4DAJA

Structure of the m3 muscarinic acetylcholine receptor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
432
structure length
429
Chain Sequence
IWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, hydrolase
molecule keywords Muscarinic acetylcholine receptor M3, Lysozyme
publication title Structure and dynamics of the M3 muscarinic acetylcholine receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 159
structure length 429
sequence length 432
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4dajA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4dajA01
1LYGA 2X72A 4W54A 2RBOA 161LA 1P37A 196LA 2KSBA 1C61A 1JFPA 1L10A 4W55A 209LA 112LA 1QSBA 3FADA 1P2RA 4EKRA 3A7KA 2HUMA 4AMJA 1OVJA 1L73A 1L27A 126LA 142LA 1L0JA 4EKSA 1Q5IA 4JR8A 1L67A 5AZDA 3GUPA 1P64A 5B34A 140LA 1D3NA 168LA 1LPYA 1LWKA 3X3CA 129LA 127LA 166LA 3DMZA 1S8LA 1LYIA 3ODUA 228LA 3RUNA 5I14A 2OTYX 2F95A 4X1HA 4ARPA 1L30A 1PXSA 4YXCA 1L53A 3C80A 1S51A 151LA 246LA 4OO9A 3F8VA 156LA 199LA 1SX7A 1T8GA 1BRDA 1CU3A 1G1VA 2RAZX 3MBVA 3HAPA 1C67A 5H2MA 1QUDA 4EA3A 3CODA 5JJNA 4EKPA 191LA 4ARQA 4Y9HA 3REYA 1TN5A 2Z73A 4G70B 3V2WA 4FBZA 1L01A 3HH4A 4W58A 3DN8A 2OU0X 3HAQA 1JQUA 3C82A 4DJHA 1LI6A 211LA 3S8GB 4IAPA 3D4SA 238LA 1QTBA 257LA 3C8RA 4YX7C 122LA 2Q9DA 167LA 1LGWA 3HU9A 1LGUA 4HYJA 160LA 2RH1A 1G0LA 1OWZA 1G0JA 1L18A 1CU5A 4LZMA 1QT8A 3GUNA 1CV1A 169LA 115LA 1LYEA 1P5CA 1LI3A 1QT4A 237LA 5J7AA 5H2PA 1I6SA 1NHBA 1XEPA 3DNAA 128LA 2RB2X 125LA 1JTNA 1SSWA 3HUKA 1QT7A 3C83A 3UZCA 4ZPUA 138LA 4W51A 1L13A 159LA 1AP9A 3SB5A 5H2IA 4IARA 4XXJA 255LA 5H2NA 3PQRA 1UAZA 1SX2A 5AX1A 2B73A 3RFMA 1CV4A 1P2LA 1PQOA 1PXRA 3ZEVA 2YCYA 1OYUA 234LA 3HT7A 1QUGA 2JAGA 1QS5A 172LA 1L52A 1LW9A 4N4WA 4QIDA 2Q9EA 2EI4A 2HUKA 1C6PA 1L19A 1L95A 1XJUA 4GBRA 4L6RA 4E97A 4QRYA 4MQSA 173LA 1KY0A 3C7WA 5H2OA 1L79A 5G36A 240LA 170LA 1L26A 1L61A 5F8UA 1L34A 2LZMA 3G3XA 2O79A 3K2RA 2NTUA 1L24A 251LA 3QAPA 1CUPA 1P8UA 224LA 4W53A 1L96A 3HARA 3CDOA 2I21A 5EN0A 1KW5A 2J4YA 3QJRB 1QSQA 3BVDB 1LYJA 4X31A 4PXKA 2ZZLA 4W56A 5A8EA 1L38A 1L89A 1L07A 3GULA 1O0AA 147LA 1KS3A 1C6LA 1L65A 1L93A 2A4TA 4ARQB 2OEAX 3F9LA 1C6DA 1OV7A 144LA 3HH5A 3C8QA 1CU0A 1G0MA 1L57A 4MD2A 259LA 3GUJA 1C6JA 5JJJA 1L63A 2HULA 1M0MA 1LI2A 158LA 1C6KA 1L94A 1P8IA 2OE9X 1L87A 1KMEA 183LA 184LA 1L03A 1BM1A 262LA 4I7PA 3HDFA 1KW7A 5B6XA 1KY1A 249LA 2KSAA 1UCQA 1QS9A 3OE9A 123LA 2YCZA 2AT9A 145LA 3OE0A 4L35A 4QI1A 4XTLA 2O4WA 5H2JA 4IAQA 1L47A 3QBIA 247LA 1L44A 253LA 5ETZA 3VI0A 1X0I1 1L0MA 3CDVA 1CU2A 5DHHA 1QUOA 3UTVA 243LA 2RAYX 198LA 3C8SA 241LA 4XTNA 1C69A 201LA 3DN0A 1L23A 218LA 2Y04A 3SB6A 3UTYA 1L56A 230LA 1C60A 219LA 1IW9A 222LA 1QTDA 4MQTA 1L51A 4PK0A 1C8SA 4G7SB 4HYXA 1DYDA 5ITCA 108LA 1L60A 1ZYTA 2WJKA 5G28A 1L54A 1L31A 3WQJA 3VHZA 4XTOA 3C7YA 1F88A 227LA 120LA 1G06A 149LA 4MBSA 3ZPQA 1QM8A 4AMIA 4IB4A 5H2KA 1L80A 3UTWA 4W59A 1IXFA 254LA 1PY6A 1QHJA 1P8HA 217LA 1CV5A 1L46A 4LDLA 1D2WA 1L35A 1D2YA 1SSYA 1C6FA 225LA 3HTBA 1QKPA 4NC3A 1M0LA 165LA 3GUIA 1EPYA 1JTMA 1L22A 1P56A 3QAKA 1X0SA 3HDEA 4EJ4A 1D3JA 1QT6A 5B35A 1LLHA 3C9MA 3QBGA 3SBAA 3G3WA 1QTVA 1C6GA 1L20A 3S3CB 3G3VA 113LA 4FAAB 1C68A 118LA 1L77A 3CDRA 2NTGA 236LA 1B6IA 1L97A 2I20A 1L00A 1L68A 5B6ZA 1L75A 1L16A 1DZEA 232LA 3LZMA 1JV7A 2YDVA 1EHKB 1L50A 3HUQA 1L14A 3C81A 2JAFA 3EMLA 131LA 3HANA 3VGAA 1C6QA 1L28A 3QJVB 1GUEA 4YXAC 2KSYA 102LA 4JKVA 1L76A 1C3WA 1XIOA 3JR6A 2R4RA 1L41A 1L90A 200LA 3OAXA 233LA 1BRRA 1KGBA 5H2LA 1C6NA 1R2NA 3PBLA 1L45A 1LYHA 1DYEA 4DKLA 1P36A 3EH3B 7LZMA 155LA 1L40A 2IGCA 4GYCA 3SN6R 4DAJA 1L98A 2F2QA 2L78A 3EH4B 2QPDB 1L21A 1L37A 3QJSB 2B6TA 188LA 2LCBA 5ITEA 4BV0A 242LA 3L64A 3NY9A 3S3BB 1L71A 163LA 3QJUB 1WTHA 1LYDA 3DN6A 1T8FA 1JV6A 2NTHA 185LA 260LA 197LA 1L84A 2B70A 1S53A 1F50A 1XJIA 3HUAA 3PDSA 1CX6A 1L05A 231LA 2B7XA 1TN0A 2QPEB 3HH3A 2OE7X 3UG9A 4BEZA 1C6TA 3VW7A 1QTZA 2O7AA 3DN2A 1L82A 1L36A 1HZXA 2QARC 4EPIA 1DYBA 3VVKA 4ARLA 5AX0A 2B6XA 1R84A 4G7QB 1K28A 1L12A 3HTFA 107LA 176LA 2QB0B 1L48A 235LA 189LA 2Y01A 1L86A 2OU9A 4I7OA 1LYFA 2R4SA 1CUQA 4EIYA 2F32A 1C8RA 2YDOA 1L88A 5B6VA 4G71B 1L29A 2B6ZA 2RB1X 3COCA 1OVKA 4A4MA 190LA 2YCWA 4I7RA 2M3GA 1F4ZA 3HASA 2Z6BA 4I7TA 4UHRA 1SWYA 187LA 3NS0A 3S8FB 5FJGA 3T45A 3DMVA 143LA 2LNLA 258LA 3DDLA 171LA 4W52A 1CV3A 1L74A 1H2SA 205LA 3GUKA 2RBSA 5BR5A 1L9HA 3VG9A 3L2XA 1L58A 4XT1A 1C6IA 252LA 141LA 3UTXA 1DYAA 3RZEA 1S52A 1L06A 4K5YA 4JQ6A 1PQKA 5DHGA 214LA 1CU6A 2Z55A 4FPDA 3GUOA 3ABWA 1QT3A 1G1WA 256LA 3UONA 1JGJA 3SBBC 1TLAA 1C64A 175LA 3AYMA 3EH5B 4WAVA 139LA 3DN4A 1C62A 1L02A 4N6HA 3DQBA 1X0K1 178LA 213LA 1L49A 4LDEA 2Y00A 2B6YA 1CTWA 195LA 1M0KA 2B72A 2RB0X 245LA 137LA 4I7SA 1S8JA 4GRVA 5LZMA 4AQNA 4BWBA 3P0GA 2ZIYA 1KNIA 5G2AA 1L85A 2ANVA 3C7ZA 1C65A 1LN6A 2WJLA 3QBLA 5AHZA 1P46A 4FA7B 1Q5JA 1C6CA 5C1MA 3QDCA 4I7MA 3SB8A 248LA 4I7QA 3S3DB 1GZMA 4ARMB 3ZPRA 3AYNA 1L43A 1L42A 4X32A 1LWGA 1PQDA 1QUHA 250LA 2G87A 2RBNA 1GU8A 1L08A 1VJMA 1G07A 2YCXA 1PQMA 1DYFA 3DN3A 4GP8B 4BUOA 5JJEA 2NTWA 4I7JA 3HAOA 4WW3A 2B6WA 226LA 3DKEX 180LA 1DYGA 1QTCA 1L11A 2LC9A 4EXMA 4S0WA 4BVNA 1L33A 5G54A 1C6AA 1P7SA 3SB7A 1E0PA 1OVHA 2F47A 2RBRA 4I7LA 1VGOA 3C9LA 3PWHA 174LA 2OTZX 3OE6A 5TGZA 1C63A 3NY8A 1L70A 1L91A 111LA 1T8AA 130LA 1G0KA 146LA 186LA 1C6HA 3QJTB 1L55A 1CV0A 1L83A 4N4YB 1OWYA 162LA 3DMXA 3HWLA 1D3MA 1L32A 4PXFA 223LA 1L09A 1FBBA 4OV0A 221LA 3FA0A 119LA 4GPOA 3FI5A 3HH6A 3HU8A 4EKQA 2KS9A 3GUMA 4I7NA 2Y02A 2VT4A 5G2DA 1C6BA 4GP4B 2HPYA 1CV6A 1C6EA 1PQIA 150LA 1G0GA 1L25A 1BRXA 1C66A 5A45A 3HTDA 1FBKA 5B6WA 4MD1A 1L59A 1T97A 192LA 2ANXA 1S54A 2ZFEA 1CWQA 3UZAA 2RBPA 1IW6A 5AWZA 1P6YA 4KLYA 210LA 3QJQB 157LA 1D3FA 1KG8A 3HTGA 1PQJA 4ARMA 1XMEB 3DN1A 261LA 181LA 3HT8A 3CAPA 5DYSA 5G2CA 2B75A 244LA 4KNFA 3X3BA 1L69A 4GBRB 2OE4X 4G7RB 110LA 3CDTA 5B0WA 212LA 3OE8A 1L99A 1SWZA 1L81A 6LZMA 5BR2A 1QTHA 104LA 1KG9A 1L66A 1ZURA 1ZWNA 1OV5A 5G53A 3V2YA 177LA 3CDQA 5B6YA 4XT3A 4BEYA 4EPFA 1QKOA 2Y03A 1T6HA 1L17A 1XJTA 1G0QA 4PJZA 3PXOA 1AT9A 182LA 114LA 4TL3A 2B74A 3NYAA 1MGYA 3QBKA 5H2HA 4I7KA 4J4QA 1H68A 164LA 1L15A 4W57A 1E12A 2OU8A 109LA 1L72A 5KKHA 3HT9A 4HWLA 1U19A 1L39A 2BRDA 148LE 1C6MA 4GP5B 4UG2A 5B2NA 1L0KA 1L04A 229LA 1DYCA 3HT6A 1D9WA 3AM6A 1G0PA 215LA 239LA 2I1XA 206LA 1QT5A 2RBQA 4LDOA 2L6XA 2I35A 2PEDA 3NSBA 4G72B 1P3NA 1L92A 2F93A 4ARJA 5AHYA 5LWEA 103LA 152LA 1CVKA 1LGXA 5A44A 1L62A 3KJ6A 2CUUA 1L64A 216LA 220LA 1CX7A 3SB9A
chains in the Genus database with same CATH superfamily
2W1YA 1IWZA 4E3UA 161LA 4H1PA 1JFPA 1BWHA 1GB9A 3A90A 1IOCA 4AMJA 4NGIA 3TXGA 4GN3A 4H8YA 4CFPA 3X3CA 5B34A 1QSAA 1LWKA 1JTTL 4W96A 1HFYA 3DMZA 5I14A 1B5YA 1PXSA 3C80A 2NWDX 156LA 3AGIA 1C67A 2Z38A 4EA3A 191LA 4Y9HA 3A94A 1QTKA 2Z12A 1L01A 4H9BA 1YKYX 4H92A 4DJHA 4RLNA 2LYZA 3D4SA 238LA 1GFHA 3C8RA 4CGEA 167LA 1IX0A 4HYJA 1OWZA 1L18A 4WLTA 3CSZA 1LHKA 4LZMA 5J7CA 1LYEA 237LA 5J7AA 1AKIA 1I20A 5H2PA 1I6SA 3DNAA 1FKQA 3HUKA 1JTOL 4ZPUA 1GEZA 5I5QA 1AP9A 2CWIA 5H2IA 4LYMA 1LJGA 4OWAA 3PQRA 3RFMA 1CV4A 2Z2EA 1GEVA 1XGRC 2MEAA 5KXPA 4N4WA 3CSRA 1TBYA 2HUKA 1C6PA 1XJUA 2EI4A 4E97A 173LA 4OOTA 1L79A 3LZTA 3CT1A 240LA 3WUNA 1RCMA 1L34A 4M4OA 1LSNA 4N1CC 251LA 1CJ9A 224LA 1KW5A 1V7SA 4PXKA 4KL7A 5A8EA 3GULA 1GB6A 1L93A 2A4TA 1NHEA 3F9LA 1XGTC 144LA 1L57A 2DQGY 1OUHA 2HULA 4N0JA 3AB6A 3AJNA 3LYMA 5KXNA 184LA 1L03A 1IEEA 3WULA 1KW7A 1UA6Y 2KSAA 1GBOA 3AZ6A 1OUEA 4XTLA 4NSHA 3P65A 4IAQA 4C5FA 2YBLA 1GFKA 3QBIA 3TXHA 247LA 1L44A 5ETZA 1IWWA 1CU2A 4P2EA 1OUGA 243LA 2I26L 4XTNA 1L23A 5D5CA 2Y04A 1CJ6A 222LA 1B5VA 4PK0A 5F9UA 5K7OA 5ITCA 5FHWA 1L60A 3TXEA 2DQAA 1BWJA 2HEEA 3A8ZA 1YKZX 1LSAA 5HMVA 4AMIA 133LA 5H2KA 1L80A 3UTWA 3CT5A 1VFBC 1D2WA 1C6FA 4NC3A 1L22A 3QAKA 1X0SA 5B59A 2W1XA 1HEQA 3C9MA 1LAAA 113LA 1OQMA 2G4QA 4FAAB 1C68A 2NTGA 1B7PA 1REMA 1L68A 5B6ZA 2YBIA 1EHKB 1GFUA 1IVMA 131LA 2D4KA 5KXMA 1LJJA 1C6QA 3QJVB 1IP4A 102LA 3G3BB 4NG1A 5DN4A 1LMPA 3OK0A 1XIOA 3JR6A 3OAXA 1BRRA 1QTEA 3PBLA 2HECA 4DC4A 7LZMA 1L98A 2BQNA 4RW2A 1PZYA 2QPDB 1L21A 8LYZA 2ZYPA 1HSWA 2LCBA 5ITEA 242LA 1L71A 2W1LA 3DN6A 260LA 1L84A 2B70A 4HTKA 1F50A 1XJIA 3HUAA 1TN0A 1JSFA 1PS5A 1C6TA 5I4WA 2Z2FA 2O7AA 1L82A 1L36A 1YIKA 5AX0A 1R84A 4GCCA 5LVJA 1K28A 2QB0B 2EKSC 1L88A 2MEBA 3AZ7A 2RB1X 1NBZC 190LA 4IASA 1QSWA 2PC2A 4I7RA 4NG8A 2ZYCA 3HASA 2Z6BA 4I7TA 187LA 5FJGA 4DD0A 3DDLA 171LA 2DQDY 2RBSA 3L2XA 4LFPA 5KXLA 141LA 3UTXA 1LSZA 4UWVA 3RZEA 1LJIA 1PQKA 4FPDA 3UONA 1JGJA 3EH5B 1JJ1A 1TLAA 175LA 3AYMA 4WAVA 139LA 5LA8A 178LA 3K3TA 1JKBA 4Z46A 2B6YA 1WVUA 195LA 4LYOA 4I7SA 4IJ4A 2D91A 4WO9A 4AQNA 3B6LA 1P46A 1Q5JA 5C1MA 135LA 248LA 4I7QA 1L42A 4X32A 2G87A 1GU8A 2YCXA 5JJEA 4I7JA 3HAOA 226LA 4EXMA 4DDCA 1QTCA 1L33A 4WG1A 1P7SA 2BPUA 1E0PA 4NEBA 1XGUC 4NSIA 2EPEA 4I7LA 1VGOA 2OTZX 3OE6A 1L70A 1FLUA 3ATOA 5HMJA 2FBDA 186LA 4PGJB 1CV0A 1L83A 1T3PA 1HFXA 1DI4A 5II3A 5LA5A 1D3MA 4G4CA 5ILFA 4XJFA 3TXIA 119LA 4GPOA 3FI5A 3HH6A 5DLAA 4EKQA 5L3IA 3GUMA 2MEFA 4WL7A 1TCYA 1IWTA 1J1XY 2ZNWY 2Z39A 4MD1A 1L59A 3UZAA 1GF4A 4ETAA 2ZFEA 4FDYA 1XEJA 1IW6A 4C3WA 5AWZA 1LJFA 4J1BA 157LA 3QJQB 1GB5A 2CDSA 3HTGA 4ARMA 4TSBA 4NWEA 181LA 5DYSA 4NY5A 5HNLA 3QNGA 4KNFA 4G7RB 3OE8A 4LYBA 1L81A 3A92A 4J0LA 5G53A 1LMOA 3V2YA 1BVKC 5B6YA 4YF2A 1SLYA 1XJTA 3PXOA 4H94A 1C43A 1IY4A 1YAQA 1D6PA 4EOFA 3NYAA 3QBKA 5H2HA 4DS7E 4J4QA 1HC0A 5B06A 2OU8A 4RLMA 1LYSA 2YBJA 3RNXA 5B1FA 1C6MA 4UG2A 5B2NA 1L04A 3A91A 1INUA 1G0PA 1OUAA 2I6ZA 4ARJA 4PPOA 1HEPA 1JIYA 5A44A 4NHPA 1WQRA 5A3EA 1CX7A 1C7PA 2X72A 4W54A 5LAFA 2BQMA 4W55A 209LA 4ZEEA 1QSBA 3FADA 1P2RA 1VATA 1QDRA 1HEOA 4G4BA 142LA 1L0JA 4EKSA 4JR8A 1LPYA 1D3NA 4WM3A 129LA 127LA 166LA 1LYIA 2W1MA 2OTYX 5LXWA 4LT2A 1S51A 151LA 