3VW7A

Crystal structure of human protease-activated receptor 1 (par1) bound with antagonist vorapaxar at 2.2 angstrom
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
447
structure length
442
Chain Sequence
DASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLGITTCHDVLSETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSANIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/antagonist
molecule keywords Proteinase-activated receptor 1, Lysozyme
publication title High-resolution crystal structure of human protease-activated receptor 1
pubmed doi rcsb
source organism Homo sapiens
total genus 165
structure length 442
sequence length 447
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3vw7A02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3vw7A01
238LA 3AYMA 173LA 2Y01A 2OE7X 239LA 1CVKA 1L87A 3T45A 5H2IA 3UG9A 4EPIA 3DN2A 178LA 4MD2A 5H2JA 1S8LA 1EHKB 1KW7A 1G0JA 2O79A 5C1MA 1L30A 231LA 3L2XA 1NHBA 1X0K1 4GPOA 1L27A 2BRDA 1D3JA 1L05A 3GUKA 1L56A 3SB6A 228LA 3HT9A 1L62A 4W52A 5LWEA 200LA 4EJ4A 1L48A 1L15A 4GBRB 1L68A 189LA 186LA 243LA 1H2SA 4BVNA 1CV4A 4LDEA 1L83A 2Z73A 3EH3B 3RFMA 1G1VA 1L84A 3QAKA 4ARLA 3D4SA 4G72B 4BEZA 4JKVA 152LA 4IAQA 2Y04A 5J7AA 1L53A 3NS0A 2LZMA 126LA 211LA 1L76A 4E97A 1OWZA 4I7PA 1PXRA 4QIDA 123LA 205LA 4PXKA 5I14A 147LA 150LA 4ARQB 3S8FB 2M3GA 4UG2A 3REYA 3F9LA 4K5YA 1Q5IA 4I7JA 175LA 1QTDA 3GUMA 3HTGA 1LYEA 1XJUA 118LA 2O7AA 2I1XA 2B70A 168LA 1C3WA 2NTUA 4I7QA 4N6HA 3HH3A 2HUKA 7LZMA 3HAOA 2KS9A 1C6FA 1LGWA 248LA 2YDVA 1L26A 1CWQA 1CTWA 214LA 3L64A 4W59A 4DJHA 3LZMA 171LA 1KS3A 3DN3A 4ZPUA 151LA 3P0GA 104LA 1PQKA 256LA 4W55A 1TN0A 190LA 1C60A 1L47A 4YXAC 3HU8A 3SN6R 5G54A 247LA 5H2PA 1C6EA 1CU5A 2YCWA 2WJLA 3RUNA 2YCXA 1GU8A 1OV5A 1QM8A 3C8QA 1KY0A 122LA 233LA 197LA 5ITCA 195LA 1D2YA 232LA 3HT7A 3HTDA 3GULA 4LZMA 4EKQA 1LGXA 3OE8A 1QSBA 1PQDA 166LA 3DMXA 4ARMA 2Y02A 4L6RA 253LA 1L31A 4FAAB 4JQ6A 4BEYA 4EKPA 3BVDB 1L61A 2L78A 1G07A 169LA 1XIOA 4X31A 3RZEA 1S52A 1G0QA 4I7NA 2EI4A 5G2CA 1LW9A 1CU6A 5AZDA 1D9WA 1L63A 215LA 1L13A 2NTHA 4ARJA 2RBQA 1QTHA 5F8UA 3HT8A 1L17A 1LPYA 3SBAA 1C66A 1C63A 1BRDA 1L92A 5H2KA 3CDRA 2Z6BA 1LWGA 3HASA 1L9HA 1CX7A 191LA 1QUHA 1OVKA 1C6JA 5DHGA 3QJTB 1OWYA 1GZMA 3MBVA 1CV3A 4WAVA 4I7TA 4W58A 3WQJA 4G7SB 115LA 1C6GA 2KSYA 1P36A 4TL3A 1KMEA 1T8AA 222LA 5H2OA 201LA 224LA 2JAFA 3EH5B 1L01A 4FPDA 3S8GB 1L18A 3HH5A 138LA 1L04A 1P64A 223LA 262LA 1L22A 5AHZA 249LA 2Y00A 237LA 3EMLA 1PXSA 1L06A 1L16A 1L59A 1R2NA 1QT5A 1QTVA 3DN0A 209LA 234LA 3HTBA 149LA 1LLHA 1P5CA 1SSYA 3VG9A 4MQTA 242LA 1T97A 226LA 2RBPA 225LA 1LI2A 1QKPA 3A7KA 1C6IA 3C80A 3UZCA 145LA 1QUDA 1L0JA 1CU0A 5ITEA 2RBSA 3FADA 5JJEA 3DMZA 1L45A 4S0WA 5B6YA 1P3NA 1P8HA 4IAPA 1L42A 245LA 1C8SA 3NY8A 2B6TA 167LA 2LCBA 3DN4A 206LA 1QT8A 3C8SA 146LA 3QDCA 4HYJA 1P7SA 2RBRA 261LA 3KJ6A 3VHZA 112LA 1C62A 1L36A 3VW7A 1ZWNA 4XTOA 5B2NA 1CUQA 1L41A 1L70A 3HUAA 3QJRB 1CUPA 2YCYA 3NYAA 4GP5B 5B6ZA 5A44A 4EXMA 1G0KA 1JTMA 1C6KA 4BUOA 1E0PA 3COCA 174LA 1DYEA 1C65A 2B6WA 1I6SA 1L12A 2B74A 5G53A 1C68A 244LA 1VGOA 2QARC 2CUUA 2KSAA 4X32A 4XT1A 4GP8B 3S3CB 4HWLA 3HH6A 1KY1A 3GUPA 157LA 3HUKA 2I35A 102LA 3JR6A 2QPDB 3UTWA 4BV0A 1L32A 4MQSA 3DDLA 2Y03A 1L91A 221LA 1OV7A 2IGCA 4L35A 2RAYX 1L99A 1P56A 1LYDA 3DNAA 4YXCA 4QI1A 184LA 3VI0A 2B6XA 2OU0X 1P6YA 4DAJA 1JTNA 213LA 1C6HA 1L93A 1LYIA 3CDOA 1S53A 5AHYA 4A4MA 4J4QA 2QPEB 5B0WA 1LYFA 1L79A 2Q9EA 1L23A 1KW5A 5LZMA 160LA 1L50A 2B6YA 1B6IA 1L86A 4ARMB 218LA 229LA 4GP4B 1L64A 1QKOA 5JJNA 3SB7A 1L66A 4MBSA 4G7RB 3C81A 2RBOA 217LA 2HULA 4EKSA 1S8JA 2F32A 4LDLA 2LNLA 5BR2A 5G2DA 1P8UA 187LA 1L77A 3DN1A 2RBNA 1BM1A 1DYBA 1FBKA 3HAQA 1L69A 1L72A 1QTCA 3QJSB 5H2MA 2PEDA 3QBKA 3C82A 2ZIYA 3X3BA 5G36A 3S3DB 6LZMA 4G7QB 1L88A 4EA3A 3FA0A 1MGYA 1C6AA 1CU2A 3S3BB 1JGJA 1PQMA 3QBGA 2RH1A 3SB9A 2AT9A 3OE0A 1L52A 1SX2A 2A4TA 4I7OA 3DKEX 3FI5A 1XJTA 1L33A 2NTGA 4UHRA 196LA 1CV0A 4I7LA 1L82A 3G3VA 1M0MA 1QT6A 2JAGA 252LA 1C6LA 1C6QA 1R84A 5B35A 1C6CA 4FBZA 3UTYA 159LA 2B75A 3GUNA 212LA 3GUIA 4XTLA 1ZYTA 4I7RA 3EH4B 1UAZA 5BR5A 1L11A 1PQJA 1LWKA 1QT7A 1CV1A 3DN8A 198LA 1LI3A 2J4YA 3CODA 4N4YB 3ZPQA 1C6MA 3ODUA 4HYXA 1S54A 2OTZX 2OU8A 129LA 2Q9DA 2F93A 250LA 192LA 1L85A 137LA 1G0LA 2Z55A 188LA 1KGBA 4WW3A 1L55A 1LYGA 5H2LA 5TGZA 2HPYA 3AM6A 2OE4X 181LA 5G2AA 109LA 1L20A 141LA 2OTYX 1QT4A 2HUMA 3PQRA 3QBLA 4XTNA 4EIYA 254LA 1L25A 3V2YA 1L44A 2YDOA 4PK0A 3K2RA 1M0KA 3DN6A 1L58A 130LA 1S51A 3AYNA 1JFPA 1WTHA 1C64A 1FBBA 3VGAA 3ZPRA 2NTWA 2B6ZA 3OE6A 5A45A 1L57A 251LA 2OEAX 1L51A 3HTFA 1C61A 1CV6A 177LA 142LA 1G0PA 1IXFA 1F4ZA 1EPYA 3HDFA 3C8RA 3C7WA 1KG9A 1L90A 4XT3A 4KNFA 1TN5A 4PJZA 2R4RA 1KNIA 1L97A 119LA 219LA 1D2WA 220LA 1DYDA 5H2NA 1DYAA 4MD1A 4AMIA 4I7KA 5B6VA 4W51A 1PY6A 4EPFA 1CX6A 2X72A 3NSBA 4EKRA 1UCQA 111LA 3PDSA 1D3FA 2F47A 128LA 114LA 3QJVB 1P37A 1QHJA 3OAXA 3HU9A 1L71A 3HUQA 1IW6A 120LA 5KKHA 1SX7A 1L39A 1L96A 1QUGA 257LA 1G06A 4XXJA 3C7YA 4G71B 108LA 1QTBA 1L34A 185LA 1L75A 1PQIA 143LA 161LA 1L94A 1T8GA 3G3WA 4LDOA 3OE9A 1U19A 3QJUB 1F88A 4IB4A 5ETZA 1XJIA 1L73A 1E12A 2ZZLA 1L65A 1LN6A 230LA 1D3MA 258LA 5A8EA 176LA 4QRYA 1C6DA 2I20A 2R4SA 1L02A 3DQBA 3PBLA 2OE9X 3CDTA 1QSQA 1G0GA 2YCZA 235LA 172LA 1IW9A 4W57A 1M0LA 1P8IA 2B7XA 1X0SA 3VVKA 241LA 1L10A 2OU9A 3HT6A 4OO9A 3G3XA 1XMEB 1C6TA 1CU3A 255LA 1KG8A 1L60A 4GBRA 1L54A 3HARA 1L0KA 3QJQB 1JV7A 2ZFEA 5DYSA 2ANXA 4YX7C 1L43A 1TLAA 1T8FA 1DYGA 2F95A 2RB1X 1K28A 3CDQA 1L07A 107LA 2QB0B 163LA 3F8VA 1L67A 1SSWA 4GRVA 164LA 1L49A 4DKLA 1C6NA 1L09A 131LA 1P46A 1VJMA 4BWBA 1LYHA 2WJKA 1L40A 2B73A 1QT3A 259LA 3DMVA 1L98A 1H68A 3UTXA 180LA 5AX1A 5B6XA 4ARQA 2O4WA 1P2RA 2RAZX 139LA 3HWLA 1L95A 216LA 3ABWA 170LA 1AT9A 4ARPA 1L81A 5AWZA 1C8RA 1DYCA 1Q5JA 1JV6A 1L14A 1L03A 1L29A 1L35A 210LA 1L24A 3UONA 4IARA 5DHHA 1C69A 1P2LA 1DZEA 5JJJA 3CDVA 1OYUA 1AP9A 156LA 1LGUA 4AQNA 4FA7B 1L89A 3C83A 1XEPA 158LA 1JQUA 240LA 4W53A 3UZAA 4W56A 4I7MA 1D3NA 3HAPA 1LYJA 2RB0X 110LA 1QUOA 3HANA 3QAPA 155LA 113LA 1C67A 1L38A 1LI6A 1G0MA 3C9MA 4X1HA 5AX0A 127LA 4G70B 1OVJA 182LA 2I21A 1SWYA 183LA 4N4WA 4OV0A 162LA 148LE 2L6XA 3C9LA 1QS5A 1L28A 1L74A 3UTVA 1L21A 3HH4A 1F50A 5FJGA 3ZEVA 1QTZA 3X3CA 103LA 4NC3A 5EN0A 2ANVA 1L80A 246LA 4GYCA 1L0MA 1HZXA 1OVHA 2LC9A 1PQOA 3PXOA 1ZURA 3HDEA 260LA 3NY9A 144LA 1L19A 4Y9HA 1BRRA 3QBIA 1L46A 4AMJA 1G1WA 2RB2X 4JR8A 4I7SA 3GUJA 199LA 2VT4A 1BRXA 1QS9A 5B6WA 1X0I1 1L08A 1O0AA 3PWHA 1T6HA 4W54A 1C6PA 3SB8A 4KLYA 2F2QA 3GUOA 2KSBA 1L37A 3SB5A 4PXFA 1C6BA 227LA 1CV5A 5G28A 3V2WA 125LA 2B72A 1L00A 3SBBC 1GUEA 3CAPA 5H2HA 236LA 140LA 165LA 3C7ZA 1DYFA 1SWZA 5B34A 2G87A
chains in the Genus database with same CATH superfamily
238LA 4XJFA 173LA 2Y01A 4DC4A 5H2IA 1LZGA 1BWJA 1GFJA 1YL0X 3WXUA 178LA 5H2JA 1S8LA 1EHKB 4NGIA 2YBHA 1L27A 1D3JA 2G4PA 3WW5A 1L05A 1L56A 228LA 1L62A 1WQRA 1GFAA 1HMKA 3A95A 4XADA 1OUAA 243LA 1CV4A 4R6CA 4B4JA 4XJHA 3EH3B 4BEZA 3D4SA 4G72B 3TMUA 1YAOA 4WM2A 2LZMA 1L76A 2W1LA 4NSHA 1OWZA 1LOZA 1WTMA 205LA 4PXKA 147LA 1AM7A 4G4CA 1ZMYL 1LSGA 5LAFA 1Q5IA 4I7JA 3GUMA 2I1XA 208LA 168LA 3TXIA 2NTUA 4N6HA 2Z37A 3HH3A 4NGOA 7LZMA 3HAOA 1LZ8A 2KS9A 4WG1A 1C6FA 4YM8A 3SP3A 1I1ZA 2BQHA 1CTWA 214LA 1YKZX 2BQNA 4W59A 2G4NA 104LA 2W1MA 5KXZA 4YXAC 3RW8A 3WYHA 3TMVA 1GU8A 233LA 153LA 195LA 232LA 4LZMA 2DQAA 2Y02A 1QSBA 4L6RA 1YILA 1L31A 1XGTC 2YBNA 4NSIA 1IC5Y 1HMLA 1OUCA 1GDXA 2C8OA 1BQLY 5DLAA 1L13A 4ARJA 2IFFY 3SBAA 1C66A 4OWEA 1LWGA 4NG1A 1CX7A 2ZIKA 1LHHA 1OWYA 3W6BA 1GZMA 1CV3A 5ILFA 1GE1A 115LA 1IP7A 1GB9A 1P36A 4NFVA 1KMEA 2HU1A 5APEA 4XJBA 3HH5A 2CDSA 4WM6A 262LA 249LA 1L06A 4PJ2C 1L59A 2HU3A 1I20A 209LA 4AXTA 1P5CA 1SSYA 3VG9A 4MQTA 2RBPA 1ZVHL 4QEQA 4N9RA 5E9RA 1IWZA 2YSSC 1GB7A 3LYMA 1HF4A 1L45A 1JKDA 1WTNA 4NHIA 2B6TA 3DN4A 1LJFA 1QT8A 3C8SA 146LA 1UUZC 1P7SA 2RBRA 112LA 1QIOA 1UC0A 5D5CA 5B1GA 2YBJA 3QJRB 3W3EA 1J1OY 4EXMA 1C6KA 4YEMA 4BUOA 1E0PA 1C65A 3CSZA 5G53A 2B74A 1UBZA 1QSWA 194LA 3HH6A 4LGKA 1GBYA 3GUPA 3HUKA 102LA 2PC2A 3JR6A 2QPDB 5FEKA 2RAYX 1P56A 1LYDA 1UIGA 1FLUA 1HERA 1OUGA 1P6YA 4DAJA 2BQDA 1JTNA 2F2NA 1IP1A 1C6HA 1KXXA 3CDOA 4J4QA 1F6RA 3LYTA 1LYFA 3B0KA 4NGWA 2Q9EA 5C6IA 1KW5A 5LZMA 1L86A 1IORA 218LA 4GN4A 5DN5A 1JUGA 217LA 2HULA 1S8JA 1REZA 1QTEA 5BR2A 2WARA 1L77A 3ATOA 1NBYC 1LJEA 1LHJA 3C82A 5G36A 4EA3A 1D0LA 1JGJA 3SB9A 2AT9A 1OUBA 3OE0A 5LA8A 2A4TA 1LCNA 1XJTA 4CGEA 4I7LA 1GB8A 5I54A 1UICA 4RLMA 1R84A 1C6QA 3P4ZA 159LA 2B75A 1UACY 3A3QA 3WPKA 212LA 3GUIA 3EH4B 1UAZA 1L11A 1QT7A 2ZQ4A 1CV1A 3ZPQA 1B7QA 2J4YA 1F10A 1WQPA 1C43A 3N9CA 1L85A 4HSFA 5L3HA 4DWXA 1L55A 181LA 5G2AA 2FYCA 3PQRA 2HUMA 4NSGA 1KXWA 3AW6A 3OJPA 1L58A 130LA 4OWHA 1S51A 1JFPA 1XEKA 3VGAA 3ZPRA 2NTWA 3A8ZA 1B7RA 1L51A 1NDGC 1FLWA 2OEAX 1C61A 2EQLA 177LA 3IJUA 5HMJA 1G0PA 1PS5A 1IXFA 1EPYA 5LVHA 1KG9A 1CKDA 1L90A 2EIZC 5J7CA 4QDNA 1TCYA 2Z39A 4KNFA 2ZWBA 3K3TA 1GEZA 1INUA 1L97A 1LSAA 1DYDA 1CKHA 4EPFA 4Z41A 8LYZA 1SQ2L 4GCBA 4Z3MA 1NBZC 128LA 2DQHY 135LA 114LA 3HU9A 1SX7A 1L39A 1G06A 1MELL 108LA 1UIFA 1L75A 1GFHA 143LA 161LA 4HTQA 4LDOA 3OE9A 3W6CA 1XJIA 1L73A 230LA 1HEOA 2F4GA 3P66A 3PBLA 4B4EA 3CDTA 4IASA 1G0GA 235LA 2F4AA 4NY5A 1IW9A 1M0LA 1X0SA 2B7XA 3N9AA 2OU9A 1J1XY 255LA 2N5ZA 5KXLA 3QJQB 2ZFEA 2ANXA 5FDJA 1LJGA 4YX7C 1Z55A 2RB1X 5HQ1A 1JTTL 4GCEA 1L49A 4HJYA 4DD2A 1C6NA 131LA 4KT3A 3A92A 1LYHA 154LA 2XBSA 2WJKA 1QDRA 4B4IA 3UTXA 1L98A 5AX1A 2CGIA 1DQJC 139LA 1YKYX 170LA 2F30A 1Q5JA 5DHHA 2BQFA 3ULRA 3CDVA 1ZV5L 1AP9A 1AZFA 4H8XA 4AGAA 1IWVA 3UZAA 2FBDA 1IX0A 1D3NA 1LTMA 1LYJA 1YAMA 5AX0A 1C67A 1LI6A 1L38A 3C9MA 4X1HA 127LA 1WVUA 2YVBA 5ILCA 1LZYA 1RI8B 3AGGG 5FJGA 1HENA 1OUFA 2ANVA 1HEPA 2DKVA 1HZXA 3CSRA 2BQGA 1PQOA 2NWDX 3PXOA 3HDEA 260LA 