4DKLA

Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
442
structure length
442
Chain Sequence
MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/antagonist
molecule keywords Mu-type opioid receptor, lysozyme chimera
publication title Crystal structure of the {mu}-opioid receptor bound to a morphinan antagonist.
pubmed doi rcsb
source organism Mus musculus
total genus 160
structure length 442
sequence length 442
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4dklA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4dklA01
102LA 3L64A 3S3DB 1L0MA 150LA 1L30A 3V2WA 2IGCA 3UZAA 234LA 1C6TA 3PWHA 1L82A 3OE9A 3PXOA 233LA 4EKPA 2JAGA 2NTUA 4Y9HA 1QTHA 2LZMA 3LZMA 1L44A 1P8UA 4ARMA 4I7MA 163LA 1KS3A 1L33A 2Q9EA 3C8SA 1DZEA 5AX1A 180LA 3A7KA 4BWBA 1L75A 1GUEA 111LA 176LA 3DNAA 2B6XA 3SB6A 4LDLA 112LA 3SBBC 3C81A 235LA 1QT5A 4ARPA 148LE 2R4RA 1QSQA 1R84A 2F32A 3RZEA 3X3CA 3OAXA 5ITEA 3QAKA 1IXFA 3CODA 1QHJA 3PDSA 4I7SA 1ZURA 5B6ZA 2B70A 4NC3A 3OE6A 4MQSA 1P3NA 1QT8A 3JR6A 217LA 2F93A 2YCWA 251LA 4GP5B 4GYCA 1CTWA 3C9LA 2L78A 4LDEA 1L42A 1VJMA 4MD2A 115LA 1L14A 252LA 2B6TA 120LA 4OO9A 2B74A 4EJ4A 1L72A 1P8IA 2YCZA 1P2LA 248LA 3EMLA 1S8LA 1XJTA 2F2QA 4W56A 2KS9A 3C8RA 5F8UA 1CUPA 2OU0X 1L95A 1C6FA 172LA 3PQRA 4HWLA 4EPFA 5G54A 1L60A 1LWGA 4GRVA 1DYCA 1ZWNA 1L02A 4IARA 3SN6R 1NHBA 244LA 1P56A 4ZPUA 4DJHA 3COCA 1QT4A 1L10A 156LA 1CWQA 2RBPA 5G2CA 1L01A 2Y00A 1L81A 3HH5A 5H2HA 1L13A 2F95A 2LCBA 130LA 1T8GA 4PK0A 2KSAA 3HARA 1L57A 1LYEA 5H2JA 1AT9A 3S3BB 3VG9A 3HDEA 4G72B 3ZPRA 1L40A 1C63A 1EPYA 1L59A 171LA 3AM6A 3VHZA 1L71A 1P36A 4BEZA 3D4SA 3F9LA 4W51A 3SB9A 1BRDA 1L31A 1CU0A 1C6HA 1SSYA 1IW9A 126LA 260LA 1L34A 4PXKA 1H2SA 4EPIA 1JTMA 1C64A 1TLAA 262LA 1L63A 1C6LA 3NS0A 2ZZLA 2Z55A 5A8EA 175LA 4GP8B 4YXCA 4E97A 2B6ZA 1EHKB 1CU5A 3QJTB 4ARLA 1L37A 1D3JA 1QTVA 3AYMA 1C6NA 1R2NA 5BR2A 1G0GA 2HPYA 1CX7A 2HULA 1SX2A 3HASA 184LA 138LA 3QJSB 229LA 206LA 2OU9A 1L91A 4L35A 4W52A 1C66A 1L18A 1LW9A 2RBNA 3KJ6A 4QIDA 1QKOA 3QJRB 1QUHA 