246LA 1QUTA 4OO9A 4YM8A 4GBRA 1B7RA 1LZ5A 3HAPA 1LZEA 1BB4A 3AGGG 5JJNA 3REYA 3V2WA 4FBZA 3HH4A 4W58A 3HAQA 211LA 4IAPA 4NGVA 257LA 4G4HA 4YX7C 5B05A 1FDLY 3HU9A 1B7QA 2BLXA 1LGUA 1IC5Y 1G0JA 4YENA 4I8SA 1KXWA 5T3FA 169LA 115LA 4LYCA 1QT4A 1GF6A 1LTMA 3WUAA 125LA 194LA 1QT7A 3C83A 3UZCA 1VEDA 2HEFA 1AM7A 3SB5A 4ZIXA 5B07A 5AX1A 4WM4A 1PXRA 2YCYA 3HT7A 3T36A 3N9AA 172LA 1LW9A 1L95A 4QRYA 3A3RX 1L26A 5F8UA 3QE8A 2NTUA 2O79A 2Z18A 132LA 1UIEA 1L96A 4W94A 2I21A 5L3HA 3QJRB 3P4ZA 3ZVQB 5JENB 3J6KA 4D9ZA 1L38A 1DQJC 147LA 4ARQB 3C8QA 259LA 4PJ2C 1M0MA 5AMYA 2OE9X 1L87A 5LIOA 1GAZA 4HJZA 183LA 262LA 4ML7A 1GB7A 3A6BY 3HDFA 1GF0A 1E8LA 1KY1A 4N8ZA 3W6AA 1BB6A 3WYHA 1QS9A 3A6CY 4QGZA 123LA 1F6RA 2AT9A 4QI1A 5H2JA 2LYOA 1WQNA 3WVYA 3VI0A 2CGIA 1BB3A 3CDVA 2LZTA 1V7TA 1IY3A 2F30A 1C69A 1O23A 201LA 218LA 3SB6A 5LVHA 230LA 5C6JA 1LZSA 4GN5C 1LSDA 4HYXA 4H8ZA 108LA 4B4IA 4H9FA 4H8XA 3VHZA 4XTOA 3P68A 5KXOA 1G06A 1H87A 4DT3A 4IB4A 2I25L 4B49A 1IXFA 254LA 3A93A 1CV5A 4LDLA 1LSGA 4TX7A 2H9JA 165LA 1GBZA 1EPYA 3HDEA 4EJ4A 3P66A 2EQLA 1GF3A 5APDA 1LLHA 3EBAB 3G3WA 3AYQA 1C6GA 4XJGA 2DQCY 5LYTA 3W6FA 2I20A 1GF7A 1L00A 1GBYA 1L16A 3LYOA 1L50A 4GLAA 3HUQA 3C81A 3HANA 3VGAA 1GDWA 1L28A 4JKVA 1NF5A 1IP2A 4WM1A 1L90A 200LA 233LA 1R2NA 3A96A 1JEFA 4PHIA 4WLXA 1DYEA 4DQ5A 1IP6A 4DKLA 1P36A 3EH3B 2L78A 4YEOA 1IP3A 5DN5A 1LMNA 2B6TA 1EQ5A 6LYTA 3L64A 4J7VA 3QJUB 1WTHA 1LYDA 1IR8A 185LA 1EQEA 1S53A 4NGOA 4DQJA 1CX6A 1KIPC 1L05A 231LA 2QPEB 2OE7X 2Z19A 4BEZA 1YAOA 1HFZA 4J1AA 4A7DA 5I4YA 1DYBA 4ARLA 2IHLA 2B6XA 3TXDA 1L12A 4DD2A 1TAYA 3HTFA 1JKAA 189LA 2Y01A 1LYFA 1CUQA 4EIYA 2YDOA 4NWHA 4G71B 3COCA 3J4GA 5HLLA 3B0IA 4NGLA 4GCBA 4DDAA 1F4ZA 1LHLA 4UHRA 1SWYA 3T45A 3DMVA 143LA 4G49A 3TXKA 4W52A 1CV3A 5KXYA 3W6BA 5BR5A 4TSCA 1L9HA 1L58A 1LMTA 3CB7A 252LA 2BQAA 1HEMA 1S52A 4K5YA 5DHGA 214LA 1CU6A 1IR9A 3GUOA 1G1WA 2D4JA 3N9EA 3SBBC 1C64A 3DN4A 4ETDA 4KXIA 1GD6A 3DQBA 4RDSA 213LA 4LDEA 3RW8A 1G7LC 1LJ3A 1REXA 2B72A 245LA 137LA 4GRVA 3P0GA 1GBWA 1GFVA 1WQMA 1BHZA 1LN6A 5AHZA 3QBLA 1IOTA 1H6MA 3SB8A 1GZMA 4ARMB 3ZPRA 3AYNA 1L43A 4B4EA 4Z3MA 3OJPA 1DPWA 1LWGA 2RBNA 1VJMA 4TTDA 1UIHA 3BKVA 1LYOA 1JSEA 3DKEX 4ZFPA 180LA 1DYGA 3EO5A 2LC9A 1UIDA 4S0WA 3IJUA 1C6AA 3SB7A 1OVHA 1B7OA 2F47A 1C46A 3C9LA 1LJ4A 3PWHA 4XJDA 3NY8A 111LA 5E4PA 4GCDA 4NHQA 5I53A 1OWYA 1DI3A 4WMGA 4HSFA 223LA 1HELA 1L09A 1FBBA 221LA 1UIAA 4H9IA 4I7NA 1C6BA 5KKIA 1OUFA 2DQIY 4I0CA 5LVKA 1JTPL 4WLDA 1YL0X 5B6WA 1G7IC 1B5UA 1FLWA 1YQVY 1N4FA 1S54A 1CWQA 3EMSA 1LSFA 1RFPA 1P6YA 1WQQA 210LA 5F9XA 2Z37A 1XMEB 1GB8A 261LA 1LHIA 5G2CA 3CAPA 3X3BA 4GBRB 2OE4X 1WTNA 1HHLA 1GF5A 6LZMA 5BR2A 4GCFA 104LA 1KG9A 1L66A 1OV5A 4XT3A 1QKOA 3CT0A 2B74A 1MGYA 5APEA 1L15A 4W57A 2CJLA 1E12A 2C8OA 3W3EA 5KXWA 4HWLA 2A7DA 1L39A 2BRDA 3WU8A 229LA 1HERA 1YAPA 3AM6A 2D6BA 2I1XA 206LA 4LDOA 2RBQA 2L6XA 1LCNA 1CVKA 3KJ6A 3CQLA 3WPKA 220LA 1LYGA 2RBOA 1P37A 3HBEX 5IDDA 1C61A 2KSBA 1L10A 4EKRA 1OVJA 1L27A 126LA 1L67A 3GUPA 1ZVYB 140LA 3LN2A 3BKHA 3RUNA 4GN4A 2F95A 1GFGA 4ARPA 4YXCA 1L53A 3F8VA 3MBVA 3FI7A 5H2MA 1QUDA 3CODA 3AW6A 1TN5A 4G70B 5F16A 4MCKA 1B9OA 2OU0X 2XTHA 1JQUA 3C82A 4UWNA 1W6ZA 1QDTA 1QTBA 2ZQ3A 122LA 5HNCA 2Q9DA 1LMAA 1GPQC 4WM2A 207LA 160LA 4XJIA 1G0LA 1IR7A 4BAPA 4NHIA 1CU5A 1CNSA 1CV1A 1LI3A 4WOAA 1LOZA 1SSWA 3TMVA 4W51A 4NSJA 2VB1A 1KIQC 2YBHA 3FE0A 4XXJA 2MEIA 1GFJA 1SX2A 1UAZA 1PQOA 1P2LA 2A7FA 1OYUA 234LA 1QUGA 2JAGA 4QIDA 1L52A 1FLQA 1NWGA 5KKJA 4MQSA 1KY0A 3C7WA 5G36A 1B5WA 1JISA 2LZMA 3G3XA 3K2RA 1L24A 4OWCA 1KXXA 1CUPA 1P8UA 2J4YA 3BVDB 1UCOA 2XJWA 4BAFA 4X31A 2ZZLA 3RT5X 1L07A 1O0AA 2ZIKA 1C6LA 1JWRA 1L65A 1NDGC 2HEBA 1C6DA 1OV7A 3HH5A 4MD2A 5KXSA 1C6JA 5JJJA 1LI2A 1C6KA 1F0WA 1UIBA 1P8IA 4XJHA 3AW7A 1BM1A 4I7PA 3ATNA 4ANRA 5B6XA 1XEIA 4QDNA 1LZCA 154LA 1VDSA 1GB0A 3CSQA 145LA 2O4WA 1L47A 1BB5A 1CKHA 253LA 3B0OA 3WMKA 1X0I1 1D9UA 1L0MA 1GE1A 5FCPA 198LA 1CKDA 4DD7A 3E3DA 3TMUA 1C60A 219LA 5LINA 4MQTA 1IC7Y 1C8SA 1BGIA 4G7SB 1NBYC 2HEAA 1ZYTA 1L54A 1L31A 4NGJA 1UIFA 4H9CA 1B7NA 4MBSA 1J1PY 1QM8A 4HTNA 4W59A 1QHJA 1P8HA 217LA 1L46A 1L35A 5B0WA 1D2YA 1MLCE 3HTBA 1M0LA 1VAUA 4NHSA 1JTMA 1QIOA 4HPEA 1LZGA 1LJNA 4OWEA 3SBAA 2ZWBA 2XQOA 1L20A 3S3CB 2BQOA 3G3VA 4N9RA 4LT0A 1JKDA 1WTMA 4QY9A 3AZ5A 4DQ7A 1L77A 3CDRA 236LA 1L97A 3AGHA 208LA 5LYMA 1F6SA 232LA 2DKVA 3LZMA 1JV7A 2F2NA 4HTQA 2BQIA 1L14A 3EMLA 2X0AA 4DD1A 1GUEA 1REYA 2BQLA 1L76A 1C3WA 3N9CA 4B0DA 1L41A 5H2LA 1C6NA 1LYHA 2MEGA 3KAMA 155LA 3ULRA 4GYCA 3SN6R 4DAJA 2F2QA 4XN6A 3EH4B 1ZV5L 3QJSB 1GFEA 5FELA 4BV0A 4EMNA 4HJYA 4DD9A 3NY9A 3S3BB 4NIJA 1DPXA 163LA 1GE0A 1NQIA 1T8FA 4YOPA 5EBHA 2NTHA 1JV6A 3RZ4A 1UUZC 2MEEA 1CKFA 3HH3A 2RSCA 3UG9A 1JUGA 1QTZA 4HPIA 1LZ6A 3M3UA 107LA 1UC0A 1L48A 2GV0A 1IOQA 1OUIA 1L86A 2OU9A 1IWVA 2R4SA 2N5ZA 2F32A 1C8RA 2B6ZA 1OVKA 2YCWA 2M3GA 2FYDA 5LVGA 1B7SA 3GXKA 2DQEY 3M18B 5ILCA 1JHLA 5APFA 4LT3A 4BADA 1TEWA 258LA 4HJVA 4H90A 1DI5A 1H2SA 205LA 2DBTA 3GUKA 4OOOA 1BWIA 3VG9A 3HBDA 1GFRA 1DYAA 3WU9A 1L06A 4JQ6A 2LHMA 2Z55A 1QT3A 256LA 1LKRA 1LHJA 1L02A 3WXUA 4H9EA 1X0K1 3F6ZA 1REZA 1HEWA 2ZIJA 2EIZC 2Y00A 2WARA 1M0KA 1GE3A 4BWBA 5LAGA 2ZIYA 1IWUA 1BQLY 4WM5A 1KNIA 1LZDA 1L85A 2ANVA 3C7ZA 1C65A 2WJLA 1C6CA 4RW1A 3QDCA 1GF9A 3S3DB 3VWOA 3A3QA 3B72A 1PQDA 1QUHA 4MSTA 4CFOA 4H9HA 1L08A 1W08A 3DN3A 3WXTA 2NTWA 4WW3A 4LFXA 5KXZA 3AZ4A 4BVNA 5G54A 3IJVA 3WW5A 1RI8B 2RBRA 1CJ8A 1LZBA 1GHLA 1XEKA 5TGZA 1C63A 1UIGA 2H5ZA 146LA 3QJTB 4N4YB 5KXKA 1LMQA 2MECA 1B7LA 3DMXA 3HWLA 153LA 1B5XA 1GDXA 4ETBA 4OV0A 1NDMC 1GFAA 3SP3A 3FA0A 4Z98A 1OUJA 3HU8A 4WM6A 4HV1A 2KS9A 2BQHA 1IWYA 3GXRA 5G2DA 4GP4B 2BQJA 1IP5A 3A95A 4NGZA 4OWHA 1C6EA 150LA 4TWSA 1L25A 4KT3A 5A3ZA 4NHTA 4N5RA 192LA 2ANXA 4NGKA 1AT6A 1OUBA 5E9RA 5KJ9A 1BVXA 2HTXA 1XSFA 1D3FA 2AUBA 1BB7A 4DD3A 2HUBA 4R6CA 1GFTA 2HEDA 6LYZA 3CDTA 1F10A 212LA 1LMCA 1SWZA 1VDPA 1CKCA 1QTHA 134LA 1ZURA 3W6CA 1B2KA 2YBMA 4H93A 4EPFA 1T6HA 1LSYA 5IHGA 1VDQA 1JJ3A 1XGPC 5F14A 5B1GA 4TL3A 1LSMA 3LYTA 1H68A 164LA 109LA 1QUSA 1XGQC 3HT9A 1ZVHL 148LE 1WQOA 1L0KA 1DYCA 1D9WA 215LA 239LA 4KPMA 1LZ9A 1YROA 1DZBX 1L92A 1P3NA 4G72B 103LA 152LA 2BQGA 2CUUA 1CJ7A 2BQCA 1ZMYL 3WUMA 235LA 3SB9A 2Y8PA 1NMMA 1HSXA 196LA 4DDBA 1AT5A 2HU3A 112LA 3A7KA 2HUMA 4O34A 1L73A 1HMLA 1Q5IA 5AZDA 1P64A 168LA 4N1EI 2DQFC 3MGWA 1S8LA 3LHMA 1QQYA 3ODUA 228LA 1GXXA 4X1HA 1L30A 2YBNA 3ZVQA 1LSCA 199LA 1SX7A 1T8GA 1TDYA 1BRDA 1CU3A 1G1VA 2RAZX 4ET8A 1GBSA 1C08C 4EKPA 4ARQA 2G4NA 2Z73A 5DM9A 1LSEA 1RE2A 3DN8A 1FKVA 1B0DA 1LI6A 4WL6A 1JPOA 3S8GB 1LZTA 1WQPA 1LGWA 2BQKA 4X3BA 1D0MA 2RH1A 1QT8A 3GUNA 4AGAA 5M1YA 3WVXA 2YSSC 1P5CA 3WW6A 1UBZA 2ZNXY 1IP7A 1XEPA 1NHBA 4ET9A 128LA 2RB2X 1JTNA 4GLVA 138LA 1L13A 4Z41A 4BS7A 159LA 9LYZA 4IARA 1GB2A 255LA 5H2NA 2B73A 3ZEVA 1LZAA 1XFPL 1QS5A 5B6VA 2Q9EA 4L6RA 1IIZA 1L19A 1LJEA 2F4AA 4XENA 5H2OA 4HV2A 1YANA 170LA 1L61A 1GXV2 1WVVA 1T6VL 3QAPA 4W53A 3HARA 3CDOA 5EN0A 4LYTA 1FBIX 1QSQA 1RJCB 1YILA 1LYJA 4W56A 1L89A 4NSGA 2XBRA 1KS3A 2ZILA 2OEAX 1HNLA 1CU0A 1G0MA 3GUJA 1L63A 158LA 1LJHA 1IO5A 3TXBA 4QEQA 1L94A 4WG7A 1KMEA 1D0LA 1JJ0A 1SQ2L 3TXFA 1D0KA 1C45A 249LA 1AZFA 1VDTA 2LYMA 1UCQA 1OUDA 3OE9A 4PRQA 4UWUA 1LZ1A 2YCZA 3OE0A 3LYZA 4LT1A 4L35A 1ALCA 2DQHY 4NGYA 1UICA 5DHHA 1QUOA 3UTVA 2RAYX 3C8SA 241LA 1LSBA 4H91A 3DN0A 3UTYA 1L56A 3TMXA 1GB3A 1IW9A 5L9JA 1QTDA 1L51A 4DYGA 1DYDA 2XBSA 5LYZA 2WJKA 5G28A 1EL1A 3WQJA 4NGWA 1GAYA 5HQ1A 3C7YA 1F88A 227LA 4LZTA 120LA 1LYYA 1LZNA 1YL1X 149LA 3ZPQA 1JITA 1PY6A 4PRUA 5FEKA 1SSYA 225LA 4R0FA 3HFMY 1QKPA 3ZEKA 1NKHA 3GUIA 3T6UA 1P56A 1D3JA 1QT6A 5B35A 3P64A 3QBGA 3G3AB 1QTVA 2BAAA 1KXYA 1YKXX 118LA 1B6IA 3WPLA 1LKSA 1L75A 3W6EA 1DZEA 4G9SA 1FLYA 3A34A 4WLYA 2YDVA 1IORA 2JAFA 1DKKA 4XYYA 1FN5A 4YXAC 2BLYA 2KSYA 2R4RA 1KGBA 4B1AA 2YVBA 5IELA 2BQFA 1L45A 1L40A 1HMKA 2IGCA 1G7HC 1A4VA 1J1OY 5FSTA 1L37A 188LA 2G4PA 1JKCA 1IOSA 1UACY 5C6LA 1CKGA 5KY1A 4NFVA 197LA 3PDSA 2B7XA 1A2YC 4WO6A 5D5FA 5APCA 3VW7A 3DN2A 1HZXA 2H9KA 2QARC 4EPIA 7LYZA 3VVKA 1G7JC 4G7QB 1GE2A 2BQEA 176LA 1KIRC 4DWXA 4OWBA 4I7OA 4YEMA 1Z55A 2C8PA 3LZ2A 1L29A 4A4MA 1LZRA 2YDGA 3WU7A 4AXTA 1B7MA 1I56A 1P2CC 2D4IA 1LZ4A 4LYZA 3RU5A 3NS0A 1D6QA 3S8FB 3HBHA 3QY4A 2LNLA 4IATA 1L74A 4II8A 2FBBA 4XT1A 1C6IA 5FDJA 1G7MC 3TMWA 4HP0A 3ABWA 1OUCA 2LZ2A 1C62A 4N6HA 3D3DA 193LA 1L49A 4TUNA 1CTWA 2HU1A 2RB0X 1S8JA 5LZMA 3A67Y 2FYCA 2MEDA 1LZ8A 4ETEA 5G2AA 1GBXA 4FA7B 5I54A 2B5ZA 1IWXA 4I7MA 1GWDA 1IC4Y 5C6IA 1HF4A 1LJKA 250LA 1G07A 4L41A 1DYFA 1PQMA 1GF8A 4GP8B 4BUOA 3D9AC 2B6WA 3IWRA 5F81A 1L11A 4FJRA 2F4GA 5DL9A 1MELL 4XJBA 174LA 1LSPA 1I1ZA 1IP1A 2BQDA 1L91A 1T8AA 130LA 1G0KA 2BQBA 2ZQ4A 1C6HA 4ETCA 1L55A 3WPJA 162LA 1L32A 4PXFA 4OW1A 3WL2A 1LHMA 2Y02A 2VT4A 5KXXA 3EXDA 2HPYA 1CV6A 1C10A 4CHXA 1PQIA 4H9AA 1G0GA 1B5ZA 3W6DA 1BRXA 1C66A 5A45A 3HTDA 1FBKA 1EQ4A 1T97A 2RBPA 4CJ2A 1DKJA 5KXRA 4KLYA 1KG8A 1PQJA 3DN1A 3HT8A 2B75A 244LA 1L69A 1LHHA 110LA 5LVIA 1YAMA 1L99A 1DXJA 5KXTA 4XADA 3TXJA 3B0KA 2Q0MX 1ZWNA 4M6DA 177LA 1OP9B 3CDQA 4BEYA 2Y03A 1GE4A 1L17A 1G0QA 2MEHA 4PJZA 1AT9A 182LA 114LA 4GCEA 2DQJY 4LGKA 2IFFY 4I7KA 1L72A 5KKHA 1LYZA 1U19A 1HENA 1LZYA 4GP5B 3HT6A 5I4XA 2PEDA 1QT5A 3WH1A 4B4JA 3NSBA 2I35A 2F93A 5AHYA 5LWEA 1LGXA 1L62A 1LPIA 1L64A 216LA 4U3XB 4MR1A
chains in the Genus database with same CATH topology
