1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords PUT3
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
3IN6A 3COQA 1WMKA 1FDIA 2ERGA 1FDOA 1ZMEC 1D66A 1F4SP 3ALCA 2G8YA 1QP9A 1PYIA 2P10A 1OMIA 2ER8A 2HAPC 3EWKA 3O6QA 3H25A 1PYCA 1HWTC 1AW6A 1AJYA 2ALCA 1F5EP 2EREA
chains in the Genus database with same CATH superfamily
1FZCB 5AW4B 3HTKB 2E5TA 2Z4EA 1FS0E 5GTIE 2KK7A 1FJKA 2E76B 1LTSC 1FAVA 3KYQA 5GTHE 1BGYE 4ASVA 1NTKD 1L0NK 3IR9A 5B66H 5KAIH 3COQA 2YKOA 2K1AA 1NTMG 1SQVG 5CCHA 1FC2C 1W2EA 5BU8B 5AVVB 3L73E 1KB9H 1G2CA 1GL2A 4H0LC 3MGNA 1AA0A 3C8VA 1NKNA 3CL3D 2FYUD 3A3YB 5H2FH 2C9NY 1EDKA 1N7SD 2P10A 1AQ5A 1BDCA 1SS1A 1QVGO 2N1TB 2V7QJ 1AFOA 3BCCD 1SQPJ 2WT7B 4L76A 1FOSE 3KZIE 2I1KA 3HD7C 1PPJG 1NU1K 1FOSF 1LT9B 1BCCD 4BRYB 2M3EA 2Y0DA 3L74D 3AEAC 3G4SP 2QG4A 2H8PD 5APQA 3SFEC 4RESB 2W27A 2Q7CA 2FXPA 4GODA 2FFDA 1MKMA 1ZRTD 1TU3F 4GOFA 1YIJP 3RK3E 3M9BA 3KQGA 1URQC 4W80A 1P84D 1Q86Q 2O01N 2QA4P 1VQLP 3BRVB 1EZVE 1LTGC 2MKVA 2BCCD 1SQQK 2K88A 2E74C 1L0LK 4DJGA 1IFJA 5KLVG 1NAFA 3B5NB 2ZT9B 1M1KQ 4D6TJ 1YJ9P 2IYPA 2YXRB 1H88A 1HBWA 1NOHA 3W67A 2C0WA 2WWWA 1R5LA 4ZKUA 4RO0A 2P67A 1NAYA 1CZQA 4OGQD 2LXCB 2GA1A 2AXCA 3CWBJ 3EFGA 3O6QA 3HUSC 1IFPA 5L8RJ 1L4AC 1JY3O 3B71A 2QJYB 5AVXB 2JO1A 4JPZB 3I56P 5BVZA 4PJ0H 1IFDA 2JWDA 1L0ND 5KAIE 2UWJE 3L75G 1PP9J 3F5HA 3V2RA 4H0LD 1YQ4C 3OW2O 1KILE 1KB9E 3LW5J 1NTME 1SQVE 1M8OB 1HGZA 4H44D 2HLOA 1Y9BA 2XNXA 1RE3A 1M7LA 2KYVA 1RF1B 1L2PA 4H13C 2O1KA 2EREA 1USEA 1E79H 3HRNA 3GMAA 3D71A 2V4HA 3AE8C 3HD7D 2JKVA 3H1KG 5CBOA 2LXBA 1NU1D 1FDMA 3MUDA 1BE3E 4RKUJ 4U7JA 1RY3A 4WY4C 5CHXA 4U3FE 4L75A 2GUVA 3WUUA 5APXA 4UB6H 1PPJE 3VYIA 2KZJA 3CC2P 4R4MA 1G2CB 1GL2B 1XTCC 3A0HE 1YTZT 3MP7B 1J1EC 2AEMA 5KLIC 2OYIC 3CCEP 3E1IA 4N78D 1SFCC 2E75D 4ZKPA 3CXHH 1AV1A 5CBNA 2RKLA 2K9JA 2K3RA 2CPSA 3LIDA 1URQD 2Q9IA 3H1JJ 1NKZB 4DZOA 5AVRB 2XV5A 2E74D 3WU2H 1EC5A 1SQQD 1GD2E 1L0LD 4L74A 3HE5A 3TSIA 3GHGA 1AVOA 1X79B 2R32A 4YXDC 1NTZJ 2JR8A 1NTZK 3P8MC 5KLVE 4PD4I 5AVZB 1SQXK 1KYOI 4EYYQ 3KPEA 2J58A 2ERGA 3H1IG 2FFDB 4N6JA 1KQSO 2R3CA 1HJ0A 3GF7A 4NPEA 4PV1B 1VQNP 1NVOA 4GDOA 3AE5C 1N86A 2FYNC 4C7NA 4PJ0E 1ZN5A 1X9VA 1T3UA 2PFXA 4YTPC 2SPZA 3VOPA 1EZVD 2OTKE 4IOIH 1K8AQ 3W68A 4Y99C 3RK3B 2E76C 3FWLA 1SVFA 3FXDA 3L75E 1NHLA 1HUCA 1MZ9A 1GTWA 4H13D 3P32A 1NTKJ 3GF3A 2OYHA 1NU1G 1YHQP 3CC4P 3PHLA 1PZQA 3O6QB 2H7HA 4ASWA 2CPBA 2YO2A 3II6A 1E5WA 3L72E 3H6PA 2WITA 1A02F 2YKPA 2YMYA 1Q2NA 5KJ7A 2QJPB 2G8YA 1N8RQ 4DCKA 2IZ1A 2FYUJ 3CX5I 2FYUK 5TJHA 5APYA 3H1KE 3H25A 4UB6E 4C7RA 4IL6H 4OWFA 2B89A 1N7SC 4KJMA 2J59M 3MD0A 2A06G 1SQBE 1SFCD 2ZXXA 1KILD 1KB9D 3EWKA 4MN4C 2ZVOB 1LT9C 1LTJA 1JEKA 1KQFB 2B9BA 3BRTB 4UB8H 4D6TG 1KFMA 1JY2P 2WPVB 3L74J 2QEXP 3AE9C 3WU2E 2KXPB 1CI6A 4HYTB 1EXIA 3TF5A 3TK1A 3RL0B 3CWBG 3CI9A 2Z5IA 1G1JA 5AVSB 1VQ8P 1H0TA 2M0BA 1WMKA 3OA7A 3AE4C 2NZ2A 3IFMA 3V2NA 4U3FD 3L71D 3BATA 1SQXD 3VMXA 5DJUB 2FBWC 1HVVA 2IX7C 3PTZA 1HGVA 2AEFA 5TISH 1PYCA 1ZOYC 2ZT9C 2K9JB 1PP9G 3AE2C 4XFJA 2AXTH 2QIWA 2QE7H 1S9KE 1RQUA 1FZAA 1HJBA 1OMIA 3L70D 1M56D 2DW3A 3JCUH 5APTA 2D2CB 