3NY9A 1L19A 4Y9HA 3QBIA 1DXJA 3HBHA 4AMJA 1G1WA 2RB2X 1DPXA 5B6WA 1X0I1 1JJ0A 1B5YA 5I4XA 4N1EI 4W54A 2F2QA 4CHXA 1C6BA 5IHGA 3V2WA 4ETBA 4H9IA 1AKIA 1L00A 1C46A 1GBSA 5IDDA 1WQOA 4DD3A 1IOQA 236LA 165LA 4G49A 4MR1A 2G87A 5B34A 2OE7X 1CVKA 3P64A 3CT0A 4XJGA 4EPIA 4H91A 5KXRA 4NGYA 1JKAA 2DQEY 1KW7A 1G0JA 5C1MA 2AUBA 2HUBA 1NHBA 3LYZA 1MLCE 4GPOA 3CT1A 1FLQA 3GUKA 1LZRA 1T6VL 4W52A 1JSFA 200LA 4EJ4A 4GBRB 1L15A 1YROA 186LA 3G3BB 4LDEA 1L83A 2BQBA 1NF5A 2MEBA 3RFMA 1G1VA 3QAKA 4ARLA 4JKVA 2LZTA 2MEGA 152LA 2FYDA 1CKFA 1L53A 126LA 211LA 4PRQA 1LZDA 2DQJY 5I14A 2DQDY 3RNXA 3AZ5A 2D4JA 3F9LA 4OWCA 1QTDA 1OUDA 5B1FA 4DS7E 2O7AA 2HUKA 248LA 1YANA 5KXNA 1CWQA 3L64A 4DJHA 1KS3A 256LA 4W55A 1C60A 1L47A 4PRUA 5G54A 1B7NA 2HTXA 247LA 1IP2A 1JTOL 1H87A 2YCWA 2VB1A 1C45A 1GFGA 1KY0A 1BHZA 1D2YA 3GULA 4EKQA 3GXKA 3DMXA 166LA 4GN5C 4FAAB 3F6ZA 1HNLA 4EKPA 3BVDB 1B7PA 1L61A 2L78A 1XIOA 4WM5A 1S52A 1G0QA 4I7NA 3QY4A 3WW6A 2EI4A 1CU6A 3TXGA 2NTHA 5LVGA 2RBQA 2HEDA 3ZEKA 3CDRA 3ATNA 2Z6BA 5IELA 4OWBA 1NKHA 5DHGA 3QJTB 1GB6A 3N9EA 4WAVA 1IWXA 3MGWA 4G7SB 1GFRA 1C6GA 3WPJA 1T8AA 1O23A 5H2OA 1REMA 3EH5B 3S8GB 4LYCA 4NEBA 3T6UA 5LIOA 223LA 5L3IA 1T3PA 237LA 3EMLA 1PXSA 1VDQA 3AB6A 1LZTA 1LZ4A 1QT5A 3DN0A 1C7PA 3HTBA 1GFUA 4NHTA 4HV2A 145LA 1L0JA 2RBSA 5B6YA 3BKVA 1L42A 3KAMA 4MCKA 4XENA 1B2KA 5F16A 5KXMA 3VW7A 1ZWNA 1L41A 2ZIJA 1LZ5A 4H93A 1CUPA 2YCYA 1PZYA 1IWYA 4GP5B 3QE8A 1IP4A 1FDLY 4WG7A 4H1PA 5LYTA 1NQIA 5I4WA 3CSQA 1DYEA 1OQMA 1I6SA 4H9FA 1C68A 244LA 3S3CB 2I35A 3A34A 2X0AA 4MQSA 3DDLA 2Y03A 221LA 4QI1A 4LZTA 3VI0A 5F81A 1ZVYB 1L93A 4A4MA 5LINA 1BB5A 1GE0A 1L79A 1KIRC 1L50A 4DQ5A 1L64A 2DBTA 3J6KA 5JJNA 1L66A 1B5ZA 4EKSA 1IP6A 1LAAA 1QUSA 4TUNA 187LA 1HEWA 3W6AA 5A3EA 5II3A 3HAQA 5H2MA 3TXKA 2ZIYA 1GBZA 3S3DB 1HFZA 6LZMA 1DI3A 5F9XA 1C6AA 3S3BB 1VAUA 2RH1A 1F6SA 3CB7A 1SX2A 4I7OA 2ZYPA 3FI5A 5I5QA 4DDBA 1CV0A 1IC7Y 4J7VA 5KXSA 3A93A 1LSEA 2LYMA 4N4YB 2H9JA 4HYXA 1RE2A 2F93A 129LA 250LA 3FI7A 1G0LA 1VFBC 1BVXA 4WW3A 4NGZA 2HPYA 3AM6A 1L20A 141LA 4XTNA 2ZNXY 5KXYA 1D0KA 4WLTA 4PK0A 3K2RA 5LVKA 1FBBA 5KKIA 4TSCA 2B6ZA 4GCDA 2GV0A 251LA 3WVXA 3W6FA 1CV6A 4NGJA 1C08C 1F4ZA 3OK0A 1CJ7A 3AZ7A 3RU5A 1B5UA 4PJZA 1TDYA 1KNIA 4PPOA 2BQKA 2MEFA 4H9EA 5JENB 4AMIA 4HP0A 4NG8A 4W51A 4YEOA 2BQJA 2X72A 1CX6A 4J1AA 3ZVQB 1GF3A 4EKRA 3TMWA 1IOTA 2DQGY 2F47A 1N4FA 3QJVB 1P37A 1QHJA 120LA 5KKHA 4RLNA 1L96A 1JJ1A 1QUGA 4E3UA 3RZ4A 1HFYA 1QTBA 1L34A 185LA 1PQIA 3G3WA 1TBYA 1LMAA 5HLLA 1HELA 1L65A 3G3AB 1GAZA 5A8EA 4QRYA 2I20A 1EQ4A 3DQBA 5KJ9A 1GB2A 4H94A 1ALCA 4W57A 2EKSC 3VVKA 4H92A 5DM9A 2FBBA 1L60A 4NHPA 4GBRA 2XBRA 1L54A 3HARA 1JV7A 1QQYA 4HJVA 4NHQA 1TLAA 1YQVY 2F95A 5F14A 2DQFC 5KY1A 132LA 1GD6A 1L07A 2H9KA 107LA 2QB0B 1SSWA 1G7IC 4DKLA 5KXKA 5APDA 3IWRA 1B7SA 3HFMY 3UTWA 1LYZA 4NGVA 2O4WA 4WLXA 1P2RA 4Z46A 1AT9A 4ARPA 1L81A 5AWZA 1JV6A 1L29A 210LA 3UONA 1IIZA 1L24A 4LT3A 4IARA 1BGIA 1OYUA 1L89A 1XEPA 158LA 240LA 4W53A 4ETEA 1LMNA 110LA 3HANA 1XEIA 1G0MA 1OVJA 1SWYA 4ANRA 183LA 4N4WA 1QS5A 1L28A 134LA 1F50A 3HH4A 4NWEA 1QTZA 1G7LC 5FHWA 1L80A 246LA 1L0MA 1LMQA 2LC9A 144LA 1BRRA 4KPMA 1LMTA 3GUJA 5APCA 5B59A 1L08A 1O0AA 1T6HA 3SB8A 1JTPL 2KSBA 1L37A 6LYTA 227LA 1CV5A 4FDYA 5G28A 1FKVA 1GUEA 1DYFA 1LZ1A 4WM1A 4GLAA 1HHLA 4XJIA 1IY3A 1IO5A 4H9CA 4MD2A 4J0LA 1LMOA 4GCCA 2O79A 1HC0A 1L30A 4QGZA 1GEVA 3SB6A 3HT9A 4C3WA 4DDAA 5LWEA 4P2EA 1L68A 2RSCA 4U3XB 1H2SA 1LJNA 2Z73A 5C6LA 4X3BA 2BQLA 4IAQA 1IP5A 1GF5A 2Y04A 3E3DA 4OOOA 1LJIA 1CJ6A 4E97A 4I7PA 1BB4A 2M3GA 1B9OA 4UG2A 3REYA 5HNLA 4K5YA 2ZQ3A 2HEAA 3HTGA 1LYEA 118LA 4H8ZA 2B70A 1JISA 1JWRA 1FN5A 207LA 4BAFA 1C3WA 3WU9A 4I7QA 4IATA 1LGWA 2YDGA 4HV1A 4DYGA 1LZ9A 4DD9A 4ZPUA 1LKSA 151LA 1HSXA 3RT5X 1TN0A 3P68A 4DDCA 1LHMA 3HU8A 3SN6R 1IR7A 4G4BA 1CU5A 2WJLA 3RUNA 2A7DA 4BS7A 4LT1A 1OV5A 1QM8A 1REXA 1CKCA 2MEHA 2Z2FA 122LA 197LA 3HT7A 1W6ZA 3HTDA 3WH1A 1IR8A 1GF6A 1PQDA 4KXIA 4BEYA 1GHLA 1GFVA 1G07A 5B05A 1LW9A 1RJCB 5AZDA 1D9WA 1JSEA 5F8UA 3A94A 1BWHA 1L17A 5FSTA 1C63A 1BRDA 1L92A 3M3UA 191LA 2BQOA 1C6JA 4NWHA 5APFA 3MBVA 1TAYA 2KSYA 4CJ2A 4TL3A 2ZYCA 222LA 1V7SA 5I4YA 201LA 1L01A 1LSNA 4FPDA 1L18A 2A7FA 3WXTA 1L04A 1WQMA 1P64A 5AHZA 1G7JC 1L16A 3AZ6A 1B7MA 1R2NA 4ETDA 2MEEA 1LLHA 3TMXA 1RFPA 1T97A 226LA 242LA 225LA 1LI2A 2CWIA 4WMGA 1QKPA 5LYMA 6LYZA 3FADA 3EO5A 3LN2A 1P8HA 4IAPA 4LT0A 3NY8A 167LA 2LCBA 5KXTA 206LA 4ZIXA 5EBHA 4HYJA 1GF4A 1E8LA 1C62A 4I0CA 1QTKA 1LZ6A 1WVVA 1CUQA 4H9AA 2D4KA 3NYAA 5B6ZA 1HFXA 3WVYA 1G0KA 1LYYA 1B5XA 3VWOA 3A96A 2Z38A 4MSTA 3ZVQA 4N5RA 4X32A 4GLVA 4HWLA 3LZ2A 5F9UA 157LA 1GFEA 1HEMA 2Y8PA 4L35A 1L99A 3DNAA 4YXCA 1UIEA 2OU0X 1LYSA 1D6QA 5AMYA 1S53A 5AHYA 1CJ9A 2I26L 4HJZA 160LA 2B6YA 1B6IA 4ARMB 4GP4B 4RW2A 3SB7A 4MBSA 4PGJB 2RBOA 2HEBA 1RCMA 133LA 5G2DA 4NSJA 1IWTA 2RBNA 1DYBA 4HTNA 1L69A 3QJSB 3X3BA 1AT6A 4W96A 1CU2A 4ET8A 1YL1X 1UIHA 1CKGA 4LYMA 4UHRA 1L33A 2Q0MX 4G4HA 3TXBA 1YAPA 1M0MA 3B0OA 1QT6A 4DT3A 252LA 5B35A 1C6CA 3UTYA 4LT2A 4XTLA 1GWDA 4I8SA 1VEDA 4I7RA 2C8PA 4XN6A 4TWSA 3CODA 198LA 1LI3A 4C5FA 1DI4A 1JKBA 3ODUA 3W6EA 1S54A 2Q9DA 137LA 1WQQA 1DKJA 2Z2EA 4OW1A 2LYOA 1LYGA 5H2LA 5TGZA 109LA 2OTYX 3QBLA 4EIYA 254LA 1B5VA 1L44A 1B7LA 3A91A 1M0KA 3DN6A 1IP3A 1IOCA 3AYNA 1WTHA 1C64A 1IWUA 4FJRA 5I53A 5A45A 1L57A 2IHLA 1IVMA 1YKXX 3C8RA 1SLYA 4WM4A 4YENA 3A6CY 2R4RA 4PHIA 4RW1A 2Z19A 5H2NA 1DYAA 4MD1A 4ETAA 1D6PA 1PY6A 3NSBA 111LA 4HTKA 4XJDA 1L71A 1JEFA 4NHSA 3C7YA 4XXJA 1L94A 1B5WA 2MEAA 1U19A 3QJUB 1E12A 2ZZLA 4H8YA 1D3MA 258LA 176LA 2DQIY 1C6DA 3CQLA 2D6BA 2OE9X 1QSQA 4H9HA 1DZBX 1GXV2 241LA 1L10A 193LA 2XTHA 3G3XA 1XMEB 1YIKA 2D91A 3D3DA 4WOAA 3IJVA 1T8FA 1DYGA 1LPIA 1K28A 3CDQA 4RDSA 2XQOA 3A67Y 4W94A 1KIQC 164LA 1P46A 1VJMA 4BWBA 2BPUA 1L40A 1QT3A 1GB3A 3DMVA 180LA 5B6XA 1LSYA 1GE3A 3HBEX 3B72A 1L95A 216LA 4OOTA 2HECA 1DYCA 1L14A 1L35A 1C69A 1P2LA 4IJ4A 156LA 1LGUA 1GPQC 5LYZA 4I7MA 2RB0X 4LFPA 2YBLA 5FELA 155LA 1LJJA 1LHIA 5B07A 1DI5A 4A7DA 2L6XA 148LE 3C9LA 1L74A 4TX7A 3X3CA 103LA 4NC3A 4M4OA 4GYCA 3A6BY 5HNCA 5KXOA 9LYZA 1OUIA 3LYOA 7LYZA 1ZURA 2BLXA 3M18B 1LZCA 3AZ4A 4JR8A 1W08A 2VT4A 3AJNA 4ZFPA 1LJHA 1C6PA 4KLYA 3WU8A 1IEEA 1IR9A 3GUOA 3A3RX 1XGRC 3P65A 3AGIA 1GBWA 1HSWA 1NHEA 1EQ5A 5H2HA 140LA 3C7ZA 1SWZA 4N1CC 3AYMA 239LA 1L87A 3T45A 3TXEA 3UG9A 3DN2A 1IC4Y 4B49A 4G9SA 231LA 2HEFA 3L2XA 1X0K1 2BRDA 2BQMA 1OUEA 1LSCA 1L48A 4TTDA 189LA 4BVNA 1JJ3A 1QDTA 2D4IA 1UA6Y 1XFPL 1BWIA 1L84A 1XGUC 1JKCA 5J7AA 4L41A 3NS0A 4XYYA 1PXRA 1KIPC 4QIDA 123LA 150LA 4ARQB 3S8FB 4QY9A 175LA 1EQEA 4BAPA 1NWGA 5L9JA 5M1YA 1XJUA 4DQ7A 1BB3A 1KXYA 1QUTA 2YBIA 1LSZA 4WO6A 2YDVA 1L26A 2H5ZA 3LZMA 171LA 3DN3A 3P0GA 1PQKA 1F0WA 190LA 1G7MC 5H2PA 1C6EA 2XJWA 2YCXA 1JHLA 1YAQA 3C8QA 5ITCA 2Z18A 4WL6A 1IWWA 1LGXA 4TSBA 3OE8A 4ARMA 253LA 4JQ6A 1UIDA 169LA 1GE4A 3RZEA 4X31A 5G2CA 1GBXA 1NDMC 4DD0A 2BLYA 1L63A 215LA 5LAGA 1QTHA 3HT8A 1LPYA 5H2KA 1DPWA 3HASA 5B06A 1L9HA 1QUHA 1OVKA 4DD7A 5DL9A 2B5ZA 1GF0A 4I7TA 4W58A 3WQJA 3A90A 2I6ZA 3QNGA 4UWUA 1FBIX 224LA 2JAFA 1GDWA 3B0IA 1XGPC 1GF8A 138LA 1DKKA 1FLYA 1L22A 4N0JA 3T36A 2Y00A 1VDSA 4YOPA 1QTVA 3WPLA 234LA 2BQIA 149LA 2BQAA 3BKHA 1JITA 5DN4A 3EBAB 4O34A 3TXJA 3A7KA 2LZ2A 1C6IA 4LFXA 3C80A 4H90A 3UZCA 1QUDA 1CU0A 5ITEA 5JJEA 3DMZA 4S0WA 4H9BA 3W6DA 4B1AA 1P3NA 245LA 1GFTA 2Z12A 1C10A 1C8SA 2HEEA 1GXXA 4B0DA 3QDCA 1B0DA 2ZILA 4DD1A 4DQJA 261LA 3KJ6A 3VHZA 1L36A 1GFKA 4XTOA 2MEDA 5D5FA 5B2NA 1L70A 3HUAA 1LKRA 5A44A 1JTMA 3HBDA 4ET9A 3COCA 3LHMA 174LA 4WO9A 2B6WA 1L12A 3WU7A 2G4QA 1VGOA 2QARC 1A2YC 1VDTA 2CUUA 4HPEA 2KSAA 4GP8B 4XT1A 5LXWA 1KY1A 3AW7A 1OUHA 4EOFA 1LJ3A 1IOSA 4BV0A 1L32A 1L91A 1OV7A 2IGCA 1H6MA 1LJ4A 184LA 1FKQA 2B6XA 1LZEA 4R0FA 213LA 1LYIA 3LZTA 2QPEB 5B0WA 1QSAA 1L23A 1D0MA 229LA 1QKOA 4D9ZA 4G7RB 3C81A 4II8A 2F32A 4LDLA 2LNLA 1OP9B 4ETCA 1P8UA 5LA5A 3DN1A 1BM1A 1CNSA 1REYA 5T3FA 1FBKA 1L72A 1QTCA 2PEDA 3QBKA 2BQEA 4G7QB 1L88A 3FA0A 1MGYA 1LSMA 1PQMA 3QBGA 3WULA 2I25L 4WLDA 1L52A 1B7OA 2LYZA 3DKEX 1GB0A 1LHKA 2NTGA 3CT5A 196LA 1L82A 1CJ8A 4GCFA 3G3VA 2JAGA 1C6LA 4FBZA 4OWAA 2ZNWY 3GUNA 1BB6A 4CFOA 1ZYTA 4N8ZA 5BR5A 1PQJA 1LWKA 3DN8A 1TEWA 2MECA 4EMNA 1C6MA 1LSBA 1LZNA 2OTZX 2OU8A 1WQNA 4ZEEA 192LA 1LZAA 2Z55A 2CJLA 188LA 1KGBA 1D9UA 3B6LA 1HEQA 2OE4X 2LHMA 4GN3A 1QT4A 4CFPA 3V2YA 1L25A 3WUNA 2YDOA 1EL1A 1UIAA 3GXRA 1A4VA 1G7HC 5KXWA 3OE6A 1LSDA 3HTFA 4YF2A 4ML7A 1XSFA 142LA 4M6DA 3HDFA 3C7WA 1LZSA 4XT3A 1TN5A 119LA 219LA 1D2WA 220LA 4J1BA 1V7TA 5B6VA 4I7KA 1XGQC 5KXPA 1UCQA 3WUMA 3PDSA 1D3FA 1LJKA 5C6JA 3OAXA 3HUQA 1JPOA 1IW6A 2EPEA 257LA 4G71B 5E4PA 1T8GA 4WL7A 5ETZA 1F88A 4IB4A 1LN6A 1LSFA 3TXFA 2R4SA 1L02A 1GE2A 1UCOA 2DQCY 1NMMA 4NGLA 2YCZA 172LA 1P8IA 4OO9A 3HT6A 4UWNA 1C6TA 4HPIA 1CU3A 1KG8A 4WM3A 5HMVA 1L0KA 5A3ZA 3J4GA 4Z98A 1GF9A 5DYSA 4KL7A 1L43A 4LYTA 5K7OA 4WLYA 3F8VA 163LA 4GRVA 1L67A 1GBOA 1L09A 1P2CC 3AGHA 2B73A 259LA 1H68A 3FE0A 1LZBA 4ARQA 3WUAA 2RAZX 3HWLA 4UWVA 3ABWA 3AYQA 2W1XA 1OUJA 4BADA 3TXDA 1C8RA 4LYZA 1L03A 1I56A 5JJJA 1DZEA 1XEJA 1LSPA 4AQNA 3TXHA 2W1YA 4FA7B 1VATA 3C83A 5LVIA 1JQUA 4W56A 1LMCA 3HAPA 3EXDA 1QUOA 3QAPA 113LA 3WL2A 4G70B 182LA 2I21A 4OV0A 162LA 2BAAA 1GB5A 1VDPA 3UTVA 1L21A 3ZEVA 1IY4A 5EN0A 5LVJA 1OVHA 3EMSA 2BQCA 1AT5A 1L46A 4NGKA 4I7SA 199LA 1BB7A 1BRXA 1QS9A 2MEIA 5KXXA 3PWHA 5KKJA 1LHLA 1GF7A 3SB5A 4PXFA 1BVKC 4LYOA 1GAYA 1LYOA 1JIYA 2YBMA 4LYBA 125LA 2B72A 3WMKA 3SBBC 1UIBA 3D9AC 3CAPA 4NIJA 1LMPA 1J1PY 5FCPA
chains in the Genus database with same CATH topology