2W1YA 1IWZA 4E3UA 161LA 4H1PA 1JFPA 1BWHA 1GB9A 3A90A 1IOCA 4AMJA 4NGIA 3TXGA 4GN3A 4H8YA 4CFPA 3X3CA 5B34A 1QSAA 1LWKA 1JTTL 4W96A 1HFYA 3DMZA 5I14A 1B5YA 1PXSA 3C80A 2NWDX 156LA 3AGIA 1C67A 2Z38A 4EA3A 191LA 4Y9HA 3A94A 1QTKA 2Z12A 1L01A 4H9BA 1YKYX 4H92A 4DJHA 4RLNA 2LYZA 3D4SA 238LA 1GFHA 3C8RA 4CGEA 167LA 1IX0A 4HYJA 1OWZA 1L18A 4WLTA 3CSZA 1LHKA 4LZMA 5J7CA 1LYEA 237LA 5J7AA 1AKIA 1I20A 5H2PA 1I6SA 3DNAA 1FKQA 3HUKA 1JTOL 4ZPUA 1GEZA 5I5QA 1AP9A 2CWIA 5H2IA 4LYMA 1LJGA 4OWAA 3PQRA 3RFMA 1CV4A 2Z2EA 1GEVA 1XGRC 2MEAA 5KXPA 4N4WA 3CSRA 1TBYA 2HUKA 1C6PA 1XJUA 2EI4A 4E97A 173LA 4OOTA 1L79A 3LZTA 3CT1A 240LA 3WUNA 1RCMA 1L34A 4M4OA 1LSNA 4N1CC 251LA 1CJ9A 224LA 1KW5A 1V7SA 4PXKA 4KL7A 5A8EA 3GULA 1GB6A 1L93A 2A4TA 1NHEA 3F9LA 1XGTC 144LA 1L57A 2DQGY 1OUHA 2HULA 4N0JA 3AB6A 3AJNA 3LYMA 5KXNA 184LA 1L03A 1IEEA 3WULA 1KW7A 1UA6Y 2KSAA 1GBOA 3AZ6A 1OUEA 4XTLA 4NSHA 3P65A 4IAQA 4C5FA 2YBLA 1GFKA 3QBIA 3TXHA 247LA 1L44A 5ETZA 1IWWA 1CU2A 4P2EA 1OUGA 243LA 2I26L 4XTNA 1L23A 5D5CA 2Y04A 1CJ6A 222LA 1B5VA 4PK0A 5F9UA 5K7OA 5ITCA 5FHWA 1L60A 3TXEA 2DQAA 1BWJA 2HEEA 3A8ZA 1YKZX 1LSAA 5HMVA 4AMIA 133LA 5H2KA 1L80A 3UTWA 3CT5A 1VFBC 1D2WA 1C6FA 4NC3A 1L22A 3QAKA 1X0SA 5B59A 2W1XA 1HEQA 3C9MA 1LAAA 113LA 1OQMA 2G4QA 4FAAB 1C68A 2NTGA 1B7PA 1REMA 1L68A 5B6ZA 2YBIA 1EHKB 1GFUA 1IVMA 131LA 2D4KA 5KXMA 1LJJA 1C6QA 3QJVB 1IP4A 102LA 3G3BB 4NG1A 5DN4A 1LMPA 3OK0A 1XIOA 3JR6A 3OAXA 1BRRA 1QTEA 3PBLA 2HECA 4DC4A 7LZMA 1L98A 2BQNA 4RW2A 1PZYA 2QPDB 1L21A 8LYZA 2ZYPA 1HSWA 2LCBA 5ITEA 242LA 1L71A 2W1LA 3DN6A 260LA 1L84A 2B70A 4HTKA 1F50A 1XJIA 3HUAA 1TN0A 1JSFA 1PS5A 1C6TA 5I4WA 2Z2FA 2O7AA 1L82A 1L36A 1YIKA 5AX0A 1R84A 4GCCA 5LVJA 1K28A 2QB0B 2EKSC 1L88A 2MEBA 3AZ7A 2RB1X 1NBZC 190LA 4IASA 1QSWA 2PC2A 4I7RA 4NG8A 2ZYCA 3HASA 2Z6BA 4I7TA 187LA 5FJGA 4DD0A 3DDLA 171LA 2DQDY 2RBSA 3L2XA 4LFPA 5KXLA 141LA 3UTXA 1LSZA 4UWVA 3RZEA 1LJIA 1PQKA 4FPDA 3UONA 1JGJA 3EH5B 1JJ1A 1TLAA 175LA 3AYMA 4WAVA 139LA 5LA8A 178LA 3K3TA 1JKBA 4Z46A 2B6YA 1WVUA 195LA 4LYOA 4I7SA 4IJ4A 2D91A 4WO9A 4AQNA 3B6LA 1P46A 1Q5JA 5C1MA 135LA 248LA 4I7QA 1L42A 4X32A 2G87A 1GU8A 2YCXA 5JJEA 4I7JA 3HAOA 226LA 4EXMA 4DDCA 1QTCA 1L33A 4WG1A 1P7SA 2BPUA 1E0PA 4NEBA 1XGUC 4NSIA 2EPEA 4I7LA 1VGOA 2OTZX 3OE6A 1L70A 1FLUA 3ATOA 5HMJA 2FBDA 186LA 4PGJB 1CV0A 1L83A 1T3PA 1HFXA 1DI4A 5II3A 5LA5A 1D3MA 4G4CA 5ILFA 4XJFA 3TXIA 119LA 4GPOA 3FI5A 3HH6A 5DLAA 4EKQA 5L3IA 3GUMA 2MEFA 4WL7A 1TCYA 1IWTA 1J1XY 2ZNWY 2Z39A 4MD1A 1L59A 3UZAA 1GF4A 4ETAA 2ZFEA 4FDYA 1XEJA 1IW6A 4C3WA 5AWZA 1LJFA 4J1BA 157LA 3QJQB 1GB5A 2CDSA 3HTGA 4ARMA 4TSBA 4NWEA 181LA 5DYSA 4NY5A 5HNLA 3QNGA 4KNFA 4G7RB 3OE8A 4LYBA 1L81A 3A92A 4J0LA 5G53A 1LMOA 3V2YA 1BVKC 5B6YA 4YF2A 1SLYA 1XJTA 3PXOA 4H94A 1C43A 1IY4A 1YAQA 1D6PA 4EOFA 3NYAA 3QBKA 5H2HA 4DS7E 4J4QA 1HC0A 5B06A 2OU8A 4RLMA 1LYSA 2YBJA 3RNXA 5B1FA 1C6MA 4UG2A 5B2NA 1L04A 3A91A 1INUA 1G0PA 1OUAA 2I6ZA 4ARJA 4PPOA 1HEPA 1JIYA 5A44A 4NHPA 1WQRA 5A3EA 1CX7A 1C7PA 2X72A 4W54A 5LAFA 2BQMA 4W55A 209LA 4ZEEA 1QSBA 3FADA 1P2RA 1VATA 1QDRA 1HEOA 4G4BA 142LA 1L0JA 4EKSA 4JR8A 1LPYA 1D3NA 4WM3A 129LA 127LA 166LA 1LYIA 2W1MA 2OTYX 5LXWA 4LT2A 1S51A 151LA 246LA 1QUTA 4OO9A 4YM8A 4GBRA 1B7RA 1LZ5A 3HAPA 1LZEA 1BB4A 3AGGG 5JJNA 3REYA 3V2WA 4FBZA 3HH4A 4W58A 3HAQA 211LA 4IAPA 4NGVA 257LA 4G4HA 4YX7C 5B05A 1FDLY 3HU9A 1B7QA 2BLXA 1LGUA 1IC5Y 1G0JA 4YENA 4I8SA 1KXWA 5T3FA 169LA 115LA 4LYCA 1QT4A 1GF6A 1LTMA 3WUAA 125LA 194LA 1QT7A 3C83A 3UZCA 1VEDA 2HEFA 1AM7A 3SB5A 4ZIXA 5B07A 5AX1A 4WM4A 1PXRA 2YCYA 3HT7A 3T36A 3N9AA 172LA 1LW9A 1L95A 4QRYA 3A3RX 1L26A 5F8UA 3QE8A 2NTUA 2O79A 2Z18A 132LA 1UIEA 1L96A 4W94A 2I21A 5L3HA 3QJRB 3P4ZA 3ZVQB 5JENB 3J6KA 4D9ZA 1L38A 1DQJC 147LA 4ARQB 3C8QA 259LA 4PJ2C 1M0MA 5AMYA 2OE9X 1L87A 5LIOA 1GAZA 4HJZA 183LA 262LA 4ML7A 1GB7A 3A6BY 3HDFA 1GF0A 1E8LA 1KY1A 4N8ZA 3W6AA 1BB6A 3WYHA 1QS9A 3A6CY 4QGZA 123LA 1F6RA 2AT9A 4QI1A 5H2JA 2LYOA 1WQNA 3WVYA 3VI0A 2CGIA 1BB3A 3CDVA 2LZTA 1V7TA 1IY3A 2F30A 1C69A 1O23A 201LA 218LA 3SB6A 5LVHA 230LA 5C6JA 1LZSA 4GN5C 1LSDA 4HYXA 4H8ZA 108LA 4B4IA 4H9FA 4H8XA 3VHZA 4XTOA 3P68A 5KXOA 1G06A 1H87A 4DT3A 4IB4A 2I25L 4B49A 1IXFA 254LA 3A93A 1CV5A 4LDLA 1LSGA 4TX7A 2H9JA 165LA 1GBZA 1EPYA 3HDEA 4EJ4A 3P66A 2EQLA 1GF3A 5APDA 1LLHA 3EBAB 3G3WA 3AYQA 1C6GA 4XJGA 2DQCY 5LYTA 3W6FA 2I20A 1GF7A 1L00A 1GBYA 1L16A 3LYOA 1L50A 4GLAA 3HUQA 3C81A 3HANA 3VGAA 1GDWA 1L28A 4JKVA 1NF5A 1IP2A 4WM1A 1L90A 200LA 233LA 1R2NA 3A96A 1JEFA 4PHIA 4WLXA 1DYEA 4DQ5A 1IP6A 4DKLA 1P36A 3EH3B 2L78A 4YEOA 1IP3A 5DN5A 1LMNA 2B6TA 1EQ5A 6LYTA 3L64A 4J7VA 3QJUB 1WTHA 1LYDA 1IR8A 185LA 1EQEA 1S53A 4NGOA 4DQJA 1CX6A 1KIPC 1L05A 231LA 2QPEB 2OE7X 2Z19A 4BEZA 1YAOA 1HFZA 4J1AA 4A7DA 5I4YA 1DYBA 4ARLA 2IHLA 2B6XA 3TXDA 1L12A 4DD2A 1TAYA 3HTFA 1JKAA 189LA 2Y01A 1LYFA 1CUQA 4EIYA 2YDOA 4NWHA 4G71B 3COCA 3J4GA 5HLLA 3B0IA 4NGLA 4GCBA 4DDAA 1F4ZA 1LHLA 4UHRA 1SWYA 3T45A 3DMVA 143LA 4G49A 3TXKA 4W52A 1CV3A 5KXYA 3W6BA 5BR5A 4TSCA 1L9HA 1L58A 1LMTA 3CB7A 252LA 2BQAA 1HEMA 1S52A 4K5YA 5DHGA 214LA 1CU6A 1IR9A 3GUOA 1G1WA 2D4JA 3N9EA 3SBBC 1C64A 3DN4A 4ETDA 4KXIA 1GD6A 3DQBA 4RDSA 213LA 4LDEA 3RW8A 1G7LC 1LJ3A 1REXA 2B72A 245LA 137LA 4GRVA 3P0GA 1GBWA 1GFVA 1WQMA 1BHZA 1LN6A 5AHZA 3QBLA 1IOTA 1H6MA 3SB8A 1GZMA 4ARMB 3ZPRA 3AYNA 1L43A 4B4EA 4Z3MA 3OJPA 1DPWA 1LWGA 2RBNA 1VJMA 4TTDA 1UIHA 3BKVA 1LYOA 1JSEA 3DKEX 4ZFPA 180LA 1DYGA 3EO5A 2LC9A 1UIDA 4S0WA 3IJUA 1C6AA 3SB7A 1OVHA 1B7OA 2F47A 1C46A 3C9LA 1LJ4A 3PWHA 4XJDA 3NY8A 111LA 5E4PA 4GCDA 4NHQA 5I53A 1OWYA 1DI3A 4WMGA 4HSFA 223LA 1HELA 1L09A 1FBBA 221LA 1UIAA 4H9IA 4I7NA 1C6BA 5KKIA 1OUFA 2DQIY 4I0CA 5LVKA 1JTPL 4WLDA 1YL0X 5B6WA 1G7IC 1B5UA 1FLWA 1YQVY 1N4FA 1S54A 1CWQA 3EMSA 1LSFA 1RFPA 1P6YA 1WQQA 210LA 5F9XA 2Z37A 1XMEB 1GB8A 261LA 1LHIA 5G2CA 3CAPA 3X3BA 4GBRB 2OE4X 1WTNA 1HHLA 1GF5A 6LZMA 5BR2A 4GCFA 104LA 1KG9A 1L66A 1OV5A 4XT3A 1QKOA 3CT0A 2B74A 1MGYA 5APEA 1L15A 4W57A 2CJLA 1E12A 2C8OA 3W3EA 5KXWA 4HWLA 2A7DA 1L39A 2BRDA 3WU8A 229LA 1HERA 1YAPA 3AM6A 2D6BA 2I1XA 206LA 4LDOA 2RBQA 2L6XA 1LCNA 1CVKA 3KJ6A 3CQLA 3WPKA 220LA 1LYGA 2RBOA 1P37A 3HBEX 5IDDA 1C61A 2KSBA 1L10A 4EKRA 1OVJA 1L27A 126LA 1L67A 3GUPA 1ZVYB 140LA 3LN2A 3BKHA 3RUNA 4GN4A 2F95A 1GFGA 4ARPA 4YXCA 1L53A 3F8VA 3MBVA 3FI7A 5H2MA 1QUDA 3CODA 3AW6A 1TN5A 4G70B 5F16A 4MCKA 1B9OA 2OU0X 2XTHA 1JQUA 3C82A 4UWNA 1W6ZA 1QDTA 1QTBA 2ZQ3A 122LA 5HNCA 2Q9DA 1LMAA 1GPQC 4WM2A 207LA 160LA 4XJIA 1G0LA 1IR7A 4BAPA 4NHIA 1CU5A 1CNSA 1CV1A 1LI3A 4WOAA 1LOZA 1SSWA 3TMVA 4W51A 4NSJA 2VB1A 1KIQC 2YBHA 3FE0A 4XXJA 2MEIA 1GFJA 1SX2A 1UAZA 1PQOA 1P2LA 2A7FA 1OYUA 234LA 1QUGA 2JAGA 4QIDA 1L52A 1FLQA 1NWGA 5KKJA 4MQSA 1KY0A 3C7WA 5G36A 1B5WA 1JISA 2LZMA 3G3XA 3K2RA 1L24A 4OWCA 1KXXA 1CUPA 1P8UA 2J4YA 3BVDB 1UCOA 2XJWA 4BAFA 4X31A 2ZZLA 3RT5X 1L07A 1O0AA 2ZIKA 1C6LA 1JWRA 1L65A 1NDGC 2HEBA 1C6DA 1OV7A 3HH5A 4MD2A 5KXSA 1C6JA 5JJJA 1LI2A 1C6KA 1F0WA 1UIBA 1P8IA 4XJHA 3AW7A 1BM1A 4I7PA 3ATNA 4ANRA 5B6XA 1XEIA 4QDNA 1LZCA 154LA 1VDSA 1GB0A 3CSQA 145LA 2O4WA 1L47A 1BB5A 1CKHA 253LA 3B0OA 3WMKA 1X0I1 1D9UA 1L0MA 1GE1A 5FCPA 198LA 1CKDA 4DD7A 3E3DA 3TMUA 1C60A 219LA 5LINA 4MQTA 1IC7Y 1C8SA 1BGIA 4G7SB 1NBYC 2HEAA 1ZYTA 1L54A 1L31A 4NGJA 1UIFA 4H9CA 1B7NA 4MBSA 1J1PY 1QM8A 4HTNA 4W59A 1QHJA 1P8HA 217LA 1L46A 1L35A 5B0WA 1D2YA 1MLCE 3HTBA 1M0LA 1VAUA 4NHSA 1JTMA 1QIOA 4HPEA 1LZGA 1LJNA 4OWEA 3SBAA 2ZWBA 2XQOA 1L20A 3S3CB 2BQOA 3G3VA 4N9RA 4LT0A 1JKDA 1WTMA 4QY9A 3AZ5A 4DQ7A 1L77A 3CDRA 236LA 1L97A 3AGHA 208LA 5LYMA 1F6SA 232LA 2DKVA 3LZMA 1JV7A 2F2NA 4HTQA 2BQIA 1L14A 3EMLA 2X0AA 4DD1A 1GUEA 1REYA 2BQLA 1L76A 1C3WA 3N9CA 4B0DA 1L41A 5H2LA 1C6NA 1LYHA 2MEGA 3KAMA 155LA 3ULRA 4GYCA 3SN6R 4DAJA 2F2QA 4XN6A 3EH4B 1ZV5L 3QJSB 1GFEA 5FELA 4BV0A 4EMNA 4HJYA 4DD9A 3NY9A 3S3BB 4NIJA 1DPXA 163LA 1GE0A 1NQIA 1T8FA 4YOPA 5EBHA 2NTHA 1JV6A 3RZ4A 1UUZC 2MEEA 1CKFA 3HH3A 2RSCA 3UG9A 1JUGA 1QTZA 4HPIA 1LZ6A 3M3UA 107LA 1UC0A 1L48A 2GV0A 1IOQA 1OUIA 1L86A 2OU9A 1IWVA 2R4SA 2N5ZA 2F32A 1C8RA 2B6ZA 1OVKA 2YCWA 2M3GA 2FYDA 5LVGA 1B7SA 3GXKA 2DQEY 3M18B 5ILCA 1JHLA 5APFA 4LT3A 4BADA 1TEWA 258LA 4HJVA 4H90A 1DI5A 1H2SA 205LA 2DBTA 3GUKA 4OOOA 1BWIA 3VG9A 3HBDA 1GFRA 1DYAA 3WU9A 1L06A 4JQ6A 2LHMA 2Z55A 1QT3A 256LA 1LKRA 1LHJA 1L02A 3WXUA 4H9EA 1X0K1 3F6ZA 1REZA 1HEWA 2ZIJA 2EIZC 2Y00A 2WARA 1M0KA 1GE3A 4BWBA 5LAGA 2ZIYA 1IWUA 1BQLY 4WM5A 1KNIA 1LZDA 1L85A 2ANVA 3C7ZA 1C65A 2WJLA 1C6CA 4RW1A 3QDCA 1GF9A 3S3DB 3VWOA 3A3QA 3B72A 1PQDA 1QUHA 4MSTA 4CFOA 4H9HA 1L08A 1W08A 3DN3A 3WXTA 2NTWA 4WW3A 4LFXA 5KXZA 3AZ4A 4BVNA 5G54A 3IJVA 3WW5A 1RI8B 2RBRA 1CJ8A 1LZBA 1GHLA 1XEKA 5TGZA 1C63A 1UIGA 2H5ZA 146LA 3QJTB 4N4YB 5KXKA 1LMQA 2MECA 1B7LA 3DMXA 3HWLA 153LA 1B5XA 1GDXA 4ETBA 4OV0A 1NDMC 1GFAA 3SP3A 3FA0A 4Z98A 1OUJA 3HU8A 4WM6A 4HV1A 2KS9A 2BQHA 1IWYA 3GXRA 5G2DA 4GP4B 2BQJA 1IP5A 3A95A 4NGZA 4OWHA 1C6EA 150LA 4TWSA 1L25A 4KT3A 5A3ZA 4NHTA 4N5RA 192LA 2ANXA 4NGKA 1AT6A 1OUBA 5E9RA 5KJ9A 1BVXA 2HTXA 1XSFA 1D3FA 2AUBA 1BB7A 4DD3A 2HUBA 4R6CA 1GFTA 2HEDA 6LYZA 3CDTA 1F10A 212LA 1LMCA 1SWZA 1VDPA 1CKCA 1QTHA 134LA 1ZURA 3W6CA 1B2KA 2YBMA 4H93A 4EPFA 1T6HA 1LSYA 5IHGA 1VDQA 1JJ3A 1XGPC 5F14A 5B1GA 4TL3A 1LSMA 3LYTA 1H68A 164LA 109LA 1QUSA 1XGQC 3HT9A 1ZVHL 148LE 1WQOA 1L0KA 1DYCA 1D9WA 215LA 239LA 4KPMA 1LZ9A 1YROA 1DZBX 1L92A 1P3NA 4G72B 103LA 152LA 2BQGA 2CUUA 1CJ7A 2BQCA 1ZMYL 3WUMA 235LA 3SB9A 2Y8PA 1NMMA 1HSXA 196LA 4DDBA 1AT5A 2HU3A 112LA 3A7KA 2HUMA 4O34A 1L73A 1HMLA 1Q5IA 5AZDA 1P64A 168LA 4N1EI 2DQFC 3MGWA 1S8LA 3LHMA 1QQYA 3ODUA 228LA 1GXXA 4X1HA 1L30A 2YBNA 3ZVQA 1LSCA 199LA 1SX7A 1T8GA 1TDYA 1BRDA 1CU3A 1G1VA 2RAZX 4ET8A 1GBSA 1C08C 4EKPA 4ARQA 2G4NA 2Z73A 5DM9A 1LSEA 1RE2A 3DN8A 1FKVA 1B0DA 1LI6A 4WL6A 1JPOA 3S8GB 1LZTA 1WQPA 1LGWA 2BQKA 4X3BA 1D0MA 2RH1A 1QT8A 3GUNA 4AGAA 5M1YA 3WVXA 2YSSC 1P5CA 3WW6A 1UBZA 2ZNXY 1IP7A 1XEPA 1NHBA 4ET9A 128LA 2RB2X 1JTNA 4GLVA 138LA 1L13A 4Z41A 4BS7A 159LA 9LYZA 4IARA 1GB2A 255LA 5H2NA 2B73A 3ZEVA 1LZAA 1XFPL 1QS5A 5B6VA 2Q9EA 4L6RA 1IIZA 1L19A 1LJEA 2F4AA 4XENA 5H2OA 4HV2A 1YANA 170LA 1L61A 1GXV2 1WVVA 1T6VL 3QAPA 4W53A 3HARA 3CDOA 5EN0A 4LYTA 1FBIX 1QSQA 1RJCB 1YILA 1LYJA 