2AEJA 2E76D 5APSA 3ITKA 3HE5B 3LW5H 4OGQC 3RBZA 4HJGH 2WSEH 2QJYC 2IPPA 3R2PA 5AW6B 3FX0A 2HAPC 2K9YA 4WBAA 2BEZF 2IBZE 1KQLA 2XDJA 2H43A 1L0NJ 3WUVA 2OTLP 3H1IJ 2W8ZA 2C9LY 2O01J 1SQPE 3VP9A 2W6JH 1MV8A 1PL5A 4C7NB 1ZP0C 1T3JA 2KSJA 3NMDA 2HPCB 4Y28J 2QJKB 1GDTA 1RF1C 3FWNA 3RK2C 3HD7A 4H44C 1VQKP 1LTIC 2P1JA 3CX5D 2GUSA 2N1TD 1UIIA 1JY2N 4IL6E 4GT1A 1EQ7A 2FKWB 3M9QA 3H1JG 2R5BA 3OJAB 1K04A 1JTHA 1KN7A 2OYHB 1LP1A 2NPSA 5CCHC 3H32A 5KKZB 1NU1J 1R8EA 1OW7A 3WMM0 2POHA 3H1HD 1OXZA 4IFDK 4UB8E 4JYCA 1LWUC 1UIXA 4GOEA 5APUA 3VMZA 1MFZA 2ZAEB 1CW5A 1NTZG 5B5EE 3Q1MA 2Y9YA 3L72D 5AW2B 1IO4A 1GK4A 1URQA 1SLQA 3PRJA 4D6TE 4YXWH 4Z1MH 2A45I 4L73A 2HR3A 3L4FA 1IZNB 2WZ7A 1YYCA 4C46A 3CCLP 1M1JC 4PD4H 2Q5UA 3GG2A 2E75C 1DH3A 3CWBE 1KYOH 5AVUB 3HE4A 3S1KA 1FDOA 5AVYB 3B5ND 1SQQJ 2ZT9D 1ZXGA 5TISE 5CJ4A 3TNUA 1RE4C 1IC2A 1L0LJ 2ITAA 1JY3P 1LTJB 2AXTE 3HUSA 1LT1A 4N3YB 1L4AA 1JM0A 1S4XA 1KC8Q 1CI6B 1DD3A 1EDIA 2YIUB 1PP9E 1NTKG 1FZBA 3JCUE 2P2UA 4PV1C 3TGUD 1H0TB 3V4QA 2NRGA 2KOGA 2MJZA 3PJSK 4YPCA 3H1LD 4I7ZB 3M9HA 2Q6QA 1OZHA 3CCSP 3A7OA 3N4XA 2FYUG 5B66E 2WSFH 1EZVI 3LIEA 4I2LC 2KI7B 3R4YA 2OYOA 3RK3C 3FGAD 2ZJSE 3CMAP 1LTBC 3VP8A 3CPWO 3BCCG 3RK2D 1K05A 2WSEJ 2ER8A 1QLED 2BEQD 5H2FE 3H1HG 2WSCJ 1VL2A 2JEEA 2OGUA 1JCCA 1BCCG 2JP3A 4WY4A 1JCDA 4OVNF 3L74G 5CCHD 2QJPC 3P7KA 4IFMA 3UIAA 1M57D 1ZLLA 1AW6A 2OYIA 4R4LA 3H1JE 1T6AA 1GL2D 3AEBC 2IBZD 1SFCA 1BGYD 1D66A 1QP9A 1DX7A 4XE5B 5DJTB 3N7NA 1SQPD 2BCCG 5CCGA 1KB9I 3P8CE 2J5UA 3L73D 2KSEA 3HD7B 1Q90D 1OX3A 4ZMDA 1NTZE 1ZR2A 1NTMK 1SQVK 3A5TA 3Q5PA 1P84H 1KILC 1N73C 3FXEA 3D6ZA 1JTHB 1KMIZ 1LP1B 2NPSB 1ZW0A 3MUDC 1IFIA 3TGUG 2M8RA 2KNCA 1N2DC 1F4SP 1VF5B 2GM4A 1IJDB 2B87A 3USSA 1KZUB 3RL0g 1VQ9P 3H1LG 3L71J 1SQXJ 3V6IA 4PV1D 5K5GB 1L0NG 3CD6P 4O9BA 1KQGB 2QRXA 2IFNA 3MHVA 1FE6A 1NTKE 3CC7P 2G3AA 1RHZB 1OVRA 3HE4B 2JDIH 2E43A 2Q3IA 4WVZA 2H88C 3L70J 3TNUB 3V4WA 4BXLA 1ZR4A 2O01H 1FDIA 3RK3D 1FZCC 1Y8AA 1BSHA 3U59A 1NGMB 2O1JA 3HUSB 1S72P 1L4AB 3Q2YA 3JSVC 3VTPC 1GU4A 2OQQA 3AE6C 2FYUE 3I55P 3ABVC 3AE3C 1GK6A 4TT3H 2KIKA 3C9IA 3NFQA 1W5CE 1VQMP 5KLVK 1K9MQ 3Q5SA 1J1DB 1AVYA 2WSFJ 1LGHB 3U1AA 3EFFK 2W90A 1N7SA 5AVWB 3RBXA 1LTTC 2KB7P 1KV4A 1BCCE 2OTJP 4EIJA 2WPSA 4LGDE 3T97A 3BASA 4H13B 1S5LH 3L74E 1VQOP 2A45G 1FZFA 2P58A 4I1LA 3RGUA 1Y47A 2N1TC 2OYHC 3BCCJ 1ZRTE 5KKZC 3D6YA 1SQQG 1GW3A 3L36A 1T2KD 1OW6A 1L0LG 3CCMP 1VPCA 1NTMD 3H1HJ 1SQVD 1NWQA 1P84E 3CXHE 1JMBA 4WY4B 2BCCE 1BCCJ 1A02J 1JOCA 4B86A 2B88A 1N7LA 4IL6X 3RL0D 5AVQB 3KZIH 1J1EB 2PRRA 2OYIB 3KDPB 3CLQA 3A0BH 2OARA 1SFCB 2WQYC 1AQTA 1EDLA 1QX8A 1BE3D 1D7MA 2KS1A 1KD1Q 3PH0A 4OH8B 2WVRA 5EFWB 1M90Q 1FZEA 2BCCJ 1IFNA 3M0AA 1PPJD 3ZDMA 3CCRP 3B5NC 1EZVG 1SQBK 3G3ZA 2YXQB 3EQ2A 1L0NE 1NH4A 3S4RA 2IYOA 1VQPP 3H1IE 2D2CD 3S9OA 1GMJA 4W7YA 3M0DC 5KAFH 1GZLA 1NJIQ 2QVAA 2KNCB 3E1RA 4EI2A 5APVA 1FBMA 3TGUJ 1X8YA 3IF4A 4NPDA 4WB4A 3GHGB 2B87B 4EDFA 2KZIA 2Q3EA 1J2JB 1HF9A 2FYNB 4RJTA 3CCUP 2JJLA 4I7ZC 1DIPA 3H1LJ 1VQ4P 3F89A 4WWIA 2WSCH 2YO3A 1AJYA 1RF0C 3PP5A 1RF1A 5KLVD 4AUWA 4Y99B 4TLFA 1QL2A 3SFDC 1NU1E 3NTNA 2WPRA 