4DJHA

Structure of the human kappa opioid receptor in complex with jdtic
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
452
structure length
447
Chain Sequence
SPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone receptor/antagonist
molecule keywords Kappa-type opioid receptor, Lysozyme
publication title tructure of the human kappa-opioid receptor in complex with JDTic
pubmed doi rcsb
source organism Homo sapiens
total genus 161
structure length 447
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4djhA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4djhA01
1SX7A 1K28A 2AT9A 1CX7A 139LA 2LZMA 2CUUA 2OE9X 3F9LA 162LA 1L21A 236LA 3JR6A 1L94A 3RZEA 244LA 2B74A 1PQOA 5JJEA 3C8RA 4OV0A 199LA 2F32A 2KS9A 3X3BA 4QI1A 5H2KA 242LA 3SBBC 3EH3B 3C83A 248LA 4BVNA 1L20A 3QDCA 1L18A 3DMZA 4I7RA 4DAJA 1G0JA 3HU9A 1BM1A 4G7QB 2I20A 5G36A 131LA 1CV3A 4KLYA 1JTNA 102LA 1EPYA 1QTCA 1L88A 4PJZA 4XT1A 1L29A 1X0I1 3VHZA 1L9HA 1L91A 3C82A 1CV1A 1L30A 1D9WA 4BWBA 3GUMA 2R4RA 1OVHA 5H2OA 2QARC 3C9MA 1L01A 6LZMA 1GU8A 1P2LA 3AYNA 1C6KA 1D3JA 3G3XA 1C65A 1QS5A 4ARQA 7LZMA 4EA3A 5BR2A 1S51A 152LA 1L08A 1QT7A 173LA 1L83A 1C6TA 1JGJA 4W56A 1LGUA 212LA 1KW7A 4LDEA 262LA 181LA 2YCZA 3MBVA 1L96A 2RH1A 4K5YA 4YX7C 3UTWA 4JR8A 5FJGA 1L43A 1S8LA 4QRYA 4BV0A 2YCWA 1L06A 4DJHA 1F50A 2VT4A 3PQRA 222LA 118LA 1QT3A 4W55A 175LA 182LA 4GBRB 4I7SA 177LA 3SB7A 3C9LA 3HAPA 3HU8A 5B0WA 180LA 157LA 1L86A 3PWHA 1L62A 259LA 1L55A 3SB6A 5H2JA 3QJTB 1L93A 160LA 165LA 172LA 5ETZA 3DN1A 4G7RB 3SB9A 5JJNA 2HULA 1E12A 3HAOA 190LA 5EN0A 2YDVA 3DNAA 1L36A 1L33A 223LA 2LC9A 2ZIYA 1M0KA 1LWGA 261LA 5AHYA 5G2AA 1G0GA 1L05A 4X32A 4BUOA 1C66A 4I7MA 4I7NA 4W57A 2OU9A 1BRXA 1C6QA 1LWKA 3HT7A 3REYA 1GUEA 1L73A 1S52A 114LA 4A4MA 4LZMA 5AWZA 2HUMA 2JAFA 2A4TA 1OYUA 1PQJA 1CWQA 1ZWNA 1L03A 210LA 2QPEB 5DHGA 3PDSA 4W53A 4I7QA 1C62A 1C6LA 1CUQA 1CUPA 249LA 237LA 2B72A 4DKLA 103LA 1SSWA 214LA 3V2YA 1L19A 5AX0A 191LA 4OO9A 5KKHA 3P0GA 1TLAA 126LA 1L10A 1DYFA 171LA 1LI2A 2B7XA 1L09A 1DYAA 1P37A 2B70A 206LA 2RBRA 3EMLA 1KGBA 1L99A 3EH5B 155LA 1L84A 2OU0X 3CDVA 3OE6A 1KS3A 1L56A 1QSBA 215LA 2HUKA 5H2HA 1L98A 260LA 1Q5JA 178LA 2B75A 2I35A 4MQTA 217LA 3SN6R 3HTDA 246LA 1PXSA 5G54A 1JV7A 1L60A 1VGOA 1L46A 1L34A 1P6YA 3HTGA 5B34A 3HAQA 4PXFA 1L04A 5H2LA 2OE7X 3FADA 4LDOA 113LA 1VJMA 1QKOA 1XMEB 4W59A 4WW3A 247LA 3RUNA 2Y04A 128LA 3NS0A 2RBOA 1JFPA 4JQ6A 1QTZA 219LA 1S54A 1L76A 4AQNA 3UG9A 221LA 1C61A 1P5CA 1G0LA 3OE9A 2JAGA 1C63A 5B6YA 1XJIA 4EPFA 2G87A 3OE8A 2RBNA 2KSAA 3NSBA 138LA 1LYJA 230LA 234LA 1L51A 3COCA 198LA 3QBIA 4X1HA 150LA 1JTMA 5A45A 1QTBA 2EI4A 1T8FA 4G72B 1PQKA 4BEZA 3DN6A 1L31A 4FA7B 4PK0A 3C7YA 257LA 1NHBA 255LA 1L0MA 1L79A 5G2DA 4GRVA 143LA 3F8VA 187LA 197LA 1P36A 1L50A 1L22A 3HTBA 1L39A 3C8SA 1F88A 3QJQB 5DHHA 1L25A 130LA 3VGAA 5B35A 1D2WA 1L65A 1TN5A 4XXJA 1M0MA 211LA 2L78A 1L89A 4Y9HA 3UZAA 4XTLA 3GUKA 1L92A 3NY8A 1S8JA 158LA 1C6BA 5C1MA 4GP8B 3DN2A 4GYCA 1L63A 1L45A 1LYHA 3QBLA 3HWLA 164LA 3C81A 3UTXA 2RB1X 4E97A 3HASA 5ITCA 3RFMA 228LA 3UZCA 123LA 1P7SA 4N4YB 3HH4A 1LI3A 1KY0A 1QSQA 2QPDB 1LYFA 2RB2X 2YCYA 1L32A 1L67A 2RBPA 3DN0A 1BRDA 1L58A 1OVKA 2F2QA 1C6FA 1L11A 4ARMA 3CDTA 239LA 3G3WA 4W51A 4HWLA 111LA 1CU3A 4PXKA 2NTGA 1C6PA 1SSYA 2Y00A 3VG9A 137LA 5AZDA 1G1VA 1L35A 1M0LA 110LA 1C6JA 4IARA 1XIOA 3HDFA 5LWEA 122LA 1L15A 5B6ZA 166LA 3CDOA 227LA 4IAQA 1C6NA 1L17A 1L52A 1MGYA 2F93A 1LLHA 1L42A 1SWYA 2Y02A 1XJTA 140LA 1JQUA 1C6EA 2QB0B 1IW9A 1IXFA 1C8SA 4ARJA 3DDLA 4MQSA 1B6IA 1L48A 2Z55A 3OAXA 4G71B 127LA 1LYEA 3GUPA 1P3NA 2WJLA 1QT8A 5F8UA 1D3FA 1QM8A 1T97A 5G53A 1P8UA 4I7TA 161LA 1C6IA 108LA 4S0WA 5LZMA 2O4WA 4WAVA 2OEAX 1PQMA 2I21A 1QS9A 1QTDA 1KG8A 1L72A 232LA 1QUDA 2LCBA 2O79A 220LA 226LA 2B6YA 5BR5A 1OVJA 1C67A 1I6SA 1LGXA 205LA 1CV5A 1PY6A 1XJUA 1C6AA 2B6WA 3SB5A 1L75A 1C8RA 1DZEA 2I1XA 3DQBA 4ARQB 1C6GA 3DMVA 3HDEA 1L13A 1GZMA 1H2SA 4ARLA 1DYDA 4EKSA 196LA 1L27A 3VI0A 1L23A 3CDRA 4FBZA 3HARA 1JV6A 1UAZA 1LGWA 147LA 5B6WA 1L87A 1C68A 251LA 2M3GA 192LA 1L41A 2IGCA 2RB0X 4IAPA 3PXOA 3QJUB 1G0QA 216LA 1QKPA 1L57A 3GUOA 2F95A 4EIYA 3C80A 4GPOA 1U19A 1L26A 4TL3A 3S8GB 4BEYA 1L97A 189LA 1QTHA 225LA 1LYDA 2ANXA 4W52A 4GP4B 3HH6A 5DYSA 3VW7A 4EKPA 1SWZA 1DYEA 224LA 129LA 1PXRA 3S3DB 1S53A 1DYGA 3QJRB 5A44A 144LA 3QBGA 3GUIA 2R4SA 3HUKA 1LN6A 1KG9A 3QJSB 1T8GA 1D3MA 1CV0A 3DN8A 3UTVA 168LA 1L68A 1R2NA 1D2YA 3C7ZA 238LA 2NTHA 176LA 1L59A 115LA 1P2RA 109LA 1D3NA 1CVKA 2Q9EA 1L82A 256LA 170LA 4I7KA 4EPIA 1P8IA 5H2IA 169LA 186LA 104LA 146LA 1L66A 1L44A 1PQDA 5ITEA 2OTYX 3CODA 2WJKA 5JJJA 3GUJA 3AM6A 5B2NA 107LA 1OV5A 2BRDA 1QUOA 4GBRA 1AT9A 4G7SB 142LA 1L77A 3QAKA 1R84A 3T45A 1LYIA 1DYBA 200LA 3DN3A 1G1WA 2LNLA 2YDOA 3EH4B 174LA 4I7LA 201LA 1O0AA 4G70B 1L37A 3A7KA 1L40A 1L00A 3HUAA 4EXMA 2J4YA 4HYXA 1L16A 1G07A 2Y03A 250LA 1P46A 1L85A 1L24A 1L02A 240LA 3D4SA 4I7OA 4ZPUA 1G0PA 2B6ZA 1G0KA 1QT5A 1KY1A 1LYGA 5AHZA 5AX1A 2RBSA 1L49A 2NTUA 3DKEX 1L74A 2ANVA 1L70A 1Q5IA 1FBKA 4N6HA 243LA 3GUNA 4L35A 4J4QA 2B6TA 4I7JA 4UG2A 3ZPRA 1CU2A 1CU0A 1ZURA 1QHJA 4X31A 1C6MA 1H68A 1QTVA 3LZMA 119LA 5B6VA 2OU8A 3CAPA 112LA 1L0KA 1L0JA 1P56A 5TGZA 3V2WA 1C69A 163LA 188LA 241LA 1AP9A 1L12A 2L6XA 1IW6A 1L64A 125LA 2NTWA 1QUHA 3CDQA 3DMXA 3NY9A 5I14A 3S3BB 1T8AA 3VVKA 1L47A 233LA 1L69A 2F47A 3SBAA 148LE 2RAYX 1ZYTA 1OWYA 4YXAC 3HT6A 159LA 4MBSA 1LI6A 3S8FB 2OE4X 1EHKB 4MD1A 1C3WA 1CV6A 3ZPQA 3HTFA 185LA 5G2CA 1L71A 3FA0A 3SB8A 1F4ZA 1KW5A 5H2NA 3WQJA 1L80A 1C6CA 3K2RA 229LA 2B73A 1L61A 1T6HA 1XEPA 3G3VA 2PEDA 1C6HA 2RAZX 2Y01A 1P64A 3OE0A 1CX6A 4YXCA 4AMIA 1LW9A 184LA 1OV7A 4QIDA 3C8QA 1P8HA 4GP5B 1L53A 1G0MA 5G28A 1QUGA 3ZEVA 3L2XA 1KMEA 2X72A 3FI5A 2O7AA 4W58A 1C6DA 3UONA 2Z6BA 209LA 2B6XA 4FAAB 1CU6A 2KSBA 1CU5A 1CV4A 1KNIA 4ARMB 156LA 1LPYA 3QAPA 1WTHA 1TN0A 1SX2A 4KNFA 3ODUA 2YCXA 1UCQA 3DN4A 231LA 1G06A 3QJVB 1L38A 2ZZLA 2OTZX 3HT8A 4EKQA 3QBKA 4AMJA 151LA 3UTYA 1L90A 4JKVA 1FBBA 3AYMA 149LA 218LA 4XT3A 1BRRA 245LA 2RBQA 4ARPA 145LA 1L54A 5H2MA 1L95A 5B6XA 3C7WA 4L6RA 5A8EA 252LA 1HZXA 1PQIA 3ABWA 4N4WA 195LA 1C60A 1QT4A 3NYAA 235LA 4EKRA 167LA 4FPDA 1OWZA 258LA 4LDLA 1L81A 1X0SA 4MD2A 3HUQA 2Q9DA 2Z73A 183LA 3HH3A 1L14A 5H2PA 5J7AA 213LA 3BVDB 4XTOA 4W54A 1CTWA 4XTNA 4NC3A 4I7PA 1E0PA 1L28A 3GULA 3PBLA 3X3CA 2HPYA 4UHRA 1L07A 4EJ4A 2KSYA 253LA 3S3CB 3HANA 4HYJA 3KJ6A 2ZFEA 141LA 1DYCA 3L64A 1X0K1 1QT6A 4IB4A 1C64A 3HH5A 120LA 254LA 3HT9A
chains in the Genus database with same CATH superfamily
1K28A 5KXZA 1IP1A 2OE9X 1LZ1A 2BQFA 1ZV5L 2AUBA 5KXOA 4G9SA 1L94A 4OV0A 3ATNA 3CT5A 5LYTA 4XJFA 1GEZA 1FLWA 5H2KA 242LA 3SBBC 3C83A 248LA 3EXDA 2HEFA 3HU9A 1BM1A 2I20A 4N8ZA 3LHMA 1X0I1 1DKJA 1LHMA 3WH1A 1L30A 4BWBA 3GUMA 2R4RA 6LYZA 1JTTL 1GU8A 2ZYCA 4GCDA 1C6KA 1LZ6A 3G3XA 1QS5A 4TX7A 7LZMA 1S51A 173LA 1C6TA 1LGUA 262LA 2YCZA 5C6IA 4XYYA 2RH1A 1LZ9A 1LZBA 1LZNA 4BV0A 2YCWA 1L06A 1GDXA 118LA 182LA 4I7SA 3PWHA 4RW1A 3P4ZA 2F2NA 5LVKA 1L93A 165LA 172LA 3A96A 4G7RB 3FI7A 4KL7A 5JJNA 5KXSA 3HAOA 1MELL 4O34A 1L36A 1L33A 1JJ1A 4WL6A 1L05A 3LN2A 2ZILA 1VEDA 4I7NA 1LWKA 3HT7A 5C6LA 3REYA 133LA 1L73A 4A4MA 4LZMA 5AWZA 1CWQA 1L03A 210LA 1LJJA 1MLCE 2QPEB 4NY5A 1C62A 1CUQA 1SSWA 1L19A 5AX0A 3W6BA 3P0GA 1OUBA 1DYFA 171LA 1LI2A 1DYAA 1H6MA 2RBRA 5KKIA 1JIYA 4NHTA 1L84A 1GXV2 3CDVA 4HP0A 4WM6A 1TDYA 1REMA 4LT3A 217LA 3P64A 3HTDA 246LA 1PXSA 5FDJA 1L46A 4PXFA 3QY4A 1XMEB 3RUNA 128LA 1QTZA 1UIGA 1C61A 2JAGA 2BLXA 2I6ZA 2FBBA 2MEEA 3OE8A 1XSFA 2KSAA 4GN4A 234LA 2W1YA 1L51A 1QTBA 2EI4A 4G72B 4NWEA 257LA 1B5ZA 3ZVQB 1BB3A 1P36A 193LA 1L22A 3HTBA 1UIFA 1L25A 3IWRA 3VGAA 5B35A 1L65A 1TN5A 4Y9HA 3GUKA 1YL1X 3NY8A 1KXXA 5I4WA 3DN2A 4GYCA 1AKIA 1LYHA 164LA 3C81A 1HFZA 3HASA 3P68A 4ETEA 1LI3A 1LYFA 4G4HA 2YBJA 3A6CY 5FELA 2DQDY 1GF4A 2DQIY 3AB6A 4XN6A 4ARMA 4IASA 4W51A 4H90A 1BQLY 4HWLA 3CQLA 2A7DA 1F6RA 1UC0A 2BAAA 2Y00A 1G1VA 1AT6A 110LA 1C6JA 3CDOA 227LA 4H93A 3W6DA 1MGYA 4WM2A 1LSZA 2QB0B 5LYZA 4MQSA 4WLXA 1L48A 1LSFA 1UIHA 2Z55A 3WMKA 4I8SA 1INUA 161LA 1EQ4A 1I20A 1GE4A 4OOOA 5B1FA 1QTDA 2O79A 1LSEA 5BR5A 1OVJA 2LYOA 1LJNA 1C67A 1I6SA 1CJ6A 1CV5A 1PY6A 1XJUA 2YSSC 4XJDA 1C6AA 1JEFA 3SB5A 1C8RA 2I1XA 3DMVA 3HDEA 1GZMA 1H2SA 3WVXA 4D9ZA 4EKSA 196LA 1LZGA 1L27A 3VI0A 4FBZA 1JV6A 4CGEA 251LA 4IAPA 2IGCA 1QKPA 3CB7A 1GF8A 3C80A 1HEWA 1YILA 1L97A 2BQMA 1QTHA 2ANXA 4UWNA 4W52A 4AGAA 1D0MA 3M3UA 4YM8A 4L41A 1WVVA 4EKPA 3S3DB 1S53A 1DYGA 3IJUA 3QBGA 4NIJA 1DI4A 3F6ZA 3WPJA 1LJIA 3QJSB 3GXRA 3DN8A 3W6CA 2X0AA 3UTVA 4MR1A 1IWVA 1R2NA 1D2YA 1L59A 115LA 5ILCA 5LIOA 4TSCA 1CVKA 256LA 1LCNA 4GCEA 104LA 146LA 1L66A 1GF6A 1PQDA 2OTYX 3CODA 5JJJA 5B2NA 1IWYA 107LA 1OV5A 1QUOA 1AT9A 4M4OA 2LZTA 142LA 1WTNA 200LA 2YDOA 1LSDA 4PRUA 4G70B 1O0AA 1L00A 3HUAA 3B0OA 2BQHA 1JKCA 1P46A 1L85A 1L02A 4ZPUA 2DQCY 1GHLA 4LFPA 1GPQC 3TXKA 4J4QA 3ZPRA 1GFEA 4X31A 1YIKA 2YBNA 1HC0A 2ZYPA 1H68A 1GF9A 1F0WA 3LZMA 3TXFA 1OUHA 1P56A 163LA 2ZQ4A 2C8OA 1L12A 2L6XA 3A8ZA 125LA 3DMXA 3CDQA 3NY9A 1UBZA 153LA 2DBTA 4B0DA 1ZMYL 1JPOA 2GV0A 3HT6A 2MEGA 3S8FB 1LHJA 1LTMA 3FA0A 1F4ZA 1KW5A 3WQJA 1JSFA 2YBHA 1L61A 5APCA 1AZFA 5LA8A 3K3TA 1YQVY 1IP4A 2BQOA 5I4XA 4QIDA 3C8QA 1P8HA 3ZEVA 1PZYA 2BQCA 1C6DA 4U3XB 1CJ9A 1W6ZA 1QSWA 1LSCA 1JSEA 3QAPA 1TN0A 2BQJA 2YCXA 231LA 4NGZA 1G06A 1RE2A 1L38A 3QJVB 3AW7A 3QBKA 1GE0A 5II3A 1B2KA 6LYTA 5IHGA 5M1YA 1BRRA 1TEWA 4ARPA 1L54A 2DQGY 2DQEY 1C7PA 2W1LA 1HZXA 2HU3A 1PQIA 3ABWA 2I25L 195LA 4DDCA 5KXWA 4EKRA 1IP2A 1NBYC 4LDLA 1X0SA 1ZVHL 2Q9DA 1LYSA 1CKFA 1L14A 5H2PA 4FDYA 1WQOA 4XTNA 3WUMA 1E0PA 3TMXA 2DQAA 2HPYA 1HERA 1DYCA 3QNGA 1LZ5A 4IB4A 4UWVA 2Q0MX 120LA 4CHXA 1CX7A 139LA 2LZMA 162LA 1L21A 236LA 1UIAA 1C46A 2MECA 3RZEA 244LA 