4W56A 1L89A 4NSGA 2XBRA 1KS3A 2ZILA 2OEAX 1HNLA 1CU0A 1G0MA 3GUJA 1L63A 158LA 1LJHA 1IO5A 3TXBA 4QEQA 1L94A 4WG7A 1KMEA 1D0LA 1JJ0A 1SQ2L 3TXFA 1D0KA 1C45A 249LA 1AZFA 1VDTA 2LYMA 1UCQA 1OUDA 3OE9A 4PRQA 4UWUA 1LZ1A 2YCZA 3OE0A 3LYZA 4LT1A 4L35A 1ALCA 2DQHY 4NGYA 1UICA 5DHHA 1QUOA 3UTVA 2RAYX 3C8SA 241LA 1LSBA 4H91A 3DN0A 3UTYA 1L56A 3TMXA 1GB3A 1IW9A 5L9JA 1QTDA 1L51A 4DYGA 1DYDA 2XBSA 5LYZA 2WJKA 5G28A 1EL1A 3WQJA 4NGWA 1GAYA 5HQ1A 3C7YA 1F88A 227LA 4LZTA 120LA 1LYYA 1LZNA 1YL1X 149LA 3ZPQA 1JITA 1PY6A 4PRUA 5FEKA 1SSYA 225LA 4R0FA 3HFMY 1QKPA 3ZEKA 1NKHA 3GUIA 3T6UA 1P56A 1D3JA 1QT6A 5B35A 3P64A 3QBGA 3G3AB 1QTVA 2BAAA 1KXYA 1YKXX 118LA 1B6IA 3WPLA 1LKSA 1L75A 3W6EA 1DZEA 4G9SA 1FLYA 3A34A 4WLYA 2YDVA 1IORA 2JAFA 1DKKA 4XYYA 1FN5A 4YXAC 2BLYA 2KSYA 2R4RA 1KGBA 4B1AA 2YVBA 5IELA 2BQFA 1L45A 1L40A 1HMKA 2IGCA 1G7HC 1A4VA 1J1OY 5FSTA 1L37A 188LA 2G4PA 1JKCA 1IOSA 1UACY 5C6LA 1CKGA 5KY1A 4NFVA 197LA 3PDSA 2B7XA 1A2YC 4WO6A 5D5FA 5APCA 3VW7A 3DN2A 1HZXA 2H9KA 2QARC 4EPIA 7LYZA 3VVKA 1G7JC 4G7QB 1GE2A 2BQEA 176LA 1KIRC 4DWXA 4OWBA 4I7OA 4YEMA 1Z55A 2C8PA 3LZ2A 1L29A 4A4MA 1LZRA 2YDGA 3WU7A 4AXTA 1B7MA 1I56A 1P2CC 2D4IA 1LZ4A 4LYZA 3RU5A 3NS0A 1D6QA 3S8FB 3HBHA 3QY4A 2LNLA 4IATA 1L74A 4II8A 2FBBA 4XT1A 1C6IA 5FDJA 1G7MC 3TMWA 4HP0A 3ABWA 1OUCA 2LZ2A 1C62A 4N6HA 3D3DA 193LA 1L49A 4TUNA 1CTWA 2HU1A 2RB0X 1S8JA 5LZMA 3A67Y 2FYCA 2MEDA 1LZ8A 4ETEA 5G2AA 1GBXA 4FA7B 5I54A 2B5ZA 1IWXA 4I7MA 1GWDA 1IC4Y 5C6IA 1HF4A 1LJKA 250LA 1G07A 4L41A 1DYFA 1PQMA 1GF8A 4GP8B 4BUOA 3D9AC 2B6WA 3IWRA 5F81A 1L11A 4FJRA 2F4GA 5DL9A 1MELL 4XJBA 174LA 1LSPA 1I1ZA 1IP1A 2BQDA 1L91A 1T8AA 130LA 1G0KA 2BQBA 2ZQ4A 1C6HA 4ETCA 1L55A 3WPJA 162LA 1L32A 4PXFA 4OW1A 3WL2A 1LHMA 2Y02A 2VT4A 5KXXA 3EXDA 2HPYA 1CV6A 1C10A 4CHXA 1PQIA 4H9AA 1G0GA 1B5ZA 3W6DA 1BRXA 1C66A 5A45A 3HTDA 1FBKA 1EQ4A 1T97A 2RBPA 4CJ2A 1DKJA 5KXRA 4KLYA 1KG8A 1PQJA 3DN1A 3HT8A 2B75A 244LA 1L69A 1LHHA 110LA 5LVIA 1YAMA 1L99A 1DXJA 5KXTA 4XADA 3TXJA 3B0KA 2Q0MX 1ZWNA 4M6DA 177LA 1OP9B 3CDQA 4BEYA 2Y03A 1GE4A 1L17A 1G0QA 2MEHA 4PJZA 1AT9A 182LA 114LA 4GCEA 2DQJY 4LGKA 2IFFY 4I7KA 1L72A 5KKHA 1LYZA 1U19A 1HENA 1LZYA 4GP5B 3HT6A 5I4XA 2PEDA 1QT5A 3WH1A 4B4JA 3NSBA 2I35A 2F93A 5AHYA 5LWEA 1LGXA 1L62A 1LPIA 1L64A 216LA 4U3XB 4MR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LYG A;  2X72 A;  4W54 A;  2RBO A;  161L A;  1P37 A;  196L A;  2KSB A;  1C61 A;  1JFP A;  1L10 A;  4W55 A;  209L A;  112L A;  1QSB A;  3FAD A;  1P2R A;  4EKR A;  3A7K A;  2HUM A;  4AMJ A;  1OVJ A;  1L73 A;  1L27 A;  126L A;  142L A;  1L0J A;  4EKS A;  1Q5I A;  4JR8 A;  1L67 A;  5AZD A;  3GUP A;  1P64 A;  5B34 A;  140L A;  1D3N A;  168L A;  1LPY A;  1LWK A;  3X3C A;  129L A;  127L A;  166L A;  3DMZ A;  1S8L A;  1LYI A;  3ODU A;  228L A;  3RUN A;  5I14 A;  2OTY X;  2F95 A;  4X1H A;  4ARP A;  1L30 A;  1PXS A;  4YXC A;  1L53 A;  3C80 A;  1S51 A;  151L A;  246L A;  4OO9 A;  3F8V A;  156L A;  199L A;  1SX7 A;  1T8G A;  1BRD A;  1CU3 A;  1G1V A;  2RAZ X;  3MBV A;  3HAP A;  1C67 A;  5H2M A;  1QUD A;  4EA3 A;  3COD A;  5JJN A;  4EKP A;  191L A;  4ARQ A;  4Y9H A;  3REY A;  1TN5 A;  2Z73 A;  4G70 B;  3V2W A;  4FBZ A;  1L01 A;  3HH4 A;  4W58 A;  3DN8 A;  2OU0 X;  3HAQ A;  1JQU A;  3C82 A;  4DJH A;  1LI6 A;  211L A;  3S8G B;  4IAP A;  3D4S A;  238L A;  1QTB A;  257L A;  3C8R A;  4YX7 C;  122L A;  2Q9D A;  167L A;  1LGW A;  3HU9 A;  1LGU A;  4HYJ A;  160L A;  2RH1 A;  1G0L A;  1OWZ A;  1G0J A;  1L18 A;  1CU5 A;  4LZM A;  1QT8 A;  3GUN A;  1CV1 A;  169L A;  115L A;  1LYE A;  1P5C A;  1LI3 A;  1QT4 A;  237L A;  5J7A A;  5H2P A;  1I6S A;  1NHB A;  1XEP A;  3DNA A;  128L A;  2RB2 X;  125L A;  1JTN A;  1SSW A;  3HUK A;  1QT7 A;  3C83 A;  3UZC A;  4ZPU A;  138L A;  4W51 A;  1L13 A;  159L A;  1AP9 A;  3SB5 A;  5H2I A;  4IAR A;  4XXJ A;  255L A;  5H2N A;  3PQR A;  1UAZ A;  1SX2 A;  5AX1 A;  2B73 A;  3RFM A;  1CV4 A;  1P2L A;  1PQO A;  1PXR A;  3ZEV A;  2YCY A;  1OYU A;  234L A;  3HT7 A;  1QUG A;  2JAG A;  1QS5 A;  172L A;  1L52 A;  1LW9 A;  4N4W A;  4QID A;  2Q9E A;  2EI4 A;  2HUK A;  1C6P A;  1L19 A;  1L95 A;  1XJU A;  4GBR A;  4L6R A;  4E97 A;  4QRY A;  4MQS A;  173L A;  1KY0 A;  3C7W A;  5H2O A;  1L79 A;  5G36 A;  240L A;  170L A;  1L26 A;  1L61 A;  5F8U A;  1L34 A;  2LZM A;  3G3X A;  2O79 A;  3K2R A;  2NTU A;  1L24 A;  251L A;  3QAP A;  1CUP A;  1P8U A;  224L A;  4W53 A;  1L96 A;  3HAR A;  3CDO A;  2I21 A;  5EN0 A;  1KW5 A;  2J4Y A;  3QJR B;  1QSQ A;  3BVD B;  1LYJ A;  4X31 A;  4PXK A;  2ZZL A;  4W56 A;  5A8E A;  1L38 A;  1L89 A;  1L07 A;  3GUL A;  1O0A A;  147L A;  1KS3 A;  1C6L A;  1L65 A;  1L93 A;  2A4T A;  4ARQ B;  2OEA X;  3F9L A;  1C6D A;  1OV7 A;  144L A;  3HH5 A;  3C8Q A;  1CU0 A;  1G0M A;  1L57 A;  4MD2 A;  259L A;  3GUJ A;  1C6J A;  5JJJ A;  1L63 A;  2HUL A;  1M0M A;  1LI2 A;  158L A;  1C6K A;  1L94 A;  1P8I A;  2OE9 X;  1L87 A;  1KME A;  183L A;  184L A;  1L03 A;  1BM1 A;  262L A;  4I7P A;  3HDF A;  1KW7 A;  5B6X A;  1KY1 A;  249L A;  2KSA A;  1UCQ A;  1QS9 A;  3OE9 A;  123L A;  2YCZ A;  2AT9 A;  145L A;  3OE0 A;  4L35 A;  4QI1 A;  4XTL A;  2O4W A;  5H2J A;  4IAQ A;  1L47 A;  3QBI A;  247L A;  1L44 A;  253L A;  5ETZ A;  3VI0 A;  1X0I 1;  1L0M A;  3CDV A;  1CU2 A;  5DHH A;  1QUO A;  3UTV A;  243L A;  2RAY X;  198L A;  3C8S A;  241L A;  4XTN A;  1C69 A;  201L A;  3DN0 A;  1L23 A;  218L A;  2Y04 A;  3SB6 A;  3UTY A;  1L56 A;  230L A;  1C60 A;  219L A;  1IW9 A;  222L A;  1QTD A;  4MQT A;  1L51 A;  4PK0 A;  1C8S A;  4G7S B;  4HYX A;  1DYD A;  5ITC A;  108L A;  1L60 A;  1ZYT A;  2WJK A;  5G28 A;  1L54 A;  1L31 A;  3WQJ A;  3VHZ A;  4XTO A;  3C7Y A;  1F88 A;  227L A;  120L A;  1G06 A;  149L A;  4MBS A;  3ZPQ A;  1QM8 A;  4AMI A;  4IB4 A;  5H2K A;  1L80 A;  3UTW A;  4W59 A;  1IXF A;  254L A;  1PY6 A;  1QHJ A;  1P8H A;  217L A;  1CV5 A;  1L46 A;  4LDL A;  1D2W A;  1L35 A;  1D2Y A;  1SSY A;  1C6F A;  225L A;  3HTB A;  1QKP A;  4NC3 A;  1M0L A;  165L A;  3GUI A;  1EPY A;  1JTM A;  1L22 A;  1P56 A;  3QAK A;  1X0S A;  3HDE A;  4EJ4 A;  1D3J A;  1QT6 A;  5B35 A;  1LLH A;  3C9M A;  3QBG A;  3SBA A;  3G3W A;  1QTV A;  1C6G A;  1L20 A;  3S3C B;  3G3V A;  113L A;  4FAA B;  1C68 A;  118L A;  1L77 A;  3CDR A;  2NTG A;  236L A;  1B6I A;  1L97 A;  2I20 A;  1L00 A;  1L68 A;  5B6Z A;  1L75 A;  1L16 A;  1DZE A;  232L A;  3LZM A;  1JV7 A;  2YDV A;  1EHK B;  1L50 A;  3HUQ A;  1L14 A;  3C81 A;  2JAF A;  3EML A;  131L A;  3HAN A;  3VGA A;  1C6Q A;  1L28 A;  3QJV B;  1GUE A;  4YXA C;  2KSY A;  102L A;  4JKV A;  1L76 A;  1C3W A;  1XIO A;  3JR6 A;  2R4R A;  1L41 A;  1L90 A;  200L A;  3OAX A;  233L A;  1BRR A;  1KGB A;  5H2L A;  1C6N A;  1R2N A;  3PBL A;  1L45 A;  1LYH A;  1DYE A;  4DKL A;  1P36 A;  3EH3 B;  7LZM A;  155L A;  1L40 A;  2IGC A;  4GYC A;  3SN6 R;  4DAJ A;  1L98 A;  2F2Q A;  2L78 A;  3EH4 B;  2QPD B;  1L21 A;  1L37 A;  3QJS B;  2B6T A;  188L A;  2LCB A;  5ITE A;  4BV0 A;  242L A;  3L64 A;  3NY9 A;  3S3B B;  1L71 A;  163L A;  3QJU B;  1WTH A;  1LYD A;  3DN6 A;  1T8F A;  1JV6 A;  2NTH A;  185L A;  260L A;  197L A;  1L84 A;  2B70 A;  1S53 A;  1F50 A;  1XJI A;  3HUA A;  3PDS A;  1CX6 A;  1L05 A;  231L A;  2B7X A;  1TN0 A;  2QPE B;  3HH3 A;  2OE7 X;  3UG9 A;  4BEZ A;  1C6T A;  3VW7 A;  1QTZ A;  2O7A A;  3DN2 A;  1L82 A;  1L36 A;  1HZX A;  2QAR C;  4EPI A;  1DYB A;  3VVK A;  4ARL A;  5AX0 A;  2B6X A;  1R84 A;  4G7Q B;  1K28 A;  1L12 A;  3HTF A;  107L A;  176L A;  2QB0 B;  1L48 A;  235L A;  189L A;  2Y01 A;  1L86 A;  2OU9 A;  4I7O A;  1LYF A;  2R4S A;  1CUQ A;  4EIY A;  2F32 A;  1C8R A;  2YDO A;  1L88 A;  5B6V A;  4G71 B;  1L29 A;  2B6Z A;  2RB1 X;  3COC A;  1OVK A;  4A4M A;  190L A;  2YCW A;  4I7R A;  2M3G A;  1F4Z A;  3HAS A;  2Z6B A;  4I7T A;  4UHR A;  1SWY A;  187L A;  3NS0 A;  3S8F B;  5FJG A;  3T45 A;  3DMV A;  143L A;  2LNL A;  258L A;  3DDL A;  171L A;  4W52 A;  1CV3 A;  1L74 A;  1H2S A;  205L A;  3GUK A;  2RBS A;  5BR5 A;  1L9H A;  3VG9 A;  3L2X A;  1L58 A;  4XT1 A;  1C6I A;  252L A;  141L A;  3UTX A;  1DYA A;  3RZE A;  1S52 A;  1L06 A;  4K5Y A;  4JQ6 A;  1PQK A;  5DHG A;  214L A;  1CU6 A;  2Z55 A;  4FPD A;  3GUO A;  3ABW A;  1QT3 A;  1G1W A;  256L A;  3UON A;  1JGJ A;  3SBB C;  1TLA A;  1C64 A;  175L A;  3AYM A;  3EH5 B;  4WAV A;  139L A;  3DN4 A;  1C62 A;  1L02 A;  4N6H A;  3DQB A;  1X0K 1;  178L A;  213L A;  1L49 A;  4LDE A;  2Y00 A;  2B6Y A;  1CTW A;  195L A;  1M0K A;  2B72 A;  2RB0 X;  245L A;  137L A;  4I7S A;  1S8J A;  4GRV A;  5LZM A;  4AQN A;  4BWB A;  3P0G A;  2ZIY A;  1KNI A;  5G2A A;  1L85 A;  2ANV A;  3C7Z A;  1C65 A;  1LN6 A;  2WJL A;  3QBL A;  5AHZ A;  1P46 A;  4FA7 B;  1Q5J A;  1C6C A;  5C1M A;  3QDC A;  4I7M A;  3SB8 A;  248L A;  4I7Q A;  3S3D B;  1GZM A;  4ARM B;  3ZPR A;  3AYN A;  1L43 A;  1L42 A;  4X32 A;  1LWG A;  1PQD A;  1QUH A;  250L A;  2G87 A;  2RBN A;  1GU8 A;  1L08 A;  1VJM A;  1G07 A;  2YCX A;  1PQM A;  1DYF A;  3DN3 A;  4GP8 B;  4BUO A;  5JJE A;  2NTW A;  4I7J A;  3HAO A;  4WW3 A;  2B6W A;  226L A;  3DKE X;  180L A;  1DYG A;  1QTC A;  1L11 A;  2LC9 A;  4EXM A;  4S0W A;  4BVN A;  1L33 A;  5G54 A;  1C6A A;  1P7S A;  3SB7 A;  1E0P A;  1OVH A;  2F47 A;  2RBR A;  4I7L A;  1VGO A;  3C9L A;  3PWH A;  174L A;  2OTZ X;  3OE6 A;  5TGZ A;  1C63 A;  3NY8 A;  1L70 A;  1L91 A;  111L A;  1T8A A;  130L A;  1G0K A;  146L A;  186L A;  1C6H A;  3QJT B;  1L55 A;  1CV0 A;  1L83 A;  4N4Y B;  1OWY A;  162L A;  3DMX A;  3HWL A;  1D3M A;  1L32 A;  4PXF A;  223L A;  1L09 A;  1FBB A;  4OV0 A;  221L A;  3FA0 A;  119L A;  4GPO A;  3FI5 A;  3HH6 A;  3HU8 A;  4EKQ A;  2KS9 A;  3GUM A;  4I7N A;  2Y02 A;  2VT4 A;  5G2D A;  1C6B A;  4GP4 B;  2HPY A;  1CV6 A;  1C6E A;  1PQI A;  150L A;  1G0G A;  1L25 A;  1BRX A;  1C66 A;  5A45 A;  3HTD A;  1FBK A;  5B6W A;  4MD1 A;  1L59 A;  1T97 A;  192L A;  2ANX A;  1S54 A;  2ZFE A;  1CWQ A;  3UZA A;  2RBP A;  1IW6 A;  5AWZ A;  1P6Y A;  4KLY A;  210L A;  3QJQ B;  157L A;  1D3F A;  1KG8 A;  3HTG A;  1PQJ A;  4ARM A;  1XME B;  3DN1 A;  261L A;  181L A;  3HT8 A;  3CAP A;  5DYS A;  5G2C A;  2B75 A;  244L A;  4KNF A;  3X3B A;  1L69 A;  4GBR B;  2OE4 X;  4G7R B;  110L A;  3CDT A;  5B0W A;  212L A;  3OE8 A;  1L99 A;  1SWZ A;  1L81 A;  6LZM A;  5BR2 A;  1QTH A;  104L A;  1KG9 A;  1L66 A;  1ZUR A;  1ZWN A;  1OV5 A;  5G53 A;  3V2Y A;  177L A;  3CDQ A;  5B6Y A;  4XT3 A;  4BEY A;  4EPF A;  1QKO A;  2Y03 A;  1T6H A;  1L17 A;  1XJT A;  1G0Q A;  4PJZ A;  3PXO A;  1AT9 A;  182L A;  114L A;  4TL3 A;  2B74 A;  3NYA A;  1MGY A;  3QBK A;  5H2H A;  4I7K A;  4J4Q A;  1H68 A;  164L A;  1L15 A;  4W57 A;  1E12 A;  2OU8 A;  109L A;  1L72 A;  5KKH A;  3HT9 A;  4HWL A;  1U19 A;  1L39 A;  2BRD A;  148L E;  1C6M A;  4GP5 B;  4UG2 A;  5B2N A;  1L0K A;  1L04 A;  229L A;  1DYC A;  3HT6 A;  1D9W A;  3AM6 A;  1G0P A;  215L A;  239L A;  2I1X A;  206L A;  1QT5 A;  2RBQ A;  4LDO A;  2L6X A;  2I35 A;  2PED A;  3NSB A;  4G72 B;  1P3N A;  1L92 A;  2F93 A;  4ARJ A;  5AHY A;  5LWE A;  103L A;  152L A;  1CVK A;  1LGX A;  5A44 A;  1L62 A;  3KJ6 A;  2CUU A;  1L64 A;  216L A;  220L A;  1CX7 A;  3SB9 A; 