1U57A 2Y9ZA 2P7JA 1YTZI 3VMYA 5AW1B 1X22A 3KHUA 1S5LE 1MFTA 1H8AA 2IDBA 3VMAA 1YI2P 3O8ZA 2ZYDA 2FXOA 1LWUA 2VRSA 4N78E 4IFFA 1HWTC 2WSSH 2Y0EA 1IK7A 2HG5D 3L35A 3L75D 1OVVA 2IBZI 5KJ7D 1BGYJ 1SQQE 2LKMA 2A06E 1PGJA 1CSBA 1BE3G 1GL2C 1M1JA 4K35A 1L0LE 1U7MA 1N7SB 2M3BA 4U3FG 1QVFO 4AQRD 3L71G 2N9BA 4NPFX 1SQPK 2HFED 4JQ0D 1SQXG 3L73J 3T97B 3A0BE 3CCQP 4AYCA 1RE4A 1IFMA 3VN0A 1JNMA 3MTUE 4ZNCA 2ZYAA 1QEXA 2NPSC 3TDKA 2L91A 3A0HH 3H1KD 5CMZA 1FZGA 5M1BA 3L70G 2HYNA 2ZXEB 2WPQA 2W6AA 1FJPA 5AW3B 1VF5C 1SP4A 1GU5A 4KHXA 1ZV8A 2PGDA 1SQBD 1R5SA 1JMMA 1PGOA 3AECC 3CXHD 3CCVP 1ZMEC 3V2PA 5KAFE 2M5AA 3B4SA 1OW8A 2FFDC 2KLVA 3KXDA 3E7KA 5AW9B 4HB1A 1S3JA 1EDJA 4XA4A 2KS1B 2I1JA 1WRGA 3TYYA 1USDA 2HODA 4EOTA 3AEFC 1W2BO 2E5YA 4JF7A 5E79H 4OGQB 1KTMA 4W7ZA 3L37A 1X0TA 1OWAA 2IFMA 3CX5H 1S9KD 2PAJA 2WTYA 1RH5B 3H1ID 2KUBA 4HKZH 1JUNA 2ALCA 3M91A 2YKQA 1J1DC 1KORA 1DEBA 4BWNA 1YJWP 3L72G 2KLUA 4H0LB 3QWOC 2LR2A 2BASA 1G1IA 5CJ0A 4K3AA 3RK2B 5C39A 4H44B 2ZYGA 1VQ5P 3QH9A 3MZWB 1KILA 1N73A 3C1LA 3A2AA 1RE3C 3OAKA 2R3SA 4QMAA 3M06A 2E42A 1GW4A 1JY3N 1HH0A 1NTMJ 1SQVJ 1SQBG 3L71E 3SWKA 1MUUA 1SQXE 1LWUB 2NPSD 1T2KC 1PGPA 2JWAA 2XU6A 4PD4E 2XKMA 1U7JA 1KYOE 3SWFA 5AW8B 3AE1C 3BVHA 1F5EP 1VF5D 3H32B 3CMEP 3RL0C 1VQ6P 3Q3DA 3L70E 5AW0B 1M1JB 3AEDC 2E75B 1KFNA 5CCGC 1BE3J 2RH0A 3V5BA 1PV3A 1PGQA 1URQB 4U3FJ 4I6MC 1S2EA 2A06D 4JBZA 2W83C 2Z5HA 2ZVNB 3AEGC 1IK9A 2L5GB 1FZCA 1QGKB 2E74B 3HTKA 3K5BA 2IZ0A 2Y0CA 4D6TD 1S1CX 2N9YB 1FU1A 3SWYA 2K37A 3D70A 1L4AD 1VDFA 1QL1A 2D2CC 2H89C 5E79E 1PIXA 3CWBD 3V2QA 3GHGC 2PP6A 1H89A 1YQ3C 5APWA 2FYZA 4A7PA 1YJNP 2YMKA 2M5AB 3CX5E 2HPCA 2I8DA 5AVTB 1LJ2A 5KLVJ 2O3JA 2ZFCA 3JC22 2IBZG 3IAOA 1BGYG 1PP9D 3BCCE 5GTIH 2KP8A 1K73Q 2Q1KA 3MIWA 3H1HE 1SQPG 4LLHA 2HODB 2N1TA 2QJKC 2WMMA 1NTKK 2XZRA 3L73G 2WT7A 5GTHH 3G71P 2QSIA 1JO5A 1LNQA 3U1CA 4KT0J 2V7QH 1DD4A 3PLNA 4DOJA 2QM7A 2FY8A 1LT9A 3IN6A 4BRYA 1DEEG 3G6EP 1YITP 1NO4A 1OFCX 3GW6A 3WUTA 3G9RA 2A45H 4WY4D 3L75J 2RN0A 1RQVA 3Q5RA 3B8EB 1T8ZA 1PFIA 1Q7YQ 1S5LX 3AEEC 5KJ7C 1OVUA 1XTGB 2C0XA 3L72J 1LTAC 2YNYA 3NXSA 1BDDA 5KLIB 2RMZA 1NYHA 5AW7B 3CCJP 3B5NA 5CCGD 1KILB 1N73B 2CK3H 5B5EH 5KTBA 3H1JD 1BSNA 3H1KJ 3TGUE 4HH2A 4GIFA 3M0DA 4M3LA 1LTJC 2XNDH 1EXJA 3H1LE 1YBKA 4DT0A 1WT6A 3SSUA 3P8CD 1SQBJ 2QM8A 4GKGA 1VQ7P 1P84I 3CXHI 1NTZD 3ALCA 1OIPA 3GLMA 2YIUC 1JY2O 2FXMA 4PD4D 1JB0J 2R5DA 5BU5A 3AE7C 1KYOD 1RF0A 4LC1A 1Q81Q 2R44A 5AW5B 4CPGA 2W6BA 1HTLC 1PYIA 4JYBA 3I5CA 1Z56A 1Q82Q
chains in the Genus database with same CATH topology
3AECC 2ZT9C 1K04A 1S5LX 3AEEC 3AE3C 3AEAC 3D70A 4TT3H 4H0LD 1YQ4C 2IDBA 3AE2C 4XFJA 3SFEC 3Q5PA 1ZMEC 2QIWA 2D2CC 1R8EA 1KILE 2H89C 1OW7A 1PIXA 3LW5J 2G8YA 4I7ZB 1RQUA 4H44D 1OW8A 2E76B 2FXPA 3D6ZA 4YXDC 1OMIA 1Y9BA 1UIXA 3Q5SA 1YQ3C 1MKMA 1KMIZ 1TU3F 3R4YA 3H25A 1HWTC 4H13C 1NYHA 2WSFJ 3RK3E 2EREA 2D2CB 2YMKA 3Q1MA 3FGAD 3GMAA 1IK7A 2E76D 3COQA 4OGQC 2ERGA 2MKVA 3D71A 1F4SP 3AE8C 2QJYC 4Z1MH 1VF5B 1HJ0A 3GF7A 4PV1B 1K05A 2E74C 2D2CD 2WSEJ 3S9OA 1GMJA 4H13B 3RL0g 2ER8A 3AEFC 2HAPC 3IAOA 3AE5C 4GDOA 2K9YA 2ZT9B 2FYNC 3EWKA 