3C8RA 2F32A 2WARA 1LSNA 4YEMA 5FSTA 1HSWA 4EOFA 3QDCA 5FHWA 2BQNA 5IELA 3DMZA 4DAJA 1G0JA 4IATA 4LT1A 1XEKA 4KLYA 1IC4Y 4OWEA 4H9IA 1CNSA 1QTCA 1L88A 4PJZA 4OWHA 3C82A 1CV1A 2CJLA 1IX0A 4OWBA 4ARQA 1RI8B 194LA 1L83A 4WOAA 1JGJA 212LA 5L3HA 181LA 1I56A 1L43A 1S8LA 1G7LC 1BB6A 154LA 2ZNXY 4GCBA 2G4PA 4GBRB 3SB7A 3HAPA 157LA 1L86A 2ZQ3A 1L62A 4LT2A 4ZIXA 2DKVA 3SB9A 2HULA 1IWTA 190LA 5EN0A 4WLTA 3DNAA 1LHLA 1LKSA 2ZIYA 1LWGA 1W08A 5AHYA 2W1XA 1B7OA 1JJ0A 1GFTA 1HF4A 4I7MA 1CKCA 2OU9A 4CFPA 5KXRA 3FE0A 5DN4A 1EQ5A 1S52A 3A3QA 2HUMA 2MEFA 2JAFA 1OYUA 1LPIA 3TXBA 3A34A 5KXYA 5HQ1A 5DHGA 3PDSA 4OW1A 1C6LA 237LA 1JKBA 2B72A 1B7PA 191LA 4OO9A 1IO5A 5KKHA 1TLAA 3QE8A 4XJBA 1YAQA 5L9JA 3AZ5A 206LA 1OUIA 3OE6A 1GFVA 1L56A 1IR9A 4MQTA 1FDLY 3SN6R 1QTEA 4G49A 1HENA 1VGOA 1LKRA 1P6YA 5B34A 4LDOA 1VJMA 2D4IA 4W59A 247LA 3NS0A 1L76A 3BKVA 4H9FA 4QEQA 1UCOA 1G0LA 4Z98A 1UA6Y 5KXMA 2G87A 3NSBA 1LYJA 3COCA 5A45A 198LA 150LA 1JTMA 1GDWA 3WU8A 2F4GA 3DN6A 4PK0A 2FYCA 4NGVA 3AJNA 1NHBA 255LA 4WM3A 4XJIA 1DQJC 143LA 187LA 4WM5A 1LMQA 4YENA 197LA 1L50A 3WXTA 1J1XY 2XTHA 3C8SA 2Z12A 3AYQA 4DQ7A 2HEDA 4PRQA 4XXJA 4GCFA 5HMVA 2L78A 4LT0A 3EMSA 3EBAB 4XTLA 1QTKA 2G4NA 2DQJY 1S8JA 158LA 4WG1A 4GP8B 4LYTA 2MEIA 5ITCA 5HMJA 3UTXA 4E97A 1BB7A 4LGKA 2XBRA 123LA 1P7SA 1QSQA 2QPDB 4NGWA 2RBPA 5KXPA 1BRDA 1OUCA 1OVKA 4N9RA 1L11A 1LZDA 1JWRA 5APDA 5AZDA 1L35A 1OP9B 5A3EA 1M0LA 1AM7A 1XIOA 5LWEA 5FCPA 1C6NA 2F93A 2LYZA 1REYA 1SWYA 1JQUA 1IXFA 4ARJA 1YANA 1P3NA 1D3FA 1T97A 5G53A 1P8UA 108LA 2MEHA 2RSCA 4S0WA 5LZMA 2O4WA 1PQMA 1LYZA 1SQ2L 135LA 1RFPA 232LA 4GCCA 226LA 2B6YA 1LGXA 4J7VA 3WPLA 2D6BA 1IIZA 4YF2A 1DZEA 1GFHA 5B07A 1C6GA 1QUTA 1DYDA 1IOCA 4NG1A 1LSYA 147LA 5B6WA 4WL7A 2RB0X 4NHIA 3GUOA 1D9UA 4GPOA 3S8GB 189LA 3A91A 1LHIA 129LA 4HTNA 3QJRB 3HUKA 1KG9A 4NSGA 1CV0A 4WMGA 1L68A 2NTHA 4R6CA 176LA 5DM9A 5F81A 5JENB 2CGIA 4ETAA 2Q9EA 3AM6A 1LZ4A 3A92A 4ETBA 170LA 4EPIA 1P8IA 1L44A 1LMPA 3RZ4A 2BQGA 4NGIA 2BRDA 3VWOA 3QAKA 1LYIA 3DN3A 5B59A 4PPOA 3EH4B 201LA 2XBSA 3T36A 5KKJA 3HBEX 4WM1A 4NHQA 2Z38A 1YAPA 1G0KA 1LYGA 5AHZA 1L74A 1L70A 3GUNA 2MEAA 3ATOA 4I7JA 1LZYA 1NKHA 1CU2A 5B05A 2D4KA 1QHJA 1QTVA 5IDDA 112LA 1WVUA 1REXA 3LYTA 4ZEEA 1KXYA 3VVKA 1L47A 1C43A 3SBAA 148LE 5T3FA 4DT3A 4LZTA 4Z41A 4MBSA 2I26L 1DI3A 1J1OY 1EHKB 4ANRA 1LMNA 185LA 3WUAA 1JJ3A 1PS5A 5H2NA 4KPMA 1GFJA 1L80A 1FLYA 229LA 1T6HA 1XEPA 3OE0A 4YXCA 4AMIA 1OV7A 1RJCB 1HFYA 3E3DA 5E9RA 1ALCA 1B5XA 3KAMA 1FN5A 3L2XA 1KMEA 1LJFA 4DD0A 2O7AA 3UONA 2Z6BA 209LA 2B6XA 4Z3MA 2Y8PA 4DD7A 1CU5A 1KNIA 4ARMB 4KNFA 1SX2A 1UCQA 5J7CA 3G3BB 4BAFA 1GB8A 2ZZLA 4AMJA 3A93A 3AYMA 1HEOA 1GFGA 1TBYA 145LA 2RBQA 5B6XA 252LA 4RLMA 4UWUA 258LA 4MD2A 3HUQA 4DQJA 183LA 3HH3A 2NWDX 1F10A 1V7TA 3BVDB 4I0CA 1D0LA 1GBSA 4HV2A 1L28A 3PBLA 1LJKA 1L07A 5EBHA 1B5UA 2KSYA 3S3CB 4HYJA 3W3EA 141LA 1LZCA 2YBLA 3AW6A 4HPEA 1C64A 1UACY 254LA 7LYZA 2AT9A 1LAAA 2CUUA 1LJHA 3F9LA 3JR6A 1JHLA 1G7MC 1PQOA 5I53A 199LA 4E3UA 2KS9A 3X3BA 2H5ZA 4QI1A 5FEKA 4BVNA 1L18A 4I7RA 1GD6A 134LA 1EPYA 1GB3A 1A4VA 1L29A 1L9HA 1IP6A 1L91A 208LA 4WO6A 2HEEA 3A3RX 4H92A 2QARC 4DWXA 6LZMA 1P2LA 3AYNA 2YBIA 1C65A 4EA3A 5DLAA 152LA 3AZ4A 1IEEA 1JKDA 1L96A 1NDGC 4K5YA 4YX7C 1VDPA 3LYZA 5FJGA 1C08C 4QRYA 3OJPA 4DJHA 4KXIA 1WQRA 1F50A 2LYMA 4TUNA 3PQRA 1XFPL 222LA 4W55A 177LA 3C9LA 4NGKA 4X3BA 4J1AA 4NGLA 1LSPA 4RW2A 1L55A 1LZRA 4N1EI 2YBMA 1H87A 160LA 5ETZA 1B5VA 3M18B 4DDBA 1VFBC 4WLDA 3WU7A 4XENA 2YDVA 261LA 5G2AA 2HEAA 1G0GA 4BUOA 1C66A 1IY4A 4W57A 1BRXA 1IOTA 114LA 2A4TA 1YL0X 1PQJA 1ZWNA 5F16A 5I5QA 3WPKA 5F14A 1T6VL 3HBHA 4W53A 2N5ZA 4I7QA 249LA 4DKLA 103LA 2Z2EA 5LAGA 3TMWA 4RLNA 1B0DA 1DKKA 1L10A 2HEBA 1P37A 1L99A 155LA 2OU0X 215LA 2HUKA 5H2HA 2MEBA 1L98A 178LA 1UIDA 5G54A 1L60A 1L34A 1GF0A 3HAQA 5H2LA 1L04A 1JKAA 3FADA 1QKOA 4WW3A 4JQ6A 2Y04A 1XEJA 1S54A 4P2EA 1G7JC 1C63A 5B6YA 3WW5A 5LXWA 4EPFA 4NHPA 1GBWA 4TWSA 3N9EA 2HECA 1HEQA 4OWCA 1PQKA 3A67Y 5E4PA 4BS7A 4FA7B 2BQDA 1L0MA 5G2DA 1L79A 4GRVA 2F4AA 3F8VA 1G7IC 1XEIA 1IOSA 1B9OA 3RNXA 1L39A 1F88A 3QJQB 5DHHA 130LA 3SP3A 2BPUA 1GEVA 8LYZA 5LVIA 1LMAA 1GBOA 4HJYA 1CKGA 1C6BA 3QBLA 3HWLA 228LA 4QY9A 4N4YB 3HH4A 1TCYA 1D6QA 3P65A 2BQEA 1L32A 1L67A 4KT3A 1B7MA 3CDTA 239LA 1CKHA 4ETDA 111LA 1CU3A 4PXKA 4H8ZA 1C6PA 1WQPA 137LA 4DDAA 1LSBA 1LZTA 4IARA 3HDFA 122LA 4IAQA 1L52A 1L17A 4N1CC 2LHMA 2BLYA 1LLHA 1L42A 2Y02A 1XJTA 1C8SA 1IW9A 1C6EA 4QGZA 3DDLA 3OAXA 4G71B 1I1ZA 1QT8A 2WJLA 1QM8A 4I7TA 1GWDA 1B7NA 1C6IA 3RU5A 2OEAX 4TSBA 1YKXX 1D6PA 3D3DA 1KG8A 1IR7A 1QUDA 3WYHA 220LA 1OUFA 1HHLA 205LA 1KXWA 1VATA 3J6KA 1B7LA 1OUDA 4ARQB 1L13A 1LJEA 5D5FA 3CDRA 2BQBA 1XGQC 1LGWA 1UAZA 1C68A 2M3GA 3QJUB 216LA 1OUEA 5LA5A 5HNLA 2F95A 4G4BA 1U19A 4TL3A 4W94A 1LYDA 5DYSA 1GXXA 4GP4B 5AMYA 1SWZA 1DYEA 224LA 5B1GA 1PXRA 5A44A 3GUIA 1UICA 4NGOA 168LA 3C7ZA 4QDNA 238LA 2FBDA 1P2RA 5LVGA 1IY3A 5H2IA 4I7KA 3RW8A 186LA 3WULA 1NBZC 3GUJA 3TXEA 2EIZC 1J1PY 4H9CA 1R84A 4HV1A 3T45A 4NGYA 1G1WA 4G4CA 4I7LA 1L40A 4EXMA 4M6DA 1L16A 1G07A 4CFOA 1L24A 240LA 3D4SA 1G0PA 4LYZA 2Z2FA 1KY1A 2F30A 5AX1A 2RBSA 5DN5A 2NTUA 3DKEX 2ANVA 1NDMC 1FBKA 243LA 3AZ6A 4BADA 4LYBA 4UG2A 1CU0A 1KIRC 1IVMA 1C6MA 1WTMA 4H8XA 2BQKA 1OUAA 5B6VA 3CAPA 1LMCA 1GE2A 1L0KA 5TGZA 1C69A 1GBYA 188LA 1GFKA 1IW6A 1LSMA 2NTWA 3S3BB 1T8AA 233LA 2A7FA 4N0JA 1YROA 4HTQA 5LVJA 5LYMA 159LA 1IWXA 2OE4X 4MD1A 3AGGG 3G3AB 4LFXA 3HTFA 4B4IA 5G2CA 4HPIA 1HFXA 4NSHA 3K2RA 2YVBA 2IHLA 4A7DA 5KXTA 1P64A 1B7QA 1HELA 2EQLA 1CX6A 3TXIA 184LA 1DI5A 1C45A 1IOQA 4W96A 2BQLA 3B72A 4B1AA 1DPXA 1L53A 5G28A 4C5FA 3FI5A 4W58A 4GLVA 4FAAB 2ZIJA 1WQNA 1CU6A 1LZSA 3J4GA 3ZVQA 1IR8A 2LZ2A 3DN4A 2FYDA 5LINA 1YAMA 4EKQA 151LA 3UTYA 4B49A 4JKVA 3HBDA 4XT3A 1LJ4A 218LA 245LA 132LA 1LSGA 1L95A 4WO9A 2HTXA 1C60A 2CDSA 4N4WA 3A95A 167LA 5HNCA 1OWZA 1L81A 1LMTA 4NG8A 2Z73A 213LA 5KXKA 2Z19A 4XTOA 4W54A 1CTWA 1B5YA 4NC3A 1NMMA 4I7PA 1GB2A 2MEDA 3GULA 4UHRA 1LHHA 3KJ6A 2ZFEA 5I4YA 3L64A 1QT6A 3IJVA 1GB9A 1REZA 3HT9A 5HLLA 1SX7A 3TXGA 5DL9A 3CSQA 2B74A 5JJEA 5B06A 5A3ZA 3EH3B 4ZFPA 1L20A 2B5ZA 5G36A 4G7QB 3CT1A 131LA 1CV3A 1JTNA 102LA 5ILFA 4XT1A 3VHZA 1D0KA 3N9CA 1FLQA 2DQHY 1VAUA 1T3PA 1D9WA 1IP3A 1OVHA 5H2OA 3C9MA 1L01A 4XADA 5KXNA 1OQMA 3W6EA 1D3JA 4WM4A 5BR2A 1QIOA 1QT7A 1L08A 4ETCA 1JITA 4W56A 4NSJA 1KW7A 4LDEA 3MBVA 1DXJA 1B7RA 4H94A 3UTWA 3AGHA 4H9HA 4JR8A 1GB6A 4H9AA 9LYZA 1HEPA 3WVYA 1QDRA 2VT4A 4DD1A 1P2CC 2ZNWY 1IWUA 1GF7A 175LA 1QT3A 5B0WA 1IORA 3HU8A 4MCKA 180LA 207LA 3N9AA 259LA 3SB6A 1FBIX 4H91A 5L3IA 5H2JA 3QJTB 3CT0A 1LYYA 3DN1A 5LVHA 3TXJA 4EMNA 4DYGA 1E12A 1HEMA 1C10A 223LA 1WQQA 2LC9A 2ZIKA 1F6SA 1M0KA 1GFRA 4LYMA 1LJ3A 4X32A 1C6QA 1GUEA 3LZTA 4NWHA 1CUPA 1DZBX 4WLYA 1BHZA 214LA 1OUGA 2D91A 1YAOA 3V2YA 4DD2A 1GAYA 126LA 1DPWA 1OUJA 2XJWA 2B7XA 1L09A 3B6LA 4J0LA 2B70A 1JTOL 3EMLA 3MGWA 1XGTC 1KGBA 3EH5B 1KS3A 1QSBA 1GAZA 2Z37A 260LA 1Q5JA 3TMVA 2B75A 2I35A 1XGUC 1JV7A 3HTGA 4NEBA 2OE7X 113LA 4XJHA 1YKZX 4OOTA 5APFA 2RBOA 1JFPA 219LA 3UG9A 4AXTA 4AQNA 5KXLA 221LA 1P5CA 1BWJA 1HNLA 3OE9A 1XJIA 4YEOA 1E8LA 3WW6A 2RBNA 3ULRA 138LA 2Z39A 230LA 3QBIA 1BGIA 4X1HA 5C6JA 3HFMY 1T8FA 4H8YA 4GN5C 2W1MA 4BEZA 1L31A 3C7YA 2G4QA 5F9XA 1LHKA 1LZ8A 1A2YC 1TAYA 1G7HC 4DC4A 3RT5X 1LYOA 1D2WA 1M0MA 211LA 1L89A 3UZAA 3T6UA 1WQMA 1L92A 1IC7Y 1GE1A 5C1MA 1L63A 1L45A 1JTPL 2RB1X 3RFMA 3UZCA 3TXHA 2EPEA 1KY0A 2RB2X 2XQOA 2YCYA 1VDSA 1UIEA 3DN0A 1L58A 2F2QA 1C6FA 1HSXA 3B0KA 3G3WA 2NTGA 1QQYA 1SSYA 3VG9A 1EL1A 5LAFA 5B6ZA 1L15A 166LA 1KIQC 3WU9A 5APEA 1IP5A 140LA 1XGRC 1B6IA 127LA 1LYEA 3GUPA 5F8UA 4GLAA 1GBXA 4WAVA 4BAPA 2I21A 4CJ2A 1FKQA 4IJ4A 4NSIA 1QS9A 3A90A 1L72A 4ET8A 1EQEA 2LCBA 2Z18A 4GN3A 4ML7A 4NGJA 4DD3A 4MSTA 1IP7A 1IC5Y 2B6WA 1L75A 1SLYA 1XGPC 3DQBA 2H9KA 3ZEKA 4ARLA 1YKYX 1BWIA 1L23A 2C8PA 3HARA 1L87A 4FJRA 2IFFY 192LA 1L41A 4NFVA 1VDTA 3PXOA 4C3WA 1BB4A 1JISA 1VDQA 1G0QA 4H9BA 4NHSA 1FKVA 1L57A 3CSRA 4EIYA 5KXXA 3A6BY 1L26A 4RDSA 4BEYA 1BVXA 225LA 4LYOA 3HH6A 3VW7A 1B7SA 3LYMA 3LZ2A 1GF3A 144LA 4B4JA 3WXUA 2R4SA 1LN6A 5K7OA 4ET9A 1T8GA 1D3MA 4R0FA 4II8A 1NQIA 4H9EA 1NF5A 2ZWBA 1QDTA 4TTDA 109LA 1D3NA 1O23A 4OWAA 1L82A 1NWGA 1QSAA 169LA 1GB0A 5ITEA 4LYCA 2WJKA 2YDGA 2HUBA 1IWWA 4GBRA 4G7SB 1L77A 1DYBA 2LNLA 174LA 1GB7A 1L37A 3A7KA 1AT5A 5KY1A 2J4YA 2BQAA 1LJGA 4DS7E 4HYXA 1UIBA 1ZVYB 2Y03A 250LA 4I7OA 2PC2A 2B6ZA 4B4EA 1QT5A 1BB5A 4DD9A 1GE3A 3CSZA 3LYOA 1L49A 1N4FA 4N6HA 1Q5IA 4L35A 1NHEA 2B6TA 3OK0A 1Z55A 1ZURA 3EO5A 1GF5A 2D4JA 2HU1A 3TXDA 119LA 1LOZA 2OU8A 1L0JA 3V2WA 3WL2A 2VB1A 4N5RA 1BVKC 241LA 1AP9A 5I54A 1HMKA 1L64A 3A94A 1LMOA 1QUHA 3D9AC 5I14A 2CWIA 1GB5A 1L69A 2F47A 1V7SA 2RAYX 1ZYTA 1OWYA 4YXAC 1HMLA 1LI6A 4PHIA 1CJ8A 1C3WA 1CV6A 4DQ5A 3ZPQA 1L71A 3AGIA 3SB8A 5F9UA 1C6CA 1FLUA 1JUGA 2B73A 1BWHA 3G3VA 2PEDA 1C6HA 2RAZX 2Y01A 1LW9A 4HSFA 3W6AA 2EKSC 4YOPA 5KJ9A 4GP5B 1QUSA 1G0MA 1QUGA 4HJZA 2H9JA 2X72A 4HJVA 2DQFC 1B5WA 2BQIA 5D5CA 1GFAA 3W6FA 1LZEA 3B0IA 1GFUA 2KSBA 1CV4A 156LA 1LPYA 1WTHA 4H1PA 3ODUA 1KIPC 4WG7A 2OTZX 4PGJB 3HT8A 1LSAA 1L90A 1FBBA 149LA 1IWZA 1RCMA 5H2MA 4Z46A 3WUNA 3C7WA 4L6RA 5A8EA 4HTKA 1QT4A 3NYAA 235LA 4J1BA 4FPDA 3AZ7A 1CKDA 3TMUA 1GBZA 1LZAA 5J7AA 3X3CA 4EJ4A 253LA 3GXKA 4XJGA 3HANA 3BKHA 3P66A 1X0K1 1CJ7A 3HH5A 1UUZC 4PJ2C
chains in the Genus database with same CATH topology