#chains in the Genus database with same CATH topology
 2W1Y A;  1IWZ A;  4E3U A;  161L A;  4H1P A;  1JFP A;  1BWH A;  1GB9 A;  3A90 A;  1IOC A;  4AMJ A;  4NGI A;  3TXG A;  4GN3 A;  4H8Y A;  4CFP A;  3X3C A;  5B34 A;  1QSA A;  1LWK A;  1JTT L;  4W96 A;  1HFY A;  3DMZ A;  5I14 A;  1B5Y A;  1PXS A;  3C80 A;  2NWD X;  156L A;  3AGI A;  1C67 A;  2Z38 A;  4EA3 A;  191L A;  4Y9H A;  3A94 A;  1QTK A;  2Z12 A;  1L01 A;  4H9B A;  1YKY X;  4H92 A;  4DJH A;  4RLN A;  2LYZ A;  3D4S A;  238L A;  1GFH A;  3C8R A;  4CGE A;  167L A;  1IX0 A;  4HYJ A;  1OWZ A;  1L18 A;  4WLT A;  3CSZ A;  1LHK A;  4LZM A;  5J7C A;  1LYE A;  237L A;  5J7A A;  1AKI A;  1I20 A;  5H2P A;  1I6S A;  3DNA A;  1FKQ A;  3HUK A;  1JTO L;  4ZPU A;  1GEZ A;  5I5Q A;  1AP9 A;  2CWI A;  5H2I A;  4LYM A;  1LJG A;  4OWA A;  3PQR A;  3RFM A;  1CV4 A;  2Z2E A;  1GEV A;  1XGR C;  2MEA A;  5KXP A;  4N4W A;  3CSR A;  1TBY A;  2HUK A;  1C6P A;  1XJU A;  2EI4 A;  4E97 A;  173L A;  4OOT A;  1L79 A;  3LZT A;  3CT1 A;  240L A;  3WUN A;  1RCM A;  1L34 A;  4M4O A;  1LSN A;  4N1C C;  251L A;  1CJ9 A;  224L A;  1KW5 A;  1V7S A;  4PXK A;  4KL7 A;  5A8E A;  3GUL A;  1GB6 A;  1L93 A;  2A4T A;  1NHE A;  3F9L A;  1XGT C;  144L A;  1L57 A;  2DQG Y;  1OUH A;  2HUL A;  4N0J A;  3AB6 A;  3AJN A;  3LYM A;  5KXN A;  184L A;  1L03 A;  1IEE A;  3WUL A;  1KW7 A;  1UA6 Y;  2KSA A;  1GBO A;  3AZ6 A;  1OUE A;  4XTL A;  4NSH A;  3P65 A;  4IAQ A;  4C5F A;  2YBL A;  1GFK A;  3QBI A;  3TXH A;  247L A;  1L44 A;  5ETZ A;  1IWW A;  1CU2 A;  4P2E A;  1OUG A;  243L A;  2I26 L;  4XTN A;  1L23 A;  5D5C A;  2Y04 A;  1CJ6 A;  222L A;  1B5V A;  4PK0 A;  5F9U A;  5K7O A;  5ITC A;  5FHW A;  1L60 A;  3TXE A;  2DQA A;  1BWJ A;  2HEE A;  3A8Z A;  1YKZ X;  1LSA A;  5HMV A;  4AMI A;  133L A;  5H2K A;  1L80 A;  3UTW A;  3CT5 A;  1VFB C;  1D2W A;  1C6F A;  4NC3 A;  1L22 A;  3QAK A;  1X0S A;  5B59 A;  2W1X A;  1HEQ A;  3C9M A;  1LAA A;  113L A;  1OQM A;  2G4Q A;  4FAA B;  1C68 A;  2NTG A;  1B7P A;  1REM A;  1L68 A;  5B6Z A;  2YBI A;  1EHK B;  1GFU A;  1IVM A;  131L A;  2D4K A;  5KXM A;  1LJJ A;  1C6Q A;  3QJV B;  1IP4 A;  102L A;  3G3B B;  4NG1 A;  5DN4 A;  1LMP A;  3OK0 A;  1XIO A;  3JR6 A;  3OAX A;  1BRR A;  1QTE A;  3PBL A;  2HEC A;  4DC4 A;  7LZM A;  1L98 A;  2BQN A;  4RW2 A;  1PZY A;  2QPD B;  1L21 A;  8LYZ A;  2ZYP A;  1HSW A;  2LCB A;  5ITE A;  242L A;  1L71 A;  2W1L A;  3DN6 A;  260L A;  1L84 A;  2B70 A;  4HTK A;  1F50 A;  1XJI A;  3HUA A;  1TN0 A;  1JSF A;  1PS5 A;  1C6T A;  5I4W A;  2Z2F A;  2O7A A;  1L82 A;  1L36 A;  1YIK A;  5AX0 A;  1R84 A;  4GCC A;  5LVJ A;  1K28 A;  2QB0 B;  2EKS C;  1L88 A;  2MEB A;  3AZ7 A;  2RB1 X;  1NBZ C;  190L A;  4IAS A;  1QSW A;  2PC2 A;  4I7R A;  4NG8 A;  2ZYC A;  3HAS A;  2Z6B A;  4I7T A;  187L A;  5FJG A;  4DD0 A;  3DDL A;  171L A;  2DQD Y;  2RBS A;  3L2X A;  4LFP A;  5KXL A;  141L A;  3UTX A;  1LSZ A;  4UWV A;  3RZE A;  1LJI A;  1PQK A;  4FPD A;  3UON A;  1JGJ A;  3EH5 B;  1JJ1 A;  1TLA A;  175L A;  3AYM A;  4WAV A;  139L A;  5LA8 A;  178L A;  3K3T A;  1JKB A;  4Z46 A;  2B6Y A;  1WVU A;  195L A;  4LYO A;  4I7S A;  4IJ4 A;  2D91 A;  4WO9 A;  4AQN A;  3B6L A;  1P46 A;  1Q5J A;  5C1M A;  135L A;  248L A;  4I7Q A;  1L42 A;  4X32 A;  2G87 A;  1GU8 A;  2YCX A;  5JJE A;  4I7J A;  3HAO A;  226L A;  4EXM A;  4DDC A;  1QTC A;  1L33 A;  4WG1 A;  1P7S A;  2BPU A;  1E0P A;  4NEB A;  1XGU C;  4NSI A;  2EPE A;  4I7L A;  1VGO A;  2OTZ X;  3OE6 A;  1L70 A;  1FLU A;  3ATO A;  5HMJ A;  2FBD A;  186L A;  4PGJ B;  1CV0 A;  1L83 A;  1T3P A;  1HFX A;  1DI4 A;  5II3 A;  5LA5 A;  1D3M A;  4G4C A;  5ILF A;  4XJF A;  3TXI A;  119L A;  4GPO A;  3FI5 A;  3HH6 A;  5DLA A;  4EKQ A;  5L3I A;  3GUM A;  2MEF A;  4WL7 A;  1TCY A;  1IWT A;  1J1X Y;  2ZNW Y;  2Z39 A;  4MD1 A;  1L59 A;  3UZA A;  1GF4 A;  4ETA A;  2ZFE A;  4FDY A;  1XEJ A;  1IW6 A;  4C3W A;  5AWZ A;  1LJF A;  4J1B A;  157L A;  3QJQ B;  1GB5 A;  2CDS A;  3HTG A;  4ARM A;  4TSB A;  4NWE A;  181L A;  5DYS A;  4NY5 A;  5HNL A;  3QNG A;  4KNF A;  4G7R B;  3OE8 A;  4LYB A;  1L81 A;  3A92 A;  4J0L A;  5G53 A;  1LMO A;  3V2Y A;  1BVK C;  5B6Y A;  4YF2 A;  1SLY A;  1XJT A;  3PXO A;  4H94 A;  1C43 A;  1IY4 A;  1YAQ A;  1D6P A;  4EOF A;  3NYA A;  3QBK A;  5H2H A;  4DS7 E;  4J4Q A;  1HC0 A;  5B06 A;  2OU8 A;  4RLM A;  1LYS A;  2YBJ A;  3RNX A;  5B1F A;  1C6M A;  4UG2 A;  5B2N A;  1L04 A;  3A91 A;  1INU A;  1G0P A;  1OUA A;  2I6Z A;  4ARJ A;  4PPO A;  1HEP A;  1JIY A;  5A44 A;  4NHP A;  1WQR A;  5A3E A;  1CX7 A;  1C7P A;  2X72 A;  4W54 A;  5LAF A;  2BQM A;  4W55 A;  209L A;  4ZEE A;  1QSB A;  3FAD A;  1P2R A;  1VAT A;  1QDR A;  1HEO A;  4G4B A;  142L A;  1L0J A;  4EKS A;  4JR8 A;  1LPY A;  1D3N A;  4WM3 A;  129L A;  127L A;  166L A;  1LYI A;  2W1M A;  2OTY X;  5LXW A;  4LT2 A;  1S51 A;  151L A;  246L A;  1QUT A;  4OO9 A;  4YM8 A;  4GBR A;  1B7R A;  1LZ5 A;  3HAP A;  1LZE A;  1BB4 A;  3AGG G;  5JJN A;  3REY A;  3V2W A;  4FBZ A;  3HH4 A;  4W58 A;  3HAQ A;  211L A;  4IAP A;  4NGV A;  257L A;  4G4H A;  4YX7 C;  5B05 A;  1FDL Y;  3HU9 A;  1B7Q A;  2BLX A;  1LGU A;  1IC5 Y;  1G0J A;  4YEN A;  4I8S A;  1KXW A;  5T3F A;  169L A;  115L A;  4LYC A;  1QT4 A;  1GF6 A;  1LTM A;  3WUA A;  125L A;  194L A;  1QT7 A;  3C83 A;  3UZC A;  1VED A;  2HEF A;  1AM7 A;  3SB5 A;  4ZIX A;  5B07 A;  5AX1 A;  4WM4 A;  1PXR A;  2YCY A;  3HT7 A;  3T36 A;  3N9A A;  172L A;  1LW9 A;  1L95 A;  4QRY A;  3A3R X;  1L26 A;  5F8U A;  3QE8 A;  2NTU A;  2O79 A;  2Z18 A;  132L A;  1UIE A;  1L96 A;  4W94 A;  2I21 A;  5L3H A;  3QJR B;  3P4Z A;  3ZVQ B;  5JEN B;  3J6K A;  4D9Z A;  1L38 A;  1DQJ C;  147L A;  4ARQ B;  3C8Q A;  259L A;  4PJ2 C;  1M0M A;  5AMY A;  2OE9 X;  1L87 A;  5LIO A;  1GAZ A;  4HJZ A;  183L A;  262L A;  4ML7 A;  1GB7 A;  3A6B Y;  3HDF A;  1GF0 A;  1E8L A;  1KY1 A;  4N8Z A;  3W6A A;  1BB6 A;  3WYH A;  1QS9 A;  3A6C Y;  4QGZ A;  123L A;  1F6R A;  2AT9 A;  4QI1 A;  5H2J A;  2LYO A;  1WQN A;  3WVY A;  3VI0 A;  2CGI A;  1BB3 A;  3CDV A;  2LZT A;  1V7T A;  1IY3 A;  2F30 A;  1C69 A;  1O23 A;  201L A;  218L A;  3SB6 A;  5LVH A;  230L A;  5C6J A;  1LZS A;  4GN5 C;  1LSD A;  4HYX A;  4H8Z A;  108L A;  4B4I A;  4H9F A;  4H8X A;  3VHZ A;  4XTO A;  3P68 A;  5KXO A;  1G06 A;  1H87 A;  4DT3 A;  4IB4 A;  2I25 L;  4B49 A;  1IXF A;  254L A;  3A93 A;  1CV5 A;  4LDL A;  1LSG A;  4TX7 A;  2H9J A;  165L A;  1GBZ A;  1EPY A;  3HDE A;  4EJ4 A;  3P66 A;  2EQL A;  1GF3 A;  5APD A;  1LLH A;  3EBA B;  3G3W A;  3AYQ A;  1C6G A;  4XJG A;  2DQC Y;  5LYT A;  3W6F A;  2I20 A;  1GF7 A;  1L00 A;  1GBY A;  1L16 A;  3LYO A;  1L50 A;  4GLA A;  3HUQ A;  3C81 A;  3HAN A;  3VGA A;  1GDW A;  1L28 A;  4JKV A;  1NF5 A;  1IP2 A;  4WM1 A;  1L90 A;  200L A;  233L A;  1R2N A;  3A96 A;  1JEF A;  4PHI A;  4WLX A;  1DYE A;  4DQ5 A;  1IP6 A;  4DKL A;  1P36 A;  3EH3 B;  2L78 A;  4YEO A;  1IP3 A;  5DN5 A;  1LMN A;  2B6T A;  1EQ5 A;  6LYT A;  3L64 A;  4J7V A;  3QJU B;  1WTH A;  1LYD A;  1IR8 A;  185L A;  1EQE A;  1S53 A;  4NGO A;  4DQJ A;  1CX6 A;  1KIP C;  1L05 A;  231L A;  2QPE B;  2OE7 X;  2Z19 A;  4BEZ A;  1YAO A;  1HFZ A;  4J1A A;  4A7D A;  5I4Y A;  1DYB A;  4ARL A;  2IHL A;  2B6X A;  3TXD A;  1L12 A;  4DD2 A;  1TAY A;  3HTF A;  1JKA A;  189L A;  2Y01 A;  1LYF A;  1CUQ A;  4EIY A;  2YDO A;  4NWH A;  4G71 B;  3COC A;  3J4G A;  5HLL A;  3B0I A;  4NGL A;  4GCB A;  4DDA A;  1F4Z A;  1LHL A;  4UHR A;  1SWY A;  3T45 A;  3DMV A;  143L A;  4G49 A;  3TXK A;  4W52 A;  1CV3 A;  5KXY A;  3W6B A;  5BR5 A;  4TSC A;  1L9H A;  1L58 A;  1LMT A;  3CB7 A;  252L A;  2BQA A;  1HEM A;  1S52 A;  4K5Y A;  5DHG A;  214L A;  1CU6 A;  1IR9 A;  3GUO A;  1G1W A;  2D4J A;  3N9E A;  3SBB C;  1C64 A;  3DN4 A;  4ETD A;  4KXI A;  1GD6 A;  3DQB A;  4RDS A;  213L A;  4LDE A;  3RW8 A;  1G7L C;  1LJ3 A;  1REX A;  2B72 A;  245L A;  137L A;  4GRV A;  3P0G A;  1GBW A;  1GFV A;  1WQM A;  1BHZ A;  1LN6 A;  5AHZ A;  3QBL A;  1IOT A;  1H6M A;  3SB8 A;  1GZM A;  4ARM B;  3ZPR A;  3AYN A;  1L43 A;  4B4E A;  4Z3M A;  3OJP A;  1DPW A;  1LWG A;  2RBN A;  1VJM A;  4TTD A;  1UIH A;  3BKV A;  1LYO A;  1JSE A;  3DKE X;  4ZFP A;  180L A;  1DYG A;  3EO5 A;  2LC9 A;  1UID A;  4S0W A;  3IJU A;  1C6A A;  3SB7 A;  1OVH A;  1B7O A;  2F47 A;  1C46 A;  3C9L A;  1LJ4 A;  3PWH A;  4XJD A;  