2BEQD 2BEZF 3AE1C 4H0LC 2E75C 1F5EP 1VF5D 2WSCJ 1VL2A 1KQFB 1EXJA 4OGQB 1KTMA 3C8VA 4PV1D 4RKUJ 4U7JA 1KQGB 3T97B 2JP3A 2WPVB 1FDOA 2QJKC 2ZT9D 4YTPC 3ALCA 2O01J 3AE9C 1ZRTE 5KKZC 3Q3DA 3D6YA 1HF9A 3GLMA 2YIUC 4R4MA 4OGQD 2QSIA 1PL5A 2P10A 2QJPC 3AEDC 4I7ZC 1DIPA 2E75B 4KT0J 1OW6A 1ZP0C 2G3AA 1DD4A 1EXIA 2E76C 3O6QA 1PV3A 1JB0J 5L8RJ 1AW6A 3AE7C 1AJYA 5KLIC 2ALCA 2V7QJ 3IN6A 4R4LA 4Y28J 3B71A 1KORA 2H88C 3AEBC 3AEGC 2E75D 1WMKA 2JO1A 1DD3A 4H13D 4H44C 5M1BA 1FDIA 3AE4C 1D66A 2E74B 2NZ2A 3GF3A 4IL6X 3G9RA 1NGMB 3SFDC 1PYIA 1QP9A 1VF5C 4H0LB 3Q2YA 1RQVA 2FBWC 1S1CX 1U57A 4PV1C 3Q5RA 2OQQA 3AE6C 2J5UA 1PYCA 2E74D 1ZOYC 2WQYC 4H44B 1Q90D 3ABVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IN6 A;  3COQ A;  1WMK A;  1FDI A;  2ERG A;  1FDO A;  1ZME C;  1D66 A;  1F4S P;  3ALC A;  2G8Y A;  1QP9 A;  1PYI A;  2P10 A;  1OMI A;  2ER8 A;  2HAP C;  3EWK A;  3O6Q A;  3H25 A;  1PYC A;  1HWT C;  1AW6 A;  1AJY A;  2ALC A;  1F5E P;  2ERE A; 
#chains in the Genus database with same CATH topology
 1FZC B;  5AW4 B;  3HTK B;  2E5T A;  2Z4E A;  1FS0 E;  5GTI E;  2KK7 A;  1FJK A;  2E76 B;  1LTS C;  1FAV A;  3KYQ A;  5GTH E;  1BGY E;  4ASV A;  1NTK D;  1L0N K;  3IR9 A;  5B66 H;  5KAI H;  3COQ A;  2YKO A;  2K1A A;  1NTM G;  1SQV G;  5CCH A;  1FC2 C;  1W2E A;  5BU8 B;  5AVV B;  3L73 E;  1KB9 H;  1G2C A;  1GL2 A;  4H0L C;  3MGN A;  1AA0 A;  3C8V A;  1NKN A;  3CL3 D;  2FYU D;  3A3Y B;  5H2F H;  2C9N Y;  1EDK A;  1N7S D;  2P10 A;  1AQ5 A;  1BDC A;  1SS1 A;  1QVG O;  2N1T B;  2V7Q J;  1AFO A;  3BCC D;  1SQP J;  2WT7 B;  4L76 A;  1FOS E;  3KZI E;  2I1K A;  3HD7 C;  1PPJ G;  1NU1 K;  1FOS F;  1LT9 B;  1BCC D;  4BRY B;  2M3E A;  2Y0D A;  3L74 D;  3AEA C;  3G4S P;  2QG4 A;  2H8P D;  5APQ A;  3SFE C;  4RES B;  2W27 A;  2Q7C A;  2FXP A;  4GOD A;  2FFD A;  1MKM A;  1ZRT D;  1TU3 F;  4GOF A;  1YIJ P;  3RK3 E;  3M9B A;  3KQG A;  1URQ C;  4W80 A;  1P84 D;  1Q86 Q;  2O01 N;  2QA4 P;  1VQL P;  3BRV B;  1EZV E;  1LTG C;  2MKV A;  2BCC D;  1SQQ K;  2K88 A;  2E74 C;  1L0L K;  4DJG A;  1IFJ A;  5KLV G;  1NAF A;  3B5N B;  2ZT9 B;  1M1K Q;  4D6T J;  1YJ9 P;  2IYP A;  2YXR B;  1H88 A;  1HBW A;  1NOH A;  3W67 A;  2C0W A;  2WWW A;  1R5L A;  4ZKU A;  4RO0 A;  2P67 A;  1NAY A;  1CZQ A;  4OGQ D;  2LXC B;  2GA1 A;  2AXC A;  3CWB J;  3EFG A;  3O6Q A;  3HUS C;  1IFP A;  5L8R J;  1L4A C;  1JY3 O;  3B71 A;  2QJY B;  5AVX B;  2JO1 A;  4JPZ B;  3I56 P;  5BVZ A;  4PJ0 H;  1IFD A;  2JWD A;  1L0N D;  5KAI E;  2UWJ E;  3L75 G;  1PP9 J;  3F5H A;  3V2R A;  4H0L D;  1YQ4 C;  3OW2 O;  1KIL E;  1KB9 E;  3LW5 J;  1NTM E;  1SQV E;  1M8O B;  1HGZ A;  4H44 D;  2HLO A;  1Y9B A;  2XNX A;  1RE3 A;  1M7L A;  2KYV A;  1RF1 B;  1L2P A;  4H13 C;  2O1K A;  2ERE A;  1USE A;  1E79 H;  3HRN A;  3GMA A;  3D71 A;  2V4H A;  3AE8 C;  3HD7 D;  2JKV A;  3H1K G;  5CBO A;  2LXB A;  1NU1 D;  1FDM A;  3MUD A;  1BE3 E;  4RKU J;  4U7J A;  1RY3 A;  4WY4 C;  5CHX A;  4U3F E;  4L75 A;  2GUV A;  3WUU A;  5APX A;  4UB6 H;  1PPJ E;  3VYI A;  2KZJ A;  3CC2 P;  4R4M A;  1G2C B;  1GL2 B;  1XTC C;  3A0H E;  