1K28A 5KXZA 1IP1A 2OE9X 1LZ1A 2BQFA 1ZV5L 2AUBA 5KXOA 4G9SA 1L94A 4OV0A 3ATNA 3CT5A 5LYTA 4XJFA 1GEZA 1FLWA 5H2KA 242LA 3SBBC 3C83A 248LA 3EXDA 2HEFA 3HU9A 1BM1A 2I20A 4N8ZA 3LHMA 1X0I1 1DKJA 1LHMA 3WH1A 1L30A 4BWBA 3GUMA 2R4RA 6LYZA 1JTTL 1GU8A 2ZYCA 4GCDA 1C6KA 1LZ6A 3G3XA 1QS5A 4TX7A 7LZMA 1S51A 173LA 1C6TA 1LGUA 262LA 2YCZA 5C6IA 4XYYA 2RH1A 1LZ9A 1LZBA 1LZNA 4BV0A 2YCWA 1L06A 1GDXA 118LA 182LA 4I7SA 3PWHA 4RW1A 3P4ZA 2F2NA 5LVKA 1L93A 165LA 172LA 3A96A 4G7RB 3FI7A 4KL7A 5JJNA 5KXSA 3HAOA 1MELL 4O34A 1L36A 1L33A 1JJ1A 4WL6A 1L05A 3LN2A 2ZILA 1VEDA 4I7NA 1LWKA 3HT7A 5C6LA 3REYA 133LA 1L73A 4A4MA 4LZMA 5AWZA 1CWQA 1L03A 210LA 1LJJA 1MLCE 2QPEB 4NY5A 1C62A 1CUQA 1SSWA 1L19A 5AX0A 3W6BA 3P0GA 1OUBA 1DYFA 171LA 1LI2A 1DYAA 1H6MA 2RBRA 5KKIA 1JIYA 4NHTA 1L84A 1GXV2 3CDVA 4HP0A 4WM6A 1TDYA 1REMA 4LT3A 217LA 3P64A 3HTDA 246LA 1PXSA 5FDJA 1L46A 4PXFA 3QY4A 1XMEB 3RUNA 128LA 1QTZA 1UIGA 1C61A 2JAGA 2BLXA 2I6ZA 2FBBA 2MEEA 3OE8A 1XSFA 2KSAA 4GN4A 234LA 2W1YA 1L51A 1QTBA 2EI4A 4G72B 4NWEA 257LA 1B5ZA 3ZVQB 1BB3A 1P36A 193LA 1L22A 3HTBA 1UIFA 1L25A 3IWRA 3VGAA 5B35A 1L65A 1TN5A 4Y9HA 3GUKA 1YL1X 3NY8A 1KXXA 5I4WA 3DN2A 4GYCA 1AKIA 1LYHA 164LA 3C81A 1HFZA 3HASA 3P68A 4ETEA 1LI3A 1LYFA 4G4HA 2YBJA 3A6CY 5FELA 2DQDY 1GF4A 2DQIY 3AB6A 4XN6A 4ARMA 4IASA 4W51A 4H90A 1BQLY 4HWLA 3CQLA 2A7DA 1F6RA 1UC0A 2BAAA 2Y00A 1G1VA 1AT6A 110LA 1C6JA 3CDOA 227LA 4H93A 3W6DA 1MGYA 4WM2A 1LSZA 2QB0B 5LYZA 4MQSA 4WLXA 1L48A 1LSFA 1UIHA 2Z55A 3WMKA 4I8SA 1INUA 161LA 1EQ4A 1I20A 1GE4A 4OOOA 5B1FA 1QTDA 2O79A 1LSEA 5BR5A 1OVJA 2LYOA 1LJNA 1C67A 1I6SA 1CJ6A 1CV5A 1PY6A 1XJUA 2YSSC 4XJDA 1C6AA 1JEFA 3SB5A 1C8RA 2I1XA 3DMVA 3HDEA 1GZMA 1H2SA 3WVXA 4D9ZA 4EKSA 196LA 1LZGA 1L27A 3VI0A 4FBZA 1JV6A 4CGEA 251LA 4IAPA 2IGCA 1QKPA 3CB7A 1GF8A 3C80A 1HEWA 1YILA 1L97A 2BQMA 1QTHA 2ANXA 4UWNA 4W52A 4AGAA 1D0MA 3M3UA 4YM8A 4L41A 1WVVA 4EKPA 3S3DB 1S53A 1DYGA 3IJUA 3QBGA 4NIJA 1DI4A 3F6ZA 3WPJA 1LJIA 3QJSB 3GXRA 3DN8A 3W6CA 2X0AA 3UTVA 4MR1A 1IWVA 1R2NA 1D2YA 1L59A 115LA 5ILCA 5LIOA 4TSCA 1CVKA 256LA 1LCNA 4GCEA 104LA 146LA 1L66A 1GF6A 1PQDA 2OTYX 3CODA 5JJJA 5B2NA 1IWYA 107LA 1OV5A 1QUOA 1AT9A 4M4OA 2LZTA 142LA 1WTNA 200LA 2YDOA 1LSDA 4PRUA 4G70B 1O0AA 1L00A 3HUAA 3B0OA 2BQHA 1JKCA 1P46A 1L85A 1L02A 4ZPUA 2DQCY 1GHLA 4LFPA 1GPQC 3TXKA 4J4QA 3ZPRA 1GFEA 4X31A 1YIKA 2YBNA 1HC0A 2ZYPA 1H68A 1GF9A 1F0WA 3LZMA 3TXFA 1OUHA 1P56A 163LA 2ZQ4A 2C8OA 1L12A 2L6XA 3A8ZA 125LA 3DMXA 3CDQA 3NY9A 1UBZA 153LA 2DBTA 4B0DA 1ZMYL 1JPOA 2GV0A 3HT6A 2MEGA 3S8FB 1LHJA 1LTMA 3FA0A 1F4ZA 1KW5A 3WQJA 1JSFA 2YBHA 1L61A 5APCA 1AZFA 5LA8A 3K3TA 1YQVY 1IP4A 2BQOA 5I4XA 4QIDA 3C8QA 1P8HA 3ZEVA 1PZYA 2BQCA 1C6DA 4U3XB 1CJ9A 1W6ZA 1QSWA 1LSCA 1JSEA 3QAPA 1TN0A 2BQJA 2YCXA 231LA 4NGZA 1G06A 1RE2A 1L38A 3QJVB 3AW7A 3QBKA 1GE0A 5II3A 1B2KA 6LYTA 5IHGA 5M1YA 1BRRA 1TEWA 4ARPA 1L54A 2DQGY 2DQEY 1C7PA 2W1LA 1HZXA 2HU3A 1PQIA 3ABWA 2I25L 195LA 4DDCA 5KXWA 4EKRA 1IP2A 1NBYC 4LDLA 1X0SA 1ZVHL 2Q9DA 1LYSA 1CKFA 1L14A 5H2PA 4FDYA 1WQOA 4XTNA 3WUMA 1E0PA 3TMXA 2DQAA 2HPYA 1HERA 1DYCA 3QNGA 1LZ5A 4IB4A 4UWVA 2Q0MX 120LA 4CHXA 1CX7A 139LA 2LZMA 162LA 1L21A 236LA 1UIAA 1C46A 2MECA 3RZEA 244LA 3C8RA 2F32A 2WARA 1LSNA 4YEMA 5FSTA 1HSWA 4EOFA 3QDCA 5FHWA 2BQNA 5IELA 3DMZA 4DAJA 1G0JA 4IATA 4LT1A 1XEKA 4KLYA 1IC4Y 4OWEA 4H9IA 1CNSA 1QTCA 1L88A 4PJZA 4OWHA 3C82A 1CV1A 2CJLA 1IX0A 4OWBA 4ARQA 1RI8B 194LA 1L83A 4WOAA 1JGJA 212LA 5L3HA 181LA 1I56A 1L43A 1S8LA 1G7LC 1BB6A 154LA 2ZNXY 4GCBA 2G4PA 4GBRB 3SB7A 3HAPA 157LA 1L86A 2ZQ3A 1L62A 4LT2A 4ZIXA 2DKVA 3SB9A 2HULA 1IWTA 190LA 5EN0A 4WLTA 3DNAA 1LHLA 1LKSA 2ZIYA 1LWGA 1W08A 5AHYA 2W1XA 1B7OA 1JJ0A 1GFTA 1HF4A 4I7MA 1CKCA 2OU9A 4CFPA 5KXRA 3FE0A 5DN4A 1EQ5A 1S52A 3A3QA 2HUMA 2MEFA 2JAFA 1OYUA 1LPIA 3TXBA 3A34A 5KXYA 5HQ1A 5DHGA 3PDSA 4OW1A 1C6LA 237LA 1JKBA 2B72A 1B7PA 191LA 4OO9A 1IO5A 5KKHA 1TLAA 3QE8A 4XJBA 1YAQA 5L9JA 3AZ5A 206LA 1OUIA 3OE6A 1GFVA 1L56A 1IR9A 4MQTA 1FDLY 3SN6R 1QTEA 4G49A 1HENA 1VGOA 1LKRA 1P6YA 5B34A 4LDOA 1VJMA 2D4IA 4W59A 247LA 3NS0A 1L76A 3BKVA 4H9FA 4QEQA 1UCOA 1G0LA 4Z98A 1UA6Y 5KXMA 2G87A 3NSBA 1LYJA 3COCA 5A45A 198LA 150LA 1JTMA 1GDWA 3WU8A 2F4GA 3DN6A 4PK0A 2FYCA 4NGVA 3AJNA 1NHBA 255LA 4WM3A 4XJIA 1DQJC 143LA 187LA 4WM5A 1LMQA 4YENA 197LA 1L50A 3WXTA 1J1XY 2XTHA 3C8SA 2Z12A 3AYQA 4DQ7A 2HEDA 4PRQA 4XXJA 4GCFA 5HMVA 2L78A 4LT0A 3EMSA 3EBAB 4XTLA 1QTKA 2G4NA 2DQJY 1S8JA 158LA 4WG1A 4GP8B 4LYTA 2MEIA 5ITCA 5HMJA 3UTXA 4E97A 1BB7A 4LGKA 2XBRA 123LA 1P7SA 1QSQA 2QPDB 4NGWA 2RBPA 5KXPA 1BRDA 1OUCA 1OVKA 4N9RA 1L11A 1LZDA 1JWRA 5APDA 5AZDA 1L35A 1OP9B 5A3EA 1M0LA 1AM7A 1XIOA 5LWEA 5FCPA 1C6NA 2F93A 2LYZA 1REYA 1SWYA 1JQUA 1IXFA 4ARJA 1YANA 1P3NA 1D3FA 1T97A 5G53A 1P8UA 108LA 2MEHA 2RSCA 4S0WA 5LZMA 2O4WA 1PQMA 1LYZA 1SQ2L 135LA 1RFPA 232LA 4GCCA 226LA 2B6YA 1LGXA 4J7VA 3WPLA 2D6BA 1IIZA 4YF2A 1DZEA 1GFHA 5B07A 1C6GA 1QUTA 1DYDA 1IOCA 4NG1A 1LSYA 147LA 5B6WA 4WL7A 2RB0X 4NHIA 3GUOA 1D9UA 4GPOA 3S8GB 189LA 3A91A 1LHIA 129LA 4HTNA 3QJRB 3HUKA 1KG9A 4NSGA 1CV0A 4WMGA 1L68A 2NTHA 4R6CA 176LA 5DM9A 5F81A 5JENB 2CGIA 4ETAA 2Q9EA 3AM6A 1LZ4A 3A92A 4ETBA 170LA 4EPIA 1P8IA 1L44A 1LMPA 3RZ4A 2BQGA 4NGIA 2BRDA 3VWOA 3QAKA 1LYIA 3DN3A 5B59A 4PPOA 3EH4B 201LA 2XBSA 3T36A 5KKJA 3HBEX 4WM1A 4NHQA 2Z38A 1YAPA 1G0KA 1LYGA 5AHZA 1L74A 1L70A 3GUNA 2MEAA 3ATOA 4I7JA 1LZYA 1NKHA 1CU2A 5B05A 2D4KA 1QHJA 1QTVA 5IDDA 112LA 1WVUA 1REXA 3LYTA 4ZEEA 1KXYA 3VVKA 1L47A 1C43A 3SBAA 148LE 5T3FA 4DT3A 4LZTA 4Z41A 4MBSA 2I26L 1DI3A 1J1OY 1EHKB 4ANRA 1LMNA 185LA 3WUAA 1JJ3A 1PS5A 5H2NA 4KPMA 1GFJA 1L80A 1FLYA 229LA 1T6HA 1XEPA 3OE0A 4YXCA 4AMIA 1OV7A 1RJCB 1HFYA 3E3DA 5E9RA 1ALCA 1B5XA 3KAMA 1FN5A 3L2XA 1KMEA 1LJFA 4DD0A 2O7AA 3UONA 2Z6BA 209LA 2B6XA 4Z3MA 2Y8PA 4DD7A 1CU5A 1KNIA 4ARMB 4KNFA 1SX2A 1UCQA 5J7CA 3G3BB 4BAFA 1GB8A 2ZZLA 4AMJA 3A93A 3AYMA 1HEOA 1GFGA 1TBYA 145LA 2RBQA 5B6XA 252LA 4RLMA 4UWUA 258LA 4MD2A 3HUQA 4DQJA 183LA 3HH3A 2NWDX 1F10A 1V7TA 3BVDB 4I0CA 1D0LA 1GBSA 4HV2A 1L28A 3PBLA 1LJKA 1L07A 5EBHA 1B5UA 2KSYA 3S3CB 4HYJA 3W3EA 141LA 1LZCA 2YBLA 3AW6A 4HPEA 1C64A 1UACY 254LA 7LYZA 2AT9A 1LAAA 2CUUA 1LJHA 3F9LA 3JR6A 1JHLA 1G7MC 1PQOA 5I53A 199LA 4E3UA 2KS9A 3X3BA 2H5ZA 4QI1A 5FEKA 4BVNA 1L18A 4I7RA 1GD6A 134LA 1EPYA 1GB3A 1A4VA 1L29A 1L9HA 1IP6A 1L91A 208LA 4WO6A 2HEEA 3A3RX 4H92A 2QARC 4DWXA 6LZMA 1P2LA 3AYNA 2YBIA 1C65A 4EA3A 5DLAA 152LA 3AZ4A 1IEEA 1JKDA 1L96A 1NDGC 4K5YA 4YX7C 1VDPA 3LYZA 5FJGA 1C08C 4QRYA 3OJPA 4DJHA 4KXIA 1WQRA 1F50A 2LYMA 4TUNA 3PQRA 1XFPL 222LA 4W55A 177LA 3C9LA 4NGKA 4X3BA 4J1AA 4NGLA 1LSPA 4RW2A 1L55A 1LZRA 4N1EI 2YBMA 1H87A 160LA 5ETZA 1B5VA 3M18B 4DDBA 1VFBC 4WLDA 3WU7A 4XENA 2YDVA 261LA 5G2AA 2HEAA 1G0GA 4BUOA 1C66A 1IY4A 4W57A 1BRXA 1IOTA 114LA 2A4TA 1YL0X 1PQJA 1ZWNA 5F16A 5I5QA 3WPKA 5F14A 1T6VL 3HBHA 4W53A 2N5ZA 4I7QA 249LA 4DKLA 103LA 2Z2EA 5LAGA 3TMWA 4RLNA 1B0DA 1DKKA 1L10A 2HEBA 1P37A 1L99A 155LA 2OU0X 215LA 2HUKA 5H2HA 2MEBA 1L98A 178LA 1UIDA 5G54A 1L60A 1L34A 1GF0A 3HAQA 5H2LA 1L04A 1JKAA 3FADA 1QKOA 4WW3A 4JQ6A 2Y04A 1XEJA 1S54A 4P2EA 1G7JC 1C63A 5B6YA 3WW5A 5LXWA 4EPFA 4NHPA 1GBWA 4TWSA 3N9EA 2HECA 1HEQA 4OWCA 1PQKA 3A67Y 5E4PA 4BS7A 4FA7B 2BQDA 1L0MA 5G2DA 1L79A 4GRVA 2F4AA 3F8VA 1G7IC 1XEIA 1IOSA 1B9OA 3RNXA 1L39A 1F88A 3QJQB 5DHHA 130LA 3SP3A 2BPUA 1GEVA 8LYZA 5LVIA 1LMAA 1GBOA 4HJYA 1CKGA 1C6BA 3QBLA 3HWLA 228LA 4QY9A 4N4YB 3HH4A 1TCYA 1D6QA 3P65A 2BQEA 1L32A 1L67A 4KT3A 1B7MA 3CDTA 239LA 1CKHA 4ETDA 111LA 1CU3A 4PXKA 4H8ZA 1C6PA 1WQPA 137LA 4DDAA 1LSBA 1LZTA 4IARA 3HDFA 122LA 4IAQA 1L52A 1L17A 4N1CC 2LHMA 2BLYA 1LLHA 1L42A 2Y02A 1XJTA 1C8SA 1IW9A 1C6EA 4QGZA 3DDLA 3OAXA 4G71B 1I1ZA 1QT8A 2WJLA 1QM8A 4I7TA 1GWDA 1B7NA 1C6IA 3RU5A 2OEAX 4TSBA 1YKXX 1D6PA 3D3DA 1KG8A 1IR7A 1QUDA 3WYHA 220LA 1OUFA 1HHLA 205LA 1KXWA 1VATA 3J6KA 1B7LA 1OUDA 4ARQB 1L13A 1LJEA 5D5FA 3CDRA 2BQBA 1XGQC 1LGWA 1UAZA 1C68A 2M3GA 3QJUB 216LA 1OUEA 5LA5A 5HNLA 2F95A 4G4BA 1U19A 4TL3A 4W94A 1LYDA 5DYSA 1GXXA 4GP4B 5AMYA 1SWZA 1DYEA 224LA 5B1GA 1PXRA 5A44A 3GUIA 1UICA 4NGOA 168LA 3C7ZA 4QDNA 238LA 2FBDA 1P2RA 5LVGA 1IY3A 5H2IA 4I7KA 3RW8A 186LA 3WULA 1NBZC 3GUJA 3TXEA 2EIZC 1J1PY 4H9CA 1R84A 4HV1A 3T45A 4NGYA 1G1WA 4G4CA 4I7LA 1L40A 4EXMA 4M6DA 1L16A 1G07A 4CFOA 1L24A 240LA 3D4SA 1G0PA 4LYZA 2Z2FA 1KY1A 2F30A 5AX1A 2RBSA 5DN5A 2NTUA 3DKEX 2ANVA 1NDMC 1FBKA 243LA 3AZ6A 4BADA 4LYBA 4UG2A 1CU0A 1KIRC 1IVMA 1C6MA 1WTMA 4H8XA 2BQKA 1OUAA 5B6VA 3CAPA 1LMCA 1GE2A 1L0KA 5TGZA 1C69A 1GBYA 188LA 1GFKA 1IW6A 1LSMA 2NTWA 3S3BB 1T8AA 233LA 2A7FA 4N0JA 1YROA 4HTQA 5LVJA 5LYMA 159LA 1IWXA 2OE4X 4MD1A 3AGGG 3G3AB 4LFXA 3HTFA 4B4IA 5G2CA 4HPIA 1HFXA 4NSHA 3K2RA 2YVBA 2IHLA 4A7DA 5KXTA 1P64A 1B7QA 1HELA 2EQLA 1CX6A 3TXIA 184LA 1DI5A 1C45A 1IOQA 4W96A 2BQLA 3B72A 4B1AA 1DPXA 1L53A 5G28A 4C5FA 3FI5A 4W58A 4GLVA 4FAAB 2ZIJA 1WQNA 1CU6A 1LZSA 3J4GA 3ZVQA 1IR8A 2LZ2A 3DN4A 2FYDA 5LINA 1YAMA 4EKQA 151LA 3UTYA 4B49A 4JKVA 3HBDA 4XT3A 1LJ4A 218LA 245LA 132LA 1LSGA 1L95A 4WO9A 2HTXA 1C60A 2CDSA 4N4WA 3A95A 167LA 5HNCA 1OWZA 1L81A 1LMTA 4NG8A 2Z73A 213LA 5KXKA 2Z19A 4XTOA 4W54A 1CTWA 1B5YA 4NC3A 1NMMA 4I7PA 1GB2A 2MEDA 3GULA 4UHRA 1LHHA 3KJ6A 2ZFEA 5I4YA 3L64A 1QT6A 3IJVA 1GB9A 1REZA 3HT9A 5HLLA 1SX7A 3TXGA 5DL9A 3CSQA 2B74A 5JJEA 5B06A 5A3ZA 3EH3B 4ZFPA 1L20A 2B5ZA 5G36A 4G7QB 3CT1A 131LA 1CV3A 1JTNA 102LA 5ILFA 4XT1A 3VHZA 1D0KA 3N9CA 1FLQA 2DQHY 1VAUA 1T3PA 1D9WA 1IP3A 1OVHA 5H2OA 3C9MA 1L01A 4XADA 5KXNA 1OQMA 3W6EA 1D3JA 4WM4A 5BR2A 1QIOA 1QT7A 1L08A 4ETCA 1JITA 4W56A 4NSJA 1KW7A 4LDEA 3MBVA 1DXJA 1B7RA 4H94A 3UTWA 3AGHA 4H9HA 4JR8A 1GB6A 4H9AA 9LYZA 1HEPA 3WVYA 1QDRA 2VT4A 4DD1A 1P2CC 2ZNWY 1IWUA 1GF7A 175LA 1QT3A 5B0WA 1IORA 3HU8A 4MCKA 180LA 207LA 3N9AA 259LA 3SB6A 1FBIX 4H91A 5L3IA 5H2JA 3QJTB 3CT0A 1LYYA 3DN1A 5LVHA 3TXJA 4EMNA 4DYGA 1E12A 1HEMA 1C10A 223LA 1WQQA 2LC9A 2ZIKA 1F6SA 1M0KA 1GFRA 4LYMA 1LJ3A 4X32A 1C6QA 1GUEA 3LZTA 4NWHA 1CUPA 1DZBX 4WLYA 1BHZA 214LA 1OUGA 2D91A 1YAOA 3V2YA 4DD2A 1GAYA 126LA 1DPWA 1OUJA 2XJWA 2B7XA 1L09A 3B6LA 4J0LA 2B70A 1JTOL 3EMLA 3MGWA 1XGTC 1KGBA 3EH5B 1KS3A 1QSBA 1GAZA 2Z37A 260LA 1Q5JA 3TMVA 2B75A 2I35A 1XGUC 1JV7A 3HTGA 4NEBA 2OE7X 113LA 4XJHA 