238LA 4XJFA 173LA 2Y01A 4DC4A 5H2IA 1LZGA 1BWJA 1GFJA 1YL0X 3WXUA 178LA 5H2JA 1S8LA 1EHKB 4NGIA 2YBHA 1L27A 1D3JA 2G4PA 3WW5A 1L05A 1L56A 228LA 1L62A 1WQRA 1GFAA 1HMKA 3A95A 4XADA 1OUAA 243LA 1CV4A 4R6CA 4B4JA 4XJHA 3EH3B 4BEZA 3D4SA 4G72B 3TMUA 1YAOA 4WM2A 2LZMA 1L76A 2W1LA 4NSHA 1OWZA 1LOZA 1WTMA 205LA 4PXKA 147LA 1AM7A 4G4CA 1ZMYL 1LSGA 5LAFA 1Q5IA 4I7JA 3GUMA 2I1XA 208LA 168LA 3TXIA 2NTUA 4N6HA 2Z37A 3HH3A 4NGOA 7LZMA 3HAOA 1LZ8A 2KS9A 4WG1A 1C6FA 4YM8A 3SP3A 1I1ZA 2BQHA 1CTWA 214LA 1YKZX 2BQNA 4W59A 2G4NA 104LA 2W1MA 5KXZA 4YXAC 3RW8A 3WYHA 3TMVA 1GU8A 233LA 153LA 195LA 232LA 4LZMA 2DQAA 2Y02A 1QSBA 4L6RA 1YILA 1L31A 1XGTC 2YBNA 4NSIA 1IC5Y 1HMLA 1OUCA 1GDXA 2C8OA 1BQLY 5DLAA 1L13A 4ARJA 2IFFY 3SBAA 1C66A 4OWEA 1LWGA 4NG1A 1CX7A 2ZIKA 1LHHA 1OWYA 3W6BA 1GZMA 1CV3A 5ILFA 1GE1A 115LA 1IP7A 1GB9A 1P36A 4NFVA 1KMEA 2HU1A 5APEA 4XJBA 3HH5A 2CDSA 4WM6A 262LA 249LA 1L06A 4PJ2C 1L59A 2HU3A 1I20A 209LA 4AXTA 1P5CA 1SSYA 3VG9A 4MQTA 2RBPA 1ZVHL 4QEQA 4N9RA 5E9RA 1IWZA 2YSSC 1GB7A 3LYMA 1HF4A 1L45A 1JKDA 1WTNA 4NHIA 2B6TA 3DN4A 1LJFA 1QT8A 3C8SA 146LA 1UUZC 1P7SA 2RBRA 112LA 1QIOA 1UC0A 5D5CA 5B1GA 2YBJA 3QJRB 3W3EA 1J1OY 4EXMA 1C6KA 4YEMA 4BUOA 1E0PA 1C65A 3CSZA 5G53A 2B74A 1UBZA 1QSWA 194LA 3HH6A 4LGKA 1GBYA 3GUPA 3HUKA 102LA 2PC2A 3JR6A 2QPDB 5FEKA 2RAYX 1P56A 1LYDA 1UIGA 1FLUA 1HERA 1OUGA 1P6YA 4DAJA 2BQDA 1JTNA 2F2NA 1IP1A 1C6HA 1KXXA 3CDOA 4J4QA 1F6RA 3LYTA 1LYFA 3B0KA 4NGWA 2Q9EA 5C6IA 1KW5A 5LZMA 1L86A 1IORA 218LA 4GN4A 5DN5A 1JUGA 217LA 2HULA 1S8JA 1REZA 1QTEA 5BR2A 2WARA 1L77A 3ATOA 1NBYC 1LJEA 1LHJA 3C82A 5G36A 4EA3A 1D0LA 1JGJA 3SB9A 2AT9A 1OUBA 3OE0A 5LA8A 2A4TA 1LCNA 1XJTA 4CGEA 4I7LA 1GB8A 5I54A 1UICA 4RLMA 1R84A 1C6QA 3P4ZA 159LA 2B75A 1UACY 3A3QA 3WPKA 212LA 3GUIA 3EH4B 1UAZA 1L11A 1QT7A 2ZQ4A 1CV1A 3ZPQA 1B7QA 2J4YA 1F10A 1WQPA 1C43A 3N9CA 1L85A 4HSFA 5L3HA 4DWXA 1L55A 181LA 5G2AA 2FYCA 3PQRA 2HUMA 4NSGA 1KXWA 3AW6A 3OJPA 1L58A 130LA 4OWHA 1S51A 1JFPA 1XEKA 3VGAA 3ZPRA 2NTWA 3A8ZA 1B7RA 1L51A 1NDGC 1FLWA 2OEAX 1C61A 2EQLA 177LA 3IJUA 5HMJA 1G0PA 1PS5A 1IXFA 1EPYA 5LVHA 1KG9A 1CKDA 1L90A 2EIZC 5J7CA 4QDNA 1TCYA 2Z39A 4KNFA 2ZWBA 3K3TA 1GEZA 1INUA 1L97A 1LSAA 1DYDA 1CKHA 4EPFA 4Z41A 8LYZA 1SQ2L 4GCBA 4Z3MA 1NBZC 128LA 2DQHY 135LA 114LA 3HU9A 1SX7A 1L39A 1G06A 1MELL 108LA 1UIFA 1L75A 1GFHA 143LA 161LA 4HTQA 4LDOA 3OE9A 3W6CA 1XJIA 1L73A 230LA 1HEOA 2F4GA 3P66A 3PBLA 4B4EA 3CDTA 4IASA 1G0GA 235LA 2F4AA 4NY5A 1IW9A 1M0LA 1X0SA 2B7XA 3N9AA 2OU9A 1J1XY 255LA 2N5ZA 5KXLA 3QJQB 2ZFEA 2ANXA 5FDJA 1LJGA 4YX7C 1Z55A 2RB1X 5HQ1A 1JTTL 4GCEA 1L49A 4HJYA 4DD2A 1C6NA 131LA 4KT3A 3A92A 1LYHA 154LA 2XBSA 2WJKA 1QDRA 4B4IA 3UTXA 1L98A 5AX1A 2CGIA 1DQJC 139LA 1YKYX 170LA 2F30A 1Q5JA 5DHHA 2BQFA 3ULRA 3CDVA 1ZV5L 1AP9A 1AZFA 4H8XA 4AGAA 1IWVA 3UZAA 2FBDA 1IX0A 1D3NA 1LTMA 1LYJA 1YAMA 5AX0A 1C67A 1LI6A 1L38A 3C9MA 4X1HA 127LA 1WVUA 2YVBA 5ILCA 1LZYA 1RI8B 3AGGG 5FJGA 1HENA 1OUFA 2ANVA 1HEPA 2DKVA 1HZXA 3CSRA 2BQGA 1PQOA 2NWDX 3PXOA 3HDEA 260LA 3NY9A 1L19A 4Y9HA 3QBIA 1DXJA 3HBHA 4AMJA 1G1WA 2RB2X 1DPXA 5B6WA 1X0I1 1JJ0A 1B5YA 5I4XA 4N1EI 4W54A 2F2QA 4CHXA 1C6BA 5IHGA 3V2WA 4ETBA 4H9IA 1AKIA 1L00A 1C46A 1GBSA 5IDDA 1WQOA 4DD3A 1IOQA 236LA 165LA 4G49A 4MR1A 2G87A 5B34A 2OE7X 1CVKA 3P64A 3CT0A 4XJGA 4EPIA 4H91A 5KXRA 4NGYA 1JKAA 2DQEY 1KW7A 1G0JA 5C1MA 2AUBA 2HUBA 1NHBA 3LYZA 1MLCE 4GPOA 3CT1A 1FLQA 3GUKA 1LZRA 1T6VL 4W52A 1JSFA 200LA 4EJ4A 4GBRB 1L15A 1YROA 186LA 3G3BB 4LDEA 1L83A 2BQBA 1NF5A 2MEBA 3RFMA 1G1VA 3QAKA 4ARLA 4JKVA 2LZTA 2MEGA 152LA 2FYDA 1CKFA 1L53A 126LA 211LA 4PRQA 1LZDA 2DQJY 5I14A 2DQDY 3RNXA 3AZ5A 2D4JA 3F9LA 4OWCA 1QTDA 1OUDA 5B1FA 4DS7E 2O7AA 2HUKA 248LA 1YANA 5KXNA 1CWQA 3L64A 4DJHA 1KS3A 256LA 4W55A 1C60A 1L47A 4PRUA 5G54A 1B7NA 2HTXA 247LA 1IP2A 1JTOL 1H87A 2YCWA 2VB1A 1C45A 1GFGA 1KY0A 1BHZA 1D2YA 3GULA 4EKQA 3GXKA 3DMXA 166LA 4GN5C 4FAAB 3F6ZA 1HNLA 4EKPA 3BVDB 1B7PA 1L61A 2L78A 1XIOA 4WM5A 1S52A 1G0QA 4I7NA 3QY4A 3WW6A 2EI4A 1CU6A 3TXGA 2NTHA 5LVGA 2RBQA 2HEDA 3ZEKA 3CDRA 3ATNA 2Z6BA 5IELA 4OWBA 1NKHA 5DHGA 3QJTB 1GB6A 3N9EA 4WAVA 1IWXA 3MGWA 4G7SB 1GFRA 1C6GA 3WPJA 1T8AA 1O23A 5H2OA 1REMA 3EH5B 3S8GB 4LYCA 4NEBA 3T6UA 5LIOA 223LA 5L3IA 1T3PA 237LA 3EMLA 1PXSA 1VDQA 3AB6A 1LZTA 1LZ4A 1QT5A 3DN0A 1C7PA 3HTBA 1GFUA 4NHTA 4HV2A 145LA 1L0JA 2RBSA 5B6YA 3BKVA 1L42A 3KAMA 4MCKA 4XENA 1B2KA 5F16A 5KXMA 3VW7A 1ZWNA 1L41A 2ZIJA 1LZ5A 4H93A 1CUPA 2YCYA 1PZYA 1IWYA 4GP5B 3QE8A 1IP4A 1FDLY 4WG7A 4H1PA 5LYTA 1NQIA 5I4WA 3CSQA 1DYEA 1OQMA 1I6SA 4H9FA 1C68A 244LA 3S3CB 2I35A 3A34A 2X0AA 4MQSA 3DDLA 2Y03A 221LA 4QI1A 4LZTA 3VI0A 5F81A 1ZVYB 1L93A 4A4MA 5LINA 1BB5A 1GE0A 1L79A 1KIRC 1L50A 4DQ5A 1L64A 2DBTA 3J6KA 5JJNA 1L66A 1B5ZA 4EKSA 1IP6A 1LAAA 1QUSA 4TUNA 187LA 1HEWA 3W6AA 5A3EA 5II3A 3HAQA 5H2MA 3TXKA 2ZIYA 1GBZA 3S3DB 1HFZA 6LZMA 1DI3A 5F9XA 1C6AA 3S3BB 1VAUA 2RH1A 1F6SA 3CB7A 1SX2A 4I7OA 2ZYPA 3FI5A 5I5QA 4DDBA 1CV0A 1IC7Y 4J7VA 5KXSA 3A93A 1LSEA 2LYMA 4N4YB 2H9JA 4HYXA 1RE2A 2F93A 129LA 250LA 3FI7A 1G0LA 1VFBC 1BVXA 4WW3A 4NGZA 2HPYA 3AM6A 1L20A 141LA 4XTNA 2ZNXY 5KXYA 1D0KA 4WLTA 4PK0A 3K2RA 5LVKA 1FBBA 5KKIA 4TSCA 2B6ZA 4GCDA 2GV0A 251LA 3WVXA 3W6FA 1CV6A 4NGJA 1C08C 1F4ZA 3OK0A 1CJ7A 3AZ7A 3RU5A 1B5UA 4PJZA 1TDYA 1KNIA 4PPOA 2BQKA 2MEFA 4H9EA 5JENB 4AMIA 4HP0A 4NG8A 4W51A 4YEOA 2BQJA 2X72A 1CX6A 4J1AA 3ZVQB 1GF3A 4EKRA 3TMWA 1IOTA 2DQGY 2F47A 1N4FA 3QJVB 1P37A 1QHJA 120LA 5KKHA 4RLNA 1L96A 1JJ1A 1QUGA 4E3UA 3RZ4A 1HFYA 1QTBA 1L34A 185LA 1PQIA 3G3WA 1TBYA 1LMAA 5HLLA 1HELA 1L65A 3G3AB 1GAZA 5A8EA 4QRYA 2I20A 1EQ4A 3DQBA 5KJ9A 1GB2A 4H94A 1ALCA 4W57A 2EKSC 3VVKA 4H92A 5DM9A 2FBBA 1L60A 4NHPA 4GBRA 2XBRA 1L54A 3HARA 1JV7A 1QQYA 4HJVA 4NHQA 1TLAA 1YQVY 2F95A 5F14A 2DQFC 5KY1A 132LA 1GD6A 1L07A 2H9KA 107LA 2QB0B 1SSWA 1G7IC 4DKLA 5KXKA 5APDA 3IWRA 1B7SA 3HFMY 3UTWA 1LYZA 4NGVA 2O4WA 4WLXA 1P2RA 4Z46A 1AT9A 4ARPA 1L81A 5AWZA 1JV6A 1L29A 210LA 3UONA 1IIZA 1L24A 4LT3A 4IARA 1BGIA 1OYUA 1L89A 1XEPA 158LA 240LA 4W53A 4ETEA 1LMNA 110LA 3HANA 1XEIA 1G0MA 1OVJA 1SWYA 4ANRA 183LA 4N4WA 1QS5A 1L28A 134LA 1F50A 3HH4A 4NWEA 1QTZA 1G7LC 5FHWA 1L80A 246LA 1L0MA 1LMQA 2LC9A 144LA 1BRRA 4KPMA 1LMTA 3GUJA 5APCA 5B59A 1L08A 1O0AA 1T6HA 3SB8A 1JTPL 2KSBA 1L37A 6LYTA 227LA 1CV5A 4FDYA 5G28A 1FKVA 1GUEA 1DYFA 1LZ1A 4WM1A 4GLAA 1HHLA 4XJIA 1IY3A 1IO5A 4H9CA 4MD2A 4J0LA 1LMOA 4GCCA 2O79A 1HC0A 1L30A 4QGZA 1GEVA 3SB6A 3HT9A 4C3WA 4DDAA 5LWEA 4P2EA 1L68A 2RSCA 4U3XB 1H2SA 1LJNA 2Z73A 5C6LA 4X3BA 2BQLA 4IAQA 1IP5A 1GF5A 2Y04A 3E3DA 4OOOA 1LJIA 1CJ6A 4E97A 4I7PA 1BB4A 2M3GA 1B9OA 4UG2A 3REYA 5HNLA 4K5YA 2ZQ3A 2HEAA 3HTGA 1LYEA 118LA 4H8ZA 2B70A 1JISA 1JWRA 1FN5A 207LA 4BAFA 1C3WA 3WU9A 4I7QA 4IATA 1LGWA 2YDGA 4HV1A 4DYGA 1LZ9A 4DD9A 4ZPUA 1LKSA 151LA 1HSXA 3RT5X 1TN0A 3P68A 4DDCA 1LHMA 3HU8A 3SN6R 1IR7A 4G4BA 1CU5A 2WJLA 3RUNA 2A7DA 4BS7A 4LT1A 1OV5A 1QM8A 1REXA 1CKCA 2MEHA 2Z2FA 122LA 197LA 3HT7A 1W6ZA 3HTDA 3WH1A 1IR8A 1GF6A 1PQDA 4KXIA 4BEYA 1GHLA 1GFVA 1G07A 5B05A 1LW9A 1RJCB 5AZDA 1D9WA 1JSEA 5F8UA 3A94A 1BWHA 1L17A 5FSTA 1C63A 1BRDA 1L92A 3M3UA 191LA 2BQOA 1C6JA 4NWHA 5APFA 3MBVA 1TAYA 2KSYA 4CJ2A 4TL3A 2ZYCA 222LA 1V7SA 5I4YA 201LA 1L01A 1LSNA 4FPDA 1L18A 2A7FA 3WXTA 1L04A 1WQMA 1P64A 5AHZA 1G7JC 1L16A 3AZ6A 1B7MA 1R2NA 4ETDA 2MEEA 1LLHA 3TMXA 1RFPA 1T97A 226LA 242LA 225LA 1LI2A 2CWIA 4WMGA 1QKPA 5LYMA 6LYZA 3FADA 3EO5A 3LN2A 1P8HA 4IAPA 4LT0A 3NY8A 167LA 2LCBA 5KXTA 206LA 4ZIXA 5EBHA 4HYJA 1GF4A 1E8LA 1C62A 4I0CA 1QTKA 1LZ6A 1WVVA 1CUQA 4H9AA 2D4KA 3NYAA 5B6ZA 1HFXA 3WVYA 1G0KA 1LYYA 1B5XA 3VWOA 3A96A 2Z38A 4MSTA 3ZVQA 4N5RA 4X32A 4GLVA 4HWLA 3LZ2A 5F9UA 157LA 1GFEA 1HEMA 2Y8PA 4L35A 1L99A 3DNAA 4YXCA 1UIEA 2OU0X 1LYSA 1D6QA 5AMYA 1S53A 5AHYA 1CJ9A 2I26L 4HJZA 160LA 2B6YA 1B6IA 4ARMB 4GP4B 4RW2A 3SB7A 4MBSA 4PGJB 2RBOA 2HEBA 1RCMA 133LA 5G2DA 4NSJA 1IWTA 2RBNA 1DYBA 4HTNA 1L69A 3QJSB 3X3BA 1AT6A 4W96A 1CU2A 4ET8A 1YL1X 1UIHA 1CKGA 4LYMA 4UHRA 1L33A 2Q0MX 4G4HA 3TXBA 1YAPA 1M0MA 3B0OA 1QT6A 4DT3A 252LA 5B35A 1C6CA 3UTYA 4LT2A 4XTLA 1GWDA 4I8SA 1VEDA 4I7RA 2C8PA 4XN6A 4TWSA 3CODA 198LA 1LI3A 4C5FA 1DI4A 1JKBA 3ODUA 3W6EA 1S54A 2Q9DA 137LA 1WQQA 1DKJA 2Z2EA 4OW1A 2LYOA 1LYGA 5H2LA 5TGZA 109LA 2OTYX 3QBLA 4EIYA 254LA 1B5VA 1L44A 1B7LA 3A91A 1M0KA 3DN6A 1IP3A 1IOCA 3AYNA 1WTHA 1C64A 1IWUA 4FJRA 5I53A 5A45A 1L57A 2IHLA 1IVMA 1YKXX 3C8RA 1SLYA 4WM4A 4YENA 3A6CY 2R4RA 4PHIA 4RW1A 2Z19A 5H2NA 1DYAA 4MD1A 4ETAA 1D6PA 1PY6A 3NSBA 111LA 4HTKA 4XJDA 1L71A 1JEFA 4NHSA 3C7YA 4XXJA 1L94A 1B5WA 2MEAA 1U19A 3QJUB 1E12A 2ZZLA 4H8YA 1D3MA 258LA 176LA 2DQIY 1C6DA 3CQLA 2D6BA 2OE9X 1QSQA 4H9HA 1DZBX 1GXV2 241LA 1L10A 193LA 2XTHA 3G3XA 1XMEB 1YIKA 2D91A 3D3DA 4WOAA 3IJVA 1T8FA 1DYGA 1LPIA 1K28A 3CDQA 4RDSA 2XQOA 3A67Y 4W94A 1KIQC 164LA 1P46A 1VJMA 4BWBA 2BPUA 1L40A 1QT3A 1GB3A 3DMVA 180LA 5B6XA 1LSYA 1GE3A 3HBEX 3B72A 1L95A 216LA 4OOTA 2HECA 1DYCA 1L14A 1L35A 1C69A 1P2LA 4IJ4A 156LA 1LGUA 1GPQC 5LYZA 4I7MA 2RB0X 4LFPA 2YBLA 5FELA 155LA 1LJJA 1LHIA 5B07A 1DI5A 4A7DA 2L6XA 148LE 3C9LA 1L74A 4TX7A 3X3CA 103LA 4NC3A 4M4OA 4GYCA 3A6BY 5HNCA 5KXOA 9LYZA 1OUIA 3LYOA 7LYZA 1ZURA 2BLXA 3M18B 1LZCA 3AZ4A 4JR8A 1W08A 2VT4A 3AJNA 4ZFPA 1LJHA 1C6PA 4KLYA 3WU8A 1IEEA 1IR9A 3GUOA 3A3RX 1XGRC 3P65A 3AGIA 1GBWA 1HSWA 1NHEA 1EQ5A 5H2HA 140LA 3C7ZA 1SWZA 4N1CC 3AYMA 239LA 1L87A 3T45A 3TXEA 3UG9A 3DN2A 1IC4Y 4B49A 4G9SA 231LA 2HEFA 3L2XA 1X0K1 2BRDA 2BQMA 1OUEA 1LSCA 1L48A 4TTDA 189LA 4BVNA 1JJ3A 1QDTA 2D4IA 1UA6Y 1XFPL 1BWIA 1L84A 1XGUC 1JKCA 5J7AA 4L41A 3NS0A 4XYYA 1PXRA 1KIPC 4QIDA 123LA 150LA 4ARQB 3S8FB 4QY9A 175LA 1EQEA 4BAPA 1NWGA 5L9JA 5M1YA 1XJUA 4DQ7A 1BB3A 1KXYA 1QUTA 2YBIA 1LSZA 4WO6A 2YDVA 1L26A 2H5ZA 3LZMA 171LA 3DN3A 3P0GA 1PQKA 1F0WA 190LA 1G7MC 5H2PA 1C6EA 2XJWA 2YCXA 1JHLA 1YAQA 3C8QA 5ITCA 2Z18A 4WL6A 1IWWA 1LGXA 4TSBA 3OE8A 4ARMA 253LA 4JQ6A 1UIDA 169LA 1GE4A 3RZEA 4X31A 5G2CA 1GBXA 1NDMC 4DD0A 2BLYA 1L63A 215LA 5LAGA 1QTHA 3HT8A 1LPYA 5H2KA 1DPWA 3HASA 5B06A 1L9HA 1QUHA 1OVKA 4DD7A 5DL9A 2B5ZA 1GF0A 4I7TA 4W58A 3WQJA 3A90A 2I6ZA 3QNGA 4UWUA 1FBIX 