210LA 4I7RA 2Q9DA 122LA 5G2AA 4UG2A 5JJEA 3HTGA 4OV0A 2YDOA 5JJNA 4G71B 3K2RA 155LA 1LGUA 1L28A 2OE9X 222LA 2RBOA 1L84A 1L47A 3HU9A 3V2YA 2B72A 3GUKA 1QSBA 3QJUB 182LA 1LYJA 4BUOA 2Y04A 4X31A 5B35A 1C6JA 243LA 144LA 1C6AA 5AHZA 4XXJA 4S0WA 2CUUA 1L09A 199LA 1CV6A 2F47A 2RBSA 1JFPA 3G3VA 5LWEA 1D3FA 3NSBA 4GBRA 1XEPA 198LA 1L41A 3RUNA 167LA 3G3WA 141LA 3ODUA 3QBGA 1L04A 103LA 4AMIA 3SB8A 3DKEX 3QBKA 5G28A 3SB5A 1CV3A 1L77A 119LA 3S8FB 1L88A 215LA 3HT8A 4HYXA 4L6RA 1L06A 3VGAA 4BV0A 2RB0X 2B75A 1XJIA 137LA 1L97A 1L29A 4EKQA 228LA 3FA0A 1CV5A 1DYDA 3QDCA 2OEAX 2LC9A 1KW7A 1X0K1 2R4SA 1S53A 2Y03A 1P5CA 3HTBA 145LA 4EXMA 1G0MA 255LA 1QUDA 1VGOA 1KMEA 3HTFA 1QTDA 1QUOA 1TN0A 1DYAA 3UTXA 1L00A 1L17A 2L6XA 197LA 1E12A 4WW3A 1C3WA 2ZFEA 2OE7X 1QTCA 143LA 1L24A 3CDOA 4PJZA 1DYGA 3C80A 1L55A 211LA 4TL3A 1P6YA 1O0AA 1L50A 1KG8A 5B6VA 5B2NA 2OE4X 1OWYA 4FPDA 170LA 3RFMA 205LA 3HAOA 246LA 1L07A 254LA 1L92A 3HAPA 4W59A 5AZDA 1L22A 1FBBA 3L2XA 109LA 1G07A 3EH5B 1L98A 1CUQA 4XTNA 209LA 3HU8A 3GUJA 3PBLA 2M3GA 3SBAA 1KY0A 1F50A 2WJKA 139LA 2ZIYA 4JR8A 4I7PA 118LA 226LA 3DN3A 1C69A 4AQNA 249LA 1B6IA 1C60A 1C68A 2RAZX 4JQ6A 2I20A 4PXFA 1LYFA 1D3NA 231LA 1L46A 1SWZA 3EH4B 177LA 2OU8A 1PQOA 1G06A 216LA 2HUKA 2OTYX 3C8QA 4ARMB 2YCYA 181LA 123LA 1BM1A 1L89A 239LA 1L86A 1L39A 2A4TA 3HT7A 2NTGA 4XT1A 258LA 2RH1A 3CDVA 5B34A 3WQJA 1T8FA 2J4YA 5ETZA 3REYA 107LA 4W57A 1LI2A 241LA 4W55A 1L64A 2JAFA 2B6YA 2QARC 1LN6A 1G1VA 2I35A 1G0KA 4BEYA 1L85A 232LA 3C7WA 3QBLA 1L26A 151LA 2B6WA 1X0SA 1C67A 3UTVA 1G1WA 1MGYA 1L90A 113LA 2RAYX 3HUAA 159LA 196LA 212LA 3DN1A 5A44A 1L15A 2O79A 1HZXA 1XMEB 3VW7A 188LA 173LA 178LA 1L93A 230LA 3HUKA 1ZYTA 3DN2A 4LZMA 2X72A 5DHHA 1QM8A 5H2KA 1DYBA 5EN0A 3CDQA 1OVJA 2Y01A 5AWZA 3DN6A 1L21A 250LA 5H2OA 2PEDA 1LYHA 4ARQA 221LA 4DAJA 1L96A 220LA 5LZMA 2RB2X 1C61A 4G70B 1L66A 140LA 1C6PA 190LA 3DN4A 2HUMA 1SX7A 1CU6A 1C6QA 238LA 1L16A 1P7SA 2Z6BA 2RBRA 2KSBA 2QPDB 1CV1A 1L80A 3CDTA 174LA 3DMZA 4UHRA 1L38A 5TGZA 5B6WA 4QRYA 128LA 1C8SA 5FJGA 