1YKZX 4OOTA 5APFA 2RBOA 1JFPA 219LA 3UG9A 4AXTA 4AQNA 5KXLA 221LA 1P5CA 1BWJA 1HNLA 3OE9A 1XJIA 4YEOA 1E8LA 3WW6A 2RBNA 3ULRA 138LA 2Z39A 230LA 3QBIA 1BGIA 4X1HA 5C6JA 3HFMY 1T8FA 4H8YA 4GN5C 2W1MA 4BEZA 1L31A 3C7YA 2G4QA 5F9XA 1LHKA 1LZ8A 1A2YC 1TAYA 1G7HC 4DC4A 3RT5X 1LYOA 1D2WA 1M0MA 211LA 1L89A 3UZAA 3T6UA 1WQMA 1L92A 1IC7Y 1GE1A 5C1MA 1L63A 1L45A 1JTPL 2RB1X 3RFMA 3UZCA 3TXHA 2EPEA 1KY0A 2RB2X 2XQOA 2YCYA 1VDSA 1UIEA 3DN0A 1L58A 2F2QA 1C6FA 1HSXA 3B0KA 3G3WA 2NTGA 1QQYA 1SSYA 3VG9A 1EL1A 5LAFA 5B6ZA 1L15A 166LA 1KIQC 3WU9A 5APEA 1IP5A 140LA 1XGRC 1B6IA 127LA 1LYEA 3GUPA 5F8UA 4GLAA 1GBXA 4WAVA 4BAPA 2I21A 4CJ2A 1FKQA 4IJ4A 4NSIA 1QS9A 3A90A 1L72A 4ET8A 1EQEA 2LCBA 2Z18A 4GN3A 4ML7A 4NGJA 4DD3A 4MSTA 1IP7A 1IC5Y 2B6WA 1L75A 1SLYA 1XGPC 3DQBA 2H9KA 3ZEKA 4ARLA 1YKYX 1BWIA 1L23A 2C8PA 3HARA 1L87A 4FJRA 2IFFY 192LA 1L41A 4NFVA 1VDTA 3PXOA 4C3WA 1BB4A 1JISA 1VDQA 1G0QA 4H9BA 4NHSA 1FKVA 1L57A 3CSRA 4EIYA 5KXXA 3A6BY 1L26A 4RDSA 4BEYA 1BVXA 225LA 4LYOA 3HH6A 3VW7A 1B7SA 3LYMA 3LZ2A 1GF3A 144LA 4B4JA 3WXUA 2R4SA 1LN6A 5K7OA 4ET9A 1T8GA 1D3MA 4R0FA 4II8A 1NQIA 4H9EA 1NF5A 2ZWBA 1QDTA 4TTDA 109LA 1D3NA 1O23A 4OWAA 1L82A 1NWGA 1QSAA 169LA 1GB0A 5ITEA 4LYCA 2WJKA 2YDGA 2HUBA 1IWWA 4GBRA 4G7SB 1L77A 1DYBA 2LNLA 174LA 1GB7A 1L37A 3A7KA 1AT5A 5KY1A 2J4YA 2BQAA 1LJGA 4DS7E 4HYXA 1UIBA 1ZVYB 2Y03A 250LA 4I7OA 2PC2A 2B6ZA 4B4EA 1QT5A 1BB5A 4DD9A 1GE3A 3CSZA 3LYOA 1L49A 1N4FA 4N6HA 1Q5IA 4L35A 1NHEA 2B6TA 3OK0A 1Z55A 1ZURA 3EO5A 1GF5A 2D4JA 2HU1A 3TXDA 119LA 1LOZA 2OU8A 1L0JA 3V2WA 3WL2A 2VB1A 4N5RA 1BVKC 241LA 1AP9A 5I54A 1HMKA 1L64A 3A94A 1LMOA 1QUHA 3D9AC 5I14A 2CWIA 1GB5A 1L69A 2F47A 1V7SA 2RAYX 1ZYTA 1OWYA 4YXAC 1HMLA 1LI6A 4PHIA 1CJ8A 1C3WA 1CV6A 4DQ5A 3ZPQA 1L71A 3AGIA 3SB8A 5F9UA 1C6CA 1FLUA 1JUGA 2B73A 1BWHA 3G3VA 2PEDA 1C6HA 2RAZX 2Y01A 1LW9A 4HSFA 3W6AA 2EKSC 4YOPA 5KJ9A 4GP5B 1QUSA 1G0MA 1QUGA 4HJZA 2H9JA 2X72A 4HJVA 2DQFC 1B5WA 2BQIA 5D5CA 1GFAA 3W6FA 1LZEA 3B0IA 1GFUA 2KSBA 1CV4A 156LA 1LPYA 1WTHA 4H1PA 3ODUA 1KIPC 4WG7A 2OTZX 4PGJB 3HT8A 1LSAA 1L90A 1FBBA 149LA 1IWZA 1RCMA 5H2MA 4Z46A 3WUNA 3C7WA 4L6RA 5A8EA 4HTKA 1QT4A 3NYAA 235LA 4J1BA 4FPDA 3AZ7A 1CKDA 3TMUA 1GBZA 1LZAA 5J7AA 3X3CA 4EJ4A 253LA 3GXKA 4XJGA 3HANA 3BKHA 3P66A 1X0K1 1CJ7A 3HH5A 1UUZC 4PJ2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SX7 A;  1K28 A;  2AT9 A;  1CX7 A;  139L A;  2LZM A;  2CUU A;  2OE9 X;  3F9L A;  162L A;  1L21 A;  236L A;  3JR6 A;  1L94 A;  3RZE A;  244L A;  2B74 A;  1PQO A;  5JJE A;  3C8R A;  4OV0 A;  199L A;  2F32 A;  2KS9 A;  3X3B A;  4QI1 A;  5H2K A;  242L A;  3SBB C;  3EH3 B;  3C83 A;  248L A;  4BVN A;  1L20 A;  3QDC A;  1L18 A;  3DMZ A;  4I7R A;  4DAJ A;  1G0J A;  3HU9 A;  1BM1 A;  4G7Q B;  2I20 A;  5G36 A;  131L A;  1CV3 A;  4KLY A;  1JTN A;  102L A;  1EPY A;  1QTC A;  1L88 A;  4PJZ A;  4XT1 A;  1L29 A;  1X0I 1;  3VHZ A;  1L9H A;  1L91 A;  3C82 A;  1CV1 A;  1L30 A;  1D9W A;  4BWB A;  3GUM A;  2R4R A;  1OVH A;  5H2O A;  2QAR C;  3C9M A;  1L01 A;  6LZM A;  1GU8 A;  1P2L A;  3AYN A;  1C6K A;  1D3J A;  3G3X A;  1C65 A;  1QS5 A;  4ARQ A;  7LZM A;  4EA3 A;  5BR2 A;  1S51 A;  152L A;  1L08 A;  1QT7 A;  173L A;  1L83 A;  1C6T A;  1JGJ A;  4W56 A;  1LGU A;  212L A;  1KW7 A;  4LDE A;  262L A;  181L A;  2YCZ A;  3MBV A;  1L96 A;  2RH1 A;  4K5Y A;  4YX7 C;  3UTW A;  4JR8 A;  5FJG A;  1L43 A;  1S8L A;  4QRY A;  4BV0 A;  2YCW A;  1L06 A;  4DJH A;  1F50 A;  2VT4 A;  3PQR A;  222L A;  118L A;  1QT3 A;  4W55 A;  175L A;  182L A;  4GBR B;  4I7S A;  177L A;  3SB7 A;  3C9L A;  3HAP A;  3HU8 A;  5B0W A;  180L A;  157L A;  1L86 A;  3PWH A;  1L62 A;  259L A;  1L55 A;  3SB6 A;  5H2J A;  3QJT B;  1L93 A;  160L A;  165L A;  172L A;  5ETZ A;  3DN1 A;  4G7R B;  3SB9 A;  5JJN A;  2HUL A;  1E12 A;  3HAO A;  190L A;  5EN0 A;  2YDV A;  3DNA A;  1L36 A;  1L33 A;  223L A;  2LC9 A;  2ZIY A;  1M0K A;  1LWG A;  261L A;  5AHY A;  5G2A A;  1G0G A;  1L05 A;  4X32 A;  4BUO A;  1C66 A;  4I7M A;  4I7N A;  4W57 A;  2OU9 A;  1BRX A;  1C6Q A;  1LWK A;  3HT7 A;  3REY A;  1GUE A;  1L73 A;  1S52 A;  114L A;  4A4M A;  4LZM A;  5AWZ A;  2HUM A;  2JAF A;  2A4T A;  1OYU A;  1PQJ A;  1CWQ A;  1ZWN A;  1L03 A;  210L A;  2QPE B;  5DHG A;  3PDS A;  4W53 A;  4I7Q A;  1C62 A;  1C6L A;  1CUQ A;  1CUP A;  249L A;  237L A;  2B72 A;  4DKL A;  103L A;  1SSW A;  214L A;  3V2Y A;  1L19 A;  5AX0 A;  191L A;  4OO9 A;  5KKH A;  3P0G A;  1TLA A;  126L A;  1L10 A;  1DYF A;  171L A;  1LI2 A;  2B7X A;  1L09 A;  1DYA A;  1P37 A;  2B70 A;  206L A;  2RBR A;  3EML A;  1KGB A;  1L99 A;  3EH5 B;  155L A;  1L84 A;  2OU0 X;  3CDV A;  3OE6 A;  1KS3 A;  1L56 A;  1QSB A;  215L A;  2HUK A;  5H2H A;  1L98 A;  260L A;  1Q5J A;  178L A;  2B75 A;  2I35 A;  4MQT A;  217L A;  3SN6 R;  3HTD A;  246L A;  1PXS A;  5G54 A;  1JV7 A;  1L60 A;  1VGO A;  1L46 A;  1L34 A;  1P6Y A;  3HTG A;  5B34 A;  3HAQ A;  4PXF A;  1L04 A;  5H2L A;  2OE7 X;  3FAD A;  4LDO A;  113L A;  1VJM A;  1QKO A;  1XME B;  4W59 A;  4WW3 A;  247L A;  3RUN A;  2Y04 A;  128L A;  3NS0 A;  2RBO A;  1JFP A;  4JQ6 A;  1QTZ A;  219L A;  1S54 A;  1L76 A;  4AQN A;  3UG9 A;  221L A;  1C61 A;  1P5C A;  1G0L A;  3OE9 A;  2JAG A;  1C63 A;  5B6Y A;  1XJI A;  4EPF A;  2G87 A;  3OE8 A;  2RBN A;  2KSA A;  3NSB A;  138L A;  1LYJ A;  230L A;  234L A;  1L51 A;  3COC A;  198L A;  3QBI A;  4X1H A;  150L A;  1JTM A;  5A45 A;  1QTB A;  2EI4 A;  1T8F A;  4G72 B;  1PQK A;  4BEZ A;  3DN6 A;  1L31 A;  4FA7 B;  4PK0 A;  3C7Y A;  257L A;  1NHB A;  255L A;  1L0M A;  1L79 A;  5G2D A;  4GRV A;  143L A;  3F8V A;  187L A;  197L A;  1P36 A;  1L50 A;  1L22 A;  3HTB A;  1L39 A;  3C8S A;  1F88 A;  3QJQ B;  5DHH A;  1L25 A;  130L A;  3VGA A;  5B35 A;  1D2W A;  1L65 A;  1TN5 A;  4XXJ A;  1M0M A;  211L A;  2L78 A;  1L89 A;  4Y9H A;  3UZA A;  4XTL A;  3GUK A;  1L92 A;  3NY8 A;  1S8J A;  158L A;  1C6B A;  5C1M A;  4GP8 B;  3DN2 A;  4GYC A;  1L63 A;  1L45 A;  1LYH A;  3QBL A;  3HWL A;  164L A;  3C81 A;  3UTX A;  2RB1 X;  4E97 A;  3HAS A;  5ITC A;  3RFM A;  228L A;  3UZC A;  123L A;  1P7S A;  4N4Y B;  3HH4 A;  1LI3 A;  1KY0 A;  1QSQ A;  2QPD B;  1LYF A;  2RB2 X;  2YCY A;  1L32 A;  1L67 A;  2RBP A;  3DN0 A;  1BRD A;  1L58 A;  1OVK A;  2F2Q A;  1C6F A;  1L11 A;  4ARM A;  3CDT A;  239L A;  3G3W A;  4W51 A;  4HWL A;  111L A;  1CU3 A;  4PXK A;  2NTG A;  1C6P A;  1SSY A;  2Y00 A;  3VG9 A;  137L A;  5AZD A;  1G1V A;  1L35 A;  1M0L A;  110L A;  1C6J A;  4IAR A;  1XIO A;  3HDF A;  5LWE A;  122L A;  1L15 A;  5B6Z A;  166L A;  3CDO A;  227L A;  4IAQ A;  1C6N A;  1L17 A;  1L52 A;  1MGY A;  2F93 A;  1LLH A;  1L42 A;  1SWY A;  2Y02 A;  1XJT A;  140L A;  1JQU A;  1C6E A;  2QB0 B;  1IW9 A;  1IXF A;  1C8S A;  4ARJ A;  3DDL A;  4MQS A;  1B6I A;  1L48 A;  2Z55 A;  3OAX A;  4G71 B;  127L A;  1LYE A;  3GUP A;  1P3N A;  2WJL A;  1QT8 A;  5F8U A;  1D3F A;  1QM8 A;  1T97 A;  5G53 A;  1P8U A;  4I7T A;  161L A;  1C6I A;  108L A;  4S0W A;  5LZM A;  2O4W A;  4WAV A;  2OEA X;  1PQM A;  2I21 A;  1QS9 A;  1QTD A;  1KG8 A;  1L72 A;  232L A;  1QUD A;  2LCB A;  2O79 A;  220L A;  226L A;  2B6Y A;  5BR5 A;  1OVJ A;  1C67 A;  1I6S A;  1LGX A;  205L A;  1CV5 A;  1PY6 A;  1XJU A;  1C6A A;  2B6W A;  3SB5 A;  1L75 A;  1C8R A;  1DZE A;  2I1X A;  3DQB A;  4ARQ B;  1C6G A;  3DMV A;  3HDE A;  1L13 A;  1GZM A;  1H2S A;  4ARL A;  1DYD A;  4EKS A;  196L A;  1L27 A;  3VI0 A;  1L23 A;  3CDR A;  4FBZ A;  3HAR A;  1JV6 A;  1UAZ A;  1LGW A;  147L A;  5B6W A;  1L87 A;  1C68 A;  251L A;  2M3G A;  192L A;  1L41 A;  2IGC A;  2RB0 X;  4IAP A;  3PXO A;  3QJU B;  1G0Q A;  216L A;  1QKP A;  1L57 A;  3GUO A;  2F95 A;  4EIY A;  3C80 A;  4GPO A;  1U19 A;  1L26 A;  4TL3 A;  3S8G B;  4BEY A;  1L97 A;  189L A;  1QTH A;  225L A;  1LYD A;  2ANX A;  4W52 A;  4GP4 B;  3HH6 A;  5DYS A;  3VW7 A;  4EKP A;  1SWZ A;  1DYE A;  224L A;  129L A;  1PXR A;  3S3D B;  1S53 A;  1DYG A;  3QJR B;  5A44 A;  144L A;  3QBG A;  3GUI A;  2R4S A;  3HUK A;  1LN6 A;  1KG9 A;  3QJS B;  1T8G A;  1D3M A;  1CV0 A;  3DN8 A;  3UTV A;  168L A;  1L68 A;  1R2N A;  1D2Y A;  3C7Z A;  238L A;  2NTH A;  176L A;  1L59 A;  115L A;  1P2R A;  109L A;  1D3N A;  1CVK A;  2Q9E A;  1L82 A;  256L A;  170L A;  4I7K A;  4EPI A;  1P8I A;  5H2I A;  169L A;  186L A;  104L A;  146L A;  1L66 A;  1L44 A;  1PQD A;  5ITE A;  2OTY X;  3COD A;  2WJK A;  5JJJ A;  3GUJ A;  3AM6 A;  5B2N A;  107L A;  1OV5 A;  2BRD A;  1QUO A;  4GBR A;  1AT9 A;  4G7S B;  142L A;  1L77 A;  3QAK A;  1R84 A;  3T45 A;  1LYI A;  1DYB A;  200L A;  3DN3 A;  1G1W A;  2LNL A;  2YDO A;  3EH4 B;  174L A;  4I7L A;  201L A;  1O0A A;  4G70 B;  1L37 A;  3A7K A;  1L40 A;  1L00 A;  3HUA A;  4EXM A;  2J4Y A;  4HYX A;  1L16 A;  1G07 A;  2Y03 A;  250L A;  1P46 A;  1L85 A;  1L24 A;  1L02 A;  240L A;  3D4S A;  4I7O A;  4ZPU A;  1G0P A;  2B6Z A;  1G0K A;  1QT5 A;  1KY1 A;  1LYG A;  5AHZ A;  5AX1 A;  2RBS A;  1L49 A;  2NTU A;  3DKE X;  1L74 A;  2ANV A;  1L70 A;  1Q5I A;  1FBK A;  4N6H A;  243L A;  3GUN A;  4L35 A;  4J4Q A;  2B6T A;  4I7J A;  4UG2 A;  3ZPR A;  1CU2 A;  1CU0 A;  1ZUR A;  1QHJ A;  4X31 A;  1C6M A;  1H68 A;  1QTV A;  3LZM A;  119L A;  5B6V A;  2OU8 A;  3CAP A;  112L A;  1L0K A;  1L0J A;  1P56 A;  5TGZ A;  3V2W A;  1C69 A;  163L A;  188L A;  241L A;  1AP9 A;  1L12 A;  2L6X A;  1IW6 A;  1L64 A;  125L A;  2NTW A;  1QUH A;  3CDQ A;  3DMX A;  3NY9 A;  5I14 A;  3S3B B;  1T8A A;  3VVK A;  1L47 A;  233L A;  1L69 A;  2F47 A;  3SBA A;  148L E;  2RAY X;  1ZYT A;  1OWY A;  4YXA C;  3HT6 A;  159L A;  4MBS A;  1LI6 A;  3S8F B;  2OE4 X;  1EHK B;  4MD1 A;  1C3W A;  1CV6 A;  3ZPQ A;  3HTF A;  185L A;  5G2C A;  1L71 A;  3FA0 A;  3SB8 A;  1F4Z A;  1KW5 A;  5H2N A;  3WQJ A;  1L80 A;  1C6C A;  3K2R A;  229L A;  2B73 A;  1L61 A;  1T6H A;  1XEP A;  3G3V A;  2PED A;  1C6H A;  2RAZ X;  2Y01 A;  1P64 A;  3OE0 A;  1CX6 A;  4YXC A;  4AMI A;  1LW9 A;  184L A;  1OV7 A;  4QID A;  3C8Q A;  1P8H A;  4GP5 B;  1L53 A;  1G0M A;  5G28 A;  1QUG A;  3ZEV A;  3L2X A;  1KME A;  2X72 A;  3FI5 A;  2O7A A;  4W58 A;  1C6D A;  3UON A;  2Z6B A;  209L A;  2B6X A;  4FAA B;  1CU6 A;  2KSB A;  1CU5 A;  1CV4 A;  1KNI A;  4ARM B;  156L A;  1LPY A;  3QAP A;  1WTH A;  1TN0 A;  1SX2 A;  4KNF A;  3ODU A;  2YCX A;  1UCQ A;  3DN4 A;  231L A;  1G06 A;  3QJV B;  1L38 A;  2ZZL A;  2OTZ X;  3HT8 A;  4EKQ A;  3QBK A;  4AMJ A;  151L A;  3UTY A;  1L90 A;  4JKV A;  1FBB A;  3AYM A;  149L A;  218L A;  4XT3 A;  1BRR A;  245L A;  2RBQ A;  4ARP A;  145L A;  1L54 A;  5H2M A;  1L95 A;  5B6X A;  3C7W A;  4L6R A;  5A8E A;  252L A;  1HZX A;  1PQI A;  3ABW A;  4N4W A;  195L A;  1C60 A;  1QT4 A;  3NYA A;  235L A;  4EKR A;  167L A;  4FPD A;  1OWZ A;  258L A;  4LDL A;  1L81 A;  1X0S A;  4MD2 A;  3HUQ A;  2Q9D A;  2Z73 A;  183L A;  3HH3 A;  1L14 A;  5H2P A;  5J7A A;  213L A;  3BVD B;  4XTO A;  4W54 A;  1CTW A;  4XTN A;  4NC3 A;  4I7P A;  1E0P A;  1L28 A;  3GUL A;  3PBL A;  3X3C A;  2HPY A;  4UHR A;  1L07 A;  4EJ4 A;  2KSY A;  253L A;  3S3C B;  3HAN A;  4HYJ A;  3KJ6 A;  2ZFE A;  141L A;  1DYC A;  3L64 A;  1X0K 1;  1QT6 A;  4IB4 A;  1C64 A;  3HH5 A;  120L A;  254L A;  3HT9 A; 