224LA 2JAFA 1GDWA 3B0IA 1XGPC 1GF8A 138LA 1DKKA 1FLYA 1L22A 4N0JA 3T36A 2Y00A 1VDSA 4YOPA 1QTVA 3WPLA 234LA 2BQIA 149LA 2BQAA 3BKHA 1JITA 5DN4A 3EBAB 4O34A 3TXJA 3A7KA 2LZ2A 1C6IA 4LFXA 3C80A 4H90A 3UZCA 1QUDA 1CU0A 5ITEA 5JJEA 3DMZA 4S0WA 4H9BA 3W6DA 4B1AA 1P3NA 245LA 1GFTA 2Z12A 1C10A 1C8SA 2HEEA 1GXXA 4B0DA 3QDCA 1B0DA 2ZILA 4DD1A 4DQJA 261LA 3KJ6A 3VHZA 1L36A 1GFKA 4XTOA 2MEDA 5D5FA 5B2NA 1L70A 3HUAA 1LKRA 5A44A 1JTMA 3HBDA 4ET9A 3COCA 3LHMA 174LA 4WO9A 2B6WA 1L12A 3WU7A 2G4QA 1VGOA 2QARC 1A2YC 1VDTA 2CUUA 4HPEA 2KSAA 4GP8B 4XT1A 5LXWA 1KY1A 3AW7A 1OUHA 4EOFA 1LJ3A 1IOSA 4BV0A 1L32A 1L91A 1OV7A 2IGCA 1H6MA 1LJ4A 184LA 1FKQA 2B6XA 1LZEA 4R0FA 213LA 1LYIA 3LZTA 2QPEB 5B0WA 1QSAA 1L23A 1D0MA 229LA 1QKOA 4D9ZA 4G7RB 3C81A 4II8A 2F32A 4LDLA 2LNLA 1OP9B 4ETCA 1P8UA 5LA5A 3DN1A 1BM1A 1CNSA 1REYA 5T3FA 1FBKA 1L72A 1QTCA 2PEDA 3QBKA 2BQEA 4G7QB 1L88A 3FA0A 1MGYA 1LSMA 1PQMA 3QBGA 3WULA 2I25L 4WLDA 1L52A 1B7OA 2LYZA 3DKEX 1GB0A 1LHKA 2NTGA 3CT5A 196LA 1L82A 1CJ8A 4GCFA 3G3VA 2JAGA 1C6LA 4FBZA 4OWAA 2ZNWY 3GUNA 1BB6A 4CFOA 1ZYTA 4N8ZA 5BR5A 1PQJA 1LWKA 3DN8A 1TEWA 2MECA 4EMNA 1C6MA 1LSBA 1LZNA 2OTZX 2OU8A 1WQNA 4ZEEA 192LA 1LZAA 2Z55A 2CJLA 188LA 1KGBA 1D9UA 3B6LA 1HEQA 2OE4X 2LHMA 4GN3A 1QT4A 4CFPA 3V2YA 1L25A 3WUNA 2YDOA 1EL1A 1UIAA 3GXRA 1A4VA 1G7HC 5KXWA 3OE6A 1LSDA 3HTFA 4YF2A 4ML7A 1XSFA 142LA 4M6DA 3HDFA 3C7WA 1LZSA 4XT3A 1TN5A 119LA 219LA 1D2WA 220LA 4J1BA 1V7TA 5B6VA 4I7KA 1XGQC 5KXPA 1UCQA 3WUMA 3PDSA 1D3FA 1LJKA 5C6JA 3OAXA 3HUQA 1JPOA 1IW6A 2EPEA 257LA 4G71B 5E4PA 1T8GA 4WL7A 5ETZA 1F88A 4IB4A 1LN6A 1LSFA 3TXFA 2R4SA 1L02A 1GE2A 1UCOA 2DQCY 1NMMA 4NGLA 2YCZA 172LA 1P8IA 4OO9A 3HT6A 4UWNA 1C6TA 4HPIA 1CU3A 1KG8A 4WM3A 5HMVA 1L0KA 5A3ZA 3J4GA 4Z98A 1GF9A 5DYSA 4KL7A 1L43A 4LYTA 5K7OA 4WLYA 3F8VA 163LA 4GRVA 1L67A 1GBOA 1L09A 1P2CC 3AGHA 2B73A 259LA 1H68A 3FE0A 1LZBA 4ARQA 3WUAA 2RAZX 3HWLA 4UWVA 3ABWA 3AYQA 2W1XA 1OUJA 4BADA 3TXDA 1C8RA 4LYZA 1L03A 1I56A 5JJJA 1DZEA 1XEJA 1LSPA 4AQNA 3TXHA 2W1YA 4FA7B 1VATA 3C83A 5LVIA 1JQUA 4W56A 1LMCA 3HAPA 3EXDA 1QUOA 3QAPA 113LA 3WL2A 4G70B 182LA 2I21A 4OV0A 162LA 2BAAA 1GB5A 1VDPA 3UTVA 1L21A 3ZEVA 1IY4A 5EN0A 5LVJA 1OVHA 3EMSA 2BQCA 1AT5A 1L46A 4NGKA 4I7SA 199LA 1BB7A 1BRXA 1QS9A 2MEIA 5KXXA 3PWHA 5KKJA 1LHLA 1GF7A 3SB5A 4PXFA 1BVKC 4LYOA 1GAYA 1LYOA 1JIYA 2YBMA 4LYBA 125LA 2B72A 3WMKA 3SBBC 1UIBA 3D9AC 3CAPA 4NIJA 1LMPA 1J1PY 5FCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 238L A;  3AYM A;  173L A;  2Y01 A;  2OE7 X;  239L A;  1CVK A;  1L87 A;  3T45 A;  5H2I A;  3UG9 A;  4EPI A;  3DN2 A;  178L A;  4MD2 A;  5H2J A;  1S8L A;  1EHK B;  1KW7 A;  1G0J A;  2O79 A;  5C1M A;  1L30 A;  231L A;  3L2X A;  1NHB A;  1X0K 1;  4GPO A;  1L27 A;  2BRD A;  1D3J A;  1L05 A;  3GUK A;  1L56 A;  3SB6 A;  228L A;  3HT9 A;  1L62 A;  4W52 A;  5LWE A;  200L A;  4EJ4 A;  1L48 A;  1L15 A;  4GBR B;  1L68 A;  189L A;  186L A;  243L A;  1H2S A;  4BVN A;  1CV4 A;  4LDE A;  1L83 A;  2Z73 A;  3EH3 B;  3RFM A;  1G1V A;  1L84 A;  3QAK A;  4ARL A;  3D4S A;  4G72 B;  4BEZ A;  4JKV A;  152L A;  4IAQ A;  2Y04 A;  5J7A A;  1L53 A;  3NS0 A;  2LZM A;  126L A;  211L A;  1L76 A;  4E97 A;  1OWZ A;  4I7P A;  1PXR A;  4QID A;  123L A;  205L A;  4PXK A;  5I14 A;  147L A;  150L A;  4ARQ B;  3S8F B;  2M3G A;  4UG2 A;  3REY A;  3F9L A;  4K5Y A;  1Q5I A;  4I7J A;  175L A;  1QTD A;  3GUM A;  3HTG A;  1LYE A;  1XJU A;  118L A;  2O7A A;  2I1X A;  2B70 A;  168L A;  1C3W A;  2NTU A;  4I7Q A;  4N6H A;  3HH3 A;  2HUK A;  7LZM A;  3HAO A;  2KS9 A;  1C6F A;  1LGW A;  248L A;  2YDV A;  1L26 A;  1CWQ A;  1CTW A;  214L A;  3L64 A;  4W59 A;  4DJH A;  3LZM A;  171L A;  1KS3 A;  3DN3 A;  4ZPU A;  151L A;  3P0G A;  104L A;  1PQK A;  256L A;  4W55 A;  1TN0 A;  190L A;  1C60 A;  1L47 A;  4YXA C;  3HU8 A;  3SN6 R;  5G54 A;  247L A;  5H2P A;  1C6E A;  1CU5 A;  2YCW A;  2WJL A;  3RUN A;  2YCX A;  1GU8 A;  1OV5 A;  1QM8 A;  3C8Q A;  1KY0 A;  122L A;  233L A;  197L A;  5ITC A;  195L A;  1D2Y A;  232L A;  3HT7 A;  3HTD A;  3GUL A;  4LZM A;  4EKQ A;  1LGX A;  3OE8 A;  1QSB A;  1PQD A;  166L A;  3DMX A;  4ARM A;  2Y02 A;  4L6R A;  253L A;  1L31 A;  4FAA B;  4JQ6 A;  4BEY A;  4EKP A;  3BVD B;  1L61 A;  2L78 A;  1G07 A;  169L A;  1XIO A;  4X31 A;  3RZE A;  1S52 A;  1G0Q A;  4I7N A;  2EI4 A;  5G2C A;  1LW9 A;  1CU6 A;  5AZD A;  1D9W A;  1L63 A;  215L A;  1L13 A;  2NTH A;  4ARJ A;  2RBQ A;  1QTH A;  5F8U A;  3HT8 A;  1L17 A;  1LPY A;  3SBA A;  1C66 A;  1C63 A;  1BRD A;  1L92 A;  5H2K A;  3CDR A;  2Z6B A;  1LWG A;  3HAS A;  1L9H A;  1CX7 A;  191L A;  1QUH A;  1OVK A;  1C6J A;  5DHG A;  3QJT B;  1OWY A;  1GZM A;  3MBV A;  1CV3 A;  4WAV A;  4I7T A;  4W58 A;  3WQJ A;  4G7S B;  115L A;  1C6G A;  2KSY A;  1P36 A;  4TL3 A;  1KME A;  1T8A A;  222L A;  5H2O A;  201L A;  224L A;  2JAF A;  3EH5 B;  1L01 A;  4FPD A;  3S8G B;  1L18 A;  3HH5 A;  138L A;  1L04 A;  1P64 A;  223L A;  262L A;  1L22 A;  5AHZ A;  249L A;  2Y00 A;  237L A;  3EML A;  1PXS A;  1L06 A;  1L16 A;  1L59 A;  1R2N A;  1QT5 A;  1QTV A;  3DN0 A;  209L A;  234L A;  3HTB A;  149L A;  1LLH A;  1P5C A;  1SSY A;  3VG9 A;  4MQT A;  242L A;  1T97 A;  226L A;  2RBP A;  225L A;  1LI2 A;  1QKP A;  3A7K A;  1C6I A;  3C80 A;  3UZC A;  145L A;  1QUD A;  1L0J A;  1CU0 A;  5ITE A;  2RBS A;  3FAD A;  5JJE A;  3DMZ A;  1L45 A;  4S0W A;  5B6Y A;  1P3N A;  1P8H A;  4IAP A;  1L42 A;  245L A;  1C8S A;  3NY8 A;  2B6T A;  167L A;  2LCB A;  3DN4 A;  206L A;  1QT8 A;  3C8S A;  146L A;  3QDC A;  4HYJ A;  1P7S A;  2RBR A;  261L A;  3KJ6 A;  3VHZ A;  112L A;  1C62 A;  1L36 A;  3VW7 A;  1ZWN A;  4XTO A;  5B2N A;  1CUQ A;  1L41 A;  1L70 A;  3HUA A;  3QJR B;  1CUP A;  2YCY A;  3NYA A;  4GP5 B;  5B6Z A;  5A44 A;  4EXM A;  1G0K A;  1JTM A;  1C6K A;  4BUO A;  1E0P A;  3COC A;  174L A;  1DYE A;  1C65 A;  2B6W A;  1I6S A;  1L12 A;  2B74 A;  5G53 A;  1C68 A;  244L A;  1VGO A;  2QAR C;  2CUU A;  2KSA A;  4X32 A;  4XT1 A;  4GP8 B;  3S3C B;  4HWL A;  3HH6 A;  1KY1 A;  3GUP A;  157L A;  3HUK A;  2I35 A;  102L A;  3JR6 A;  2QPD B;  3UTW A;  4BV0 A;  1L32 A;  4MQS A;  3DDL A;  2Y03 A;  1L91 A;  221L A;  1OV7 A;  2IGC A;  4L35 A;  2RAY X;  1L99 A;  1P56 A;  1LYD A;  3DNA A;  4YXC A;  4QI1 A;  184L A;  3VI0 A;  2B6X A;  2OU0 X;  1P6Y A;  4DAJ A;  1JTN A;  213L A;  1C6H A;  1L93 A;  1LYI A;  3CDO A;  1S53 A;  5AHY A;  4A4M A;  4J4Q A;  2QPE B;  5B0W A;  1LYF A;  1L79 A;  2Q9E A;  1L23 A;  1KW5 A;  5LZM A;  160L A;  1L50 A;  2B6Y A;  1B6I A;  1L86 A;  4ARM B;  218L A;  229L A;  4GP4 B;  1L64 A;  1QKO A;  5JJN A;  3SB7 A;  1L66 A;  4MBS A;  4G7R B;  3C81 A;  2RBO A;  217L A;  2HUL A;  4EKS A;  1S8J A;  2F32 A;  4LDL A;  2LNL A;  5BR2 A;  5G2D A;  1P8U A;  187L A;  1L77 A;  3DN1 A;  2RBN A;  1BM1 A;  1DYB A;  1FBK A;  3HAQ A;  1L69 A;  1L72 A;  1QTC A;  3QJS B;  5H2M A;  2PED A;  3QBK A;  3C82 A;  2ZIY A;  3X3B A;  5G36 A;  3S3D B;  6LZM A;  4G7Q B;  1L88 A;  4EA3 A;  3FA0 A;  1MGY A;  1C6A A;  1CU2 A;  3S3B B;  1JGJ A;  1PQM A;  3QBG A;  2RH1 A;  3SB9 A;  2AT9 A;  3OE0 A;  1L52 A;  1SX2 A;  2A4T A;  4I7O A;  3DKE X;  3FI5 A;  1XJT A;  1L33 A;  2NTG A;  4UHR A;  196L A;  1CV0 A;  4I7L A;  1L82 A;  3G3V A;  1M0M A;  1QT6 A;  2JAG A;  252L A;  1C6L A;  1C6Q A;  1R84 A;  5B35 A;  1C6C A;  4FBZ A;  3UTY A;  159L A;  2B75 A;  3GUN A;  212L A;  3GUI A;  4XTL A;  1ZYT A;  4I7R A;  3EH4 B;  1UAZ A;  5BR5 A;  1L11 A;  1PQJ A;  1LWK A;  1QT7 A;  1CV1 A;  3DN8 A;  198L A;  1LI3 A;  2J4Y A;  3COD A;  4N4Y B;  3ZPQ A;  1C6M A;  3ODU A;  4HYX A;  1S54 A;  2OTZ X;  2OU8 A;  129L A;  2Q9D A;  2F93 A;  250L A;  192L A;  1L85 A;  137L A;  1G0L A;  2Z55 A;  188L A;  1KGB A;  4WW3 A;  1L55 A;  1LYG A;  5H2L A;  5TGZ A;  2HPY A;  3AM6 A;  2OE4 X;  181L A;  5G2A A;  109L A;  1L20 A;  141L A;  2OTY X;  1QT4 A;  2HUM A;  3PQR A;  3QBL A;  4XTN A;  4EIY A;  254L A;  1L25 A;  3V2Y A;  1L44 A;  2YDO A;  4PK0 A;  3K2R A;  1M0K A;  3DN6 A;  1L58 A;  130L A;  1S51 A;  3AYN A;  1JFP A;  1WTH A;  1C64 A;  1FBB A;  3VGA A;  3ZPR A;  2NTW A;  2B6Z A;  3OE6 A;  5A45 A;  1L57 A;  251L A;  2OEA X;  1L51 A;  3HTF A;  1C61 A;  1CV6 A;  177L A;  142L A;  1G0P A;  1IXF A;  1F4Z A;  1EPY A;  3HDF A;  3C8R A;  3C7W A;  1KG9 A;  1L90 A;  4XT3 A;  4KNF A;  1TN5 A;  4PJZ A;  2R4R A;  1KNI A;  1L97 A;  119L A;  219L A;  1D2W A;  220L A;  1DYD A;  5H2N A;  1DYA A;  4MD1 A;  4AMI A;  4I7K A;  5B6V A;  4W51 A;  1PY6 A;  4EPF A;  1CX6 A;  2X72 A;  3NSB A;  4EKR A;  1UCQ A;  111L A;  3PDS A;  1D3F A;  2F47 A;  128L A;  114L A;  3QJV B;  1P37 A;  1QHJ A;  3OAX A;  3HU9 A;  1L71 A;  3HUQ A;  1IW6 A;  120L A;  5KKH A;  1SX7 A;  1L39 A;  1L96 A;  1QUG A;  257L A;  1G06 A;  4XXJ A;  3C7Y A;  4G71 B;  108L A;  1QTB A;  1L34 A;  185L A;  1L75 A;  1PQI A;  143L A;  161L A;  1L94 A;  1T8G A;  3G3W A;  4LDO A;  3OE9 A;  1U19 A;  3QJU B;  1F88 A;  4IB4 A;  5ETZ A;  1XJI A;  1L73 A;  1E12 A;  2ZZL A;  1L65 A;  1LN6 A;  230L A;  1D3M A;  258L A;  5A8E A;  176L A;  4QRY A;  1C6D A;  2I20 A;  2R4S A;  1L02 A;  3DQB A;  3PBL A;  2OE9 X;  3CDT A;  1QSQ A;  1G0G A;  2YCZ A;  235L A;  172L A;  1IW9 A;  4W57 A;  1M0L A;  1P8I A;  2B7X A;  1X0S A;  3VVK A;  241L A;  1L10 A;  2OU9 A;  3HT6 A;  4OO9 A;  3G3X A;  1XME B;  1C6T A;  1CU3 A;  255L A;  1KG8 A;  1L60 A;  4GBR A;  1L54 A;  3HAR A;  1L0K A;  3QJQ B;  1JV7 A;  2ZFE A;  5DYS A;  2ANX A;  4YX7 C;  1L43 A;  1TLA A;  1T8F A;  1DYG A;  2F95 A;  2RB1 X;  1K28 A;  3CDQ A;  1L07 A;  107L A;  2QB0 B;  163L A;  3F8V A;  1L67 A;  1SSW A;  4GRV A;  164L A;  1L49 A;  4DKL A;  1C6N A;  1L09 A;  131L A;  1P46 A;  1VJM A;  4BWB A;  1LYH A;  2WJK A;  1L40 A;  2B73 A;  1QT3 A;  259L A;  3DMV A;  1L98 A;  1H68 A;  3UTX