1YTZ T;  3MP7 B;  1J1E C;  2AEM A;  5KLI C;  2OYI C;  3CCE P;  3E1I A;  4N78 D;  1SFC C;  2E75 D;  4ZKP A;  3CXH H;  1AV1 A;  5CBN A;  2RKL A;  2K9J A;  2K3R A;  2CPS A;  3LID A;  1URQ D;  2Q9I A;  3H1J J;  1NKZ B;  4DZO A;  5AVR B;  2XV5 A;  2E74 D;  3WU2 H;  1EC5 A;  1SQQ D;  1GD2 E;  1L0L D;  4L74 A;  3HE5 A;  3TSI A;  3GHG A;  1AVO A;  1X79 B;  2R32 A;  4YXD C;  1NTZ J;  2JR8 A;  1NTZ K;  3P8M C;  5KLV E;  4PD4 I;  5AVZ B;  1SQX K;  1KYO I;  4EYY Q;  3KPE A;  2J58 A;  2ERG A;  3H1I G;  2FFD B;  4N6J A;  1KQS O;  2R3C A;  1HJ0 A;  3GF7 A;  4NPE A;  4PV1 B;  1VQN P;  1NVO A;  4GDO A;  3AE5 C;  1N86 A;  2FYN C;  4C7N A;  4PJ0 E;  1ZN5 A;  1X9V A;  1T3U A;  2PFX A;  4YTP C;  2SPZ A;  3VOP A;  1EZV D;  2OTK E;  4IOI H;  1K8A Q;  3W68 A;  4Y99 C;  3RK3 B;  2E76 C;  3FWL A;  1SVF A;  3FXD A;  3L75 E;  1NHL A;  1HUC A;  1MZ9 A;  1GTW A;  4H13 D;  3P32 A;  1NTK J;  3GF3 A;  2OYH A;  1NU1 G;  1YHQ P;  3CC4 P;  3PHL A;  1PZQ A;  3O6Q B;  2H7H A;  4ASW A;  2CPB A;  2YO2 A;  3II6 A;  1E5W A;  3L72 E;  3H6P A;  2WIT A;  1A02 F;  2YKP A;  2YMY A;  1Q2N A;  5KJ7 A;  2QJP B;  2G8Y A;  1N8R Q;  4DCK A;  2IZ1 A;  2FYU J;  3CX5 I;  2FYU K;  5TJH A;  5APY A;  3H1K E;  3H25 A;  4UB6 E;  4C7R A;  4IL6 H;  4OWF A;  2B89 A;  1N7S C;  4KJM A;  2J59 M;  3MD0 A;  2A06 G;  1SQB E;  1SFC D;  2ZXX A;  1KIL D;  1KB9 D;  3EWK A;  4MN4 C;  2ZVO B;  1LT9 C;  1LTJ A;  1JEK A;  1KQF B;  2B9B A;  3BRT B;  4UB8 H;  4D6T G;  1KFM A;  1JY2 P;  2WPV B;  3L74 J;  2QEX P;  3AE9 C;  3WU2 E;  2KXP B;  1CI6 A;  4HYT B;  1EXI A;  3TF5 A;  3TK1 A;  3RL0 B;  3CWB G;  3CI9 A;  2Z5I A;  1G1J A;  5AVS B;  1VQ8 P;  1H0T A;  2M0B A;  1WMK A;  3OA7 A;  3AE4 C;  2NZ2 A;  3IFM A;  3V2N A;  4U3F D;  3L71 D;  3BAT A;  1SQX D;  3VMX A;  5DJU B;  2FBW C;  1HVV A;  2IX7 C;  3PTZ A;  1HGV A;  2AEF A;  5TIS H;  1PYC A;  1ZOY C;  2ZT9 C;  2K9J B;  1PP9 G;  3AE2 C;  4XFJ A;  2AXT H;  2QIW A;  2QE7 H;  1S9K E;  1RQU A;  1FZA A;  1HJB A;  1OMI A;  3L70 D;  1M56 D;  2DW3 A;  3JCU H;  5APT A;  2D2C B;  2AEJ A;  2E76 D;  5APS A;  3ITK A;  3HE5 B;  3LW5 H;  4OGQ C;  3RBZ A;  4HJG H;  2WSE H;  2QJY C;  2IPP A;  3R2P A;  5AW6 B;  3FX0 A;  2HAP C;  2K9Y A;  4WBA A;  2BEZ F;  2IBZ E;  1KQL A;  2XDJ A;  2H43 A;  1L0N J;  3WUV A;  2OTL P;  3H1I J;  2W8Z A;  2C9L Y;  2O01 J;  1SQP E;  3VP9 A;  2W6J H;  1MV8 A;  1PL5 A;  4C7N B;  1ZP0 C;  1T3J A;  2KSJ A;  3NMD A;  2HPC B;  4Y28 J;  2QJK B;  1GDT A;  1RF1 C;  3FWN A;  3RK2 C;  3HD7 A;  4H44 C;  1VQK P;  1LTI C;  2P1J A;  3CX5 D;  2GUS A;  2N1T D;  1UII A;  1JY2 N;  4IL6 E;  4GT1 A;  1EQ7 A;  2FKW B;  3M9Q A;  3H1J G;  2R5B A;  3OJA B;  1K04 A;  1JTH A;  1KN7 A;  2OYH B;  1LP1 A;  2NPS A;  5CCH C;  3H32 A;  5KKZ B;  1NU1 J;  1R8E A;  1OW7 A;  3WMM 0;  2POH A;  3H1H D;  1OXZ A;  4IFD K;  4UB8 E;  4JYC A;  1LWU C;  1UIX A;  4GOE A;  5APU A;  3VMZ A;  1MFZ A;  2ZAE B;  1CW5 A;  1NTZ G;  5B5E E;  3Q1M A;  2Y9Y A;  3L72 D;  5AW2 B;  1IO4 A;  1GK4 A;  1URQ A;  1SLQ A;  3PRJ A;  4D6T E;  4YXW H;  4Z1M H;  2A45 I;  4L73 A;  2HR3 A;  3L4F A;  