#chains in the Genus database with same CATH topology
 1K28 A;  5KXZ A;  1IP1 A;  2OE9 X;  1LZ1 A;  2BQF A;  1ZV5 L;  2AUB A;  5KXO A;  4G9S A;  1L94 A;  4OV0 A;  3ATN A;  3CT5 A;  5LYT A;  4XJF A;  1GEZ A;  1FLW A;  5H2K A;  242L A;  3SBB C;  3C83 A;  248L A;  3EXD A;  2HEF A;  3HU9 A;  1BM1 A;  2I20 A;  4N8Z A;  3LHM A;  1X0I 1;  1DKJ A;  1LHM A;  3WH1 A;  1L30 A;  4BWB A;  3GUM A;  2R4R A;  6LYZ A;  1JTT L;  1GU8 A;  2ZYC A;  4GCD A;  1C6K A;  1LZ6 A;  3G3X A;  1QS5 A;  4TX7 A;  7LZM A;  1S51 A;  173L A;  1C6T A;  1LGU A;  262L A;  2YCZ A;  5C6I A;  4XYY A;  2RH1 A;  1LZ9 A;  1LZB A;  1LZN A;  4BV0 A;  2YCW A;  1L06 A;  1GDX A;  118L A;  182L A;  4I7S A;  3PWH A;  4RW1 A;  3P4Z A;  2F2N A;  5LVK A;  1L93 A;  165L A;  172L A;  3A96 A;  4G7R B;  3FI7 A;  4KL7 A;  5JJN A;  5KXS A;  3HAO A;  1MEL L;  4O34 A;  1L36 A;  1L33 A;  1JJ1 A;  4WL6 A;  1L05 A;  3LN2 A;  2ZIL A;  1VED A;  4I7N A;  1LWK A;  3HT7 A;  5C6L A;  3REY A;  133L A;  1L73 A;  4A4M A;  4LZM A;  5AWZ A;  1CWQ A;  1L03 A;  210L A;  1LJJ A;  1MLC E;  2QPE B;  4NY5 A;  1C62 A;  1CUQ A;  1SSW A;  1L19 A;  5AX0 A;  3W6B A;  3P0G A;  1OUB A;  1DYF A;  171L A;  1LI2 A;  1DYA A;  1H6M A;  2RBR A;  5KKI A;  1JIY A;  4NHT A;  1L84 A;  1GXV 2;  3CDV A;  4HP0 A;  4WM6 A;  1TDY A;  1REM A;  4LT3 A;  217L A;  3P64 A;  3HTD A;  246L A;  1PXS A;  5FDJ A;  1L46 A;  4PXF A;  3QY4 A;  1XME B;  3RUN A;  128L A;  1QTZ A;  1UIG A;  1C61 A;  2JAG A;  2BLX A;  2I6Z A;  2FBB A;  2MEE A;  3OE8 A;  1XSF A;  2KSA A;  4GN4 A;  234L A;  2W1Y A;  1L51 A;  1QTB A;  2EI4 A;  4G72 B;  4NWE A;  257L A;  1B5Z A;  3ZVQ B;  1BB3 A;  1P36 A;  193L A;  1L22 A;  3HTB A;  1UIF A;  1L25 A;  3IWR A;  3VGA A;  5B35 A;  1L65 A;  1TN5 A;  4Y9H A;  3GUK A;  1YL1 X;  3NY8 A;  1KXX A;  5I4W A;  3DN2 A;  4GYC A;  1AKI A;  1LYH A;  164L A;  3C81 A;  1HFZ A;  3HAS A;  3P68 A;  4ETE A;  1LI3 A;  1LYF A;  4G4H A;  2YBJ A;  3A6C Y;  5FEL A;  2DQD Y;  1GF4 A;  2DQI Y;  3AB6 A;  4XN6 A;  4ARM A;  4IAS A;  4W51 A;  4H90 A;  1BQL Y;  4HWL A;  3CQL A;  2A7D A;  1F6R A;  1UC0 A;  2BAA A;  2Y00 A;  1G1V A;  1AT6 A;  110L A;  1C6J A;  3CDO A;  227L A;  4H93 A;  3W6D A;  1MGY A;  4WM2 A;  1LSZ A;  2QB0 B;  5LYZ A;  4MQS A;  4WLX A;  1L48 A;  1LSF A;  1UIH A;  2Z55 A;  3WMK A;  4I8S A;  1INU A;  161L A;  1EQ4 A;  1I20 A;  1GE4 A;  4OOO A;  5B1F A;  1QTD A;  2O79 A;  1LSE A;  5BR5 A;  1OVJ A;  2LYO A;  1LJN A;  1C67 A;  1I6S A;  1CJ6 A;  1CV5 A;  1PY6 A;  1XJU A;  2YSS C;  4XJD A;  1C6A A;  1JEF A;  3SB5 A;  1C8R A;  2I1X A;  3DMV A;  3HDE A;  1GZM A;  1H2S A;  3WVX A;  4D9Z A;  4EKS A;  196L A;  1LZG A;  1L27 A;  3VI0 A;  4FBZ A;  1JV6 A;  4CGE A;  251L A;  4IAP A;  2IGC A;  1QKP A;  3CB7 A;  1GF8 A;  3C80 A;  1HEW A;  1YIL A;  1L97 A;  2BQM A;  1QTH A;  2ANX A;  4UWN A;  4W52 A;  4AGA A;  1D0M A;  3M3U A;  4YM8 A;  4L41 A;  1WVV A;  4EKP A;  3S3D B;  1S53 A;  1DYG A;  3IJU A;  3QBG A;  4NIJ A;  1DI4 A;  3F6Z A;  3WPJ A;  1LJI A;  3QJS B;  3GXR A;  3DN8 A;  3W6C A;  2X0A A;  3UTV A;  4MR1 A;  1IWV A;  1R2N A;  1D2Y A;  1L59 A;  115L A;  5ILC A;  5LIO A;  4TSC A;  1CVK A;  256L A;  1LCN A;  4GCE A;  104L A;  146L A;  1L66 A;  1GF6 A;  1PQD A;  2OTY X;  3COD A;  5JJJ A;  5B2N A;  1IWY A;  107L A;  1OV5 A;  1QUO A;  1AT9 A;  4M4O A;  2LZT A;  142L A;  1WTN A;  200L A;  2YDO A;  1LSD A;  4PRU A;  4G70 B;  1O0A A;  1L00 A;  3HUA A;  3B0O A;  2BQH A;  1JKC A;  1P46 A;  1L85 A;  1L02 A;  4ZPU A;  2DQC Y;  1GHL A;  4LFP A;  1GPQ C;  3TXK A;  4J4Q A;  3ZPR A;  1GFE A;  4X31 A;  1YIK A;  2YBN A;  1HC0 A;  2ZYP A;  1H68 A;  1GF9 A;  1F0W A;  3LZM A;  3TXF A;  1OUH A;  1P56 A;  163L A;  2ZQ4 A;  2C8O A;  1L12 A;  2L6X A;  3A8Z A;  125L A;  3DMX A;  3CDQ A;  3NY9 A;  1UBZ A;  153L A;  2DBT A;  4B0D A;  1ZMY L;  1JPO A;  2GV0 A;  3HT6 A;  2MEG A;  3S8F B;  1LHJ A;  1LTM A;  3FA0 A;  1F4Z A;  1KW5 A;  3WQJ A;  1JSF A;  2YBH A;  1L61 A;  5APC A;  1AZF A;  5LA8 A;  3K3T A;  1YQV Y;  1IP4 A;  2BQO A;  5I4X A;  4QID A;  3C8Q A;  1P8H A;  3ZEV A;  1PZY A;  2BQC A;  1C6D A;  4U3X B;  1CJ9 A;  1W6Z A;  1QSW A;  1LSC A;  1JSE A;  3QAP A;  1TN0 A;  2BQJ A;  2YCX A;  231L A;  4NGZ A;  1G06 A;  1RE2 A;  1L38 A;  3QJV B;  3AW7 A;  3QBK A;  1GE0 A;  5II3 A;  1B2K A;  6LYT A;  5IHG A;  5M1Y A;  1BRR A;  1TEW A;  4ARP A;  1L54 A;  2DQG Y;  2DQE Y;  1C7P A;  2W1L A;  1HZX A;  2HU3 A;  1PQI A;  3ABW A;  2I25 L;  195L A;  4DDC A;  5KXW A;  4EKR A;  1IP2 A;  1NBY C;  4LDL A;  1X0S A;  1ZVH L;  2Q9D A;  1LYS A;  1CKF A;  1L14 A;  5H2P A;  4FDY A;  1WQO A;  4XTN A;  3WUM A;  1E0P A;  3TMX A;  2DQA A;  2HPY A;  1HER A;  1DYC A;  3QNG A;  1LZ5 A;  4IB4 A;  4UWV A;  2Q0M X;  120L A;  4CHX A;  1CX7 A;  139L A;  2LZM A;  162L A;  1L21 A;  236L A;  1UIA A;  1C46 A;  2MEC A;  3RZE A;  244L A;  3C8R A;  2F32 A;  2WAR A;  1LSN A;  4YEM A;  5FST A;  1HSW A;  4EOF A;  3QDC A;  5FHW A;  2BQN A;  5IEL A;  3DMZ A;  4DAJ A;  1G0J A;  4IAT A;  4LT1 A;  1XEK A;  4KLY A;  1IC4 Y;  4OWE A;  4H9I A;  1CNS A;  1QTC A;  1L88 A;  4PJZ A;  4OWH A;  3C82 A;  1CV1 A;  2CJL A;  1IX0 A;  4OWB A;  4ARQ A;  1RI8 B;  194L A;  1L83 A;  4WOA A;  1JGJ A;  212L A;  5L3H A;  181L A;  1I56 A;  1L43 A;  1S8L A;  1G7L C;  1BB6 A;  154L A;  2ZNX Y;  4GCB A;  2G4P A;  4GBR B;  3SB7 A;  3HAP A;  157L A;  1L86 A;  2ZQ3 A;  1L62 A;  4LT2 A;  4ZIX A;  2DKV A;  3SB9 A;  2HUL A;  1IWT A;  190L A;  5EN0 A;  4WLT A;  3DNA A;  1LHL A;  1LKS A;  2ZIY A;  1LWG A;  1W08 A;  5AHY A;  2W1X A;  1B7O A;  1JJ0 A;  1GFT A;  1HF4 A;  4I7M A;  1CKC A;  2OU9 A;  4CFP A;  5KXR A;  3FE0 A;  5DN4 A;  1EQ5 A;  1S52 A;  3A3Q A;  2HUM A;  2MEF A;  2JAF A;  1OYU A;  1LPI A;  3TXB A;  3A34 A;  5KXY A;  5HQ1 A;  5DHG A;  3PDS A;  4OW1 A;  1C6L A;  237L A;  1JKB A;  2B72 A;  1B7P A;  191L A;  4OO9 A;  1IO5 A;  5KKH A;  1TLA A;  3QE8 A;  4XJB A;  1YAQ A;  5L9J A;  3AZ5 A;  206L A;  1OUI A;  3OE6 A;  1GFV A;  1L56 A;  1IR9 A;  4MQT A;  1FDL Y;  3SN6 R;  1QTE A;  4G49 A;  1HEN A;  1VGO A;  1LKR A;  1P6Y A;  5B34 A;  4LDO A;  1VJM A;  2D4I A;  4W59 A;  247L A;  3NS0 A;  1L76 A;  3BKV A;  4H9F A;  4QEQ A;  1UCO A;  1G0L A;  4Z98 A;  1UA6 Y;  5KXM A;  2G87 A;  3NSB A;  1LYJ A;  3COC A;  5A45 A;  198L A;  150L A;  1JTM A;  1GDW A;  3WU8 A;  2F4G A;  3DN6 A;  4PK0 A;  2FYC A;  4NGV A;  3AJN A;  1NHB A;  255L A;  4WM3 A;  4XJI A;  1DQJ C;  143L A;  187L A;  4WM5 A;  1LMQ A;  4YEN A;  197L A;  1L50 A;  3WXT A;  1J1X Y;  2XTH A;  3C8S A;  2Z12 A;  3AYQ A;  4DQ7 A;  2HED A;  4PRQ A;  4XXJ A;  4GCF A;  5HMV A;  2L78 A;  4LT0 A;  3EMS A;  3EBA B;  4XTL A;  1QTK A;  2G4N A;  2DQJ Y;  1S8J A;  158L A;  4WG1 A;  4GP8 B;  4LYT A;  2MEI A;  5ITC A;  5HMJ A;  3UTX A;  4E97 A;  1BB7 A;  4LGK A;  2XBR A;  123L A;  1P7S A;  1QSQ A;  2QPD B;  4NGW A;  2RBP A;  5KXP A;  1BRD A;  1OUC A;  1OVK A;  4N9R A;  1L11 A;  1LZD A;  1JWR A;  5APD A;  5AZD A;  1L35 A;  1OP9 B;  5A3E A;  1M0L A;  1AM7 A;  1XIO A;  5LWE A;  5FCP A;  1C6N A;  2F93 A;  2LYZ A;  1REY A;  1SWY A;  1JQU A;  1IXF A;  4ARJ A;  1YAN A;  1P3N A;  1D3F A;  1T97 A;  5G53 A;  1P8U A;  108L A;  2MEH A;  2RSC A;  4S0W A;  5LZM A;  2O4W A;  1PQM A;  1LYZ A;  1SQ2 L;  135L A;  1RFP A;  232L A;  4GCC A;  226L A;  2B6Y A;  1LGX A;  4J7V A;  3WPL A;  2D6B A;  1IIZ A;  4YF2 A;  1DZE A;  1GFH A;  5B07 A;  1C6G A;  1QUT A;  1DYD A;  1IOC A;  4NG1 A;  1LSY A;  147L A;  5B6W A;  4WL7 A;  2RB0 X;  4NHI A;  3GUO A;  1D9U A;  4GPO A;  3S8G B;  189L A;  3A91 A;  1LHI A;  129L A;  4HTN A;  3QJR B;  3HUK A;  1KG9 A;  4NSG A;  1CV0 A;  4WMG A;  1L68 A;  2NTH A;  4R6C A;  176L A;  5DM9 A;  5F81 A;  5JEN B;  2CGI A;  4ETA A;  2Q9E A;  3AM6 A;  1LZ4 A;  3A92 A;  4ETB A;  170L A;  4EPI A;  1P8I A;  1L44 A;  1LMP A;  3RZ4 A;  2BQG A;  4NGI A;  2BRD A;  3VWO A;  3QAK A;  1LYI A;  3DN3 A;  5B59 A;  4PPO A;  3EH4 B;  201L A;  2XBS A;  3T36 A;  5KKJ A;  3HBE X;  4WM1 A;  4NHQ A;  2Z38 A;  1YAP A;  1G0K A;  1LYG A;  5AHZ A;  1L74 A;  1L70 A;  3GUN A;  2MEA A;  3ATO A;  4I7J A;  1LZY A;  1NKH A;  1CU2 A;  5B05 A;  2D4K A;  1QHJ A;  1QTV A;  5IDD A;  112L A;  1WVU A;  1REX A;  3LYT A;  4ZEE A;  1KXY A;  3VVK A;  1L47 A;  1C43 A;  3SBA A;  148L E;  5T3F A;  4DT3 A;  4LZT A;  4Z41 A;  4MBS A;  2I26 L;  1DI3 