A;  180L A;  5AX1 A;  5B6X A;  4ARQ A;  2O4W A;  1P2R A;  2RAZ X;  139L A;  3HWL A;  1L95 A;  216L A;  3ABW A;  170L A;  1AT9 A;  4ARP A;  1L81 A;  5AWZ A;  1C8R A;  1DYC A;  1Q5J A;  1JV6 A;  1L14 A;  1L03 A;  1L29 A;  1L35 A;  210L A;  1L24 A;  3UON A;  4IAR A;  5DHH A;  1C69 A;  1P2L A;  1DZE A;  5JJJ A;  3CDV A;  1OYU A;  1AP9 A;  156L A;  1LGU A;  4AQN A;  4FA7 B;  1L89 A;  3C83 A;  1XEP A;  158L A;  1JQU A;  240L A;  4W53 A;  3UZA A;  4W56 A;  4I7M A;  1D3N A;  3HAP A;  1LYJ A;  2RB0 X;  110L A;  1QUO A;  3HAN A;  3QAP A;  155L A;  113L A;  1C67 A;  1L38 A;  1LI6 A;  1G0M A;  3C9M A;  4X1H A;  5AX0 A;  127L A;  4G70 B;  1OVJ A;  182L A;  2I21 A;  1SWY A;  183L A;  4N4W A;  4OV0 A;  162L A;  148L E;  2L6X A;  3C9L A;  1QS5 A;  1L28 A;  1L74 A;  3UTV A;  1L21 A;  3HH4 A;  1F50 A;  5FJG A;  3ZEV A;  1QTZ A;  3X3C A;  103L A;  4NC3 A;  5EN0 A;  2ANV A;  1L80 A;  246L A;  4GYC A;  1L0M A;  1HZX A;  1OVH A;  2LC9 A;  1PQO A;  3PXO A;  1ZUR A;  3HDE A;  260L A;  3NY9 A;  144L A;  1L19 A;  4Y9H A;  1BRR A;  3QBI A;  1L46 A;  4AMJ A;  1G1W A;  2RB2 X;  4JR8 A;  4I7S A;  3GUJ A;  199L A;  2VT4 A;  1BRX A;  1QS9 A;  5B6W A;  1X0I 1;  1L08 A;  1O0A A;  3PWH A;  1T6H A;  4W54 A;  1C6P A;  3SB8 A;  4KLY A;  2F2Q A;  3GUO A;  2KSB A;  1L37 A;  3SB5 A;  4PXF A;  1C6B A;  227L A;  1CV5 A;  5G28 A;  3V2W A;  125L A;  2B72 A;  1L00 A;  3SBB C;  1GUE A;  3CAP A;  5H2H A;  236L A;  140L A;  165L A;  3C7Z A;  1DYF A;  1SWZ A;  5B34 A;  2G87 A; 
#chains in the Genus database with same CATH topology
 238L A;  4XJF A;  173L A;  2Y01 A;  4DC4 A;  5H2I A;  1LZG A;  1BWJ A;  1GFJ A;  1YL0 X;  3WXU A;  178L A;  5H2J A;  1S8L A;  1EHK B;  4NGI A;  2YBH A;  1L27 A;  1D3J A;  2G4P A;  3WW5 A;  1L05 A;  1L56 A;  228L A;  1L62 A;  1WQR A;  1GFA A;  1HMK A;  3A95 A;  4XAD A;  1OUA A;  243L A;  1CV4 A;  4R6C A;  4B4J A;  4XJH A;  3EH3 B;  4BEZ A;  3D4S A;  4G72 B;  3TMU A;  1YAO A;  4WM2 A;  2LZM A;  1L76 A;  2W1L A;  4NSH A;  1OWZ A;  1LOZ A;  1WTM A;  205L A;  4PXK A;  147L A;  1AM7 A;  4G4C A;  1ZMY L;  1LSG A;  5LAF A;  1Q5I A;  4I7J A;  3GUM A;  2I1X A;  208L A;  168L A;  3TXI A;  2NTU A;  4N6H A;  2Z37 A;  3HH3 A;  4NGO A;  7LZM A;  3HAO A;  1LZ8 A;  2KS9 A;  4WG1 A;  1C6F A;  4YM8 A;  3SP3 A;  1I1Z A;  2BQH A;  1CTW A;  214L A;  1YKZ X;  2BQN A;  4W59 A;  2G4N A;  104L A;  2W1M A;  5KXZ A;  4YXA C;  3RW8 A;  3WYH A;  3TMV A;  1GU8 A;  233L A;  153L A;  195L A;  232L A;  4LZM A;  2DQA A;  2Y02 A;  1QSB A;  4L6R A;  1YIL A;  1L31 A;  1XGT C;  2YBN A;  4NSI A;  1IC5 Y;  1HML A;  1OUC A;  1GDX A;  2C8O A;  1BQL Y;  5DLA A;  1L13 A;  4ARJ A;  2IFF Y;  3SBA A;  1C66 A;  4OWE A;  1LWG A;  4NG1 A;  1CX7 A;  2ZIK A;  1LHH A;  1OWY A;  3W6B A;  1GZM A;  1CV3 A;  5ILF A;  1GE1 A;  115L A;  1IP7 A;  1GB9 A;  1P36 A;  4NFV A;  1KME A;  2HU1 A;  5APE A;  4XJB A;  3HH5 A;  2CDS A;  4WM6 A;  262L A;  249L A;  1L06 A;  4PJ2 C;  1L59 A;  2HU3 A;  1I20 A;  209L A;  4AXT A;  1P5C A;  1SSY A;  3VG9 A;  4MQT A;  2RBP A;  1ZVH L;  4QEQ A;  4N9R A;  5E9R A;  1IWZ A;  2YSS C;  1GB7 A;  3LYM A;  1HF4 A;  1L45 A;  1JKD A;  1WTN A;  4NHI A;  2B6T A;  3DN4 A;  1LJF A;  1QT8 A;  3C8S A;  146L A;  1UUZ C;  1P7S A;  2RBR A;  112L A;  1QIO A;  1UC0 A;  5D5C A;  5B1G A;  2YBJ A;  3QJR B;  3W3E A;  1J1O Y;  4EXM A;  1C6K A;  4YEM A;  4BUO A;  1E0P A;  1C65 A;  3CSZ A;  5G53 A;  2B74 A;  1UBZ A;  1QSW A;  194L A;  3HH6 A;  4LGK A;  1GBY A;  3GUP A;  3HUK A;  102L A;  2PC2 A;  3JR6 A;  2QPD B;  5FEK A;  2RAY X;  1P56 A;  1LYD A;  1UIG A;  1FLU A;  1HER A;  1OUG A;  1P6Y A;  4DAJ A;  2BQD A;  1JTN A;  2F2N A;  1IP1 A;  1C6H A;  1KXX A;  3CDO A;  4J4Q A;  1F6R A;  3LYT A;  1LYF A;  3B0K A;  4NGW A;  2Q9E A;  5C6I A;  1KW5 A;  5LZM A;  1L86 A;  1IOR A;  218L A;  4GN4 A;  5DN5 A;  1JUG A;  217L A;  2HUL A;  1S8J A;  1REZ A;  1QTE A;  5BR2 A;  2WAR A;  1L77 A;  3ATO A;  1NBY C;  1LJE A;  1LHJ A;  3C82 A;  5G36 A;  4EA3 A;  1D0L A;  1JGJ A;  3SB9 A;  2AT9 A;  1OUB A;  3OE0 A;  5LA8 A;  2A4T A;  1LCN A;  1XJT A;  4CGE A;  4I7L A;  1GB8 A;  5I54 A;  1UIC A;  4RLM A;  1R84 A;  1C6Q A;  3P4Z A;  159L A;  2B75 A;  1UAC Y;  3A3Q A;  3WPK A;  212L A;  3GUI A;  3EH4 B;  1UAZ A;  1L11 A;  1QT7 A;  2ZQ4 A;  1CV1 A;  3ZPQ A;  1B7Q A;  2J4Y A;  1F10 A;  1WQP A;  1C43 A;  3N9C A;  1L85 A;  4HSF A;  5L3H A;  4DWX A;  1L55 A;  181L A;  5G2A A;  2FYC A;  3PQR A;  2HUM A;  4NSG A;  1KXW A;  3AW6 A;  3OJP A;  1L58 A;  130L A;  4OWH A;  1S51 A;  1JFP A;  1XEK A;  3VGA A;  3ZPR A;  2NTW A;  3A8Z A;  1B7R A;  1L51 A;  1NDG C;  1FLW A;  2OEA X;  1C61 A;  2EQL A;  177L A;  3IJU A;  5HMJ A;  1G0P A;  1PS5 A;  1IXF A;  1EPY A;  5LVH A;  1KG9 A;  1CKD A;  1L90 A;  2EIZ C;  5J7C A;  4QDN A;  1TCY A;  2Z39 A;  4KNF A;  2ZWB A;  3K3T A;  1GEZ A;  1INU A;  1L97 A;  1LSA A;  1DYD A;  1CKH A;  4EPF A;  4Z41 A;  8LYZ A;  1SQ2 L;  4GCB A;  4Z3M A;  1NBZ C;  128L A;  2DQH Y;  135L A;  114L A;  3HU9 A;  1SX7 A;  1L39 A;  1G06 A;  1MEL L;  108L A;  1UIF A;  1L75 A;  1GFH A;  143L A;  161L A;  4HTQ A;  4LDO A;  3OE9 A;  3W6C A;  1XJI A;  1L73 A;  230L A;  1HEO A;  2F4G A;  3P66 A;  3PBL A;  4B4E A;  3CDT A;  4IAS A;  1G0G A;  235L A;  2F4A A;  4NY5 A;  1IW9 A;  1M0L A;  1X0S A;  2B7X A;  3N9A A;  2OU9 A;  1J1X Y;  255L A;  2N5Z A;  5KXL A;  3QJQ B;  2ZFE A;  2ANX A;  5FDJ A;  1LJG A;  4YX7 C;  1Z55 A;  2RB1 X;  5HQ1 A;  1JTT L;  4GCE A;  1L49 A;  4HJY A;  4DD2 A;  1C6N A;  131L A;  4KT3 A;  3A92 A;  1LYH A;  154L A;  2XBS A;  2WJK A;  1QDR A;  4B4I A;  3UTX A;  1L98 A;  5AX1 A;  2CGI A;  1DQJ C;  139L A;  1YKY X;  170L A;  2F30 A;  1Q5J A;  5DHH A;  2BQF A;  3ULR A;  3CDV A;  1ZV5 L;  1AP9 A;  1AZF A;  4H8X A;  4AGA A;  1IWV A;  3UZA A;  2FBD A;  1IX0 A;  1D3N A;  1LTM A;  1LYJ A;  1YAM A;  5AX0 A;  1C67 A;  1LI6 A;  1L38 A;  3C9M A;  4X1H A;  127L A;  1WVU A;  2YVB A;  5ILC A;  1LZY A;  1RI8 B;  3AGG G;  5FJG A;  1HEN A;  1OUF A;  2ANV A;  1HEP A;  2DKV A;  1HZX A;  3CSR A;  2BQG A;  1PQO A;  2NWD X;  3PXO A;  3HDE A;  260L A;  3NY9 A;  1L19 A;  4Y9H A;  3QBI A;  1DXJ A;  3HBH A;  4AMJ A;  1G1W A;  2RB2 X;  1DPX A;  5B6W A;  1X0I 1;  1JJ0 A;  1B5Y A;  5I4X A;  4N1E I;  4W54 A;  2F2Q A;  4CHX A;  1C6B A;  5IHG A;  3V2W A;  4ETB A;  4H9I A;  1AKI A;  1L00 A;  1C46 A;  1GBS A;  5IDD A;  1WQO A;  4DD3 A;  1IOQ A;  236L A;  165L A;  4G49 A;  4MR1 A;  2G87 A;  5B34 A;  2OE7 X;  1CVK A;  3P64 A;  3CT0 A;  4XJG A;  4EPI A;  4H91 A;  5KXR A;  4NGY A;  1JKA A;  2DQE Y;  1KW7 A;  1G0J A;  5C1M A;  2AUB A;  2HUB A;  1NHB A;  3LYZ A;  1MLC E;  4GPO A;  3CT1 A;  1FLQ A;  3GUK A;  1LZR A;  1T6V L;  4W52 A;  1JSF A;  200L A;  4EJ4 A;  4GBR B;  1L15 A;  1YRO A;  186L A;  3G3B B;  4LDE A;  1L83 A;  2BQB A;  1NF5 A;  2MEB A;  3RFM A;  1G1V A;  3QAK A;  4ARL A;  4JKV A;  2LZT A;  2MEG A;  152L A;  2FYD A;  1CKF A;  1L53 A;  126L A;  211L A;  4PRQ A;  1LZD A;  2DQJ Y;  5I14 A;  2DQD Y;  3RNX A;  3AZ5 A;  2D4J A;  3F9L A;  4OWC A;  1QTD A;  1OUD A;  5B1F A;  4DS7 E;  2O7A A;  2HUK A;  248L A;  1YAN A;  5KXN A;  1CWQ A;  3L64 A;  4DJH A;  1KS3 A;  256L A;  4W55 A;  1C60 A;  1L47 A;  4PRU A;  5G54 A;  1B7N A;  2HTX A;  247L A;  1IP2 A;  1JTO L;  1H87 A;  2YCW A;  2VB1 A;  1C45 A;  1GFG A;  1KY0 A;  1BHZ A;  1D2Y A;  3GUL A;  4EKQ A;  3GXK A;  3DMX A;  166L A;  4GN5 C;  4FAA B;  3F6Z A;  1HNL A;  4EKP A;  3BVD B;  1B7P A;  1L61 A;  2L78 A;  1XIO A;  4WM5 A;  1S52 A;  1G0Q A;  4I7N A;  3QY4 A;  3WW6 A;  2EI4 A;  1CU6 A;  3TXG A;  2NTH A;  5LVG A;  2RBQ A;  2HED A;  3ZEK A;  3CDR A;  3ATN A;  2Z6B A;  5IEL A;  4OWB A;  1NKH A;  5DHG A;  3QJT B;  1GB6 A;  3N9E A;  4WAV A;  1IWX A;  3MGW A;  4G7S B;  1GFR A;  1C6G A;  3WPJ A;  1T8A A;  1O23 A;  5H2O A;  1REM A;  3EH5 B;  3S8G B;  4LYC A;  4NEB A;  3T6U A;  5LIO A;  223L A;  5L3I A;  1T3P A;  237L A;  3EML A;  1PXS A;  1VDQ A;  3AB6 A;  1LZT A;  1LZ4 A;  1QT5 A;  3DN0 A;  1C7P A;  3HTB A;  1GFU A;  4NHT A;  4HV2 A;  145L A;  1L0J A;  2RBS A;  5B6Y A;  3BKV A;  1L42 A;  3KAM A;  4MCK A;  4XEN A;  1B2K A;  5F16 A;  5KXM A;  3VW7 A;  1ZWN A;  1L41 A;  2ZIJ A;  1LZ5 A;  4H93 A;  1CUP A;  2YCY A;  1PZY A;  1IWY A;  4GP5 B;  3QE8 A;  1IP4 A;  1FDL Y;  4WG7 A;  4H1P A;  5LYT A;  1NQI A;  5I4W A;  3CSQ A;  1DYE A;  1OQM A;  1I6S A;  4H9F A;  1C68 A;  244L A;  3S3C B;  2I35 A;  3A34 A;  2X0A A;  4MQS A;  3DDL A;  2Y03 A;  221L A;  4QI1 A;  4LZT A;  3VI0 A;  5F81 A;  1ZVY B;  1L93 A;  4A4M A;  5LIN A;  1BB5 A;  1GE0 A;  1L79 A;  1KIR C;  1L50 A;  4DQ5 A;  1L64 A;  2DBT A;  3J6K A;  5JJN A;  1L66 A;  1B5Z A;  4EKS A;  1IP6 A;  1LAA A;  1QUS A;  4TUN A;  187L A;  1HEW A;  3W6A A;  5A3E A;  5II3 A;  3HAQ A;  5H2M A;  3TXK A;  2ZIY A;  1GBZ A;  3S3D B;  1HFZ A;  6LZM A;  1DI3 A;  5F9X A;  1C6A A;  3S3B B;  1VAU A;  2RH1 A;  1F6S A;  3CB7 A;  1SX2 A;  4I7O A;  2ZYP A;  3FI5 A;  5I5Q A;  4DDB A;  1CV0 A;  1IC7 Y;  4J7V A;  5KXS A;  3A93 A;  1LSE A;  2LYM A;  4N4Y B;  2H9J A;  4HYX A;  1RE2 A;  2F93 A;  129L A;  250L A;  3FI7 A;  1G0L A;  1VFB C;  1BVX A;  4WW3 A;  4NGZ A;  2HPY A;  3AM6 A;  1L20 A;  141L A;  4XTN A;  2ZNX Y;  5KXY A;  1D0K A;  4WLT A;  4PK0 A;  3K2R A;  5LVK A;  1FBB A;  5KKI A;  4TSC A;  2B6Z A;  4GCD A;  2GV0 A;  251L A;  3WVX A;  3W6F A;  1CV6 A;  4NGJ A;  1C08 C;  1F4Z A;  3OK0 A;  1CJ7 A;  3AZ7 A;  3RU5 A;  1B5U A;  4PJZ A;  1TDY A;  1KNI A;  4PPO A;  2BQK A;  2MEF A;  4H9E A;  5JEN B;  4AMI A;  4HP0 A;  4NG8 A;  4W51 A;  4YEO A;  2BQJ A;  2X72 A;  1CX6 A;  4J1A A;  3ZVQ B;  1GF3 A;  4EKR A;  3TMW A;  1IOT A;  2DQG Y;  2F47 A;  1N4F A;  3QJV B;  1P37 A;  1QHJ A;  120L A;  5KKH A;  4RLN A;  1L96 A;  1JJ1 A;  1QUG A;  4E3U A;  3RZ4 