4G7RB 1LLHA 1G0QA 3DQBA 2O4WA 4MD1A 1D2WA 5B0WA 3GULA 1QKPA 4KNFA 4I7LA 3VVKA 1LYGA 2B73A 240LA 4GPOA 4I7OA 5DHGA 1UAZA 1S52A 4G7QB 1CV4A 1LYDA 1LI6A 1TN5A 4G7SB 1OVHA 5JJJA 3AYNA 5KKHA 186LA 160LA 1JGJA 213LA 236LA 1L11A 1CX6A 4FBZA 1LPYA 3C7ZA 3GUIA 3UG9A 2QPEB 146LA 1L62A 1XJUA 1L03A 1P8HA 1C6CA 192LA 3S3CB 165LA 1G0JA 4EKRA 1S51A 1UCQA 2NTWA 5G36A 1L69A 1QTBA 5BR5A 1L36A 3C9MA 1L20A 1L58A 4GP4B 1X0I1 1PQIA 4BVNA 1KY1A 3ABWA 1L83A 1Q5JA 4KLYA 3QJVB 257LA 3CDRA 166LA 5B6YA 5AX0A 4J4QA 4QI1A 1PXSA 1D2YA 3P0GA 195LA 5AHYA 1GU8A 1QS5A 1L70A 1L67A 1C6KA 3OE8A 1L19A 1PQMA 191LA 1OV7A 3DDLA 2KSYA 4IAPA 1H68A 1D3MA 1C65A 110LA 1P46A 3GUMA 1L23A 3EH3B 3X3BA 1QT6A 2ANVA 1L76A 129LA 3ZPQA 4EIYA 4A4MA 4DKLA 7LZMA 3VI0A 1C6DA 3HT9A 1C6GA 2Y02A 1P2RA 3QBIA 2B7XA 4FAAB 261LA 2I21A 1L61A 4I7NA 1XIOA 4MBSA 158LA 4GBRB 3CAPA 1SWYA 3HANA 2QB0B 1L49A 1SSWA 1LI3A 2LNLA 4W54A 1L27A 1S8JA 1D9WA 3UTWA 1L25A 1L79A 1L35A 1L53A 1BRRA 1DYEA 2VT4A 245LA 214LA 4YX7C 1PY6A 1L43A 1E0PA 3BVDB 1KNIA 3T45A 1I6SA 3DMVA 2BRDA 1S54A 259LA 1M0MA 2YDVA 104LA 187LA 169LA 1LYIA 1OYUA 5H2PA 2O7AA 223LA 3HH3A 1PQDA 1P64A 3UZCA 4EA3A 4IAQA 4N4YB 4IB4A 3UONA 2WJLA 219LA 1L51A 1QS9A 5J7AA 227LA 1L52A 242LA 3HT6A 4AMJA 4XTOA 1U19A 168LA 1C62A 4EKSA 1CVKA 3HDFA 3C82A 2RB1X 4I7QA 1L45A 2YCXA 1L54A 1L94A 164LA 253LA 4W58A 5H2MA 1IW6A 1KW5A 189LA 3C7YA 2AT9A 225LA 3GUOA 218LA 5C1MA 2I1XA 1OWZA 247LA 1QT3A 2ANXA 3QAPA 3NY8A 3S8GB 1FBKA 4N6HA 5I14A 4WAVA 1T6HA 5H2LA 161LA 2NTHA 1CV0A 4MQTA 4N4WA 1L65A 2Z73A 1DYFA 3NY9A 4FA7B 237LA 1C8RA 3OE0A 1PQKA 1GZMA 1L0KA 1QTZA 4X1HA 1L74A 4YXAC 1L9HA 1L68A 3MBVA 108LA 1C6EA 5B6XA 1M0KA 1OVKA 200LA 1C6MA 4K5YA 149LA 201LA 4XT3A 1Q5IA 4JKVA 1L12A 6LZMA 1C6BA 4X32A 1PQJA 1L0JA 4LDOA 183LA 5ITCA 3QJQB 5H2IA 4I7KA 3C83A 1KGBA 147LA 5G2DA 1L05A 3DN0A 3HH4A 157LA 4I7TA 142LA 162LA 1K28A 3GUNA 3HH6A 3ZEVA 1L08A 3UTYA 4I7JA 1CU3A 2RBQA 3NYAA 1L48A 1M0LA 4W53A 3F8VA 1L99A 3SB7A 1QT7A 224LA 1KG9A 1L87A 1JQUA 1T97A 131LA 5A45A 1L56A 1JV7A 5G53A 1OV5A 2OTZX 3GUPA 5DYSA 127LA 1P37A 1WTHA 1QUGA 1BRXA 1JV6A 1L73A 185LA 3HTDA 4XTLA 1LGWA 3HWLA 1CU2A 2EI4A 4HYJA 114LA 3DN8A 1C6IA 3G3XA 3FI5A 1G0LA 1LGXA 3HUQA 1PXRA 1L32A 1LWKA 256LA 1JTNA 3FADA 4ARQB 1F4ZA 3HAQA 3DMXA 152LA 1AP9A 1F88A 125LA 2G87A 1G0PA 1T8AA 5H2NA 4ARJA