A;  1J1O Y;  1EHK B;  4ANR A;  1LMN A;  185L A;  3WUA A;  1JJ3 A;  1PS5 A;  5H2N A;  4KPM A;  1GFJ A;  1L80 A;  1FLY A;  229L A;  1T6H A;  1XEP A;  3OE0 A;  4YXC A;  4AMI A;  1OV7 A;  1RJC B;  1HFY A;  3E3D A;  5E9R A;  1ALC A;  1B5X A;  3KAM A;  1FN5 A;  3L2X A;  1KME A;  1LJF A;  4DD0 A;  2O7A A;  3UON A;  2Z6B A;  209L A;  2B6X A;  4Z3M A;  2Y8P A;  4DD7 A;  1CU5 A;  1KNI A;  4ARM B;  4KNF A;  1SX2 A;  1UCQ A;  5J7C A;  3G3B B;  4BAF A;  1GB8 A;  2ZZL A;  4AMJ A;  3A93 A;  3AYM A;  1HEO A;  1GFG A;  1TBY A;  145L A;  2RBQ A;  5B6X A;  252L A;  4RLM A;  4UWU A;  258L A;  4MD2 A;  3HUQ A;  4DQJ A;  183L A;  3HH3 A;  2NWD X;  1F10 A;  1V7T A;  3BVD B;  4I0C A;  1D0L A;  1GBS A;  4HV2 A;  1L28 A;  3PBL A;  1LJK A;  1L07 A;  5EBH A;  1B5U A;  2KSY A;  3S3C B;  4HYJ A;  3W3E A;  141L A;  1LZC A;  2YBL A;  3AW6 A;  4HPE A;  1C64 A;  1UAC Y;  254L A;  7LYZ A;  2AT9 A;  1LAA A;  2CUU A;  1LJH A;  3F9L A;  3JR6 A;  1JHL A;  1G7M C;  1PQO A;  5I53 A;  199L A;  4E3U A;  2KS9 A;  3X3B A;  2H5Z A;  4QI1 A;  5FEK A;  4BVN A;  1L18 A;  4I7R A;  1GD6 A;  134L A;  1EPY A;  1GB3 A;  1A4V A;  1L29 A;  1L9H A;  1IP6 A;  1L91 A;  208L A;  4WO6 A;  2HEE A;  3A3R X;  4H92 A;  2QAR C;  4DWX A;  6LZM A;  1P2L A;  3AYN A;  2YBI A;  1C65 A;  4EA3 A;  5DLA A;  152L A;  3AZ4 A;  1IEE A;  1JKD A;  1L96 A;  1NDG C;  4K5Y A;  4YX7 C;  1VDP A;  3LYZ A;  5FJG A;  1C08 C;  4QRY A;  3OJP A;  4DJH A;  4KXI A;  1WQR A;  1F50 A;  2LYM A;  4TUN A;  3PQR A;  1XFP L;  222L A;  4W55 A;  177L A;  3C9L A;  4NGK A;  4X3B A;  4J1A A;  4NGL A;  1LSP A;  4RW2 A;  1L55 A;  1LZR A;  4N1E I;  2YBM A;  1H87 A;  160L A;  5ETZ A;  1B5V A;  3M18 B;  4DDB A;  1VFB C;  4WLD A;  3WU7 A;  4XEN A;  2YDV A;  261L A;  5G2A A;  2HEA A;  1G0G A;  4BUO A;  1C66 A;  1IY4 A;  4W57 A;  1BRX A;  1IOT A;  114L A;  2A4T A;  1YL0 X;  1PQJ A;  1ZWN A;  5F16 A;  5I5Q A;  3WPK A;  5F14 A;  1T6V L;  3HBH A;  4W53 A;  2N5Z A;  4I7Q A;  249L A;  4DKL A;  103L A;  2Z2E A;  5LAG A;  3TMW A;  4RLN A;  1B0D A;  1DKK A;  1L10 A;  2HEB A;  1P37 A;  1L99 A;  155L A;  2OU0 X;  215L A;  2HUK A;  5H2H A;  2MEB A;  1L98 A;  178L A;  1UID A;  5G54 A;  1L60 A;  1L34 A;  1GF0 A;  3HAQ A;  5H2L A;  1L04 A;  1JKA A;  3FAD A;  1QKO A;  4WW3 A;  4JQ6 A;  2Y04 A;  1XEJ A;  1S54 A;  4P2E A;  1G7J C;  1C63 A;  5B6Y A;  3WW5 A;  5LXW A;  4EPF A;  4NHP A;  1GBW A;  4TWS A;  3N9E A;  2HEC A;  1HEQ A;  4OWC A;  1PQK A;  3A67 Y;  5E4P A;  4BS7 A;  4FA7 B;  2BQD A;  1L0M A;  5G2D A;  1L79 A;  4GRV A;  2F4A A;  3F8V A;  1G7I C;  1XEI A;  1IOS A;  1B9O A;  3RNX A;  1L39 A;  1F88 A;  3QJQ B;  5DHH A;  130L A;  3SP3 A;  2BPU A;  1GEV A;  8LYZ A;  5LVI A;  1LMA A;  1GBO A;  4HJY A;  1CKG A;  1C6B A;  3QBL A;  3HWL A;  228L A;  4QY9 A;  4N4Y B;  3HH4 A;  1TCY A;  1D6Q A;  3P65 A;  2BQE A;  1L32 A;  1L67 A;  4KT3 A;  1B7M A;  3CDT A;  239L A;  1CKH A;  4ETD A;  111L A;  1CU3 A;  4PXK A;  4H8Z A;  1C6P A;  1WQP A;  137L A;  4DDA A;  1LSB A;  1LZT A;  4IAR A;  3HDF A;  122L A;  4IAQ A;  1L52 A;  1L17 A;  4N1C C;  2LHM A;  2BLY A;  1LLH A;  1L42 A;  2Y02 A;  1XJT A;  1C8S A;  1IW9 A;  1C6E A;  4QGZ A;  3DDL A;  3OAX A;  4G71 B;  1I1Z A;  1QT8 A;  2WJL A;  1QM8 A;  4I7T A;  1GWD A;  1B7N A;  1C6I A;  3RU5 A;  2OEA X;  4TSB A;  1YKX X;  1D6P A;  3D3D A;  1KG8 A;  1IR7 A;  1QUD A;  3WYH A;  220L A;  1OUF A;  1HHL A;  205L A;  1KXW A;  1VAT A;  3J6K A;  1B7L A;  1OUD A;  4ARQ B;  1L13 A;  1LJE A;  5D5F A;  3CDR A;  2BQB A;  1XGQ C;  1LGW A;  1UAZ A;  1C68 A;  2M3G A;  3QJU B;  216L A;  1OUE A;  5LA5 A;  5HNL A;  2F95 A;  4G4B A;  1U19 A;  4TL3 A;  4W94 A;  1LYD A;  5DYS A;  1GXX A;  4GP4 B;  5AMY A;  1SWZ A;  1DYE A;  224L A;  5B1G A;  1PXR A;  5A44 A;  3GUI A;  1UIC A;  4NGO A;  168L A;  3C7Z A;  4QDN A;  238L A;  2FBD A;  1P2R A;  5LVG A;  1IY3 A;  5H2I A;  4I7K A;  3RW8 A;  186L A;  3WUL A;  1NBZ C;  3GUJ A;  3TXE A;  2EIZ C;  1J1P Y;  4H9C A;  1R84 A;  4HV1 A;  3T45 A;  4NGY A;  1G1W A;  4G4C A;  4I7L A;  1L40 A;  4EXM A;  4M6D A;  1L16 A;  1G07 A;  4CFO A;  1L24 A;  240L A;  3D4S A;  1G0P A;  4LYZ A;  2Z2F A;  1KY1 A;  2F30 A;  5AX1 A;  2RBS A;  5DN5 A;  2NTU A;  3DKE X;  2ANV A;  1NDM C;  1FBK A;  243L A;  3AZ6 A;  4BAD A;  4LYB A;  4UG2 A;  1CU0 A;  1KIR C;  1IVM A;  1C6M A;  1WTM A;  4H8X A;  2BQK A;  1OUA A;  5B6V A;  3CAP A;  1LMC A;  1GE2 A;  1L0K A;  5TGZ A;  1C69 A;  1GBY A;  188L A;  1GFK A;  1IW6 A;  1LSM A;  2NTW A;  3S3B B;  1T8A A;  233L A;  2A7F A;  4N0J A;  1YRO A;  4HTQ A;  5LVJ A;  5LYM A;  159L A;  1IWX A;  2OE4 X;  4MD1 A;  3AGG G;  3G3A B;  4LFX A;  3HTF A;  4B4I A;  5G2C A;  4HPI A;  1HFX A;  4NSH A;  3K2R A;  2YVB A;  2IHL A;  4A7D A;  5KXT A;  1P64 A;  1B7Q A;  1HEL A;  2EQL A;  1CX6 A;  3TXI A;  184L A;  1DI5 A;  1C45 A;  1IOQ A;  4W96 A;  2BQL A;  3B72 A;  4B1A A;  1DPX A;  1L53 A;  5G28 A;  4C5F A;  3FI5 A;  4W58 A;  4GLV A;  4FAA B;  2ZIJ A;  1WQN A;  1CU6 A;  1LZS A;  3J4G A;  3ZVQ A;  1IR8 A;  2LZ2 A;  3DN4 A;  2FYD A;  5LIN A;  1YAM A;  4EKQ A;  151L A;  3UTY A;  4B49 A;  4JKV A;  3HBD A;  4XT3 A;  1LJ4 A;  218L A;  245L A;  132L A;  1LSG A;  1L95 A;  4WO9 A;  2HTX A;  1C60 A;  2CDS A;  4N4W A;  3A95 A;  167L A;  5HNC A;  1OWZ A;  1L81 A;  1LMT A;  4NG8 A;  2Z73 A;  213L A;  5KXK A;  2Z19 A;  4XTO A;  4W54 A;  1CTW A;  1B5Y A;  4NC3 A;  1NMM A;  4I7P A;  1GB2 A;  2MED A;  3GUL A;  4UHR A;  1LHH A;  3KJ6 A;  2ZFE A;  5I4Y A;  3L64 A;  1QT6 A;  3IJV A;  1GB9 A;  1REZ A;  3HT9 A;  5HLL A;  1SX7 A;  3TXG A;  5DL9 A;  3CSQ A;  2B74 A;  5JJE A;  5B06 A;  5A3Z A;  3EH3 B;  4ZFP A;  1L20 A;  2B5Z A;  5G36 A;  4G7Q B;  3CT1 A;  131L A;  1CV3 A;  1JTN A;  102L A;  5ILF A;  4XT1 A;  3VHZ A;  1D0K A;  3N9C A;  1FLQ A;  2DQH Y;  1VAU A;  1T3P A;  1D9W A;  1IP3 A;  1OVH A;  5H2O A;  3C9M A;  1L01 A;  4XAD A;  5KXN A;  1OQM A;  3W6E A;  1D3J A;  4WM4 A;  5BR2 A;  1QIO A;  1QT7 A;  1L08 A;  4ETC A;  1JIT A;  4W56 A;  4NSJ A;  1KW7 A;  4LDE A;  3MBV A;  1DXJ A;  1B7R A;  4H94 A;  3UTW A;  3AGH A;  4H9H A;  4JR8 A;  1GB6 A;  4H9A A;  9LYZ A;  1HEP A;  3WVY A;  1QDR A;  2VT4 A;  4DD1 A;  1P2C C;  2ZNW Y;  1IWU A;  1GF7 A;  175L A;  1QT3 A;  5B0W A;  1IOR A;  3HU8 A;  4MCK A;  180L A;  207L A;  3N9A A;  259L A;  3SB6 A;  1FBI X;  4H91 A;  5L3I A;  5H2J A;  3QJT B;  3CT0 A;  1LYY A;  3DN1 A;  5LVH A;  3TXJ A;  4EMN A;  4DYG A;  1E12 A;  1HEM A;  1C10 A;  223L A;  1WQQ A;  2LC9 A;  2ZIK A;  1F6S A;  1M0K A;  1GFR A;  4LYM A;  1LJ3 A;  4X32 A;  1C6Q A;  1GUE A;  3LZT A;  4NWH A;  1CUP A;  1DZB X;  4WLY A;  1BHZ A;  214L A;  1OUG A;  2D91 A;  1YAO A;  3V2Y A;  4DD2 A;  1GAY A;  126L A;  1DPW A;  1OUJ A;  2XJW A;  2B7X A;  1L09 A;  3B6L A;  4J0L A;  2B70 A;  1JTO L;  3EML A;  3MGW A;  1XGT C;  1KGB A;  3EH5 B;  1KS3 A;  1QSB A;  1GAZ A;  2Z37 A;  260L A;  1Q5J A;  3TMV A;  2B75 A;  2I35 A;  1XGU C;  1JV7 A;  3HTG A;  4NEB A;  2OE7 X;  113L A;  4XJH A;  1YKZ X;  4OOT A;  5APF A;  2RBO A;  1JFP A;  219L A;  3UG9 A;  4AXT A;  4AQN A;  5KXL A;  221L A;  1P5C A;  1BWJ A;  1HNL A;  3OE9 A;  1XJI A;  4YEO A;  1E8L A;  3WW6 A;  2RBN A;  3ULR A;  138L A;  2Z39 A;  230L A;  3QBI A;  1BGI A;  4X1H A;  5C6J A;  3HFM Y;  1T8F A;  4H8Y A;  4GN5 C;  2W1M A;  4BEZ A;  1L31 A;  3C7Y A;  2G4Q A;  5F9X A;  1LHK A;  1LZ8 A;  1A2Y C;  1TAY A;  1G7H C;  4DC4 A;  3RT5 X;  1LYO A;  1D2W A;  1M0M A;  211L A;  1L89 A;  3UZA A;  3T6U A;  1WQM A;  1L92 A;  1IC7 Y;  1GE1 A;  5C1M A;  1L63 A;  1L45 A;  1JTP L;  2RB1 X;  3RFM A;  3UZC A;  3TXH A;  2EPE A;  1KY0 A;  2RB2 X;  2XQO A;  2YCY A;  1VDS A;  1UIE A;  3DN0 A;  1L58 A;  2F2Q A;  1C6F A;  1HSX A;  3B0K A;  3G3W A;  2NTG A;  1QQY A;  1SSY A;  3VG9 A;  1EL1 A;  5LAF A;  5B6Z A;  1L15 A;  166L A;  1KIQ C;  3WU9 A;  5APE A;  1IP5 A;  140L A;  1XGR C;  1B6I A;  127L A;  1LYE A;  3GUP A;  5F8U A;  4GLA A;  1GBX A;  4WAV A;  4BAP A;  2I21 A;  4CJ2 A;  1FKQ A;  4IJ4 A;  4NSI A;  1QS9 A;  3A90 A;  1L72 A;  4ET8 A;  1EQE A;  2LCB A;  2Z18 A;  4GN3 A;  4ML7 A;  4NGJ A;  4DD3 A;  4MST A;  1IP7 A;  1IC5 Y;  2B6W A;  1L75 A;  1SLY A;  1XGP C;  3DQB A;  2H9K A;  3ZEK A;  4ARL A;  1YKY X;  1BWI A;  1L23 A;  2C8P A;  3HAR A;  1L87 A;  4FJR A;  2IFF Y;  192L A;  1L41 A;  4NFV A;  1VDT A;  3PXO A;  4C3W A;  1BB4 A;  1JIS A;  1VDQ A;  1G0Q A;  4H9B A;  4NHS A;  1FKV A;  1L57 A;  3CSR A;  4EIY A;  5KXX A;  3A6B Y;  1L26 A;  4RDS A;  4BEY A;  1BVX A;  225L A;  4LYO A;  3HH6 A;  3VW7 A;  1B7S A;  3LYM A;  3LZ2 A;  1GF3 A;  144L A;  4B4J A;  3WXU A;  2R4S A;  1LN6 A;  5K7O A;  4ET9 A;  1T8G A;  1D3M A;  4R0F A;  4II8 A;  1NQI A;  4H9E A;  1NF5 A;  2ZWB A;  1QDT A;  4TTD A;  109L A;  1D3N A;  1O23 A;  4OWA A;  1L82 A;  1NWG A;  1QSA A;  169L A;  1GB0 A;  5ITE A;  4LYC A;  2WJK A;  2YDG A;  2HUB A;  1IWW A;  4GBR A;  4G7S B;  1L77 A;  1DYB A;  2LNL A;  174L A;  1GB7 A;  1L37 A;  3A7K A;  1AT5 A;  5KY1 A;  2J4Y A;  2BQA A;  1LJG A;  4DS7 E;  4HYX A;  1UIB A;  1ZVY B;  2Y03 A;  250L A;  4I7O A;  2PC2 A;  2B6Z A;  4B4E A;  1QT5 A;  1BB5 A;  4DD9 A;  1GE3 A;  3CSZ A;  3LYO A;  1L49 A;  1N4F A;  4N6H A;  1Q5I A;  4L35 A;  1NHE A;  2B6T A;  3OK0 A;  1Z55 A;  1ZUR A;  3EO5 A;  1GF5 A;  2D4J A;  2HU1 A;  3TXD A;  119L A;  1LOZ A;  2OU8 A;  1L0J A;  3V2W A;  3WL2 A;  2VB1 A;  4N5R A;  1BVK C;  241L A;  1AP9 A;  5I54 A;  1HMK A;  1L64 A;  3A94 A;  1LMO A;  1QUH A;  3D9A C;  5I14 A;  2CWI A;  1GB5 A;  1L69 A;  2F47 A;  1V7S A;  2RAY X;  1ZYT A;  1OWY A;  4YXA C;  1HML A;  1LI6 A;  4PHI A;  1CJ8 A;  1C3W A;  1CV6 A;  4DQ5 A;  3ZPQ A;  1L71 A;  3AGI A;  3SB8 A;  5F9U A;  1C6C A;  1FLU A;  1JUG A;  2B73 A;  1BWH A;  3G3V A;  2PED A;  1C6H A;  2RAZ X;  2Y01 A;  1LW9 A;  4HSF A;  3W6A A;  2EKS C;  4YOP A;  5KJ9 A;  4GP5 B;  1QUS A;  1G0M A;  1QUG A;  4HJZ A;  2H9J A;  2X72 A;  4HJV A;  2DQF C;  1B5W A;  2BQI A;  5D5C A;  1GFA A;  3W6F A;  1LZE A;  3B0I A;  1GFU A;  2KSB A;  1CV4 A;  156L A;  1LPY A;  1WTH A;  4H1P A;  3ODU A;  1KIP C;  4WG7 A;  2OTZ X;  4PGJ B;  3HT8 A;  1LSA A;  1L90 A;  1FBB A;  149L A;  1IWZ A;  1RCM A;  5H2M A;  4Z46 A;  3WUN A;  3C7W A;  4L6R A;  5A8E A;  4HTK A;  1QT4 A;  3NYA A;  235L A;  4J1B A;  4FPD A;  3AZ7 A;  1CKD A;  3TMU A;  1GBZ A;  1LZA A;  5J7A A;  3X3C A;  4EJ4 A;  253L A;  3GXK A;  4XJG A;  3HAN A;  3BKH A;  3P66 A;  1X0K 1;  1CJ7 A;  3HH5 A;  1UUZ C;  4PJ2 C; 