A;  1HFY A;  1QTB A;  1L34 A;  185L A;  1PQI A;  3G3W A;  1TBY A;  1LMA A;  5HLL A;  1HEL A;  1L65 A;  3G3A B;  1GAZ A;  5A8E A;  4QRY A;  2I20 A;  1EQ4 A;  3DQB A;  5KJ9 A;  1GB2 A;  4H94 A;  1ALC A;  4W57 A;  2EKS C;  3VVK A;  4H92 A;  5DM9 A;  2FBB A;  1L60 A;  4NHP A;  4GBR A;  2XBR A;  1L54 A;  3HAR A;  1JV7 A;  1QQY A;  4HJV A;  4NHQ A;  1TLA A;  1YQV Y;  2F95 A;  5F14 A;  2DQF C;  5KY1 A;  132L A;  1GD6 A;  1L07 A;  2H9K A;  107L A;  2QB0 B;  1SSW A;  1G7I C;  4DKL A;  5KXK A;  5APD A;  3IWR A;  1B7S A;  3HFM Y;  3UTW A;  1LYZ A;  4NGV A;  2O4W A;  4WLX A;  1P2R A;  4Z46 A;  1AT9 A;  4ARP A;  1L81 A;  5AWZ A;  1JV6 A;  1L29 A;  210L A;  3UON A;  1IIZ A;  1L24 A;  4LT3 A;  4IAR A;  1BGI A;  1OYU A;  1L89 A;  1XEP A;  158L A;  240L A;  4W53 A;  4ETE A;  1LMN A;  110L A;  3HAN A;  1XEI A;  1G0M A;  1OVJ A;  1SWY A;  4ANR A;  183L A;  4N4W A;  1QS5 A;  1L28 A;  134L A;  1F50 A;  3HH4 A;  4NWE A;  1QTZ A;  1G7L C;  5FHW A;  1L80 A;  246L A;  1L0M A;  1LMQ A;  2LC9 A;  144L A;  1BRR A;  4KPM A;  1LMT A;  3GUJ A;  5APC A;  5B59 A;  1L08 A;  1O0A A;  1T6H A;  3SB8 A;  1JTP L;  2KSB A;  1L37 A;  6LYT A;  227L A;  1CV5 A;  4FDY A;  5G28 A;  1FKV A;  1GUE A;  1DYF A;  1LZ1 A;  4WM1 A;  4GLA A;  1HHL A;  4XJI A;  1IY3 A;  1IO5 A;  4H9C A;  4MD2 A;  4J0L A;  1LMO A;  4GCC A;  2O79 A;  1HC0 A;  1L30 A;  4QGZ A;  1GEV A;  3SB6 A;  3HT9 A;  4C3W A;  4DDA A;  5LWE A;  4P2E A;  1L68 A;  2RSC A;  4U3X B;  1H2S A;  1LJN A;  2Z73 A;  5C6L A;  4X3B A;  2BQL A;  4IAQ A;  1IP5 A;  1GF5 A;  2Y04 A;  3E3D A;  4OOO A;  1LJI A;  1CJ6 A;  4E97 A;  4I7P A;  1BB4 A;  2M3G A;  1B9O A;  4UG2 A;  3REY A;  5HNL A;  4K5Y A;  2ZQ3 A;  2HEA A;  3HTG A;  1LYE A;  118L A;  4H8Z A;  2B70 A;  1JIS A;  1JWR A;  1FN5 A;  207L A;  4BAF A;  1C3W A;  3WU9 A;  4I7Q A;  4IAT A;  1LGW A;  2YDG A;  4HV1 A;  4DYG A;  1LZ9 A;  4DD9 A;  4ZPU A;  1LKS A;  151L A;  1HSX A;  3RT5 X;  1TN0 A;  3P68 A;  4DDC A;  1LHM A;  3HU8 A;  3SN6 R;  1IR7 A;  4G4B A;  1CU5 A;  2WJL A;  3RUN A;  2A7D A;  4BS7 A;  4LT1 A;  1OV5 A;  1QM8 A;  1REX A;  1CKC A;  2MEH A;  2Z2F A;  122L A;  197L A;  3HT7 A;  1W6Z A;  3HTD A;  3WH1 A;  1IR8 A;  1GF6 A;  1PQD A;  4KXI A;  4BEY A;  1GHL A;  1GFV A;  1G07 A;  5B05 A;  1LW9 A;  1RJC B;  5AZD A;  1D9W A;  1JSE A;  5F8U A;  3A94 A;  1BWH A;  1L17 A;  5FST A;  1C63 A;  1BRD A;  1L92 A;  3M3U A;  191L A;  2BQO A;  1C6J A;  4NWH A;  5APF A;  3MBV A;  1TAY A;  2KSY A;  4CJ2 A;  4TL3 A;  2ZYC A;  222L A;  1V7S A;  5I4Y A;  201L A;  1L01 A;  1LSN A;  4FPD A;  1L18 A;  2A7F A;  3WXT A;  1L04 A;  1WQM A;  1P64 A;  5AHZ A;  1G7J C;  1L16 A;  3AZ6 A;  1B7M A;  1R2N A;  4ETD A;  2MEE A;  1LLH A;  3TMX A;  1RFP A;  1T97 A;  226L A;  242L A;  225L A;  1LI2 A;  2CWI A;  4WMG A;  1QKP A;  5LYM A;  6LYZ A;  3FAD A;  3EO5 A;  3LN2 A;  1P8H A;  4IAP A;  4LT0 A;  3NY8 A;  167L A;  2LCB A;  5KXT A;  206L A;  4ZIX A;  5EBH A;  4HYJ A;  1GF4 A;  1E8L A;  1C62 A;  4I0C A;  1QTK A;  1LZ6 A;  1WVV A;  1CUQ A;  4H9A A;  2D4K A;  3NYA A;  5B6Z A;  1HFX A;  3WVY A;  1G0K A;  1LYY A;  1B5X A;  3VWO A;  3A96 A;  2Z38 A;  4MST A;  3ZVQ A;  4N5R A;  4X32 A;  4GLV A;  4HWL A;  3LZ2 A;  5F9U A;  157L A;  1GFE A;  1HEM A;  2Y8P A;  4L35 A;  1L99 A;  3DNA A;  4YXC A;  1UIE A;  2OU0 X;  1LYS A;  1D6Q A;  5AMY A;  1S53 A;  5AHY A;  1CJ9 A;  2I26 L;  4HJZ A;  160L A;  2B6Y A;  1B6I A;  4ARM B;  4GP4 B;  4RW2 A;  3SB7 A;  4MBS A;  4PGJ B;  2RBO A;  2HEB A;  1RCM A;  133L A;  5G2D A;  4NSJ A;  1IWT A;  2RBN A;  1DYB A;  4HTN A;  1L69 A;  3QJS B;  3X3B A;  1AT6 A;  4W96 A;  1CU2 A;  4ET8 A;  1YL1 X;  1UIH A;  1CKG A;  4LYM A;  4UHR A;  1L33 A;  2Q0M X;  4G4H A;  3TXB A;  1YAP A;  1M0M A;  3B0O A;  1QT6 A;  4DT3 A;  252L A;  5B35 A;  1C6C A;  3UTY A;  4LT2 A;  4XTL A;  1GWD A;  4I8S A;  1VED A;  4I7R A;  2C8P A;  4XN6 A;  4TWS A;  3COD A;  198L A;  1LI3 A;  4C5F A;  1DI4 A;  1JKB A;  3ODU A;  3W6E A;  1S54 A;  2Q9D A;  137L A;  1WQQ A;  1DKJ A;  2Z2E A;  4OW1 A;  2LYO A;  1LYG A;  5H2L A;  5TGZ A;  109L A;  2OTY X;  3QBL A;  4EIY A;  254L A;  1B5V A;  1L44 A;  1B7L A;  3A91 A;  1M0K A;  3DN6 A;  1IP3 A;  1IOC A;  3AYN A;  1WTH A;  1C64 A;  1IWU A;  4FJR A;  5I53 A;  5A45 A;  1L57 A;  2IHL A;  1IVM A;  1YKX X;  3C8R A;  1SLY A;  4WM4 A;  4YEN A;  3A6C Y;  2R4R A;  4PHI A;  4RW1 A;  2Z19 A;  5H2N A;  1DYA A;  4MD1 A;  4ETA A;  1D6P A;  1PY6 A;  3NSB A;  111L A;  4HTK A;  4XJD A;  1L71 A;  1JEF A;  4NHS A;  3C7Y A;  4XXJ A;  1L94 A;  1B5W A;  2MEA A;  1U19 A;  3QJU B;  1E12 A;  2ZZL A;  4H8Y A;  1D3M A;  258L A;  176L A;  2DQI Y;  1C6D A;  3CQL A;  2D6B A;  2OE9 X;  1QSQ A;  4H9H A;  1DZB X;  1GXV 2;  241L A;  1L10 A;  193L A;  2XTH A;  3G3X A;  1XME B;  1YIK A;  2D91 A;  3D3D A;  4WOA A;  3IJV A;  1T8F A;  1DYG A;  1LPI A;  1K28 A;  3CDQ A;  4RDS A;  2XQO A;  3A67 Y;  4W94 A;  1KIQ C;  164L A;  1P46 A;  1VJM A;  4BWB A;  2BPU A;  1L40 A;  1QT3 A;  1GB3 A;  3DMV A;  180L A;  5B6X A;  1LSY A;  1GE3 A;  3HBE X;  3B72 A;  1L95 A;  216L A;  4OOT A;  2HEC A;  1DYC A;  1L14 A;  1L35 A;  1C69 A;  1P2L A;  4IJ4 A;  156L A;  1LGU A;  1GPQ C;  5LYZ A;  4I7M A;  2RB0 X;  4LFP A;  2YBL A;  5FEL A;  155L A;  1LJJ A;  1LHI A;  5B07 A;  1DI5 A;  4A7D A;  2L6X A;  148L E;  3C9L A;  1L74 A;  4TX7 A;  3X3C A;  103L A;  4NC3 A;  4M4O A;  4GYC A;  3A6B Y;  5HNC A;  5KXO A;  9LYZ A;  1OUI A;  3LYO A;  7LYZ A;  1ZUR A;  2BLX A;  3M18 B;  1LZC A;  3AZ4 A;  4JR8 A;  1W08 A;  2VT4 A;  3AJN A;  4ZFP A;  1LJH A;  1C6P A;  4KLY A;  3WU8 A;  1IEE A;  1IR9 A;  3GUO A;  3A3R X;  1XGR C;  3P65 A;  3AGI A;  1GBW A;  1HSW A;  1NHE A;  1EQ5 A;  5H2H A;  140L A;  3C7Z A;  1SWZ A;  4N1C C;  3AYM A;  239L A;  1L87 A;  3T45 A;  3TXE A;  3UG9 A;  3DN2 A;  1IC4 Y;  4B49 A;  4G9S A;  231L A;  2HEF A;  3L2X A;  1X0K 1;  2BRD A;  2BQM A;  1OUE A;  1LSC A;  1L48 A;  4TTD A;  189L A;  4BVN A;  1JJ3 A;  1QDT A;  2D4I A;  1UA6 Y;  1XFP L;  1BWI A;  1L84 A;  1XGU C;  1JKC A;  5J7A A;  4L41 A;  3NS0 A;  4XYY A;  1PXR A;  1KIP C;  4QID A;  123L A;  150L A;  4ARQ B;  3S8F B;  4QY9 A;  175L A;  1EQE A;  4BAP A;  1NWG A;  5L9J A;  5M1Y A;  1XJU A;  4DQ7 A;  1BB3 A;  1KXY A;  1QUT A;  2YBI A;  1LSZ A;  4WO6 A;  2YDV A;  1L26 A;  2H5Z A;  3LZM A;  171L A;  3DN3 A;  3P0G A;  1PQK A;  1F0W A;  190L A;  1G7M C;  5H2P A;  1C6E A;  2XJW A;  2YCX A;  1JHL A;  1YAQ A;  3C8Q A;  5ITC A;  2Z18 A;  4WL6 A;  1IWW A;  1LGX A;  4TSB A;  3OE8 A;  4ARM A;  253L A;  4JQ6 A;  1UID A;  169L A;  1GE4 A;  3RZE A;  4X31 A;  5G2C A;  1GBX A;  1NDM C;  4DD0 A;  2BLY A;  1L63 A;  215L A;  5LAG A;  1QTH A;  3HT8 A;  1LPY A;  5H2K A;  1DPW A;  3HAS A;  5B06 A;  1L9H A;  1QUH A;  1OVK A;  4DD7 A;  5DL9 A;  2B5Z A;  1GF0 A;  4I7T A;  4W58 A;  3WQJ A;  3A90 A;  2I6Z A;  3QNG A;  4UWU A;  1FBI X;  224L A;  2JAF A;  1GDW A;  3B0I A;  1XGP C;  1GF8 A;  138L A;  1DKK A;  1FLY A;  1L22 A;  4N0J A;  3T36 A;  2Y00 A;  1VDS A;  4YOP A;  1QTV A;  3WPL A;  234L A;  2BQI A;  149L A;  2BQA A;  3BKH A;  1JIT A;  5DN4 A;  3EBA B;  4O34 A;  3TXJ A;  3A7K A;  2LZ2 A;  1C6I A;  4LFX A;  3C80 A;  4H90 A;  3UZC A;  1QUD A;  1CU0 A;  5ITE A;  5JJE A;  3DMZ A;  4S0W A;  4H9B A;  3W6D A;  4B1A A;  1P3N A;  245L A;  1GFT A;  2Z12 A;  1C10 A;  1C8S A;  2HEE A;  1GXX A;  4B0D A;  3QDC A;  1B0D A;  2ZIL A;  4DD1 A;  4DQJ A;  261L A;  3KJ6 A;  3VHZ A;  1L36 A;  1GFK A;  4XTO A;  2MED A;  5D5F A;  5B2N A;  1L70 A;  3HUA A;  1LKR A;  5A44 A;  1JTM A;  3HBD A;  4ET9 A;  3COC A;  3LHM A;  174L A;  4WO9 A;  2B6W A;  1L12 A;  3WU7 A;  2G4Q A;  1VGO A;  2QAR C;  1A2Y C;  1VDT A;  2CUU A;  4HPE A;  2KSA A;  4GP8 B;  4XT1 A;  5LXW A;  1KY1 A;  3AW7 A;  1OUH A;  4EOF A;  1LJ3 A;  1IOS A;  4BV0 A;  1L32 A;  1L91 A;  1OV7 A;  2IGC A;  1H6M A;  1LJ4 A;  184L A;  1FKQ A;  2B6X A;  1LZE A;  4R0F A;  213L A;  1LYI A;  3LZT A;  2QPE B;  5B0W A;  1QSA A;  1L23 A;  1D0M A;  229L A;  1QKO A;  4D9Z A;  4G7R B;  3C81 A;  4II8 A;  2F32 A;  4LDL A;  2LNL A;  1OP9 B;  4ETC A;  1P8U A;  5LA5 A;  3DN1 A;  1BM1 A;  1CNS A;  1REY A;  5T3F A;  1FBK A;  1L72 A;  1QTC A;  2PED A;  3QBK A;  2BQE A;  4G7Q B;  1L88 A;  3FA0 A;  1MGY A;  1LSM A;  1PQM A;  3QBG A;  3WUL A;  2I25 L;  4WLD A;  1L52 A;  1B7O A;  2LYZ A;  3DKE X;  1GB0 A;  1LHK A;  2NTG A;  3CT5 A;  196L A;  1L82 A;  1CJ8 A;  4GCF A;  3G3V A;  2JAG A;  1C6L A;  4FBZ A;  4OWA A;  2ZNW Y;  3GUN A;  1BB6 A;  4CFO A;  1ZYT A;  4N8Z A;  5BR5 A;  1PQJ A;  1LWK A;  3DN8 A;  1TEW A;  2MEC A;  4EMN A;  1C6M A;  1LSB A;  1LZN A;  2OTZ X;  2OU8 A;  1WQN A;  4ZEE A;  192L A;  1LZA A;  2Z55 A;  2CJL A;  188L A;  1KGB A;  1D9U A;  3B6L A;  1HEQ A;  2OE4 X;  2LHM A;  4GN3 A;  1QT4 A;  4CFP A;  3V2Y A;  1L25 A;  3WUN A;  2YDO A;  1EL1 A;  1UIA A;  3GXR A;  1A4V A;  1G7H C;  5KXW A;  3OE6 A;  1LSD A;  3HTF A;  4YF2 A;  4ML7 A;  1XSF A;  142L A;  4M6D A;  3HDF A;  3C7W A;  1LZS A;  4XT3 A;  1TN5 A;  119L A;  219L A;  1D2W A;  220L A;  4J1B A;  1V7T A;  5B6V A;  4I7K A;  1XGQ C;  5KXP A;  1UCQ A;  3WUM A;  3PDS A;  1D3F A;  1LJK A;  5C6J A;  3OAX A;  3HUQ A;  1JPO A;  1IW6 A;  2EPE A;  257L A;  4G71 B;  5E4P A;  1T8G A;  4WL7 A;  5ETZ A;  1F88 A;  4IB4 A;  1LN6 A;  1LSF A;  3TXF A;  2R4S A;  1L02 A;  1GE2 A;  1UCO A;  2DQC Y;  1NMM A;  4NGL A;  2YCZ A;  172L A;  1P8I A;  4OO9 A;  3HT6 A;  4UWN A;  1C6T A;  4HPI A;  1CU3 A;  1KG8 A;  4WM3 A;  5HMV A;  1L0K A;  5A3Z A;  3J4G A;  4Z98 A;  1GF9 A;  5DYS A;  4KL7 A;  1L43 A;  4LYT A;  5K7O A;  4WLY A;  3F8V A;  163L A;  4GRV A;  1L67 A;  1GBO A;  1L09 A;  1P2C C;  3AGH A;  2B73 A;  259L A;  1H68 A;  3FE0 A;  1LZB A;  4ARQ A;  3WUA A;  2RAZ X;  3HWL A;  4UWV A;  3ABW A;  3AYQ A;  2W1X A;  1OUJ A;  4BAD A;  3TXD A;  1C8R A;  4LYZ A;  1L03 A;  1I56 A;  5JJJ A;  1DZE A;  1XEJ A;  1LSP A;  4AQN A;  3TXH A;  2W1Y A;  4FA7 B;  1VAT A;  3C83 A;  5LVI A;  1JQU A;  4W56 A;  1LMC A;  3HAP A;  3EXD A;  1QUO A;  3QAP A;  113L A;  3WL2 A;  4G70 B;  182L A;  2I21 A;  4OV0 A;  162L A;  2BAA A;  1GB5 A;  1VDP A;  3UTV A;  1L21 A;  3ZEV A;  1IY4 A;  5EN0 A;  5LVJ A;  1OVH A;  3EMS A;  2BQC A;  1AT5 A;  1L46 A;  4NGK A;  4I7S A;  199L A;  1BB7 A;  1BRX A;  1QS9 A;  2MEI A;  5KXX A;  3PWH A;  5KKJ A;  1LHL A;  1GF7 A;  3SB5 A;  4PXF A;  1BVK C;  4LYO A;  1GAY A;  1LYO A;  1JIY A;  2YBM A;  4LYB A;  125L A;  2B72 A;  3WMK A;  3SBB C;  1UIB A;  3D9A C;  3CAP A;  4NIJ A;  1LMP A;  1J1P Y;  5FCP A; 