1IZN B;  2WZ7 A;  1YYC A;  4C46 A;  3CCL P;  1M1J C;  4PD4 H;  2Q5U A;  3GG2 A;  2E75 C;  1DH3 A;  3CWB E;  1KYO H;  5AVU B;  3HE4 A;  3S1K A;  1FDO A;  5AVY B;  3B5N D;  1SQQ J;  2ZT9 D;  1ZXG A;  5TIS E;  5CJ4 A;  3TNU A;  1RE4 C;  1IC2 A;  1L0L J;  2ITA A;  1JY3 P;  1LTJ B;  2AXT E;  3HUS A;  1LT1 A;  4N3Y B;  1L4A A;  1JM0 A;  1S4X A;  1KC8 Q;  1CI6 B;  1DD3 A;  1EDI A;  2YIU B;  1PP9 E;  1NTK G;  1FZB A;  3JCU E;  2P2U A;  4PV1 C;  3TGU D;  1H0T B;  3V4Q A;  2NRG A;  2KOG A;  2MJZ A;  3PJS K;  4YPC A;  3H1L D;  4I7Z B;  3M9H A;  2Q6Q A;  1OZH A;  3CCS P;  3A7O A;  3N4X A;  2FYU G;  5B66 E;  2WSF H;  1EZV I;  3LIE A;  4I2L C;  2KI7 B;  3R4Y A;  2OYO A;  3RK3 C;  3FGA D;  2ZJS E;  3CMA P;  1LTB C;  3VP8 A;  3CPW O;  3BCC G;  3RK2 D;  1K05 A;  2WSE J;  2ER8 A;  1QLE D;  2BEQ D;  5H2F E;  3H1H G;  2WSC J;  1VL2 A;  2JEE A;  2OGU A;  1JCC A;  1BCC G;  2JP3 A;  4WY4 A;  1JCD A;  4OVN F;  3L74 G;  5CCH D;  2QJP C;  3P7K A;  4IFM A;  3UIA A;  1M57 D;  1ZLL A;  1AW6 A;  2OYI A;  4R4L A;  3H1J E;  1T6A A;  1GL2 D;  3AEB C;  2IBZ D;  1SFC A;  1BGY D;  1D66 A;  1QP9 A;  1DX7 A;  4XE5 B;  5DJT B;  3N7N A;  1SQP D;  2BCC G;  5CCG A;  1KB9 I;  3P8C E;  2J5U A;  3L73 D;  2KSE A;  3HD7 B;  1Q90 D;  1OX3 A;  4ZMD A;  1NTZ E;  1ZR2 A;  1NTM K;  1SQV K;  3A5T A;  3Q5P A;  1P84 H;  1KIL C;  1N73 C;  3FXE A;  3D6Z A;  1JTH B;  1KMI Z;  1LP1 B;  2NPS B;  1ZW0 A;  3MUD C;  1IFI A;  3TGU G;  2M8R A;  2KNC A;  1N2D C;  1F4S P;  1VF5 B;  2GM4 A;  1IJD B;  2B87 A;  3USS A;  1KZU B;  3RL0 g;  1VQ9 P;  3H1L G;  3L71 J;  1SQX J;  3V6I A;  4PV1 D;  5K5G B;  1L0N G;  3CD6 P;  4O9B A;  1KQG B;  2QRX A;  2IFN A;  3MHV A;  1FE6 A;  1NTK E;  3CC7 P;  2G3A A;  1RHZ B;  1OVR A;  3HE4 B;  2JDI H;  2E43 A;  2Q3I A;  4WVZ A;  2H88 C;  3L70 J;  3TNU B;  3V4W A;  4BXL A;  1ZR4 A;  2O01 H;  1FDI A;  3RK3 D;  1FZC C;  1Y8A A;  1BSH A;  3U59 A;  1NGM B;  2O1J A;  3HUS B;  1S72 P;  1L4A B;  3Q2Y A;  3JSV C;  3VTP C;  1GU4 A;  2OQQ A;  3AE6 C;  2FYU E;  3I55 P;  3ABV C;  3AE3 C;  1GK6 A;  4TT3 H;  2KIK A;  3C9I A;  3NFQ A;  1W5C E;  1VQM P;  5KLV K;  1K9M Q;  3Q5S A;  1J1D B;  1AVY A;  2WSF J;  1LGH B;  3U1A A;  3EFF K;  2W90 A;  1N7S A;  5AVW B;  3RBX A;  1LTT C;  2KB7 P;  1KV4 A;  1BCC E;  2OTJ P;  4EIJ A;  2WPS A;  4LGD E;  3T97 A;  3BAS A;  4H13 B;  1S5L H;  3L74 E;  1VQO P;  2A45 G;  1FZF A;  2P58 A;  4I1L A;  3RGU A;  1Y47 A;  2N1T C;  2OYH C;  3BCC J;  1ZRT E;  5KKZ C;  3D6Y A;  1SQQ G;  1GW3 A;  3L36 A;  1T2K D;  1OW6 A;  1L0L G;  3CCM P;  1VPC A;  1NTM D;  3H1H J;  1SQV D;  1NWQ A;  1P84 E;  3CXH E;  1JMB A;  4WY4 B;  2BCC E;  1BCC J;  1A02 J;  1JOC A;  4B86 A;  2B88 A;  1N7L A;  4IL6 X;  3RL0 D;  5AVQ B;  3KZI H;  1J1E B;  2PRR A;  2OYI B;  3KDP B;  3CLQ A;  3A0B H;  2OAR A;  1SFC B;  2WQY C;  1AQT A;  1EDL A;  1QX8 A;  1BE3 D;  1D7M A;  2KS1 A;  1KD1 Q;  3PH0 A;  4OH8 B;  2WVR A;  5EFW B;  1M90 Q;  1FZE A;  2BCC J;  1IFN A;  3M0A A;  1PPJ D;  3ZDM A;  3CCR P;  3B5N C;  1EZV G;  1SQB K;  3G3Z A;  2YXQ B;  3EQ2 A;  1L0N E;  1NH4 A;  3S4R