#chains in the Genus database with same CATH homology
 1K28 A;  5KXZ A;  1IP1 A;  2OE9 X;  1LZ1 A;  2BQF A;  1ZV5 L;  2AUB A;  5KXO A;  4G9S A;  1L94 A;  4OV0 A;  3ATN A;  3CT5 A;  5LYT A;  4XJF A;  1GEZ A;  1FLW A;  5H2K A;  242L A;  3SBB C;  3C83 A;  248L A;  3EXD A;  2HEF A;  3HU9 A;  1BM1 A;  2I20 A;  4N8Z A;  3LHM A;  1X0I 1;  1DKJ A;  1LHM A;  3WH1 A;  1L30 A;  4BWB A;  3GUM A;  2R4R A;  6LYZ A;  1JTT L;  1GU8 A;  2ZYC A;  4GCD A;  1C6K A;  1LZ6 A;  3G3X A;  1QS5 A;  4TX7 A;  7LZM A;  1S51 A;  173L A;  1C6T A;  1LGU A;  262L A;  2YCZ A;  5C6I A;  4XYY A;  2RH1 A;  1LZ9 A;  1LZB A;  1LZN A;  4BV0 A;  2YCW A;  1L06 A;  1GDX A;  118L A;  182L A;  4I7S A;  3PWH A;  4RW1 A;  3P4Z A;  2F2N A;  5LVK A;  1L93 A;  165L A;  172L A;  3A96 A;  4G7R B;  3FI7 A;  4KL7 A;  5JJN A;  5KXS A;  3HAO A;  1MEL L;  4O34 A;  1L36 A;  1L33 A;  1JJ1 A;  4WL6 A;  1L05 A;  3LN2 A;  2ZIL A;  1VED A;  4I7N A;  1LWK A;  3HT7 A;  5C6L A;  3REY A;  133L A;  1L73 A;  4A4M A;  4LZM A;  5AWZ A;  1CWQ A;  1L03 A;  210L A;  1LJJ A;  1MLC E;  2QPE B;  4NY5 A;  1C62 A;  1CUQ A;  1SSW A;  1L19 A;  5AX0 A;  3W6B A;  3P0G A;  1OUB A;  1DYF A;  171L A;  1LI2 A;  1DYA A;  1H6M A;  2RBR A;  5KKI A;  1JIY A;  4NHT A;  1L84 A;  1GXV 2;  3CDV A;  4HP0 A;  4WM6 A;  1TDY A;  1REM A;  4LT3 A;  217L A;  3P64 A;  3HTD A;  246L A;  1PXS A;  5FDJ A;  1L46 A;  4PXF A;  3QY4 A;  1XME B;  3RUN A;  128L A;  1QTZ A;  1UIG A;  1C61 A;  2JAG A;  2BLX A;  2I6Z A;  2FBB A;  2MEE A;  3OE8 A;  1XSF A;  2KSA A;  4GN4 A;  234L A;  2W1Y A;  1L51 A;  1QTB A;  2EI4 A;  4G72 B;  4NWE A;  257L A;  1B5Z A;  3ZVQ B;  1BB3 A;  1P36 A;  193L A;  1L22 A;  3HTB A;  1UIF A;  1L25 A;  3IWR A;  3VGA A;  5B35 A;  1L65 A;  1TN5 A;  4Y9H A;  3GUK A;  1YL1 X;  3NY8 A;  1KXX A;  5I4W A;  3DN2 A;  4GYC A;  1AKI A;  1LYH A;  164L A;  3C81 A;  1HFZ A;  3HAS A;  3P68 A;  4ETE A;  1LI3 A;  1LYF A;  4G4H A;  2YBJ A;  3A6C Y;  5FEL A;  2DQD Y;  1GF4 A;  2DQI Y;  3AB6 A;  4XN6 A;  4ARM A;  4IAS A;  4W51 A;  4H90 A;  1BQL Y;  4HWL A;  3CQL A;  2A7D A;  1F6R A;  1UC0 A;  2BAA A;  2Y00 A;  1G1V A;  1AT6 A;  110L A;  1C6J A;  3CDO A;  227L A;  4H93 A;  3W6D A;  1MGY A;  4WM2 A;  1LSZ A;  2QB0 B;  5LYZ A;  4MQS A;  4WLX A;  1L48 A;  1LSF A;  1UIH A;  2Z55 A;  3WMK A;  4I8S A;  1INU A;  161L A;  1EQ4 A;  1I20 A;  1GE4 A;  4OOO A;  5B1F A;  1QTD A;  2O79 A;  1LSE A;  5BR5 A;  1OVJ A;  2LYO A;  1LJN A;  1C67 A;  1I6S A;  1CJ6 A;  1CV5 A;  1PY6 A;  1XJU A;  2YSS C;  4XJD A;  1C6A A;  1JEF A;  3SB5 A;  1C8R A;  2I1X A;  3DMV A;  3HDE A;  1GZM A;  1H2S A;  3WVX A;  4D9Z A;  4EKS A;  196L A;  1LZG A;  1L27 A;  3VI0 A;  4FBZ A;  1JV6 A;  4CGE A;  251L A;  4IAP A;  2IGC A;  1QKP A;  3CB7 A;  1GF8 A;  3C80 A;  1HEW A;  1YIL A;  1L97 A;  2BQM A;  1QTH A;  2ANX A;  4UWN A;  4W52 A;  4AGA A;  1D0M A;  3M3U A;  4YM8 A;  4L41 A;  1WVV A;  4EKP A;  3S3D B;  1S53 A;  1DYG A;  3IJU A;  3QBG A;  4NIJ A;  1DI4 A;  3F6Z A;  3WPJ A;  1LJI A;  3QJS B;  3GXR A;  3DN8 A;  3W6C A;  2X0A A;  3UTV A;  4MR1 A;  1IWV A;  1R2N A;  1D2Y A;  1L59 A;  115L A;  5ILC A;  5LIO A;  4TSC A;  1CVK A;  256L A;  1LCN A;  4GCE A;  104L A;  146L A;  1L66 A;  1GF6 A;  1PQD A;  2OTY X;  3COD A;  5JJJ A;  5B2N A;  1IWY A;  107L A;  1OV5 A;  1QUO A;  1AT9 A;  4M4O A;  2LZT A;  142L A;  1WTN A;  200L A;  2YDO A;  1LSD A;  4PRU A;  4G70 B;  1O0A A;  1L00 A;  3HUA A;  3B0O A;  2BQH A;  1JKC A;  1P46 A;  1L85 A;  1L02 A;  4ZPU A;  2DQC Y;  1GHL A;  4LFP A;  1GPQ C;  3TXK A;  4J4Q A;  3ZPR A;  1GFE A;  4X31 A;  1YIK A;  2YBN A;  1HC0 A;  2ZYP A;  1H68 A;  1GF9 A;  1F0W A;  3LZM A;  3TXF A;  1OUH A;  1P56 A;  163L A;  2ZQ4 A;  2C8O A;  1L12 A;  2L6X A;  3A8Z A;  125L A;  3DMX A;  3CDQ A;  3NY9 A;  1UBZ A;  153L A;  2DBT A;  4B0D A;  1ZMY L;  1JPO A;  2GV0 A;  3HT6 A;  2MEG A;  3S8F B;  1LHJ A;  1LTM A;  3FA0 A;  1F4Z A;  1KW5 A;  3WQJ A;  1JSF A;  2YBH A;  1L61 A;  5APC A;  1AZF A;  5LA8 A;  3K3T A;  1YQV Y;  1IP4 A;  2BQO A;  5I4X A;  4QID A;  3C8Q A;  1P8H A;  3ZEV A;  1PZY A;  2BQC A;  1C6D A;  4U3X B;  1CJ9 A;  1W6Z A;  1QSW A;  1LSC A;  1JSE A;  3QAP A;  1TN0 A;  2BQJ A;  2YCX A;  231L A;  4NGZ A;  1G06 A;  1RE2 A;  1L38 A;  3QJV B;  3AW7 A;  3QBK A;  1GE0 A;  5II3 A;  1B2K A;  6LYT A;  5IHG A;  5M1Y A;  1BRR A;  1TEW A;  4ARP A;  1L54 A;  2DQG Y;  2DQE Y;  1C7P A;  2W1L A;  1HZX A;  2HU3 A;  1PQI A;  3ABW A;  2I25 L;  195L A;  4DDC A;  5KXW A;  4EKR A;  1IP2 A;  1NBY C;  4LDL A;  1X0S A;  1ZVH L;  2Q9D A;  1LYS A;  1CKF A;  1L14 A;  5H2P A;  4FDY A;  1WQO A;  4XTN A;  3WUM A;  1E0P A;  3TMX A;  2DQA A;  2HPY A;  1HER A;  1DYC A;  3QNG A;  1LZ5 A;  4IB4 A;  4UWV A;  2Q0M X;  120L A;  4CHX A;  1CX7 A;  139L A;  2LZM A;  162L A;  1L21 A;  236L A;  1UIA A;  1C46 A;  2MEC A;  3RZE A;  244L A;  3C8R A;  2F32 A;  2WAR A;  1LSN A;  4YEM A;  5FST A;  1HSW A;  4EOF A;  3QDC A;  5FHW A;  2BQN A;  5IEL A;  3DMZ A;  4DAJ A;  1G0J A;  4IAT A;  4LT1 A;  1XEK A;  4KLY A;  1IC4 Y;  4OWE A;  4H9I A;  1CNS A;  1QTC A;  1L88 A;  4PJZ A;  4OWH A;  3C82 A;  1CV1 A;  2CJL A;  1IX0 A;  4OWB A;  4ARQ A;  1RI8 B;  194L A;  1L83 A;  4WOA A;  1JGJ A;  212L A;  5L3H A;  181L A;  1I56 A;  1L43 A;  1S8L A;  1G7L C;  1BB6 A;  154L A;  2ZNX Y;  4GCB A;  2G4P A;  4GBR B;  3SB7 A;  3HAP A;  157L A;  1L86 A;  2ZQ3 A;  1L62 A;  4LT2 A;  4ZIX A;  2DKV A;  3SB9 A;  2HUL A;  1IWT A;  190L A;  5EN0 A;  4WLT A;  3DNA A;  1LHL A;  1LKS A;  2ZIY A;  1LWG A;  1W08 A;  5AHY A;  2W1X A;  1B7O A;  1JJ0 A;  1GFT A;  1HF4 A;  4I7M A;  1CKC A;  2OU9 A;  4CFP A;  5KXR A;  3FE0 A;  5DN4 A;  1EQ5 A;  1S52 A;  3A3Q A;  2HUM A;  2MEF A;  2JAF A;  1OYU A;  1LPI A;  3TXB A;  3A34 A;  5KXY A;  5HQ1 A;  5DHG A;  3PDS A;  4OW1 A;  1C6L A;  237L A;  1JKB A;  2B72 A;  1B7P A;  191L A;  4OO9 A;  1IO5 A;  5KKH A;  1TLA A;  3QE8 A;  4XJB A;  1YAQ A;  5L9J A;  3AZ5 A;  206L A;  1OUI A;  3OE6 A;  1GFV A;  1L56 A;  1IR9 A;  4MQT A;  1FDL Y;  3SN6 R;  1QTE A;  4G49 A;  1HEN A;  1VGO A;  1LKR A;  1P6Y A;  5B34 A;  4LDO A;  1VJM A;  2D4I A;  4W59 A;  247L A;  3NS0 A;  1L76 A;  3BKV A;  4H9F A;  4QEQ A;  1UCO A;  1G0L A;  4Z98 A;  1UA6 Y;  5KXM A;  2G87 A;  3NSB A;  1LYJ A;  3COC A;  5A45 A;  198L A;  150L A;  1JTM A;  1GDW A;  3WU8 A;  2F4G A;  3DN6 A;  4PK0 A;  2FYC A;  4NGV A;  3AJN A;  1NHB A;  255L A;  4WM3 A;  4XJI A;  1DQJ C;  143L A;  187L A;  4WM5 A;  1LMQ A;  4YEN A;  197L A;  1L50 A;  3WXT A;  1J1X Y;  2XTH A;  3C8S A;  2Z12 A;  3AYQ A;  4DQ7 A;  2HED A;  4PRQ A;  4XXJ A;  4GCF A;  5HMV A;  2L78 A;  4LT0 A;  3EMS A;  3EBA B;  4XTL A;  1QTK A;  2G4N A;  2DQJ Y;  1S8J A;  158L A;  4WG1 A;  4GP8 B;  4LYT A;  2MEI A;  5ITC A;  5HMJ A;  3UTX A;  4E97 A;  1BB7 A;  4LGK A;  2XBR A;  123L A;  1P7S A;  1QSQ A;  2QPD B;  4NGW A;  2RBP A;  5KXP A;  1BRD A;  1OUC A;  1OVK A;  4N9R A;  1L11 A;  1LZD A;  1JWR A;  5APD A;  5AZD A;  1L35 A;  1OP9 B;  5A3E A;  1M0L A;  1AM7 A;  1XIO A;  5LWE A;  5FCP A;  1C6N A;  2F93 A;  2LYZ A;  1REY A;  1SWY A;  1JQU A;  1IXF A;  4ARJ A;  1YAN A;  1P3N A;  1D3F A;  1T97 A;  5G53 A;  1P8U A;  108L A;  2MEH A;  2RSC A;  4S0W A;  5LZM A;  2O4W A;  1PQM A;  1LYZ A;  1SQ2 L;  135L A;  1RFP A;  232L A;  4GCC A;  226L A;  2B6Y A;  1LGX A;  4J7V A;  3WPL A;  2D6B A;  1IIZ A;  4YF2 A;  1DZE A;  1GFH A;  5B07 A;  1C6G A;  1QUT A;  1DYD A;  1IOC A;  4NG1 A;  1LSY A;  147L A;  5B6W A;  4WL7 A;  2RB0 X;  4NHI A;  3GUO A;  1D9U A;  4GPO A;  3S8G B;  189L A;  3A91 A;  1LHI A;  129L A;  4HTN A;  3QJR B;  3HUK A;  1KG9 A;  4NSG A;  1CV0 A;  4WMG A;  1L68 A;  2NTH A;  4R6C A;  176L A;  5DM9 A;  5F81 A;  5JEN B;  2CGI A;  4ETA A;  2Q9E A;  3AM6 A;  1LZ4 A;  3A92 A;  4ETB A;  170L A;  4EPI A;  1P8I A;  1L44 A;  1LMP A;  3RZ4 A;  2BQG A;  4NGI A;  2BRD A;  3VWO A;  3QAK A;  1LYI A;  3DN3 A;  5B59 A;  4PPO A;  3EH4 B;  201L A;  2XBS A;  3T36 A;  5KKJ A;  3HBE X;  4WM1 A;  4NHQ A;  2Z38 A;  1YAP A;  1G0K A;  1LYG A;  5AHZ A;  1L74 A;  1L70 A;  3GUN A;  2MEA A;  3ATO A;  4I7J A;  1LZY A;  1NKH A;  1CU2 A;  5B05 A;  2D4K A;  1QHJ A;  1QTV A;  5IDD A;  112L A;  1WVU A;  1REX A;  3LYT A;  4ZEE A;  1KXY A;  3VVK A;  1L47 A;  1C43 A;  3SBA A;  148L E;  5T3F A;  4DT3 A;  4LZT A;  4Z41 A;  4MBS A;  2I26 L;  1DI3 A;  1J1O Y;  1EHK B;  4ANR A;  1LMN A;  185L A;  3WUA A;  1JJ3 A;  1PS5 A;  5H2N A;  4KPM A;  1GFJ A;  1L80 A;  1FLY A;  229L A;  1T6H A;  1XEP A;  3OE0 A;  4YXC A;  4AMI A;  1OV7 A;  1RJC B;  1HFY A;  3E3D A;  5E9R A;  1ALC A;  1B5X A;  3KAM A;  1FN5 A;  3L2X A;  1KME A;  1LJF A;  4DD0 A;  2O7A A;  3UON A;  2Z6B A;  209L A;  2B6X A;  4Z3M A;  2Y8P A;  4DD7 A;  1CU5 A;  1KNI A;  4ARM B;  4KNF A;  1SX2 A;  1UCQ A;  5J7C A;  3G3B B;  4BAF A;  1GB8 A;  2ZZL A;  4AMJ A;  3A93 A;  3AYM A;  1HEO A;  1GFG A;  1TBY A;  145L A;  2RBQ A;  5B6X A;  252L A;  4RLM A;  4UWU A;  258L A;  4MD2 A;  3HUQ A;  4DQJ A;  183L A;  3HH3 A;  2NWD X;  1F10 A;  1V7T A;  3BVD B;  4I0C A;  1D0L A;  1GBS A;  4HV2 A;  1L28 A;  