#chains in the Genus database with same CATH homology
 238L A;  4XJF A;  173L A;  2Y01 A;  4DC4 A;  5H2I A;  1LZG A;  1BWJ A;  1GFJ A;  1YL0 X;  3WXU A;  178L A;  5H2J A;  1S8L A;  1EHK B;  4NGI A;  2YBH A;  1L27 A;  1D3J A;  2G4P A;  3WW5 A;  1L05 A;  1L56 A;  228L A;  1L62 A;  1WQR A;  1GFA A;  1HMK A;  3A95 A;  4XAD A;  1OUA A;  243L A;  1CV4 A;  4R6C A;  4B4J A;  4XJH A;  3EH3 B;  4BEZ A;  3D4S A;  4G72 B;  3TMU A;  1YAO A;  4WM2 A;  2LZM A;  1L76 A;  2W1L A;  4NSH A;  1OWZ A;  1LOZ A;  1WTM A;  205L A;  4PXK A;  147L A;  1AM7 A;  4G4C A;  1ZMY L;  1LSG A;  5LAF A;  1Q5I A;  4I7J A;  3GUM A;  2I1X A;  208L A;  168L A;  3TXI A;  2NTU A;  4N6H A;  2Z37 A;  3HH3 A;  4NGO A;  7LZM A;  3HAO A;  1LZ8 A;  2KS9 A;  4WG1 A;  1C6F A;  4YM8 A;  3SP3 A;  1I1Z A;  2BQH A;  1CTW A;  214L A;  1YKZ X;  2BQN A;  4W59 A;  2G4N A;  104L A;  2W1M A;  5KXZ A;  4YXA C;  3RW8 A;  3WYH A;  3TMV A;  1GU8 A;  233L A;  153L A;  195L A;  232L A;  4LZM A;  2DQA A;  2Y02 A;  1QSB A;  4L6R A;  1YIL A;  1L31 A;  1XGT C;  2YBN A;  4NSI A;  1IC5 Y;  1HML A;  1OUC A;  1GDX A;  2C8O A;  1BQL Y;  5DLA A;  1L13 A;  4ARJ A;  2IFF Y;  3SBA A;  1C66 A;  4OWE A;  1LWG A;  4NG1 A;  1CX7 A;  2ZIK A;  1LHH A;  1OWY A;  3W6B A;  1GZM A;  1CV3 A;  5ILF A;  1GE1 A;  115L A;  1IP7 A;  1GB9 A;  1P36 A;  4NFV A;  1KME A;  2HU1 A;  5APE A;  4XJB A;  3HH5 A;  2CDS A;  4WM6 A;  262L A;  249L A;  1L06 A;  4PJ2 C;  1L59 A;  2HU3 A;  1I20 A;  209L A;  4AXT A;  1P5C A;  1SSY A;  3VG9 A;  4MQT A;  2RBP A;  1ZVH L;  4QEQ A;  4N9R A;  5E9R A;  1IWZ A;  2YSS C;  1GB7 A;  3LYM A;  1HF4 A;  1L45 A;  1JKD A;  1WTN A;  4NHI A;  2B6T A;  3DN4 A;  1LJF A;  1QT8 A;  3C8S A;  146L A;  1UUZ C;  1P7S A;  2RBR A;  112L A;  1QIO A;  1UC0 A;  5D5C A;  5B1G A;  2YBJ A;  3QJR B;  3W3E A;  1J1O Y;  4EXM A;  1C6K A;  4YEM A;  4BUO A;  1E0P A;  1C65 A;  3CSZ A;  5G53 A;  2B74 A;  1UBZ A;  1QSW A;  194L A;  3HH6 A;  4LGK A;  1GBY A;  3GUP A;  3HUK A;  102L A;  2PC2 A;  3JR6 A;  2QPD B;  5FEK A;  2RAY X;  1P56 A;  1LYD A;  1UIG A;  1FLU A;  1HER A;  1OUG A;  1P6Y A;  4DAJ A;  2BQD A;  1JTN A;  2F2N A;  1IP1 A;  1C6H A;  1KXX A;  3CDO A;  4J4Q A;  1F6R A;  3LYT A;  1LYF A;  3B0K A;  4NGW A;  2Q9E A;  5C6I A;  1KW5 A;  5LZM A;  1L86 A;  1IOR A;  218L A;  4GN4 A;  5DN5 A;  1JUG A;  217L A;  2HUL A;  1S8J A;  1REZ A;  1QTE A;  5BR2 A;  2WAR A;  1L77 A;  3ATO A;  1NBY C;  1LJE A;  1LHJ A;  3C82 A;  5G36 A;  4EA3 A;  1D0L A;  1JGJ A;  3SB9 A;  2AT9 A;  1OUB A;  3OE0 A;  5LA8 A;  2A4T A;  1LCN A;  1XJT A;  4CGE A;  4I7L A;  1GB8 A;  5I54 A;  1UIC A;  4RLM A;  1R84 A;  1C6Q A;  3P4Z A;  159L A;  2B75 A;  1UAC Y;  3A3Q A;  3WPK A;  212L A;  3GUI A;  3EH4 B;  1UAZ A;  1L11 A;  1QT7 A;  2ZQ4 A;  1CV1 A;  3ZPQ A;  1B7Q A;  2J4Y A;  1F10 A;  1WQP A;  1C43 A;  3N9C A;  1L85 A;  4HSF A;  5L3H A;  4DWX A;  1L55 A;  181L A;  5G2A A;  2FYC A;  3PQR A;  2HUM A;  4NSG A;  1KXW A;  3AW6 A;  3OJP A;  1L58 A;  130L A;  4OWH A;  1S51 A;  1JFP A;  1XEK A;  3VGA A;  3ZPR A;  2NTW A;  3A8Z A;  1B7R A;  1L51 A;  1NDG C;  1FLW A;  2OEA X;  1C61 A;  2EQL A;  177L A;  3IJU A;  5HMJ A;  1G0P A;  1PS5 A;  1IXF A;  1EPY A;  5LVH A;  1KG9 A;  1CKD A;  1L90 A;  2EIZ C;  5J7C A;  4QDN A;  1TCY A;  2Z39 A;  4KNF A;  2ZWB A;  3K3T A;  1GEZ A;  1INU A;  1L97 A;  1LSA A;  1DYD A;  1CKH A;  4EPF A;  4Z41 A;  8LYZ A;  1SQ2 L;  4GCB A;  4Z3M A;  1NBZ C;  128L A;  2DQH Y;  135L A;  114L A;  3HU9 A;  1SX7 A;  1L39 A;  1G06 A;  1MEL L;  108L A;  1UIF A;  1L75 A;  1GFH A;  143L A;  161L A;  4HTQ A;  4LDO A;  3OE9 A;  3W6C A;  1XJI A;  1L73 A;  230L A;  1HEO A;  2F4G A;  3P66 A;  3PBL A;  4B4E A;  3CDT A;  4IAS A;  1G0G A;  235L A;  2F4A A;  4NY5 A;  1IW9 A;  1M0L A;  1X0S A;  2B7X A;  3N9A A;  2OU9 A;  1J1X Y;  255L A;  2N5Z A;  5KXL A;  3QJQ B;  2ZFE A;  2ANX A;  5FDJ A;  1LJG A;  4YX7 C;  1Z55 A;  2RB1 X;  5HQ1 A;  1JTT L;  4GCE A;  1L49 A;  4HJY A;  4DD2 A;  1C6N A;  131L A;  4KT3 A;  3A92 A;  1LYH A;  154L A;  2XBS A;  2WJK A;  1QDR A;  4B4I A;  3UTX A;  1L98 A;  5AX1 A;  2CGI A;  1DQJ C;  139L A;  1YKY X;  170L A;  2F30 A;  1Q5J A;  5DHH A;  2BQF A;  3ULR A;  3CDV A;  1ZV5 L;  1AP9 A;  1AZF A;  4H8X A;  4AGA A;  1IWV A;  3UZA A;  2FBD A;  1IX0 A;  1D3N A;  1LTM A;  1LYJ A;  1YAM A;  5AX0 A;  1C67 A;  1LI6 A;  1L38 A;  3C9M A;  4X1H A;  127L A;  1WVU A;  2YVB A;  5ILC A;  1LZY A;  1RI8 B;  3AGG G;  5FJG A;  1HEN A;  1OUF A;  2ANV A;  1HEP A;  2DKV A;  1HZX A;  3CSR A;  2BQG A;  1PQO A;  2NWD X;  3PXO A;  3HDE A;  260L A;  3NY9 A;  1L19 A;  4Y9H A;  3QBI A;  1DXJ A;  3HBH A;  4AMJ A;  1G1W A;  2RB2 X;  1DPX A;  5B6W A;  1X0I 1;  1JJ0 A;  1B5Y A;  5I4X A;  4N1E I;  4W54 A;  2F2Q A;  4CHX A;  1C6B A;  5IHG A;  3V2W A;  4ETB A;  4H9I A;  1AKI A;  1L00 A;  1C46 A;  1GBS A;  5IDD A;  1WQO A;  4DD3 A;  1IOQ A;  236L A;  165L A;  4G49 A;  4MR1 A;  2G87 A;  5B34 A;  2OE7 X;  1CVK A;  3P64 A;  3CT0 A;  4XJG A;  4EPI A;  4H91 A;  5KXR A;  4NGY A;  1JKA A;  2DQE Y;  1KW7 A;  1G0J A;  5C1M A;  2AUB A;  2HUB A;  1NHB A;  3LYZ A;  1MLC E;  4GPO A;  3CT1 A;  1FLQ A;  3GUK A;  1LZR A;  1T6V L;  4W52 A;  1JSF A;  200L A;  4EJ4 A;  4GBR B;  1L15 A;  1YRO A;  186L A;  3G3B B;  4LDE A;  1L83 A;  2BQB A;  1NF5 A;  2MEB A;  3RFM A;  1G1V A;  3QAK A;  4ARL A;  4JKV A;  2LZT A;  2MEG A;  152L A;  2FYD A;  1CKF A;  1L53 A;  126L A;  211L A;  4PRQ A;  1LZD A;  2DQJ Y;  5I14 A;  2DQD Y;  3RNX A;  3AZ5 A;  2D4J A;  3F9L A;  4OWC A;  1QTD A;  1OUD A;  5B1F A;  4DS7 E;  2O7A A;  2HUK A;  248L A;  1YAN A;  5KXN A;  1CWQ A;  3L64 A;  4DJH A;  1KS3 A;  256L A;  4W55 A;  1C60 A;  1L47 A;  4PRU A;  5G54 A;  1B7N A;  2HTX A;  247L A;  1IP2 A;  1JTO L;  1H87 A;  2YCW A;  2VB1 A;  1C45 A;  1GFG A;  1KY0 A;  1BHZ A;  1D2Y A;  3GUL A;  4EKQ A;  3GXK A;  3DMX A;  166L A;  4GN5 C;  4FAA B;  3F6Z A;  1HNL A;  4EKP A;  3BVD B;  1B7P A;  1L61 A;  2L78 A;  1XIO A;  4WM5 A;  1S52 A;  1G0Q A;  4I7N A;  3QY4 A;  3WW6 A;  2EI4 A;  1CU6 A;  3TXG A;  2NTH A;  5LVG A;  2RBQ A;  2HED A;  3ZEK A;  3CDR A;  3ATN A;  2Z6B A;  5IEL A;  4OWB A;  1NKH A;  5DHG A;  3QJT B;  1GB6 A;  3N9E A;  4WAV A;  1IWX A;  3MGW A;  4G7S B;  1GFR A;  1C6G A;  3WPJ A;  1T8A A;  1O23 A;  5H2O A;  1REM A;  3EH5 B;  3S8G B;  4LYC A;  4NEB A;  3T6U A;  5LIO A;  223L A;  5L3I A;  1T3P A;  237L A;  3EML A;  1PXS A;  1VDQ A;  3AB6 A;  1LZT A;  1LZ4 A;  1QT5 A;  3DN0 A;  1C7P A;  3HTB A;  1GFU A;  4NHT A;  4HV2 A;  145L A;  1L0J A;  2RBS A;  5B6Y A;  3BKV A;  1L42 A;  3KAM A;  4MCK A;  4XEN A;  1B2K A;  5F16 A;  5KXM A;  3VW7 A;  1ZWN A;  1L41 A;  2ZIJ A;  1LZ5 A;  4H93 A;  1CUP A;  2YCY A;  1PZY A;  1IWY A;  4GP5 B;  3QE8 A;  1IP4 A;  1FDL Y;  4WG7 A;  4H1P A;  5LYT A;  1NQI A;  5I4W A;  3CSQ A;  1DYE A;  1OQM A;  1I6S A;  4H9F A;  1C68 A;  244L A;  3S3C B;  2I35 A;  3A34 A;  2X0A A;  4MQS A;  3DDL A;  2Y03 A;  221L A;  4QI1 A;  4LZT A;  3VI0 A;  5F81 A;  1ZVY B;  1L93 A;  4A4M A;  5LIN A;  1BB5 A;  1GE0 A;  1L79 A;  1KIR C;  1L50 A;  4DQ5 A;  1L64 A;  2DBT A;  3J6K A;  5JJN A;  1L66 A;  1B5Z A;  4EKS A;  1IP6 A;  1LAA A;  1QUS A;  4TUN A;  187L A;  1HEW A;  3W6A A;  5A3E A;  5II3 A;  3HAQ A;  5H2M A;  3TXK A;  2ZIY A;  1GBZ A;  3S3D B;  1HFZ A;  6LZM A;  1DI3 A;  5F9X A;  1C6A A;  3S3B B;  1VAU A;  2RH1 A;  1F6S A;  3CB7 A;  1SX2 A;  4I7O A;  2ZYP A;  3FI5 A;  5I5Q A;  4DDB A;  1CV0 A;  1IC7 Y;  4J7V A;  5KXS A;  3A93 A;  1LSE A;  2LYM A;  4N4Y B;  2H9J A;  4HYX A;  1RE2 A;  2F93 A;  129L A;  250L A;  3FI7 A;  1G0L A;  1VFB C;  1BVX A;  4WW3 A;  4NGZ A;  2HPY A;  3AM6 A;  1L20 A;  141L A;  4XTN A;  2ZNX Y;  5KXY A;  1D0K A;  4WLT A;  4PK0 A;  3K2R A;  5LVK A;  1FBB A;  5KKI A;  4TSC A;  2B6Z A;  4GCD A;  2GV0 A;  251L A;  3WVX A;  3W6F A;  1CV6 A;  4NGJ A;  1C08 C;  1F4Z A;  3OK0 A;  1CJ7 A;  3AZ7 A;  3RU5 A;  1B5U A;  4PJZ A;  1TDY A;  1KNI A;  4PPO A;  2BQK A;  2MEF A;  4H9E A;  5JEN B;  4AMI A;  4HP0 A;  4NG8 A;  4W51 A;  4YEO A;  2BQJ A;  2X72 A;  1CX6 A;  4J1A A;  3ZVQ B;  1GF3 A;  4EKR A;  3TMW A;  1IOT A;  2DQG Y;  2F47 A;  1N4F A;  3QJV B;  1P37 A;  1QHJ A;  120L A;  5KKH A;  4RLN A;  1L96 A;  1JJ1 A;  1QUG A;  4E3U A;  3RZ4 A;  1HFY A;  1QTB A;  1L34 A;  185L A;  1PQI A;  3G3W A;  1TBY A;  1LMA A;  5HLL A;  1HEL A;  1L65 A;  3G3A B;  1GAZ A;  5A8E A;  4QRY A;  2I20 A;  1EQ4 A;  3DQB A;  5KJ9 A;  1GB2 A;  4H94 A;  1ALC A;  4W57 A;  2EKS C;  3VVK A;  4H92 A;  5DM9 A;  2FBB A;  1L60 A;  4NHP A;  4GBR A;  2XBR A;  1L54 A;  3HAR A;  1JV7 A;  1QQY A;  4HJV A;  4NHQ A;  1TLA A;  1YQV Y;  2F95 A;  5F14 A;  2DQF C;  5KY1 A;  132L A;  1GD6 A;  1L07 A;  2H9K A;  107L A;  2QB0 B;  1SSW A;  1G7I C;  4DKL A;  5KXK A;  5APD A;  3IWR A;  1B7S A;  3HFM Y;  3UTW A;  1LYZ A;  4NGV A;  2O4W A;  4WLX A;  1P2R A;  4Z46 A;  1AT9 A;  4ARP A;  1L81 A;  5AWZ A;  1JV6 A;  1L29 A;  210L A;  3UON A;  1IIZ A;  1L24 A;  4LT3 A;  4IAR A;  1BGI A;  1OYU A;  1L89 A;  1XEP A;  158L A;  240L A;  