3NY8 A;  111L A;  5E4P A;  4GCD A;  4NHQ A;  5I53 A;  1OWY A;  1DI3 A;  4WMG A;  4HSF A;  223L A;  1HEL A;  1L09 A;  1FBB A;  221L A;  1UIA A;  4H9I A;  4I7N A;  1C6B A;  5KKI A;  1OUF A;  2DQI Y;  4I0C A;  5LVK A;  1JTP L;  4WLD A;  1YL0 X;  5B6W A;  1G7I C;  1B5U A;  1FLW A;  1YQV Y;  1N4F A;  1S54 A;  1CWQ A;  3EMS A;  1LSF A;  1RFP A;  1P6Y A;  1WQQ A;  210L A;  5F9X A;  2Z37 A;  1XME B;  1GB8 A;  261L A;  1LHI A;  5G2C A;  3CAP A;  3X3B A;  4GBR B;  2OE4 X;  1WTN A;  1HHL A;  1GF5 A;  6LZM A;  5BR2 A;  4GCF A;  104L A;  1KG9 A;  1L66 A;  1OV5 A;  4XT3 A;  1QKO A;  3CT0 A;  2B74 A;  1MGY A;  5APE A;  1L15 A;  4W57 A;  2CJL A;  1E12 A;  2C8O A;  3W3E A;  5KXW A;  4HWL A;  2A7D A;  1L39 A;  2BRD A;  3WU8 A;  229L A;  1HER A;  1YAP A;  3AM6 A;  2D6B A;  2I1X A;  206L A;  4LDO A;  2RBQ A;  2L6X A;  1LCN A;  1CVK A;  3KJ6 A;  3CQL A;  3WPK A;  220L A;  1LYG A;  2RBO A;  1P37 A;  3HBE X;  5IDD A;  1C61 A;  2KSB A;  1L10 A;  4EKR A;  1OVJ A;  1L27 A;  126L A;  1L67 A;  3GUP A;  1ZVY B;  140L A;  3LN2 A;  3BKH A;  3RUN A;  4GN4 A;  2F95 A;  1GFG A;  4ARP A;  4YXC A;  1L53 A;  3F8V A;  3MBV A;  3FI7 A;  5H2M A;  1QUD A;  3COD A;  3AW6 A;  1TN5 A;  4G70 B;  5F16 A;  4MCK A;  1B9O A;  2OU0 X;  2XTH A;  1JQU A;  3C82 A;  4UWN A;  1W6Z A;  1QDT A;  1QTB A;  2ZQ3 A;  122L A;  5HNC A;  2Q9D A;  1LMA A;  1GPQ C;  4WM2 A;  207L A;  160L A;  4XJI A;  1G0L A;  1IR7 A;  4BAP A;  4NHI A;  1CU5 A;  1CNS A;  1CV1 A;  1LI3 A;  4WOA A;  1LOZ A;  1SSW A;  3TMV A;  4W51 A;  4NSJ A;  2VB1 A;  1KIQ C;  2YBH A;  3FE0 A;  4XXJ A;  2MEI A;  1GFJ A;  1SX2 A;  1UAZ A;  1PQO A;  1P2L A;  2A7F A;  1OYU A;  234L A;  1QUG A;  2JAG A;  4QID A;  1L52 A;  1FLQ A;  1NWG A;  5KKJ A;  4MQS A;  1KY0 A;  3C7W A;  5G36 A;  1B5W A;  1JIS A;  2LZM A;  3G3X A;  3K2R A;  1L24 A;  4OWC A;  1KXX A;  1CUP A;  1P8U A;  2J4Y A;  3BVD B;  1UCO A;  2XJW A;  4BAF A;  4X31 A;  2ZZL A;  3RT5 X;  1L07 A;  1O0A A;  2ZIK A;  1C6L A;  1JWR A;  1L65 A;  1NDG C;  2HEB A;  1C6D A;  1OV7 A;  3HH5 A;  4MD2 A;  5KXS A;  1C6J A;  5JJJ A;  1LI2 A;  1C6K A;  1F0W A;  1UIB A;  1P8I A;  4XJH A;  3AW7 A;  1BM1 A;  4I7P A;  3ATN A;  4ANR A;  5B6X A;  1XEI A;  4QDN A;  1LZC A;  154L A;  1VDS A;  1GB0 A;  3CSQ A;  145L A;  2O4W A;  1L47 A;  1BB5 A;  1CKH A;  253L A;  3B0O A;  3WMK A;  1X0I 1;  1D9U A;  1L0M A;  1GE1 A;  5FCP A;  198L A;  1CKD A;  4DD7 A;  3E3D A;  3TMU A;  1C60 A;  219L A;  5LIN A;  4MQT A;  1IC7 Y;  1C8S A;  1BGI A;  4G7S B;  1NBY C;  2HEA A;  1ZYT A;  1L54 A;  1L31 A;  4NGJ A;  1UIF A;  4H9C A;  1B7N A;  4MBS A;  1J1P Y;  1QM8 A;  4HTN A;  4W59 A;  1QHJ A;  1P8H A;  217L A;  1L46 A;  1L35 A;  5B0W A;  1D2Y A;  1MLC E;  3HTB A;  1M0L A;  1VAU A;  4NHS A;  1JTM A;  1QIO A;  4HPE A;  1LZG A;  1LJN A;  4OWE A;  3SBA A;  2ZWB A;  2XQO A;  1L20 A;  3S3C B;  2BQO A;  3G3V A;  4N9R A;  4LT0 A;  1JKD A;  1WTM A;  4QY9 A;  3AZ5 A;  4DQ7 A;  1L77 A;  3CDR A;  236L A;  1L97 A;  3AGH A;  208L A;  5LYM A;  1F6S A;  232L A;  2DKV A;  3LZM A;  1JV7 A;  2F2N A;  4HTQ A;  2BQI A;  1L14 A;  3EML A;  2X0A A;  4DD1 A;  1GUE A;  1REY A;  2BQL A;  1L76 A;  1C3W A;  3N9C A;  4B0D A;  1L41 A;  5H2L A;  1C6N A;  1LYH A;  2MEG A;  3KAM A;  155L A;  3ULR A;  4GYC A;  3SN6 R;  4DAJ A;  2F2Q A;  4XN6 A;  3EH4 B;  1ZV5 L;  3QJS B;  1GFE A;  5FEL A;  4BV0 A;  4EMN A;  4HJY A;  4DD9 A;  3NY9 A;  3S3B B;  4NIJ A;  1DPX A;  163L A;  1GE0 A;  1NQI A;  1T8F A;  4YOP A;  5EBH A;  2NTH A;  1JV6 A;  3RZ4 A;  1UUZ C;  2MEE A;  1CKF A;  3HH3 A;  2RSC A;  3UG9 A;  1JUG A;  1QTZ A;  4HPI A;  1LZ6 A;  3M3U A;  107L A;  1UC0 A;  1L48 A;  2GV0 A;  1IOQ A;  1OUI A;  1L86 A;  2OU9 A;  1IWV A;  2R4S A;  2N5Z A;  2F32 A;  1C8R A;  2B6Z A;  1OVK A;  2YCW A;  2M3G A;  2FYD A;  5LVG A;  1B7S A;  3GXK A;  2DQE Y;  3M18 B;  5ILC A;  1JHL A;  5APF A;  4LT3 A;  4BAD A;  1TEW A;  258L A;  4HJV A;  4H90 A;  1DI5 A;  1H2S A;  205L A;  2DBT A;  3GUK A;  4OOO A;  1BWI A;  3VG9 A;  3HBD A;  1GFR A;  1DYA A;  3WU9 A;  1L06 A;  4JQ6 A;  2LHM A;  2Z55 A;  1QT3 A;  256L A;  1LKR A;  1LHJ A;  1L02 A;  3WXU A;  4H9E A;  1X0K 1;  3F6Z A;  1REZ A;  1HEW A;  2ZIJ A;  2EIZ C;  2Y00 A;  2WAR A;  1M0K A;  1GE3 A;  4BWB A;  5LAG A;  2ZIY A;  1IWU A;  1BQL Y;  4WM5 A;  1KNI A;  1LZD A;  1L85 A;  2ANV A;  3C7Z A;  1C65 A;  2WJL A;  1C6C A;  4RW1 A;  3QDC A;  1GF9 A;  3S3D B;  3VWO A;  3A3Q A;  3B72 A;  1PQD A;  1QUH A;  4MST A;  4CFO A;  4H9H A;  1L08 A;  1W08 A;  3DN3 A;  3WXT A;  2NTW A;  4WW3 A;  4LFX A;  5KXZ A;  3AZ4 A;  4BVN A;  5G54 A;  3IJV A;  3WW5 A;  1RI8 B;  2RBR A;  1CJ8 A;  1LZB A;  1GHL A;  1XEK A;  5TGZ A;  1C63 A;  1UIG A;  2H5Z A;  146L A;  3QJT B;  4N4Y B;  5KXK A;  1LMQ A;  2MEC A;  1B7L A;  3DMX A;  3HWL A;  153L A;  1B5X A;  1GDX A;  4ETB A;  4OV0 A;  1NDM C;  1GFA A;  3SP3 A;  3FA0 A;  4Z98 A;  1OUJ A;  3HU8 A;  4WM6 A;  4HV1 A;  2KS9 A;  2BQH A;  1IWY A;  3GXR A;  5G2D A;  4GP4 B;  2BQJ A;  1IP5 A;  3A95 A;  4NGZ A;  4OWH A;  1C6E A;  150L A;  4TWS A;  1L25 A;  4KT3 A;  5A3Z A;  4NHT A;  4N5R A;  192L A;  2ANX A;  4NGK A;  1AT6 A;  1OUB A;  5E9R A;  5KJ9 A;  1BVX A;  2HTX A;  1XSF A;  1D3F A;  2AUB A;  1BB7 A;  4DD3 A;  2HUB A;  4R6C A;  1GFT A;  2HED A;  6LYZ A;  3CDT A;  1F10 A;  212L A;  1LMC A;  1SWZ A;  1VDP A;  1CKC A;  1QTH A;  134L A;  1ZUR A;  3W6C A;  1B2K A;  2YBM A;  4H93 A;  4EPF A;  1T6H A;  1LSY A;  5IHG A;  1VDQ A;  1JJ3 A;  1XGP C;  5F14 A;  5B1G A;  4TL3 A;  1LSM A;  3LYT A;  1H68 A;  164L A;  109L A;  1QUS A;  1XGQ C;  3HT9 A;  1ZVH L;  148L E;  1WQO A;  1L0K A;  1DYC A;  1D9W A;  215L A;  239L A;  4KPM A;  1LZ9 A;  1YRO A;  1DZB X;  1L92 A;  1P3N A;  4G72 B;  103L A;  152L A;  2BQG A;  2CUU A;  1CJ7 A;  2BQC A;  1ZMY L;  3WUM A;  235L A;  3SB9 A;  2Y8P A;  1NMM A;  1HSX A;  196L A;  4DDB A;  1AT5 A;  2HU3 A;  112L A;  3A7K A;  2HUM A;  4O34 A;  1L73 A;  1HML A;  1Q5I A;  5AZD A;  1P64 A;  168L A;  4N1E I;  2DQF C;  3MGW A;  1S8L A;  3LHM A;  1QQY A;  3ODU A;  228L A;  1GXX A;  4X1H A;  1L30 A;  2YBN A;  3ZVQ A;  1LSC A;  199L A;  1SX7 A;  1T8G A;  1TDY A;  1BRD A;  1CU3 A;  1G1V A;  2RAZ X;  4ET8 A;  1GBS A;  1C08 C;  4EKP A;  4ARQ A;  2G4N A;  2Z73 A;  5DM9 A;  1LSE A;  1RE2 A;  3DN8 A;  1FKV A;  1B0D A;  1LI6 A;  4WL6 A;  1JPO A;  3S8G B;  1LZT A;  1WQP A;  1LGW A;  2BQK A;  4X3B A;  1D0M A;  2RH1 A;  1QT8 A;  3GUN A;  4AGA A;  5M1Y A;  3WVX A;  2YSS C;  1P5C A;  3WW6 A;  1UBZ A;  2ZNX Y;  1IP7 A;  1XEP A;  1NHB A;  4ET9 A;  128L A;  2RB2 X;  1JTN A;  4GLV A;  138L A;  1L13 A;  4Z41 A;  4BS7 A;  159L A;  9LYZ A;  4IAR A;  1GB2 A;  255L A;  5H2N A;  2B73 A;  3ZEV A;  1LZA A;  1XFP L;  1QS5 A;  5B6V A;  2Q9E A;  4L6R A;  1IIZ A;  1L19 A;  1LJE A;  2F4A A;  4XEN A;  5H2O A;  4HV2 A;  1YAN A;  170L A;  1L61 A;  1GXV 2;  1WVV A;  1T6V L;  3QAP A;  4W53 A;  3HAR A;  3CDO A;  5EN0 A;  4LYT A;  1FBI X;  1QSQ A;  1RJC B;  1YIL A;  1LYJ A;  4W56 A;  1L89 A;  4NSG A;  2XBR A;  1KS3 A;  2ZIL A;  2OEA X;  1HNL A;  1CU0 A;  1G0M A;  3GUJ A;  1L63 A;  158L A;  1LJH A;  1IO5 A;  3TXB A;  4QEQ A;  1L94 A;  4WG7 A;  1KME A;  1D0L A;  1JJ0 A;  1SQ2 L;  3TXF A;  1D0K A;  1C45 A;  249L A;  1AZF A;  1VDT A;  2LYM A;  1UCQ A;  1OUD A;  3OE9 A;  4PRQ A;  4UWU A;  1LZ1 A;  2YCZ A;  3OE0 A;  3LYZ A;  4LT1 A;  4L35 A;  1ALC A;  2DQH Y;  4NGY A;  1UIC A;  5DHH A;  1QUO A;  3UTV A;  2RAY X;  3C8S A;  241L A;  1LSB A;  4H91 A;  3DN0 A;  3UTY A;  1L56 A;  3TMX A;  1GB3 A;  1IW9 A;  5L9J A;  1QTD A;  1L51 A;  4DYG A;  1DYD A;  2XBS A;  5LYZ A;  2WJK A;  5G28 A;  1EL1 A;  3WQJ A;  4NGW A;  1GAY A;  5HQ1 A;  3C7Y A;  1F88 A;  227L A;  4LZT A;  120L A;  1LYY A;  1LZN A;  1YL1 X;  149L A;  3ZPQ A;  1JIT A;  1PY6 A;  4PRU A;  5FEK A;  1SSY A;  225L A;  4R0F A;  3HFM Y;  1QKP A;  3ZEK A;  1NKH A;  3GUI A;  3T6U A;  1P56 A;  1D3J A;  1QT6 A;  5B35 A;  3P64 A;  3QBG A;  3G3A B;  1QTV A;  2BAA A;  1KXY A;  1YKX X;  118L A;  1B6I A;  3WPL A;  1LKS A;  1L75 A;  3W6E A;  1DZE A;  4G9S A;  1FLY A;  3A34 A;  4WLY A;  2YDV A;  1IOR A;  2JAF A;  1DKK A;  4XYY A;  1FN5 A;  4YXA C;  2BLY A;  2KSY A;  2R4R A;  1KGB A;  4B1A A;  2YVB A;  5IEL A;  2BQF A;  1L45 A;  1L40 A;  1HMK A;  2IGC A;  1G7H C;  1A4V A;  1J1O Y;  5FST A;  1L37 A;  188L A;  2G4P A;  1JKC A;  1IOS A;  1UAC Y;  5C6L A;  1CKG A;  5KY1 A;  4NFV A;  197L A;  3PDS A;  2B7X A;  1A2Y C;  4WO6 A;  5D5F A;  5APC A;  3VW7 A;  3DN2 A;  1HZX A;  2H9K A;  2QAR C;  4EPI A;  7LYZ A;  3VVK A;  1G7J C;  4G7Q B;  1GE2 A;  2BQE A;  176L A;  1KIR C;  4DWX A;  4OWB A;  4I7O A;  4YEM A;  1Z55 A;  2C8P A;  3LZ2 A;  1L29 A;  4A4M A;  1LZR A;  2YDG A;  3WU7 A;  4AXT A;  1B7M A;  1I56 A;  1P2C C;  2D4I A;  1LZ4 A;  4LYZ A;  3RU5 A;  3NS0 A;  1D6Q A;  3S8F B;  3HBH A;  3QY4 A;  2LNL A;  4IAT A;  1L74 A;  4II8 A;  2FBB A;  4XT1 A;  1C6I A;  5FDJ A;  1G7M C;  3TMW A;  4HP0 A;  3ABW A;  1OUC A;  2LZ2 A;  1C62 A;  4N6H A;  3D3D A;  193L A;  1L49 A;  4TUN A;  1CTW A;  2HU1 A;  2RB0 X;  1S8J A;  5LZM A;  3A67 Y;  2FYC A;  2MED A;  1LZ8 A;  4ETE A;  5G2A A;  1GBX A;  4FA7 B;  5I54 A;  2B5Z A;  1IWX A;  4I7M A;  1GWD A;  1IC4 Y;  5C6I A;  1HF4 A;  1LJK A;  250L A;  1G07 A;  4L41 A;  1DYF A;  1PQM A;  1GF8 A;  4GP8 B;  4BUO A;  3D9A C;  2B6W A;  3IWR A;  5F81 A;  1L11 A;  4FJR A;  2F4G A;  5DL9 A;  1MEL L;  4XJB A;  174L A;  1LSP A;  1I1Z A;  1IP1 A;  2BQD A;  1L91 A;  1T8A A;  130L A;  1G0K A;  2BQB A;  2ZQ4 A;  1C6H A;  4ETC A;  1L55 A;  3WPJ A;  162L A;  1L32 A;  4PXF A;  4OW1 A;  3WL2 A;  1LHM A;  2Y02 A;  2VT4 A;  5KXX A;  3EXD A;  2HPY A;  1CV6 A;  1C10 A;  4CHX A;  1PQI A;  4H9A A;  1G0G A;  1B5Z A;  3W6D A;  1BRX A;  1C66 A;  5A45 A;  3HTD A;  1FBK A;  1EQ4 A;  1T97 A;  2RBP A;  4CJ2 A;  1DKJ A;  5KXR A;  4KLY A;  1KG8 A;  1PQJ A;  3DN1 A;  3HT8 A;  2B75 A;  244L A;  1L69 A;  1LHH A;  110L A;  5LVI A;  1YAM A;  1L99 A;  1DXJ A;  5KXT A;  4XAD A;  3TXJ A;  3B0K A;  2Q0M X;  1ZWN A;  4M6D A;  177L A;  1OP9 B;  3CDQ A;  4BEY A;  2Y03 A;  1GE4 A;  1L17 A;  1G0Q A;  2MEH A;  4PJZ A;  1AT9 A;  182L A;  114L A;  4GCE A;  2DQJ Y;  4LGK A;  2IFF Y;  4I7K A;  1L72 A;  5KKH A;  1LYZ A;  1U19 A;  1HEN A;  1LZY A;  4GP5 B;  3HT6 A;  5I4X A;  2PED A;  1QT5 A;  3WH1 A;  4B4J A;  3NSB A;  2I35 A;  2F93 A;  5AHY A;  5LWE A;  1LGX A;  1L62 A;  1LPI A;  1L64 A;  216L A;  4U3X B;  4MR1 A; 