A;  2IYO A;  1VQP P;  3H1I E;  2D2C D;  3S9O A;  1GMJ A;  4W7Y A;  3M0D C;  5KAF H;  1GZL A;  1NJI Q;  2QVA A;  2KNC B;  3E1R A;  4EI2 A;  5APV A;  1FBM A;  3TGU J;  1X8Y A;  3IF4 A;  4NPD A;  4WB4 A;  3GHG B;  2B87 B;  4EDF A;  2KZI A;  2Q3E A;  1J2J B;  1HF9 A;  2FYN B;  4RJT A;  3CCU P;  2JJL A;  4I7Z C;  1DIP A;  3H1L J;  1VQ4 P;  3F89 A;  4WWI A;  2WSC H;  2YO3 A;  1AJY A;  1RF0 C;  3PP5 A;  1RF1 A;  5KLV D;  4AUW A;  4Y99 B;  4TLF A;  1QL2 A;  3SFD C;  1NU1 E;  3NTN A;  2WPR A;  1U57 A;  2Y9Z A;  2P7J A;  1YTZ I;  3VMY A;  5AW1 B;  1X22 A;  3KHU A;  1S5L E;  1MFT A;  1H8A A;  2IDB A;  3VMA A;  1YI2 P;  3O8Z A;  2ZYD A;  2FXO A;  1LWU A;  2VRS A;  4N78 E;  4IFF A;  1HWT C;  2WSS H;  2Y0E A;  1IK7 A;  2HG5 D;  3L35 A;  3L75 D;  1OVV A;  2IBZ I;  5KJ7 D;  1BGY J;  1SQQ E;  2LKM A;  2A06 E;  1PGJ A;  1CSB A;  1BE3 G;  1GL2 C;  1M1J A;  4K35 A;  1L0L E;  1U7M A;  1N7S B;  2M3B A;  4U3F G;  1QVF O;  4AQR D;  3L71 G;  2N9B A;  4NPF X;  1SQP K;  2HFE D;  4JQ0 D;  1SQX G;  3L73 J;  3T97 B;  3A0B E;  3CCQ P;  4AYC A;  1RE4 A;  1IFM A;  3VN0 A;  1JNM A;  3MTU E;  4ZNC A;  2ZYA A;  1QEX A;  2NPS C;  3TDK A;  2L91 A;  3A0H H;  3H1K D;  5CMZ A;  1FZG A;  5M1B A;  3L70 G;  2HYN A;  2ZXE B;  2WPQ A;  2W6A A;  1FJP A;  5AW3 B;  1VF5 C;  1SP4 A;  1GU5 A;  4KHX A;  1ZV8 A;  2PGD A;  1SQB D;  1R5S A;  1JMM A;  1PGO A;  3AEC C;  3CXH D;  3CCV P;  1ZME C;  3V2P A;  5KAF E;  2M5A A;  3B4S A;  1OW8 A;  2FFD C;  2KLV A;  3KXD A;  3E7K A;  5AW9 B;  4HB1 A;  1S3J A;  1EDJ A;  4XA4 A;  2KS1 B;  2I1J A;  1WRG A;  3TYY A;  1USD A;  2HOD A;  4EOT A;  3AEF C;  1W2B O;  2E5Y A;  4JF7 A;  5E79 H;  4OGQ B;  1KTM A;  4W7Z A;  3L37 A;  1X0T A;  1OWA A;  2IFM A;  3CX5 H;  1S9K D;  2PAJ A;  2WTY A;  1RH5 B;  3H1I D;  2KUB A;  4HKZ H;  1JUN A;  2ALC A;  3M91 A;  2YKQ A;  1J1D C;  1KOR A;  1DEB A;  4BWN A;  1YJW P;  3L72 G;  2KLU A;  4H0L B;  3QWO C;  2LR2 A;  2BAS A;  1G1I A;  5CJ0 A;  4K3A A;  3RK2 B;  5C39 A;  4H44 B;  2ZYG A;  1VQ5 P;  3QH9 A;  3MZW B;  1KIL A;  1N73 A;  3C1L A;  3A2A A;  1RE3 C;  3OAK A;  2R3S A;  4QMA A;  3M06 A;  2E42 A;  1GW4 A;  1JY3 N;  1HH0 A;  1NTM J;  1SQV J;  1SQB G;  3L71 E;  3SWK A;  1MUU A;  1SQX E;  1LWU B;  2NPS D;  1T2K C;  1PGP A;  2JWA A;  2XU6 A;  4PD4 E;  2XKM A;  1U7J A;  1KYO E;  3SWF A;  5AW8 B;  3AE1 C;  3BVH A;  1F5E P;  1VF5 D;  3H32 B;  3CME P;  3RL0 C;  1VQ6 P;  3Q3D A;  3L70 E;  5AW0 B;  1M1J B;  3AED C;  2E75 B;  1KFN A;  5CCG C;  1BE3 J;  2RH0 A;  3V5B A;  1PV3 A;  1PGQ A;  1URQ B;  4U3F J;  4I6M C;  1S2E A;  2A06 D;  4JBZ A;  2W83 C;  2Z5H A;  2ZVN B;  3AEG C;  1IK9 A;  2L5G B;  1FZC A;  1QGK B;  2E74 B;  3HTK A;  3K5B A;  2IZ0 A;  2Y0C A;  4D6T D;  1S1C X;  2N9Y B;  1FU1 A;  3SWY A;  2K37 A;  3D70 A;  1L4A D;  1VDF A;  1QL1 A;  2D2C C;  2H89 C;  5E79 E;  1PIX A;  3CWB D;  3V2Q A;  3GHG C;  2PP6 A;  1H89 A;  1YQ3 C;  5APW A;  2FYZ A;  4A7P A;  1YJN P;  2YMK A;  2M5A B;  3CX5 E;  2HPC A;  2I8D A;  5AVT B;  1LJ2 A;  5KLV J;  2O3J A;  2ZFC A;  3JC2 2;  2IBZ G;  3IAO A;  1BGY G;  1PP9 D;  3BCC