4W53 A;  4ETE A;  1LMN A;  110L A;  3HAN A;  1XEI A;  1G0M A;  1OVJ A;  1SWY A;  4ANR A;  183L A;  4N4W A;  1QS5 A;  1L28 A;  134L A;  1F50 A;  3HH4 A;  4NWE A;  1QTZ A;  1G7L C;  5FHW A;  1L80 A;  246L A;  1L0M A;  1LMQ A;  2LC9 A;  144L A;  1BRR A;  4KPM A;  1LMT A;  3GUJ A;  5APC A;  5B59 A;  1L08 A;  1O0A A;  1T6H A;  3SB8 A;  1JTP L;  2KSB A;  1L37 A;  6LYT A;  227L A;  1CV5 A;  4FDY A;  5G28 A;  1FKV A;  1GUE A;  1DYF A;  1LZ1 A;  4WM1 A;  4GLA A;  1HHL A;  4XJI A;  1IY3 A;  1IO5 A;  4H9C A;  4MD2 A;  4J0L A;  1LMO A;  4GCC A;  2O79 A;  1HC0 A;  1L30 A;  4QGZ A;  1GEV A;  3SB6 A;  3HT9 A;  4C3W A;  4DDA A;  5LWE A;  4P2E A;  1L68 A;  2RSC A;  4U3X B;  1H2S A;  1LJN A;  2Z73 A;  5C6L A;  4X3B A;  2BQL A;  4IAQ A;  1IP5 A;  1GF5 A;  2Y04 A;  3E3D A;  4OOO A;  1LJI A;  1CJ6 A;  4E97 A;  4I7P A;  1BB4 A;  2M3G A;  1B9O A;  4UG2 A;  3REY A;  5HNL A;  4K5Y A;  2ZQ3 A;  2HEA A;  3HTG A;  1LYE A;  118L A;  4H8Z A;  2B70 A;  1JIS A;  1JWR A;  1FN5 A;  207L A;  4BAF A;  1C3W A;  3WU9 A;  4I7Q A;  4IAT A;  1LGW A;  2YDG A;  4HV1 A;  4DYG A;  1LZ9 A;  4DD9 A;  4ZPU A;  1LKS A;  151L A;  1HSX A;  3RT5 X;  1TN0 A;  3P68 A;  4DDC A;  1LHM A;  3HU8 A;  3SN6 R;  1IR7 A;  4G4B A;  1CU5 A;  2WJL A;  3RUN A;  2A7D A;  4BS7 A;  4LT1 A;  1OV5 A;  1QM8 A;  1REX A;  1CKC A;  2MEH A;  2Z2F A;  122L A;  197L A;  3HT7 A;  1W6Z A;  3HTD A;  3WH1 A;  1IR8 A;  1GF6 A;  1PQD A;  4KXI A;  4BEY A;  1GHL A;  1GFV A;  1G07 A;  5B05 A;  1LW9 A;  1RJC B;  5AZD A;  1D9W A;  1JSE A;  5F8U A;  3A94 A;  1BWH A;  1L17 A;  5FST A;  1C63 A;  1BRD A;  1L92 A;  3M3U A;  191L A;  2BQO A;  1C6J A;  4NWH A;  5APF A;  3MBV A;  1TAY A;  2KSY A;  4CJ2 A;  4TL3 A;  2ZYC A;  222L A;  1V7S A;  5I4Y A;  201L A;  1L01 A;  1LSN A;  4FPD A;  1L18 A;  2A7F A;  3WXT A;  1L04 A;  1WQM A;  1P64 A;  5AHZ A;  1G7J C;  1L16 A;  3AZ6 A;  1B7M A;  1R2N A;  4ETD A;  2MEE A;  1LLH A;  3TMX A;  1RFP A;  1T97 A;  226L A;  242L A;  225L A;  1LI2 A;  2CWI A;  4WMG A;  1QKP A;  5LYM A;  6LYZ A;  3FAD A;  3EO5 A;  3LN2 A;  1P8H A;  4IAP A;  4LT0 A;  3NY8 A;  167L A;  2LCB A;  5KXT A;  206L A;  4ZIX A;  5EBH A;  4HYJ A;  1GF4 A;  1E8L A;  1C62 A;  4I0C A;  1QTK A;  1LZ6 A;  1WVV A;  1CUQ A;  4H9A A;  2D4K A;  3NYA A;  5B6Z A;  1HFX A;  3WVY A;  1G0K A;  1LYY A;  1B5X A;  3VWO A;  3A96 A;  2Z38 A;  4MST A;  3ZVQ A;  4N5R A;  4X32 A;  4GLV A;  4HWL A;  3LZ2 A;  5F9U A;  157L A;  1GFE A;  1HEM A;  2Y8P A;  4L35 A;  1L99 A;  3DNA A;  4YXC A;  1UIE A;  2OU0 X;  1LYS A;  1D6Q A;  5AMY A;  1S53 A;  5AHY A;  1CJ9 A;  2I26 L;  4HJZ A;  160L A;  2B6Y A;  1B6I A;  4ARM B;  4GP4 B;  4RW2 A;  3SB7 A;  4MBS A;  4PGJ B;  2RBO A;  2HEB A;  1RCM A;  133L A;  5G2D A;  4NSJ A;  1IWT A;  2RBN A;  1DYB A;  4HTN A;  1L69 A;  3QJS B;  3X3B A;  1AT6 A;  4W96 A;  1CU2 A;  4ET8 A;  1YL1 X;  1UIH A;  1CKG A;  4LYM A;  4UHR A;  1L33 A;  2Q0M X;  4G4H A;  3TXB A;  1YAP A;  1M0M A;  3B0O A;  1QT6 A;  4DT3 A;  252L A;  5B35 A;  1C6C A;  3UTY A;  4LT2 A;  4XTL A;  1GWD A;  4I8S A;  1VED A;  4I7R A;  2C8P A;  4XN6 A;  4TWS A;  3COD A;  198L A;  1LI3 A;  4C5F A;  1DI4 A;  1JKB A;  3ODU A;  3W6E A;  1S54 A;  2Q9D A;  137L A;  1WQQ A;  1DKJ A;  2Z2E A;  4OW1 A;  2LYO A;  1LYG A;  5H2L A;  5TGZ A;  109L A;  2OTY X;  3QBL A;  4EIY A;  254L A;  1B5V A;  1L44 A;  1B7L A;  3A91 A;  1M0K A;  3DN6 A;  1IP3 A;  1IOC A;  3AYN A;  1WTH A;  1C64 A;  1IWU A;  4FJR A;  5I53 A;  5A45 A;  1L57 A;  2IHL A;  1IVM A;  1YKX X;  3C8R A;  1SLY A;  4WM4 A;  4YEN A;  3A6C Y;  2R4R A;  4PHI A;  4RW1 A;  2Z19 A;  5H2N A;  1DYA A;  4MD1 A;  4ETA A;  1D6P A;  1PY6 A;  3NSB A;  111L A;  4HTK A;  4XJD A;  1L71 A;  1JEF A;  4NHS A;  3C7Y A;  4XXJ A;  1L94 A;  1B5W A;  2MEA A;  1U19 A;  3QJU B;  1E12 A;  2ZZL A;  4H8Y A;  1D3M A;  258L A;  176L A;  2DQI Y;  1C6D A;  3CQL A;  2D6B A;  2OE9 X;  1QSQ A;  4H9H A;  1DZB X;  1GXV 2;  241L A;  1L10 A;  193L A;  2XTH A;  3G3X A;  1XME B;  1YIK A;  2D91 A;  3D3D A;  4WOA A;  3IJV A;  1T8F A;  1DYG A;  1LPI A;  1K28 A;  3CDQ A;  4RDS A;  2XQO A;  3A67 Y;  4W94 A;  1KIQ C;  164L A;  1P46 A;  1VJM A;  4BWB A;  2BPU A;  1L40 A;  1QT3 A;  1GB3 A;  3DMV A;  180L A;  5B6X A;  1LSY A;  1GE3 A;  3HBE X;  3B72 A;  1L95 A;  216L A;  4OOT A;  2HEC A;  1DYC A;  1L14 A;  1L35 A;  1C69 A;  1P2L A;  4IJ4 A;  156L A;  1LGU A;  1GPQ C;  5LYZ A;  4I7M A;  2RB0 X;  4LFP A;  2YBL A;  5FEL A;  155L A;  1LJJ A;  1LHI A;  5B07 A;  1DI5 A;  4A7D A;  2L6X A;  148L E;  3C9L A;  1L74 A;  4TX7 A;  3X3C A;  103L A;  4NC3 A;  4M4O A;  4GYC A;  3A6B Y;  5HNC A;  5KXO A;  9LYZ A;  1OUI A;  3LYO A;  7LYZ A;  1ZUR A;  2BLX A;  3M18 B;  1LZC A;  3AZ4 A;  4JR8 A;  1W08 A;  2VT4 A;  3AJN A;  4ZFP A;  1LJH A;  1C6P A;  4KLY A;  3WU8 A;  1IEE A;  1IR9 A;  3GUO A;  3A3R X;  1XGR C;  3P65 A;  3AGI A;  1GBW A;  1HSW A;  1NHE A;  1EQ5 A;  5H2H A;  140L A;  3C7Z A;  1SWZ A;  4N1C C;  3AYM A;  239L A;  1L87 A;  3T45 A;  3TXE A;  3UG9 A;  3DN2 A;  1IC4 Y;  4B49 A;  4G9S A;  231L A;  2HEF A;  3L2X A;  1X0K 1;  2BRD A;  2BQM A;  1OUE A;  1LSC A;  1L48 A;  4TTD A;  189L A;  4BVN A;  1JJ3 A;  1QDT A;  2D4I A;  1UA6 Y;  1XFP L;  1BWI A;  1L84 A;  1XGU C;  1JKC A;  5J7A A;  4L41 A;  3NS0 A;  4XYY A;  1PXR A;  1KIP C;  4QID A;  123L A;  150L A;  4ARQ B;  3S8F B;  4QY9 A;  175L A;  1EQE A;  4BAP A;  1NWG A;  5L9J A;  5M1Y A;  1XJU A;  4DQ7 A;  1BB3 A;  1KXY A;  1QUT A;  2YBI A;  1LSZ A;  4WO6 A;  2YDV A;  1L26 A;  2H5Z A;  3LZM A;  171L A;  3DN3 A;  3P0G A;  1PQK A;  1F0W A;  190L A;  1G7M C;  5H2P A;  1C6E A;  2XJW A;  2YCX A;  1JHL A;  1YAQ A;  3C8Q A;  5ITC A;  2Z18 A;  4WL6 A;  1IWW A;  1LGX A;  4TSB A;  3OE8 A;  4ARM A;  253L A;  4JQ6 A;  1UID A;  169L A;  1GE4 A;  3RZE A;  4X31 A;  5G2C A;  1GBX A;  1NDM C;  4DD0 A;  2BLY A;  1L63 A;  215L A;  5LAG A;  1QTH A;  3HT8 A;  1LPY A;  5H2K A;  1DPW A;  3HAS A;  5B06 A;  1L9H A;  1QUH A;  1OVK A;  4DD7 A;  5DL9 A;  2B5Z A;  1GF0 A;  4I7T A;  4W58 A;  3WQJ A;  3A90 A;  2I6Z A;  3QNG A;  4UWU A;  1FBI X;  224L A;  2JAF A;  1GDW A;  3B0I A;  1XGP C;  1GF8 A;  138L A;  1DKK A;  1FLY A;  1L22 A;  4N0J A;  3T36 A;  2Y00 A;  1VDS A;  4YOP A;  1QTV A;  3WPL A;  234L A;  2BQI A;  149L A;  2BQA A;  3BKH A;  1JIT A;  5DN4 A;  3EBA B;  4O34 A;  3TXJ A;  3A7K A;  2LZ2 A;  1C6I A;  4LFX A;  3C80 A;  4H90 A;  3UZC A;  1QUD A;  1CU0 A;  5ITE A;  5JJE A;  3DMZ A;  4S0W A;  4H9B A;  3W6D A;  4B1A A;  1P3N A;  245L A;  1GFT A;  2Z12 A;  1C10 A;  1C8S A;  2HEE A;  1GXX A;  4B0D A;  3QDC A;  1B0D A;  2ZIL A;  4DD1 A;  4DQJ A;  261L A;  3KJ6 A;  3VHZ A;  1L36 A;  1GFK A;  4XTO A;  2MED A;  5D5F A;  5B2N A;  1L70 A;  3HUA A;  1LKR A;  5A44 A;  1JTM A;  3HBD A;  4ET9 A;  3COC A;  3LHM A;  174L A;  4WO9 A;  2B6W A;  1L12 A;  3WU7 A;  2G4Q A;  1VGO A;  2QAR C;  1A2Y C;  1VDT A;  2CUU A;  4HPE A;  2KSA A;  4GP8 B;  4XT1 A;  5LXW A;  1KY1 A;  3AW7 A;  1OUH A;  4EOF A;  1LJ3 A;  1IOS A;  4BV0 A;  1L32 A;  1L91 A;  1OV7 A;  2IGC A;  1H6M A;  1LJ4 A;  184L A;  1FKQ A;  2B6X A;  1LZE A;  4R0F A;  213L A;  1LYI A;  3LZT A;  2QPE B;  5B0W A;  1QSA A;  1L23 A;  1D0M A;  229L A;  1QKO A;  4D9Z A;  4G7R B;  3C81 A;  4II8 A;  2F32 A;  4LDL A;  2LNL A;  1OP9 B;  4ETC A;  1P8U A;  5LA5 A;  3DN1 A;  1BM1 A;  1CNS A;  1REY A;  5T3F A;  1FBK A;  1L72 A;  1QTC A;  2PED A;  3QBK A;  2BQE A;  4G7Q B;  1L88 A;  3FA0 A;  1MGY A;  1LSM A;  1PQM A;  3QBG A;  3WUL A;  2I25 L;  4WLD A;  1L52 A;  1B7O A;  2LYZ A;  3DKE X;  1GB0 A;  1LHK A;  2NTG A;  3CT5 A;  196L A;  1L82 A;  1CJ8 A;  4GCF A;  3G3V A;  2JAG A;  1C6L A;  4FBZ A;  4OWA A;  2ZNW Y;  3GUN A;  1BB6 A;  4CFO A;  1ZYT A;  4N8Z A;  5BR5 A;  1PQJ A;  1LWK A;  3DN8 A;  1TEW A;  2MEC A;  4EMN A;  1C6M A;  1LSB A;  1LZN A;  2OTZ X;  2OU8 A;  1WQN A;  4ZEE A;  192L A;  1LZA A;  2Z55 A;  2CJL A;  188L A;  1KGB A;  1D9U A;  3B6L A;  1HEQ A;  2OE4 X;  2LHM A;  4GN3 A;  1QT4 A;  4CFP A;  3V2Y A;  1L25 A;  3WUN A;  2YDO A;  1EL1 A;  1UIA A;  3GXR A;  1A4V A;  1G7H C;  5KXW A;  3OE6 A;  1LSD A;  3HTF A;  4YF2 A;  4ML7 A;  1XSF A;  142L A;  4M6D A;  3HDF A;  3C7W A;  1LZS A;  4XT3 A;  1TN5 A;  119L A;  219L A;  1D2W A;  220L A;  4J1B A;  1V7T A;  5B6V A;  4I7K A;  1XGQ C;  5KXP A;  1UCQ A;  3WUM A;  3PDS A;  1D3F A;  1LJK A;  5C6J A;  3OAX A;  3HUQ A;  1JPO A;  1IW6 A;  2EPE A;  257L A;  4G71 B;  5E4P A;  1T8G A;  4WL7 A;  5ETZ A;  1F88 A;  4IB4 A;  1LN6 A;  1LSF A;  3TXF A;  2R4S A;  1L02 A;  1GE2 A;  1UCO A;  2DQC Y;  1NMM A;  4NGL A;  2YCZ A;  172L A;  1P8I A;  4OO9 A;  3HT6 A;  4UWN A;  1C6T A;  4HPI A;  1CU3 A;  1KG8 A;  4WM3 A;  5HMV A;  1L0K A;  5A3Z A;  3J4G A;  4Z98 A;  1GF9 A;  5DYS A;  4KL7 A;  1L43 A;  4LYT A;  5K7O A;  4WLY A;  3F8V A;  163L A;  4GRV A;  1L67 A;  1GBO A;  1L09 A;  1P2C C;  3AGH A;  2B73 A;  259L A;  1H68 A;  3FE0 A;  1LZB A;  4ARQ A;  3WUA A;  2RAZ X;  3HWL A;  4UWV A;  3ABW A;  3AYQ A;  2W1X A;  1OUJ A;  4BAD A;  3TXD A;  1C8R A;  4LYZ A;  1L03 A;  1I56 A;  5JJJ A;  1DZE A;  1XEJ A;  1LSP A;  4AQN A;  3TXH A;  2W1Y A;  4FA7 B;  1VAT A;  3C83 A;  5LVI A;  1JQU A;  4W56 A;  1LMC A;  3HAP A;  3EXD A;  1QUO A;  3QAP A;  113L A;  3WL2 A;  4G70 B;  182L A;  2I21 A;  4OV0 A;  162L A;  2BAA A;  1GB5 A;  1VDP A;  3UTV A;  1L21 A;  3ZEV A;  1IY4 A;  5EN0 A;  5LVJ A;  1OVH A;  3EMS A;  2BQC A;  1AT5 A;  1L46 A;  4NGK A;  4I7S A;  199L A;  1BB7 A;  1BRX A;  1QS9 A;  2MEI A;  5KXX A;  3PWH A;  5KKJ A;  1LHL A;  1GF7 A;  3SB5 A;  4PXF A;  1BVK C;  4LYO A;  1GAY A;  1LYO A;  1JIY A;  2YBM A;  4LYB A;  125L A;  2B72 A;  3WMK A;  3SBB C;  1UIB A;  3D9A C;  3CAP A;  4NIJ A;  1LMP A;  1J1P Y;  5FCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...