#chains in the Genus database with same CATH homology
 2W1Y A;  1IWZ A;  4E3U A;  161L A;  4H1P A;  1JFP A;  1BWH A;  1GB9 A;  3A90 A;  1IOC A;  4AMJ A;  4NGI A;  3TXG A;  4GN3 A;  4H8Y A;  4CFP A;  3X3C A;  5B34 A;  1QSA A;  1LWK A;  1JTT L;  4W96 A;  1HFY A;  3DMZ A;  5I14 A;  1B5Y A;  1PXS A;  3C80 A;  2NWD X;  156L A;  3AGI A;  1C67 A;  2Z38 A;  4EA3 A;  191L A;  4Y9H A;  3A94 A;  1QTK A;  2Z12 A;  1L01 A;  4H9B A;  1YKY X;  4H92 A;  4DJH A;  4RLN A;  2LYZ A;  3D4S A;  238L A;  1GFH A;  3C8R A;  4CGE A;  167L A;  1IX0 A;  4HYJ A;  1OWZ A;  1L18 A;  4WLT A;  3CSZ A;  1LHK A;  4LZM A;  5J7C A;  1LYE A;  237L A;  5J7A A;  1AKI A;  1I20 A;  5H2P A;  1I6S A;  3DNA A;  1FKQ A;  3HUK A;  1JTO L;  4ZPU A;  1GEZ A;  5I5Q A;  1AP9 A;  2CWI A;  5H2I A;  4LYM A;  1LJG A;  4OWA A;  3PQR A;  3RFM A;  1CV4 A;  2Z2E A;  1GEV A;  1XGR C;  2MEA A;  5KXP A;  4N4W A;  3CSR A;  1TBY A;  2HUK A;  1C6P A;  1XJU A;  2EI4 A;  4E97 A;  173L A;  4OOT A;  1L79 A;  3LZT A;  3CT1 A;  240L A;  3WUN A;  1RCM A;  1L34 A;  4M4O A;  1LSN A;  4N1C C;  251L A;  1CJ9 A;  224L A;  1KW5 A;  1V7S A;  4PXK A;  4KL7 A;  5A8E A;  3GUL A;  1GB6 A;  1L93 A;  2A4T A;  1NHE A;  3F9L A;  1XGT C;  144L A;  1L57 A;  2DQG Y;  1OUH A;  2HUL A;  4N0J A;  3AB6 A;  3AJN A;  3LYM A;  5KXN A;  184L A;  1L03 A;  1IEE A;  3WUL A;  1KW7 A;  1UA6 Y;  2KSA A;  1GBO A;  3AZ6 A;  1OUE A;  4XTL A;  4NSH A;  3P65 A;  4IAQ A;  4C5F A;  2YBL A;  1GFK A;  3QBI A;  3TXH A;  247L A;  1L44 A;  5ETZ A;  1IWW A;  1CU2 A;  4P2E A;  1OUG A;  243L A;  2I26 L;  4XTN A;  1L23 A;  5D5C A;  2Y04 A;  1CJ6 A;  222L A;  1B5V A;  4PK0 A;  5F9U A;  5K7O A;  5ITC A;  5FHW A;  1L60 A;  3TXE A;  2DQA A;  1BWJ A;  2HEE A;  3A8Z A;  1YKZ X;  1LSA A;  5HMV A;  4AMI A;  133L A;  5H2K A;  1L80 A;  3UTW A;  3CT5 A;  1VFB C;  1D2W A;  1C6F A;  4NC3 A;  1L22 A;  3QAK A;  1X0S A;  5B59 A;  2W1X A;  1HEQ A;  3C9M A;  1LAA A;  113L A;  1OQM A;  2G4Q A;  4FAA B;  1C68 A;  2NTG A;  1B7P A;  1REM A;  1L68 A;  5B6Z A;  2YBI A;  1EHK B;  1GFU A;  1IVM A;  131L A;  2D4K A;  5KXM A;  1LJJ A;  1C6Q A;  3QJV B;  1IP4 A;  102L A;  3G3B B;  4NG1 A;  5DN4 A;  1LMP A;  3OK0 A;  1XIO A;  3JR6 A;  3OAX A;  1BRR A;  1QTE A;  3PBL A;  2HEC A;  4DC4 A;  7LZM A;  1L98 A;  2BQN A;  4RW2 A;  1PZY A;  2QPD B;  1L21 A;  8LYZ A;  2ZYP A;  1HSW A;  2LCB A;  5ITE A;  242L A;  1L71 A;  2W1L A;  3DN6 A;  260L A;  1L84 A;  2B70 A;  4HTK A;  1F50 A;  1XJI A;  3HUA A;  1TN0 A;  1JSF A;  1PS5 A;  1C6T A;  5I4W A;  2Z2F A;  2O7A A;  1L82 A;  1L36 A;  1YIK A;  5AX0 A;  1R84 A;  4GCC A;  5LVJ A;  1K28 A;  2QB0 B;  2EKS C;  1L88 A;  2MEB A;  3AZ7 A;  2RB1 X;  1NBZ C;  190L A;  4IAS A;  1QSW A;  2PC2 A;  4I7R A;  4NG8 A;  2ZYC A;  3HAS A;  2Z6B A;  4I7T A;  187L A;  5FJG A;  4DD0 A;  3DDL A;  171L A;  2DQD Y;  2RBS A;  3L2X A;  4LFP A;  5KXL A;  141L A;  3UTX A;  1LSZ A;  4UWV A;  3RZE A;  1LJI A;  1PQK A;  4FPD A;  3UON A;  1JGJ A;  3EH5 B;  1JJ1 A;  1TLA A;  175L A;  3AYM A;  4WAV A;  139L A;  5LA8 A;  178L A;  3K3T A;  1JKB A;  4Z46 A;  2B6Y A;  1WVU A;  195L A;  4LYO A;  4I7S A;  4IJ4 A;  2D91 A;  4WO9 A;  4AQN A;  3B6L A;  1P46 A;  1Q5J A;  5C1M A;  135L A;  248L A;  4I7Q A;  1L42 A;  4X32 A;  2G87 A;  1GU8 A;  2YCX A;  5JJE A;  4I7J A;  3HAO A;  226L A;  4EXM A;  4DDC A;  1QTC A;  1L33 A;  4WG1 A;  1P7S A;  2BPU A;  1E0P A;  4NEB A;  1XGU C;  4NSI A;  2EPE A;  4I7L A;  1VGO A;  2OTZ X;  3OE6 A;  1L70 A;  1FLU A;  3ATO A;  5HMJ A;  2FBD A;  186L A;  4PGJ B;  1CV0 A;  1L83 A;  1T3P A;  1HFX A;  1DI4 A;  5II3 A;  5LA5 A;  1D3M A;  4G4C A;  5ILF A;  4XJF A;  3TXI A;  119L A;  4GPO A;  3FI5 A;  3HH6 A;  5DLA A;  4EKQ A;  5L3I A;  3GUM A;  2MEF A;  4WL7 A;  1TCY A;  1IWT A;  1J1X Y;  2ZNW Y;  2Z39 A;  4MD1 A;  1L59 A;  3UZA A;  1GF4 A;  4ETA A;  2ZFE A;  4FDY A;  1XEJ A;  1IW6 A;  4C3W A;  5AWZ A;  1LJF A;  4J1B A;  157L A;  3QJQ B;  1GB5 A;  2CDS A;  3HTG A;  4ARM A;  4TSB A;  4NWE A;  181L A;  5DYS A;  4NY5 A;  5HNL A;  3QNG A;  4KNF A;  4G7R B;  3OE8 A;  4LYB A;  1L81 A;  3A92 A;  4J0L A;  5G53 A;  1LMO A;  3V2Y A;  1BVK C;  5B6Y A;  4YF2 A;  1SLY A;  1XJT A;  3PXO A;  4H94 A;  1C43 A;  1IY4 A;  1YAQ A;  1D6P A;  4EOF A;  3NYA A;  3QBK A;  5H2H A;  4DS7 E;  4J4Q A;  1HC0 A;  5B06 A;  2OU8 A;  4RLM A;  1LYS A;  2YBJ A;  3RNX A;  5B1F A;  1C6M A;  4UG2 A;  5B2N A;  1L04 A;  3A91 A;  1INU A;  1G0P A;  1OUA A;  2I6Z A;  4ARJ A;  4PPO A;  1HEP A;  1JIY A;  5A44 A;  4NHP A;  1WQR A;  5A3E A;  1CX7 A;  1C7P A;  2X72 A;  4W54 A;  5LAF A;  2BQM A;  4W55 A;  209L A;  4ZEE A;  1QSB A;  3FAD A;  1P2R A;  1VAT A;  1QDR A;  1HEO A;  4G4B A;  142L A;  1L0J A;  4EKS A;  4JR8 A;  1LPY A;  1D3N A;  4WM3 A;  129L A;  127L A;  166L A;  1LYI A;  2W1M A;  2OTY X;  5LXW A;  4LT2 A;  1S51 A;  151L A;  246L A;  1QUT A;  4OO9 A;  4YM8 A;  4GBR A;  1B7R A;  1LZ5 A;  3HAP A;  1LZE A;  1BB4 A;  3AGG G;  5JJN A;  3REY A;  3V2W A;  4FBZ A;  3HH4 A;  4W58 A;  3HAQ A;  211L A;  4IAP A;  4NGV A;  257L A;  4G4H A;  4YX7 C;  5B05 A;  1FDL Y;  3HU9 A;  1B7Q A;  2BLX A;  1LGU A;  1IC5 Y;  1G0J A;  4YEN A;  4I8S A;  1KXW A;  5T3F A;  169L A;  115L A;  4LYC A;  1QT4 A;  1GF6 A;  1LTM A;  3WUA A;  125L A;  194L A;  1QT7 A;  3C83 A;  3UZC A;  1VED A;  2HEF A;  1AM7 A;  3SB5 A;  4ZIX A;  5B07 A;  5AX1 A;  4WM4 A;  1PXR A;  2YCY A;  3HT7 A;  3T36 A;  3N9A A;  172L A;  1LW9 A;  1L95 A;  4QRY A;  3A3R X;  1L26 A;  5F8U A;  3QE8 A;  2NTU A;  2O79 A;  2Z18 A;  132L A;  1UIE A;  1L96 A;  4W94 A;  2I21 A;  5L3H A;  3QJR B;  3P4Z A;  3ZVQ B;  5JEN B;  3J6K A;  4D9Z A;  1L38 A;  1DQJ C;  147L A;  4ARQ B;  3C8Q A;  259L A;  4PJ2 C;  1M0M A;  5AMY A;  2OE9 X;  1L87 A;  5LIO A;  1GAZ A;  4HJZ A;  183L A;  262L A;  4ML7 A;  1GB7 A;  3A6B Y;  3HDF A;  1GF0 A;  1E8L A;  1KY1 A;  4N8Z A;  3W6A A;  1BB6 A;  3WYH A;  1QS9 A;  3A6C Y;  4QGZ A;  123L A;  1F6R A;  2AT9 A;  4QI1 A;  5H2J A;  2LYO A;  1WQN A;  3WVY A;  3VI0 A;  2CGI A;  1BB3 A;  3CDV A;  2LZT A;  1V7T A;  1IY3 A;  2F30 A;  1C69 A;  1O23 A;  201L A;  218L A;  3SB6 A;  5LVH A;  230L A;  5C6J A;  1LZS A;  4GN5 C;  1LSD A;  4HYX A;  4H8Z A;  108L A;  4B4I A;  4H9F A;  4H8X A;  3VHZ A;  4XTO A;  3P68 A;  5KXO A;  1G06 A;  1H87 A;  4DT3 A;  4IB4 A;  2I25 L;  4B49 A;  1IXF A;  254L A;  3A93 A;  1CV5 A;  4LDL A;  1LSG A;  4TX7 A;  2H9J A;  165L A;  1GBZ A;  1EPY A;  3HDE A;  4EJ4 A;  3P66 A;  2EQL A;  1GF3 A;  5APD A;  1LLH A;  3EBA B;  3G3W A;  3AYQ A;  1C6G A;  4XJG A;  2DQC Y;  5LYT A;  3W6F A;  2I20 A;  1GF7 A;  1L00 A;  1GBY A;  1L16 A;  3LYO A;  1L50 A;  4GLA A;  3HUQ A;  3C81 A;  3HAN A;  3VGA A;  1GDW A;  1L28 A;  4JKV A;  1NF5 A;  1IP2 A;  4WM1 A;  1L90 A;  200L A;  233L A;  1R2N A;  3A96 A;  1JEF A;  4PHI A;  4WLX A;  1DYE A;  4DQ5 A;  1IP6 A;  4DKL A;  1P36 A;  3EH3 B;  2L78 A;  4YEO A;  1IP3 A;  5DN5 A;  1LMN A;  2B6T A;  1EQ5 A;  6LYT A;  3L64 A;  4J7V A;  3QJU B;  1WTH A;  1LYD A;  1IR8 A;  185L A;  1EQE A;  1S53 A;  4NGO A;  4DQJ A;  1CX6 A;  1KIP C;  1L05 A;  231L A;  2QPE B;  2OE7 X;  2Z19 A;  4BEZ A;  1YAO A;  1HFZ A;  4J1A A;  4A7D A;  5I4Y A;  1DYB A;  4ARL A;  2IHL A;  2B6X A;  3TXD A;  1L12 A;  4DD2 A;  1TAY A;  3HTF A;  1JKA A;  189L A;  2Y01 A;  1LYF A;  1CUQ A;  4EIY A;  2YDO A;  4NWH A;  4G71 B;  3COC A;  3J4G A;  5HLL A;  3B0I A;  4NGL A;  4GCB A;  4DDA A;  1F4Z A;  1LHL A;  4UHR A;  1SWY A;  3T45 A;  3DMV A;  143L A;  4G49 A;  3TXK A;  4W52 A;  1CV3 A;  5KXY A;  3W6B A;  5BR5 A;  4TSC A;  1L9H A;  1L58 A;  1LMT A;  3CB7 A;  252L A;  2BQA A;  1HEM A;  1S52 A;  4K5Y A;  5DHG A;  214L A;  1CU6 A;  1IR9 A;  3GUO A;  1G1W A;  2D4J A;  3N9E A;  3SBB C;  1C64 A;  3DN4 A;  4ETD A;  4KXI A;  1GD6 A;  3DQB A;  4RDS A;  213L A;  4LDE A;  3RW8 A;  1G7L C;  1LJ3 A;  1REX A;  2B72 A;  245L A;  137L A;  4GRV A;  3P0G A;  1GBW A;  1GFV A;  1WQM A;  1BHZ A;  1LN6 A;  5AHZ A;  3QBL A;  1IOT A;  1H6M A;  3SB8 A;  1GZM A;  4ARM B;  3ZPR A;  3AYN A;  1L43 A;  4B4E A;  4Z3M A;  3OJP A;  1DPW A;  1LWG A;  2RBN A;  1VJM A;  4TTD A;  1UIH A;  3BKV A;  1LYO A;  1JSE A;  3DKE X;  4ZFP A;  180L A;  1DYG A;  3EO5 A;  2LC9 A;  1UID A;  4S0W A;  3IJU A;  1C6A A;  3SB7 A;  1OVH A;  1B7O A;  2F47 A;  1C46 A;  3C9L A;  1LJ4 A;  3PWH A;  4XJD A;  3NY8 A;  111L A;  5E4P A;  4GCD A;  4NHQ A;  5I53 A;  1OWY A;  1DI3 A;  4WMG A;  4HSF A;  223L A;  1HEL A;  1L09 A;  1FBB A;  221L A;  1UIA A;  4H9I A;  4I7N A;  1C6B A;  5KKI A;  1OUF A;  2DQI Y;  4I0C A;  5LVK A;  1JTP L;  4WLD A;  1YL0 X;  5B6W A;  1G7I C;  1B5U A;  1FLW A;  1YQV Y;  1N4F A;  1S54 A;  1CWQ A;  3EMS A;  1LSF A;  1RFP A;  1P6Y A;  1WQQ A;  210L A;  5F9X A;  2Z37 A;  1XME B;  1GB8 A;  261L A;  1LHI A;  5G2C A;  3CAP A;  3X3B A;  4GBR B;  2OE4 X;  1WTN A;  1HHL A;  1GF5 A;  6LZM A;  5BR2 A;  4GCF A;  104L A;  1KG9 A;  1L66 A;  1OV5 A;  4XT3 A;  1QKO A;  3CT0 A;  2B74 A;  1MGY A;  5APE A;  1L15 A;  4W57 A;  2CJL A;  1E12 A;  2C8O A;  3W3E A;  5KXW A;  4HWL A;  2A7D A;  1L39 A;  