3PBL A;  1LJK A;  1L07 A;  5EBH A;  1B5U A;  2KSY A;  3S3C B;  4HYJ A;  3W3E A;  141L A;  1LZC A;  2YBL A;  3AW6 A;  4HPE A;  1C64 A;  1UAC Y;  254L A;  7LYZ A;  2AT9 A;  1LAA A;  2CUU A;  1LJH A;  3F9L A;  3JR6 A;  1JHL A;  1G7M C;  1PQO A;  5I53 A;  199L A;  4E3U A;  2KS9 A;  3X3B A;  2H5Z A;  4QI1 A;  5FEK A;  4BVN A;  1L18 A;  4I7R A;  1GD6 A;  134L A;  1EPY A;  1GB3 A;  1A4V A;  1L29 A;  1L9H A;  1IP6 A;  1L91 A;  208L A;  4WO6 A;  2HEE A;  3A3R X;  4H92 A;  2QAR C;  4DWX A;  6LZM A;  1P2L A;  3AYN A;  2YBI A;  1C65 A;  4EA3 A;  5DLA A;  152L A;  3AZ4 A;  1IEE A;  1JKD A;  1L96 A;  1NDG C;  4K5Y A;  4YX7 C;  1VDP A;  3LYZ A;  5FJG A;  1C08 C;  4QRY A;  3OJP A;  4DJH A;  4KXI A;  1WQR A;  1F50 A;  2LYM A;  4TUN A;  3PQR A;  1XFP L;  222L A;  4W55 A;  177L A;  3C9L A;  4NGK A;  4X3B A;  4J1A A;  4NGL A;  1LSP A;  4RW2 A;  1L55 A;  1LZR A;  4N1E I;  2YBM A;  1H87 A;  160L A;  5ETZ A;  1B5V A;  3M18 B;  4DDB A;  1VFB C;  4WLD A;  3WU7 A;  4XEN A;  2YDV A;  261L A;  5G2A A;  2HEA A;  1G0G A;  4BUO A;  1C66 A;  1IY4 A;  4W57 A;  1BRX A;  1IOT A;  114L A;  2A4T A;  1YL0 X;  1PQJ A;  1ZWN A;  5F16 A;  5I5Q A;  3WPK A;  5F14 A;  1T6V L;  3HBH A;  4W53 A;  2N5Z A;  4I7Q A;  249L A;  4DKL A;  103L A;  2Z2E A;  5LAG A;  3TMW A;  4RLN A;  1B0D A;  1DKK A;  1L10 A;  2HEB A;  1P37 A;  1L99 A;  155L A;  2OU0 X;  215L A;  2HUK A;  5H2H A;  2MEB A;  1L98 A;  178L A;  1UID A;  5G54 A;  1L60 A;  1L34 A;  1GF0 A;  3HAQ A;  5H2L A;  1L04 A;  1JKA A;  3FAD A;  1QKO A;  4WW3 A;  4JQ6 A;  2Y04 A;  1XEJ A;  1S54 A;  4P2E A;  1G7J C;  1C63 A;  5B6Y A;  3WW5 A;  5LXW A;  4EPF A;  4NHP A;  1GBW A;  4TWS A;  3N9E A;  2HEC A;  1HEQ A;  4OWC A;  1PQK A;  3A67 Y;  5E4P A;  4BS7 A;  4FA7 B;  2BQD A;  1L0M A;  5G2D A;  1L79 A;  4GRV A;  2F4A A;  3F8V A;  1G7I C;  1XEI A;  1IOS A;  1B9O A;  3RNX A;  1L39 A;  1F88 A;  3QJQ B;  5DHH A;  130L A;  3SP3 A;  2BPU A;  1GEV A;  8LYZ A;  5LVI A;  1LMA A;  1GBO A;  4HJY A;  1CKG A;  1C6B A;  3QBL A;  3HWL A;  228L A;  4QY9 A;  4N4Y B;  3HH4 A;  1TCY A;  1D6Q A;  3P65 A;  2BQE A;  1L32 A;  1L67 A;  4KT3 A;  1B7M A;  3CDT A;  239L A;  1CKH A;  4ETD A;  111L A;  1CU3 A;  4PXK A;  4H8Z A;  1C6P A;  1WQP A;  137L A;  4DDA A;  1LSB A;  1LZT A;  4IAR A;  3HDF A;  122L A;  4IAQ A;  1L52 A;  1L17 A;  4N1C C;  2LHM A;  2BLY A;  1LLH A;  1L42 A;  2Y02 A;  1XJT A;  1C8S A;  1IW9 A;  1C6E A;  4QGZ A;  3DDL A;  3OAX A;  4G71 B;  1I1Z A;  1QT8 A;  2WJL A;  1QM8 A;  4I7T A;  1GWD A;  1B7N A;  1C6I A;  3RU5 A;  2OEA X;  4TSB A;  1YKX X;  1D6P A;  3D3D A;  1KG8 A;  1IR7 A;  1QUD A;  3WYH A;  220L A;  1OUF A;  1HHL A;  205L A;  1KXW A;  1VAT A;  3J6K A;  1B7L A;  1OUD A;  4ARQ B;  1L13 A;  1LJE A;  5D5F A;  3CDR A;  2BQB A;  1XGQ C;  1LGW A;  1UAZ A;  1C68 A;  2M3G A;  3QJU B;  216L A;  1OUE A;  5LA5 A;  5HNL A;  2F95 A;  4G4B A;  1U19 A;  4TL3 A;  4W94 A;  1LYD A;  5DYS A;  1GXX A;  4GP4 B;  5AMY A;  1SWZ A;  1DYE A;  224L A;  5B1G A;  1PXR A;  5A44 A;  3GUI A;  1UIC A;  4NGO A;  168L A;  3C7Z A;  4QDN A;  238L A;  2FBD A;  1P2R A;  5LVG A;  1IY3 A;  5H2I A;  4I7K A;  3RW8 A;  186L A;  3WUL A;  1NBZ C;  3GUJ A;  3TXE A;  2EIZ C;  1J1P Y;  4H9C A;  1R84 A;  4HV1 A;  3T45 A;  4NGY A;  1G1W A;  4G4C A;  4I7L A;  1L40 A;  4EXM A;  4M6D A;  1L16 A;  1G07 A;  4CFO A;  1L24 A;  240L A;  3D4S A;  1G0P A;  4LYZ A;  2Z2F A;  1KY1 A;  2F30 A;  5AX1 A;  2RBS A;  5DN5 A;  2NTU A;  3DKE X;  2ANV A;  1NDM C;  1FBK A;  243L A;  3AZ6 A;  4BAD A;  4LYB A;  4UG2 A;  1CU0 A;  1KIR C;  1IVM A;  1C6M A;  1WTM A;  4H8X A;  2BQK A;  1OUA A;  5B6V A;  3CAP A;  1LMC A;  1GE2 A;  1L0K A;  5TGZ A;  1C69 A;  1GBY A;  188L A;  1GFK A;  1IW6 A;  1LSM A;  2NTW A;  3S3B B;  1T8A A;  233L A;  2A7F A;  4N0J A;  1YRO A;  4HTQ A;  5LVJ A;  5LYM A;  159L A;  1IWX A;  2OE4 X;  4MD1 A;  3AGG G;  3G3A B;  4LFX A;  3HTF A;  4B4I A;  5G2C A;  4HPI A;  1HFX A;  4NSH A;  3K2R A;  2YVB A;  2IHL A;  4A7D A;  5KXT A;  1P64 A;  1B7Q A;  1HEL A;  2EQL A;  1CX6 A;  3TXI A;  184L A;  1DI5 A;  1C45 A;  1IOQ A;  4W96 A;  2BQL A;  3B72 A;  4B1A A;  1DPX A;  1L53 A;  5G28 A;  4C5F A;  3FI5 A;  4W58 A;  4GLV A;  4FAA B;  2ZIJ A;  1WQN A;  1CU6 A;  1LZS A;  3J4G A;  3ZVQ A;  1IR8 A;  2LZ2 A;  3DN4 A;  2FYD A;  5LIN A;  1YAM A;  4EKQ A;  151L A;  3UTY A;  4B49 A;  4JKV A;  3HBD A;  4XT3 A;  1LJ4 A;  218L A;  245L A;  132L A;  1LSG A;  1L95 A;  4WO9 A;  2HTX A;  1C60 A;  2CDS A;  4N4W A;  3A95 A;  167L A;  5HNC A;  1OWZ A;  1L81 A;  1LMT A;  4NG8 A;  2Z73 A;  213L A;  5KXK A;  2Z19 A;  4XTO A;  4W54 A;  1CTW A;  1B5Y A;  4NC3 A;  1NMM A;  4I7P A;  1GB2 A;  2MED A;  3GUL A;  4UHR A;  1LHH A;  3KJ6 A;  2ZFE A;  5I4Y A;  3L64 A;  1QT6 A;  3IJV A;  1GB9 A;  1REZ A;  3HT9 A;  5HLL A;  1SX7 A;  3TXG A;  5DL9 A;  3CSQ A;  2B74 A;  5JJE A;  5B06 A;  5A3Z A;  3EH3 B;  4ZFP A;  1L20 A;  2B5Z A;  5G36 A;  4G7Q B;  3CT1 A;  131L A;  1CV3 A;  1JTN A;  102L A;  5ILF A;  4XT1 A;  3VHZ A;  1D0K A;  3N9C A;  1FLQ A;  2DQH Y;  1VAU A;  1T3P A;  1D9W A;  1IP3 A;  1OVH A;  5H2O A;  3C9M A;  1L01 A;  4XAD A;  5KXN A;  1OQM A;  3W6E A;  1D3J A;  4WM4 A;  5BR2 A;  1QIO A;  1QT7 A;  1L08 A;  4ETC A;  1JIT A;  4W56 A;  4NSJ A;  1KW7 A;  4LDE A;  3MBV A;  1DXJ A;  1B7R A;  4H94 A;  3UTW A;  3AGH A;  4H9H A;  4JR8 A;  1GB6 A;  4H9A A;  9LYZ A;  1HEP A;  3WVY A;  1QDR A;  2VT4 A;  4DD1 A;  1P2C C;  2ZNW Y;  1IWU A;  1GF7 A;  175L A;  1QT3 A;  5B0W A;  1IOR A;  3HU8 A;  4MCK A;  180L A;  207L A;  3N9A A;  259L A;  3SB6 A;  1FBI X;  4H91 A;  5L3I A;  5H2J A;  3QJT B;  3CT0 A;  1LYY A;  3DN1 A;  5LVH A;  3TXJ A;  4EMN A;  4DYG A;  1E12 A;  1HEM A;  1C10 A;  223L A;  1WQQ A;  2LC9 A;  2ZIK A;  1F6S A;  1M0K A;  1GFR A;  4LYM A;  1LJ3 A;  4X32 A;  1C6Q A;  1GUE A;  3LZT A;  4NWH A;  1CUP A;  1DZB X;  4WLY A;  1BHZ A;  214L A;  1OUG A;  2D91 A;  1YAO A;  3V2Y A;  4DD2 A;  1GAY A;  126L A;  1DPW A;  1OUJ A;  2XJW A;  2B7X A;  1L09 A;  3B6L A;  4J0L A;  2B70 A;  1JTO L;  3EML A;  3MGW A;  1XGT C;  1KGB A;  3EH5 B;  1KS3 A;  1QSB A;  1GAZ A;  2Z37 A;  260L A;  1Q5J A;  3TMV A;  2B75 A;  2I35 A;  1XGU C;  1JV7 A;  3HTG A;  4NEB A;  2OE7 X;  113L A;  4XJH A;  1YKZ X;  4OOT A;  5APF A;  2RBO A;  1JFP A;  219L A;  3UG9 A;  4AXT A;  4AQN A;  5KXL A;  221L A;  1P5C A;  1BWJ A;  1HNL A;  3OE9 A;  1XJI A;  4YEO A;  1E8L A;  3WW6 A;  2RBN A;  3ULR A;  138L A;  2Z39 A;  230L A;  3QBI A;  1BGI A;  4X1H A;  5C6J A;  3HFM Y;  1T8F A;  4H8Y A;  4GN5 C;  2W1M A;  4BEZ A;  1L31 A;  3C7Y A;  2G4Q A;  5F9X A;  1LHK A;  1LZ8 A;  1A2Y C;  1TAY A;  1G7H C;  4DC4 A;  3RT5 X;  1LYO A;  1D2W A;  1M0M A;  211L A;  1L89 A;  3UZA A;  3T6U A;  1WQM A;  1L92 A;  1IC7 Y;  1GE1 A;  5C1M A;  1L63 A;  1L45 A;  1JTP L;  2RB1 X;  3RFM A;  3UZC A;  3TXH A;  2EPE A;  1KY0 A;  2RB2 X;  2XQO A;  2YCY A;  1VDS A;  1UIE A;  3DN0 A;  1L58 A;  2F2Q A;  1C6F A;  1HSX A;  3B0K A;  3G3W A;  2NTG A;  1QQY A;  1SSY A;  3VG9 A;  1EL1 A;  5LAF A;  5B6Z A;  1L15 A;  166L A;  1KIQ C;  3WU9 A;  5APE A;  1IP5 A;  140L A;  1XGR C;  1B6I A;  127L A;  1LYE A;  3GUP A;  5F8U A;  4GLA A;  1GBX A;  4WAV A;  4BAP A;  2I21 A;  4CJ2 A;  1FKQ A;  4IJ4 A;  4NSI A;  1QS9 A;  3A90 A;  1L72 A;  4ET8 A;  1EQE A;  2LCB A;  2Z18 A;  4GN3 A;  4ML7 A;  4NGJ A;  4DD3 A;  4MST A;  1IP7 A;  1IC5 Y;  2B6W A;  1L75 A;  1SLY A;  1XGP C;  3DQB A;  2H9K A;  3ZEK A;  4ARL A;  1YKY X;  1BWI A;  1L23 A;  2C8P A;  3HAR A;  1L87 A;  4FJR A;  2IFF Y;  192L A;  1L41 A;  4NFV A;  1VDT A;  3PXO A;  4C3W A;  1BB4 A;  1JIS A;  1VDQ A;  1G0Q A;  4H9B A;  4NHS A;  1FKV A;  1L57 A;  3CSR A;  4EIY A;  5KXX A;  3A6B Y;  1L26 A;  4RDS A;  4BEY A;  1BVX A;  225L A;  4LYO A;  3HH6 A;  3VW7 A;  1B7S A;  3LYM A;  3LZ2 A;  1GF3 A;  144L A;  4B4J A;  3WXU A;  2R4S A;  1LN6 A;  5K7O A;  4ET9 A;  1T8G A;  1D3M A;  4R0F A;  4II8 A;  1NQI A;  4H9E A;  1NF5 A;  2ZWB A;  1QDT A;  4TTD A;  109L A;  1D3N A;  1O23 A;  4OWA A;  1L82 A;  1NWG A;  1QSA A;  169L A;  1GB0 A;  5ITE A;  4LYC A;  2WJK A;  2YDG A;  2HUB A;  1IWW A;  4GBR A;  4G7S B;  1L77 A;  1DYB A;  2LNL A;  174L A;  1GB7 A;  1L37 A;  3A7K A;  1AT5 A;  5KY1 A;  2J4Y A;  2BQA A;  1LJG A;  4DS7 E;  4HYX A;  1UIB A;  1ZVY B;  2Y03 A;  250L A;  4I7O A;  2PC2 A;  2B6Z A;  4B4E A;  1QT5 A;  1BB5 A;  4DD9 A;  1GE3 A;  3CSZ A;  3LYO A;  1L49 A;  1N4F A;  4N6H A;  1Q5I A;  4L35 A;  1NHE A;  2B6T A;  3OK0 A;  1Z55 A;  1ZUR A;  3EO5 A;  1GF5 A;  2D4J A;  2HU1 A;  3TXD A;  119L A;  1LOZ A;  2OU8 A;  1L0J A;  3V2W A;  3WL2 A;  2VB1 A;  4N5R A;  1BVK C;  241L A;  1AP9 A;  5I54 A;  1HMK A;  1L64 A;  3A94 A;  1LMO A;  1QUH A;  3D9A C;  5I14 A;  2CWI A;  1GB5 A;  1L69 A;  2F47 A;  1V7S A;  2RAY X;  1ZYT A;  1OWY A;  4YXA C;  1HML A;  1LI6 A;  4PHI A;  1CJ8 A;  1C3W A;  1CV6 A;  4DQ5 A;  3ZPQ A;  1L71 A;  3AGI A;  3SB8 A;  5F9U A;  1C6C A;  1FLU A;  1JUG A;  2B73 A;  1BWH A;  3G3V A;  2PED A;  1C6H A;  2RAZ X;  2Y01 A;  1LW9 A;  4HSF A;  3W6A A;  2EKS C;  4YOP A;  5KJ9 A;  4GP5 B;  1QUS A;  1G0M A;  1QUG A;  4HJZ A;  2H9J A;  2X72 A;  4HJV A;  2DQF C;  1B5W A;  2BQI A;  5D5C A;  1GFA A;  3W6F A;  1LZE A;  3B0I A;  1GFU A;  2KSB A;  1CV4 A;  156L A;  1LPY A;  1WTH A;  4H1P A;  3ODU A;  1KIP C;  4WG7 A;  2OTZ X;  4PGJ B;  3HT8 A;  1LSA A;  1L90 A;  1FBB A;  149L A;  1IWZ A;  1RCM A;  5H2M A;  4Z46 A;  3WUN A;  3C7W A;  4L6R A;  5A8E A;  4HTK A;  1QT4 A;  3NYA A;  235L A;  4J1B A;  4FPD A;  3AZ7 A;  1CKD A;  3TMU A;  1GBZ A;  1LZA A;  5J7A A;  3X3C A;  4EJ4 A;  253L A;  3GXK A;  4XJG A;  3HAN A;  3BKH A;  3P66 A;  1X0K 1;  1CJ7 A;  3HH5 A;  1UUZ C;  4PJ2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...