chains in the Genus database with same CATH superfamily
1L0MA 150LA 2FYCA 4PGJB 4HJZA 4EKPA 2G4NA 1L44A 3RNXA 4H9AA 2Q9EA 3A90A 1DZEA 1OUFA 1LMAA 2MECA 3A7KA 4BWBA 5LVHA 1GUEA 111LA 1C08C 3RT5X 3SB6A 2HECA 112LA 3WW6A 3EO5A 3SBBC 1IORA 3C81A 6LYTA 1EQEA 1OUBA 148LE 1CJ9A 1QHJA 4I7SA 5LINA 1RFPA 1QT8A 3JR6A 217LA 1N4FA 2YCWA 251LA 1B7PA 4GYCA 3C9LA 4LDEA 2B6TA 1L14A 4EJ4A 4TWSA 4H90A 1LZSA 3CSQA 2LYOA 5LYMA 2KS9A 2F2QA 4W56A 3C8RA 1CUPA 2OU0X 1L95A 1GWDA 1C6FA 1YAOA 4HWLA 5G54A 1L60A 1GBSA 1J1XY 1GE3A 1NHBA 3COCA 1QT4A 4DT3A 1LZ4A 1NKHA 2DQIY 3ULRA 5H2HA 3W6AA 2F95A 2D4KA 1NWGA 2LCBA 130LA 1LJJA 3HARA 1XGTC 1LYEA 5KXOA 3HDEA 4G72B 3AZ5A 3P68A 1L71A 1LAAA 3F9LA 3SB9A 5APCA 1C6HA 2LHMA 3AW7A 5L3HA 262LA 1C6LA 2ZZLA 2Z55A 2Z38A 1B7SA 4WM1A 4YXCA 1CU5A 1QDTA 1D0LA 1SX2A 229LA 1UC0A 1GB0A 3QJRB 5JJEA 122LA 4UG2A 3T6UA 1GFRA 4GCFA 4HPEA 4EOFA 222LA 3WL2A 3OJPA 1L84A 1GXXA 5KXYA 3HU9A 1GE1A 4HJYA 2ZYPA 1G7LC 4DD1A 3TXHA 2W1XA 4DQJA 1C6AA 1AKIA 1G7MC 4XXJA 1NMMA 2CUUA 1DXJA 2F47A 4E3UA 2RBSA 5LWEA 4WM6A 1BVKC 3NSBA 4GBRA 198LA 1B5XA 167LA 3G3WA 3ODUA 1TBYA 3SB8A 3QBKA 4IJ4A 3SB5A 1L77A 119LA 5FHWA 1GF9A 1YAPA 1L06A 3VGAA 4CFPA 4EKQA 1QSWA 1CV5A 4WMGA 5DL9A 1KW7A 4NGKA 2Y03A 145LA 3W3EA 1QSAA 1QUDA 1GFVA 1HEMA 1QUOA 1DYAA 1GAZA 1CJ7A 1C3WA 1B5VA 4PJZA 1DYGA 4TL3A 211LA 1P6YA 1KG8A 2OE4X 205LA 1E8LA 246LA 254LA 4GLAA 4W59A 3L2XA 4LZTA 3EH5B 4TUNA 1D6PA 4ETAA 3PBLA 1YILA 5F81A 1AT5A 1LJHA 1IWUA 1C60A 2MEBA 4H8ZA 4PXFA 4MSTA 1D3NA 177LA 2OU8A 5KXNA 1LMNA 1L89A 3W6FA 4NWEA 2Z2EA 5B34A 4LYTA 2Z37A 2J4YA 107LA 1LSEA 2C8PA 2ZNXY 1FKVA 1LZAA 2B6YA 1G1VA 2QARC 1G0KA 4BEYA 1L26A 1L90A 1HF4A 3HFMY 196LA 5A44A 1L15A 2O79A 1A4VA 3TXDA 2XTHA 178LA 4M4OA 4XJFA 3A93A 2W1LA 3N9CA 5EN0A 3DN6A 