2BRD A;  3WU8 A;  229L A;  1HER A;  1YAP A;  3AM6 A;  2D6B A;  2I1X A;  206L A;  4LDO A;  2RBQ A;  2L6X A;  1LCN A;  1CVK A;  3KJ6 A;  3CQL A;  3WPK A;  220L A;  1LYG A;  2RBO A;  1P37 A;  3HBE X;  5IDD A;  1C61 A;  2KSB A;  1L10 A;  4EKR A;  1OVJ A;  1L27 A;  126L A;  1L67 A;  3GUP A;  1ZVY B;  140L A;  3LN2 A;  3BKH A;  3RUN A;  4GN4 A;  2F95 A;  1GFG A;  4ARP A;  4YXC A;  1L53 A;  3F8V A;  3MBV A;  3FI7 A;  5H2M A;  1QUD A;  3COD A;  3AW6 A;  1TN5 A;  4G70 B;  5F16 A;  4MCK A;  1B9O A;  2OU0 X;  2XTH A;  1JQU A;  3C82 A;  4UWN A;  1W6Z A;  1QDT A;  1QTB A;  2ZQ3 A;  122L A;  5HNC A;  2Q9D A;  1LMA A;  1GPQ C;  4WM2 A;  207L A;  160L A;  4XJI A;  1G0L A;  1IR7 A;  4BAP A;  4NHI A;  1CU5 A;  1CNS A;  1CV1 A;  1LI3 A;  4WOA A;  1LOZ A;  1SSW A;  3TMV A;  4W51 A;  4NSJ A;  2VB1 A;  1KIQ C;  2YBH A;  3FE0 A;  4XXJ A;  2MEI A;  1GFJ A;  1SX2 A;  1UAZ A;  1PQO A;  1P2L A;  2A7F A;  1OYU A;  234L A;  1QUG A;  2JAG A;  4QID A;  1L52 A;  1FLQ A;  1NWG A;  5KKJ A;  4MQS A;  1KY0 A;  3C7W A;  5G36 A;  1B5W A;  1JIS A;  2LZM A;  3G3X A;  3K2R A;  1L24 A;  4OWC A;  1KXX A;  1CUP A;  1P8U A;  2J4Y A;  3BVD B;  1UCO A;  2XJW A;  4BAF A;  4X31 A;  2ZZL A;  3RT5 X;  1L07 A;  1O0A A;  2ZIK A;  1C6L A;  1JWR A;  1L65 A;  1NDG C;  2HEB A;  1C6D A;  1OV7 A;  3HH5 A;  4MD2 A;  5KXS A;  1C6J A;  5JJJ A;  1LI2 A;  1C6K A;  1F0W A;  1UIB A;  1P8I A;  4XJH A;  3AW7 A;  1BM1 A;  4I7P A;  3ATN A;  4ANR A;  5B6X A;  1XEI A;  4QDN A;  1LZC A;  154L A;  1VDS A;  1GB0 A;  3CSQ A;  145L A;  2O4W A;  1L47 A;  1BB5 A;  1CKH A;  253L A;  3B0O A;  3WMK A;  1X0I 1;  1D9U A;  1L0M A;  1GE1 A;  5FCP A;  198L A;  1CKD A;  4DD7 A;  3E3D A;  3TMU A;  1C60 A;  219L A;  5LIN A;  4MQT A;  1IC7 Y;  1C8S A;  1BGI A;  4G7S B;  1NBY C;  2HEA A;  1ZYT A;  1L54 A;  1L31 A;  4NGJ A;  1UIF A;  4H9C A;  1B7N A;  4MBS A;  1J1P Y;  1QM8 A;  4HTN A;  4W59 A;  1QHJ A;  1P8H A;  217L A;  1L46 A;  1L35 A;  5B0W A;  1D2Y A;  1MLC E;  3HTB A;  1M0L A;  1VAU A;  4NHS A;  1JTM A;  1QIO A;  4HPE A;  1LZG A;  1LJN A;  4OWE A;  3SBA A;  2ZWB A;  2XQO A;  1L20 A;  3S3C B;  2BQO A;  3G3V A;  4N9R A;  4LT0 A;  1JKD A;  1WTM A;  4QY9 A;  3AZ5 A;  4DQ7 A;  1L77 A;  3CDR A;  236L A;  1L97 A;  3AGH A;  208L A;  5LYM A;  1F6S A;  232L A;  2DKV A;  3LZM A;  1JV7 A;  2F2N A;  4HTQ A;  2BQI A;  1L14 A;  3EML A;  2X0A A;  4DD1 A;  1GUE A;  1REY A;  2BQL A;  1L76 A;  1C3W A;  3N9C A;  4B0D A;  1L41 A;  5H2L A;  1C6N A;  1LYH A;  2MEG A;  3KAM A;  155L A;  3ULR A;  4GYC A;  3SN6 R;  4DAJ A;  2F2Q A;  4XN6 A;  3EH4 B;  1ZV5 L;  3QJS B;  1GFE A;  5FEL A;  4BV0 A;  4EMN A;  4HJY A;  4DD9 A;  3NY9 A;  3S3B B;  4NIJ A;  1DPX A;  163L A;  1GE0 A;  1NQI A;  1T8F A;  4YOP A;  5EBH A;  2NTH A;  1JV6 A;  3RZ4 A;  1UUZ C;  2MEE A;  1CKF A;  3HH3 A;  2RSC A;  3UG9 A;  1JUG A;  1QTZ A;  4HPI A;  1LZ6 A;  3M3U A;  107L A;  1UC0 A;  1L48 A;  2GV0 A;  1IOQ A;  1OUI A;  1L86 A;  2OU9 A;  1IWV A;  2R4S A;  2N5Z A;  2F32 A;  1C8R A;  2B6Z A;  1OVK A;  2YCW A;  2M3G A;  2FYD A;  5LVG A;  1B7S A;  3GXK A;  2DQE Y;  3M18 B;  5ILC A;  1JHL A;  5APF A;  4LT3 A;  4BAD A;  1TEW A;  258L A;  4HJV A;  4H90 A;  1DI5 A;  1H2S A;  205L A;  2DBT A;  3GUK A;  4OOO A;  1BWI A;  3VG9 A;  3HBD A;  1GFR A;  1DYA A;  3WU9 A;  1L06 A;  4JQ6 A;  2LHM A;  2Z55 A;  1QT3 A;  256L A;  1LKR A;  1LHJ A;  1L02 A;  3WXU A;  4H9E A;  1X0K 1;  3F6Z A;  1REZ A;  1HEW A;  2ZIJ A;  2EIZ C;  2Y00 A;  2WAR A;  1M0K A;  1GE3 A;  4BWB A;  5LAG A;  2ZIY A;  1IWU A;  1BQL Y;  4WM5 A;  1KNI A;  1LZD A;  1L85 A;  2ANV A;  3C7Z A;  1C65 A;  2WJL A;  1C6C A;  4RW1 A;  3QDC A;  1GF9 A;  3S3D B;  3VWO A;  3A3Q A;  3B72 A;  1PQD A;  1QUH A;  4MST A;  4CFO A;  4H9H A;  1L08 A;  1W08 A;  3DN3 A;  3WXT A;  2NTW A;  4WW3 A;  4LFX A;  5KXZ A;  3AZ4 A;  4BVN A;  5G54 A;  3IJV A;  3WW5 A;  1RI8 B;  2RBR A;  1CJ8 A;  1LZB A;  1GHL A;  1XEK A;  5TGZ A;  1C63 A;  1UIG A;  2H5Z A;  146L A;  3QJT B;  4N4Y B;  5KXK A;  1LMQ A;  2MEC A;  1B7L A;  3DMX A;  3HWL A;  153L A;  1B5X A;  1GDX A;  4ETB A;  4OV0 A;  1NDM C;  1GFA A;  3SP3 A;  3FA0 A;  4Z98 A;  1OUJ A;  3HU8 A;  4WM6 A;  4HV1 A;  2KS9 A;  2BQH A;  1IWY A;  3GXR A;  5G2D A;  4GP4 B;  2BQJ A;  1IP5 A;  3A95 A;  4NGZ A;  4OWH A;  1C6E A;  150L A;  4TWS A;  1L25 A;  4KT3 A;  5A3Z A;  4NHT A;  4N5R A;  192L A;  2ANX A;  4NGK A;  1AT6 A;  1OUB A;  5E9R A;  5KJ9 A;  1BVX A;  2HTX A;  1XSF A;  1D3F A;  2AUB A;  1BB7 A;  4DD3 A;  2HUB A;  4R6C A;  1GFT A;  2HED A;  6LYZ A;  3CDT A;  1F10 A;  212L A;  1LMC A;  1SWZ A;  1VDP A;  1CKC A;  1QTH A;  134L A;  1ZUR A;  3W6C A;  1B2K A;  2YBM A;  4H93 A;  4EPF A;  1T6H A;  1LSY A;  5IHG A;  1VDQ A;  1JJ3 A;  1XGP C;  5F14 A;  5B1G A;  4TL3 A;  1LSM A;  3LYT A;  1H68 A;  164L A;  109L A;  1QUS A;  1XGQ C;  3HT9 A;  1ZVH L;  148L E;  1WQO A;  1L0K A;  1DYC A;  1D9W A;  215L A;  239L A;  4KPM A;  1LZ9 A;  1YRO A;  1DZB X;  1L92 A;  1P3N A;  4G72 B;  103L A;  152L A;  2BQG A;  2CUU A;  1CJ7 A;  2BQC A;  1ZMY L;  3WUM A;  235L A;  3SB9 A;  2Y8P A;  1NMM A;  1HSX A;  196L A;  4DDB A;  1AT5 A;  2HU3 A;  112L A;  3A7K A;  2HUM A;  4O34 A;  1L73 A;  1HML A;  1Q5I A;  5AZD A;  1P64 A;  168L A;  4N1E I;  2DQF C;  3MGW A;  1S8L A;  3LHM A;  1QQY A;  3ODU A;  228L A;  1GXX A;  4X1H A;  1L30 A;  2YBN A;  3ZVQ A;  1LSC A;  199L A;  1SX7 A;  1T8G A;  1TDY A;  1BRD A;  1CU3 A;  1G1V A;  2RAZ X;  4ET8 A;  1GBS A;  1C08 C;  4EKP A;  4ARQ A;  2G4N A;  2Z73 A;  5DM9 A;  1LSE A;  1RE2 A;  3DN8 A;  1FKV A;  1B0D A;  1LI6 A;  4WL6 A;  1JPO A;  3S8G B;  1LZT A;  1WQP A;  1LGW A;  2BQK A;  4X3B A;  1D0M A;  2RH1 A;  1QT8 A;  3GUN A;  4AGA A;  5M1Y A;  3WVX A;  2YSS C;  1P5C A;  3WW6 A;  1UBZ A;  2ZNX Y;  1IP7 A;  1XEP A;  1NHB A;  4ET9 A;  128L A;  2RB2 X;  1JTN A;  4GLV A;  138L A;  1L13 A;  4Z41 A;  4BS7 A;  159L A;  9LYZ A;  4IAR A;  1GB2 A;  255L A;  5H2N A;  2B73 A;  3ZEV A;  1LZA A;  1XFP L;  1QS5 A;  5B6V A;  2Q9E A;  4L6R A;  1IIZ A;  1L19 A;  1LJE A;  2F4A A;  4XEN A;  5H2O A;  4HV2 A;  1YAN A;  170L A;  1L61 A;  1GXV 2;  1WVV A;  1T6V L;  3QAP A;  4W53 A;  3HAR A;  3CDO A;  5EN0 A;  4LYT A;  1FBI X;  1QSQ A;  1RJC B;  1YIL A;  1LYJ A;  4W56 A;  1L89 A;  4NSG A;  2XBR A;  1KS3 A;  2ZIL A;  2OEA X;  1HNL A;  1CU0 A;  1G0M A;  3GUJ A;  1L63 A;  158L A;  1LJH A;  1IO5 A;  3TXB A;  4QEQ A;  1L94 A;  4WG7 A;  1KME A;  1D0L A;  1JJ0 A;  1SQ2 L;  3TXF A;  1D0K A;  1C45 A;  249L A;  1AZF A;  1VDT A;  2LYM A;  1UCQ A;  1OUD A;  3OE9 A;  4PRQ A;  4UWU A;  1LZ1 A;  2YCZ A;  3OE0 A;  3LYZ A;  4LT1 A;  4L35 A;  1ALC A;  2DQH Y;  4NGY A;  1UIC A;  5DHH A;  1QUO A;  3UTV A;  2RAY X;  3C8S A;  241L A;  1LSB A;  4H91 A;  3DN0 A;  3UTY A;  1L56 A;  3TMX A;  1GB3 A;  1IW9 A;  5L9J A;  1QTD A;  1L51 A;  4DYG A;  1DYD A;  2XBS A;  5LYZ A;  2WJK A;  5G28 A;  1EL1 A;  3WQJ A;  4NGW A;  1GAY A;  5HQ1 A;  3C7Y A;  1F88 A;  227L A;  4LZT A;  120L A;  1LYY A;  1LZN A;  1YL1 X;  149L A;  3ZPQ A;  1JIT A;  1PY6 A;  4PRU A;  5FEK A;  1SSY A;  225L A;  4R0F A;  3HFM Y;  1QKP A;  3ZEK A;  1NKH A;  3GUI A;  3T6U A;  1P56 A;  1D3J A;  1QT6 A;  5B35 A;  3P64 A;  3QBG A;  3G3A B;  1QTV A;  2BAA A;  1KXY A;  1YKX X;  118L A;  1B6I A;  3WPL A;  1LKS A;  1L75 A;  3W6E A;  1DZE A;  4G9S A;  1FLY A;  3A34 A;  4WLY A;  2YDV A;  1IOR A;  2JAF A;  1DKK A;  4XYY A;  1FN5 A;  4YXA C;  2BLY A;  2KSY A;  2R4R A;  1KGB A;  4B1A A;  2YVB A;  5IEL A;  2BQF A;  1L45 A;  1L40 A;  1HMK A;  2IGC A;  1G7H C;  1A4V A;  1J1O Y;  5FST A;  1L37 A;  188L A;  2G4P A;  1JKC A;  1IOS A;  1UAC Y;  5C6L A;  1CKG A;  5KY1 A;  4NFV A;  197L A;  3PDS A;  2B7X A;  1A2Y C;  4WO6 A;  5D5F A;  5APC A;  3VW7 A;  3DN2 A;  1HZX A;  2H9K A;  2QAR C;  4EPI A;  7LYZ A;  3VVK A;  1G7J C;  4G7Q B;  1GE2 A;  2BQE A;  176L A;  1KIR C;  4DWX A;  4OWB A;  4I7O A;  4YEM A;  1Z55 A;  2C8P A;  3LZ2 A;  1L29 A;  4A4M A;  1LZR A;  2YDG A;  3WU7 A;  4AXT A;  1B7M A;  1I56 A;  1P2C C;  2D4I A;  1LZ4 A;  4LYZ A;  3RU5 A;  3NS0 A;  1D6Q A;  3S8F B;  3HBH A;  3QY4 A;  2LNL A;  4IAT A;  1L74 A;  4II8 A;  2FBB A;  4XT1 A;  1C6I A;  5FDJ A;  1G7M C;  3TMW A;  4HP0 A;  3ABW A;  1OUC A;  2LZ2 A;  1C62 A;  4N6H A;  3D3D A;  193L A;  1L49 A;  4TUN A;  1CTW A;  2HU1 A;  2RB0 X;  1S8J A;  5LZM A;  3A67 Y;  2FYC A;  2MED A;  1LZ8 A;  4ETE A;  5G2A A;  1GBX A;  4FA7 B;  5I54 A;  2B5Z A;  1IWX A;  4I7M A;  1GWD A;  1IC4 Y;  5C6I A;  1HF4 A;  1LJK A;  250L A;  1G07 A;  4L41 A;  1DYF A;  1PQM A;  1GF8 A;  4GP8 B;  4BUO A;  3D9A C;  2B6W A;  3IWR A;  5F81 A;  1L11 A;  4FJR A;  2F4G A;  5DL9 A;  1MEL L;  4XJB A;  174L A;  1LSP A;  1I1Z A;  1IP1 A;  2BQD A;  1L91 A;  1T8A A;  130L A;  1G0K A;  2BQB A;  2ZQ4 A;  1C6H A;  4ETC A;  1L55 A;  3WPJ A;  162L A;  1L32 A;  4PXF A;  4OW1 A;  3WL2 A;  1LHM A;  2Y02 A;  2VT4 A;  5KXX A;  3EXD A;  2HPY A;  1CV6 A;  1C10 A;  4CHX A;  1PQI A;  4H9A A;  1G0G A;  1B5Z A;  3W6D A;  1BRX A;  1C66 A;  5A45 A;  3HTD A;  1FBK A;  1EQ4 A;  1T97 A;  2RBP A;  4CJ2 A;  1DKJ A;  5KXR A;  4KLY A;  1KG8 A;  1PQJ A;  3DN1 A;  3HT8 A;  2B75 A;  244L A;  1L69 A;  1LHH A;  110L A;  5LVI A;  1YAM A;  1L99 A;  1DXJ A;  5KXT A;  4XAD A;  3TXJ A;  3B0K A;  2Q0M X;  1ZWN A;  4M6D A;  177L A;  1OP9 B;  3CDQ A;  4BEY A;  2Y03 A;  1GE4 A;  1L17 A;  1G0Q A;  2MEH A;  4PJZ A;  1AT9 A;  182L A;  114L A;  4GCE A;  2DQJ Y;  4LGK A;  2IFF Y;  4I7K A;  1L72 A;  5KKH A;  1LYZ A;  1U19 A;  1HEN A;  1LZY A;  4GP5 B;  3HT6 A;  5I4X A;  2PED A;  1QT5 A;  3WH1 A;  4B4J A;  3NSB A;  2I35 A;  2F93 A;  5AHY A;  5LWE A;  1LGX A;  1L62 A;  1LPI A;  1L64 A;  216L A;  4U3X B;  4MR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...