E;  5GTI H;  2KP8 A;  1K73 Q;  2Q1K A;  3MIW A;  3H1H E;  1SQP G;  4LLH A;  2HOD B;  2N1T A;  2QJK C;  2WMM A;  1NTK K;  2XZR A;  3L73 G;  2WT7 A;  5GTH H;  3G71 P;  2QSI A;  1JO5 A;  1LNQ A;  3U1C A;  4KT0 J;  2V7Q H;  1DD4 A;  3PLN A;  4DOJ A;  2QM7 A;  2FY8 A;  1LT9 A;  3IN6 A;  4BRY A;  1DEE G;  3G6E P;  1YIT P;  1NO4 A;  1OFC X;  3GW6 A;  3WUT A;  3G9R A;  2A45 H;  4WY4 D;  3L75 J;  2RN0 A;  1RQV A;  3Q5R A;  3B8E B;  1T8Z A;  1PFI A;  1Q7Y Q;  1S5L X;  3AEE C;  5KJ7 C;  1OVU A;  1XTG B;  2C0X A;  3L72 J;  1LTA C;  2YNY A;  3NXS A;  1BDD A;  5KLI B;  2RMZ A;  1NYH A;  5AW7 B;  3CCJ P;  3B5N A;  5CCG D;  1KIL B;  1N73 B;  2CK3 H;  5B5E H;  5KTB A;  3H1J D;  1BSN A;  3H1K J;  3TGU E;  4HH2 A;  4GIF A;  3M0D A;  4M3L A;  1LTJ C;  2XND H;  1EXJ A;  3H1L E;  1YBK A;  4DT0 A;  1WT6 A;  3SSU A;  3P8C D;  1SQB J;  2QM8 A;  4GKG A;  1VQ7 P;  1P84 I;  3CXH I;  1NTZ D;  3ALC A;  1OIP A;  3GLM A;  2YIU C;  1JY2 O;  2FXM A;  4PD4 D;  1JB0 J;  2R5D A;  5BU5 A;  3AE7 C;  1KYO D;  1RF0 A;  4LC1 A;  1Q81 Q;  2R44 A;  5AW5 B;  4CPG A;  2W6B A;  1HTL C;  1PYI A;  4JYB A;  3I5C A;  1Z56 A;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 3AEC C;  2ZT9 C;  1K04 A;  1S5L X;  3AEE C;  3AE3 C;  3AEA C;  3D70 A;  4TT3 H;  4H0L D;  1YQ4 C;  2IDB A;  3AE2 C;  4XFJ A;  3SFE C;  3Q5P A;  1ZME C;  2QIW A;  2D2C C;  1R8E A;  1KIL E;  2H89 C;  1OW7 A;  1PIX A;  3LW5 J;  2G8Y A;  4I7Z B;  1RQU A;  4H44 D;  1OW8 A;  2E76 B;  2FXP A;  3D6Z A;  4YXD C;  1OMI A;  1Y9B A;  1UIX A;  3Q5S A;  1YQ3 C;  1MKM A;  1KMI Z;  1TU3 F;  3R4Y A;  3H25 A;  1HWT C;  4H13 C;  1NYH A;  2WSF J;  3RK3 E;  2ERE A;  2D2C B;  2YMK A;  3Q1M A;  3FGA D;  3GMA A;  1IK7 A;  2E76 D;  3COQ A;  4OGQ C;  2ERG A;  2MKV A;  3D71 A;  1F4S P;  3AE8 C;  2QJY C;  4Z1M H;  1VF5 B;  1HJ0 A;  3GF7 A;  4PV1 B;  1K05 A;  2E74 C;  2D2C D;  2WSE J;  3S9O A;  1GMJ A;  4H13 B;  3RL0 g;  2ER8 A;  3AEF C;  2HAP C;  3IAO A;  3AE5 C;  4GDO A;  2K9Y A;  2ZT9 B;  2FYN C;  3EWK A;  2BEQ D;  2BEZ F;  3AE1 C;  4H0L C;  2E75 C;  1F5E P;  1VF5 D;  2WSC J;  1VL2 A;  1KQF B;  1EXJ A;  4OGQ B;  1KTM A;  3C8V A;  4PV1 D;  4RKU J;  4U7J A;  1KQG B;  3T97 B;  2JP3 A;  2WPV B;  1FDO A;  2QJK C;  2ZT9 D;  4YTP C;  3ALC A;  2O01 J;  3AE9 C;  1ZRT E;  5KKZ C;  3Q3D A;  3D6Y A;  1HF9 A;  3GLM A;  2YIU C;  4R4M A;  4OGQ D;  2QSI A;  1PL5 A;  2P10 A;  2QJP C;  3AED C;  4I7Z C;  1DIP A;  2E75 B;  4KT0 J;  1OW6 A;  1ZP0 C;  2G3A A;  1DD4 A;  1EXI A;  2E76 C;  3O6Q A;  1PV3 A;  1JB0 J;  5L8R J;  1AW6 A;  3AE7 C;  1AJY A;  5KLI C;  2ALC A;  2V7Q J;  3IN6 A;  4R4L A;  4Y28 J;  3B71 A;  1KOR A;  2H88 C;  3AEB C;  3AEG C;  2E75 D;  1WMK A;  2JO1 A;  1DD3 A;  4H13 D;  4H44 C;  5M1B A;  1FDI A;  3AE4 C;  1D66 A;  2E74 B;  2NZ2 A;  3GF3 A;  4IL6 X;  3G9R A;  1NGM B;  3SFD C;  1PYI A;  1QP9 A;  1VF5 C;  4H0L B;  3Q2Y A;  1RQV A;  2FBW C;  1S1C X;  1U57 A;  4PV1 C;  3Q5R A;  2OQQ A;  3AE6 C;  2J5U A;  1PYC A;  2E74 D;  1ZOY C;  2WQY C;  4H44 B;  1Q90 D;  3ABV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...