A;  1BGY E;  1SLQ A;  2YIU B;  1IK9 A;  3H1K E;  1SQV K;  1J1E C;  1T3J A;  5KTB A;  2D2C B;  2ITA A;  1N7S C;  2W90 A;  3M0D C;  1NVO A;  1FE6 A;  2FYN B;  3Q3D A;  5APS A;  3IFM A;  5KLV E;  3M9B A;  2WSE J;  2G8Y A;  1OFC X;  4EOT A;  3MP7 B;  3CL3 D;  4TLF A;  2ZT9 D;  2IBZ E;  4H0L C;  1VQP P;  4WY4 A;  4H13 D;  3CCV P;  3A3Y B;  3L74 J;  2QA4 P;  3HD7 B;  1AVY A;  2ZFC A;  1GL2 A;  3ALC A;  2QE7 H;  1PZQ A;  1SFC D;  5CJ4 A;  3A5T A;  2HOD B;  2BCC G;  2O01 J;  1YYC A;  1FZC C;  1LP1 B;  3KPE A;  2K37 A;  3IF4 A;  3P8M C;  3CD6 P;  3MD0 A;  2W6J H;  2AEF A;  2ZT9 C;  4C7N A;  2WIT A;  1NU1 J;  1BSH A;  4MN4 C;  4H13 C;  1FDO A;  1EZV E;  5KKZ C;  1OVU A;  3S4R A;  5BVZ A;  1SQX E;  1SQQ J;  1H89 A;  1OVV A;  2KXP B;  1QX8 A;  1IZN B;  4I2L C;  1J2J B;  1NU1 D;  1NKN A;  1FBM A;  3VMA A;  3Q5S A;  3RGU A;  2BEQ D;  1NU1 G;  2IDB A;  2NPS B;  2M5A A;  2JWA A;  4QMA A;  4YXD C;  1A02 J;  3GHG C;  1SQQ D;  3HUS A;  1RE3 A;  2E5T A;  2PP6 A;  3CXH D;  1LT9 C;  1SQV E;  3HTK B;  1SQB J;  1SQQ G;  3COQ A;  4U3F G;  1PIX A;  4JF7 A;  1EDK A;  2YKO A;  1VQ8 P;  4IL6 E;  3H1I E;  2FXO A;  3ABV C;  2C0W A;  1ZOY C;  3TF5 A;  3CMA P;  2AXT E;  2QJY C;  1SQB D;  3H25 A;  2M0B A;  3Q5R A;  1KIL B;  4OGQ D;  1M56 D;  1RHZ B;  1X22 A;  1KMI Z;  3H1L D;  1DX7 A;  4HYT B;  3L71 D;  4GDO A;  4OH8 B;  3GMA A;  3H1L G;  1LTB C;  5KAI H;  3U1A A;  3L71 G;  4HJG H;  1FZG A;  1GTW A;  1IK7 A;  3FXE A;  3RL0 B;  2QM7 A;  4OGQ C;  1UII A;  3I55 P;  1L2P A;  3L74 E;  1S5L X;  5GTH H;  4K3A A;  2CPB A;  1JB0 J;  1S9K D;  3H1H E;  3WU2 H;  1SQP K;  3QWO C;  1M1J B;  3V5B A;  2WVR A;  1OWA A;  2P2U A;  2W6B A;  1G2C B;  1KB9 I;  2A45 H;  3M9Q A;  5CHX A;  1PYI A;  1YQ4 C;  3AED C;  3OW2 O;  3PRJ A;  3I56 P;  4GT1 A;  4D6T J;  4K35 A;  3II6 A;  2KK7 A;  3L72 E; 
#chains in the Genus database with same CATH homology
 3T97 B;  3RK3 E;  2QJK C;  3S9O A;  3LW5 J;  1VF5 B;  3ABV C;  4R4M A;  1HF9 A;  3AE2 C;  1ZOY C;  1K05 A;  3D6Y A;  1EXJ A;  2ZT9 B;  3ALC A;  1ZP0 C;  2YMK A;  3AE1 C;  1D66 A;  3AEA C;  4OGQ B;  2QJY C;  4XFJ A;  1QP9 A;  2E75 D;  1VF5 D;  2O01 J;  3Q5P A;  3AE6 C;  4H44 D;  3H25 A;  2WPV B;  2QSI A;  1YQ3 C;  1U57 A;  4R4L A;  2FXP A;  2MKV A;  3AEF C;  2ER8 A;  1GMJ A;  2FYN C;  2WSF J;  3D6Z A;  3Q5R A;  1KTM A;  1TU3 F;  1Y9B A;  2BEZ F;  4OGQ D;  2JP3 A;  2G3A A;  3B71 A;  1KMI Z;  1Q90 D;  3SFE C;  3D71 A;  2QIW A;  2ZT9 C;  3R4Y A;  3IN6 A;  1PL5 A;  4I7Z B;  4Z1M H;  1KQG B;  2E75 B;  1RQV A;  4PV1 C;  1HJ0 A;  2P10 A;  1MKM A;  4H44 B;  4GDO A;  1AJY A;  3G9R A;  4H13 C;  1FDO A;  3GMA A;  3GLM A;  2K9Y A;  4TT3 H;  1PYC A;  2V7Q J;  2ERG A;  1KIL E;  5KKZ C;  1UIX A;  2WQY C;  3AE7 C;  1IK7 A;  1F5E P;  1AW6 A;  4KT0 J;  3AEE C;  1ZME C;  5KLI C;  4I7Z C;  2E75 C;  1VF5 C;  1DD4 A;  2D2C D;  4H44 C;  4RKU J;  5M1B A;  1OW7 A;  2NZ2 A;  1HWT C;  3EWK A;  2E76 B;  1F4S P;  2H88 C;  4OGQ C;  3Q5S A;  1PV3 A;  3O6Q A;  1EXI A;  1KOR A;  1S1C X;  2QJP C;  3RL0 g;  1S5L X;  2BEQ D;  5L8R J;  1RQU A;  2ERE A;  2HAP C;  2D2C B;  1DIP A;  2E76 D;  2IDB A;  3SFD C;  4YTP C;  2WSC J;  2ALC A;  1JB0 J;  1DD3 A;  4U7J A;  1OW8 A;  4YXD C;  1OW6 A;  4IL6 X;  3AE3 C;  2E76 C;  3FGA D;  1NYH A;  2YIU C;  1K04 A;  3Q3D A;  3AE5 C;  4H0L B;  1OMI A;  3GF3 A;  3Q1M A;  1WMK A;  2WSE J;  2E74 B;  3AEG C;  2OQQ A;  2G8Y A;  2D2C C;  3IAO A;  4PV1 B;  1NGM B;  1ZRT E;  3AEB C;  4H13 B;  3D70 A;  3COQ A;  4H0L D;  3AE4 C;  1YQ4 C;  1PIX A;  1PYI A;  1KQF B;  3AED C;  2E74 D;  2ZT9 D;  3AE9 C;  3C8V A;  3AE8 C;  3GF7 A;  4PV1 D;  1R8E A;  3AEC C;  2FBW C;  4H0L C;  3Q2Y A;  1FDI A;  4H13 D;  2JO1 A;  4Y28 J;  1VL2 A;  2H89 C;  2E74 C;  2J5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...