3P4ZA 1LYHA 5APDA 4ARQA 5K7OA 220LA 4G70B 2Z12A 1IWTA 1BGIA 3DN4A 4XYYA 4H94A 5KXZA 4NHQA 1IWVA 1L16A 1YKYX 2QPDB 1CV1A 1B5ZA 3CDTA 174LA 4HJVA 1C8SA 4G4BA 3DQBA 2O4WA 4HPIA 2FBDA 3GULA 1LZYA 4KT3A 4NIJA 5F9UA 5DHGA 1IR8A 1UIDA 4LT3A 5JJJA 4NSIA 3AYNA 2HU3A 1UA6Y 1GDXA 160LA 3QE8A 4N8ZA 1HEWA 4OWAA 1B5WA 1KXXA 3S3CB 1UCQA 1QTBA 5BR5A 1JKBA 1L36A 1YKXX 3C9MA 1GE0A 1L58A 1L83A 1Q5JA 5B6YA 3CDRA 166LA 1JEFA 1LYZA 4QI1A 2H9KA 5AHYA 1QS5A 3LYTA 1HHLA 3OE8A 3WXTA 4CJ2A 1PQMA 3TXBA 1XEIA 4U3XB 110LA 1TAYA 1P46A 3GUMA 3EH3B 1LSAA 2YBLA 1QT6A 3ZPQA 5KXTA 3P65A 1IY3A 3VI0A 4ANRA 1C6DA 3HT9A 1XGPC 1WQPA 2B7XA 4DD3A 5C6IA 3CAPA 4DYGA 3T36A 2LNLA 3LZTA 1LHKA 4W54A 1L25A 2GV0A 1CKCA 1L35A 1L53A 4G4CA 5LVGA 1DYEA 3J6KA 245LA 3CB7A 1PY6A 1L43A 3B6LA 5KXPA 5HNCA 3BVDB 3AGHA 3T45A 3DMVA 1IX0A 1S54A 1M0MA 135LA 1F10A 2O7AA 4IAQA 3UONA 2EKSC 1REZA 227LA 4GCDA 3TXJA 1L52A 1DI4A 1GBXA 1GEZA 1LKRA 4AMJA 1JISA 1GBYA 1GB3A 168LA 5KKIA 1UCOA 3C82A 1L45A 1YQVY 4BADA 2AT9A 3GUOA 218LA 4RDSA 1QT3A 3NY8A 4N5RA 2BPUA 1FBIX 4N6HA 5I14A 5I4XA 5I5QA 3ATOA 5E9RA 4MQTA 4N4WA 1DYFA 4AXTA 1REYA 5B6XA 1LSPA 1WVUA 1M0KA 2N5ZA 200LA 4Z41A 4XT3A 3CQLA 4HSFA 1PQJA 2VB1A 4QEQA 5LYTA 3C83A 4OOOA 1JKCA 1BWHA 1AT6A 4ETBA 4HTNA 3HH6A 1JTTL 3AGIA 1D6QA 2RBQA 2RSCA 4J1AA 3F8VA 2LYMA 1GFHA 1T97A 131LA 5A45A 1IP7A 2OTZX 3GUPA 5L9JA 1L73A 3A94A 1FLYA 1BQLY 4XTLA 1LGWA 2EI4A 3DN8A 1LGXA 3HUQA 1PXRA 1LWKA 1LHIA 1JTNA 3WU7A 1F4ZA 1AP9A 1F88A 2G87A 1UIGA 4PHIA 4ARJA 1QM8A 2ZYCA 1WQMA 3S3DB 1GB2A 1L30A 2IGCA 3UZAA 234LA 1C6TA 5L3IA 1QTHA 2LZMA 1LJFA 3LZMA 4ARMA 5C6JA 1I20A 1KS3A 1L33A 1QUSA 3C8SA 1LJGA 5AX1A 1IWYA 3WW5A 4QDNA 2HTXA 1L75A 4H9EA 1GF0A 1TEWA 176LA 5ILFA 2B6XA 4ZEEA 1QT5A 4ARPA 1LZGA 1R84A 3GXKA 5J7CA 3CODA 2BQEA 1ZURA 2B70A 4NC3A 4DD0A 4DD9A 1JJ1A 3WXUA 4MQSA 3P66A 1EQ5A 1CTWA 2L78A 4XJGA 1L42A 1VJMA 3EBAB 252LA 3A6BY 4OO9A 1P8IA 4LYBA 1P2LA 1S8LA 1JKDA 1YAMA 1D0MA 5F8UA 3EMSA 134LA 2D6BA 2A7DA 2BQIA 1LJ3A 193LA 4ZPUA 1IEEA 3LYMA 2RBPA 1L81A 3RU5A 1L13A 4OWHA 3TMWA 5I4WA 2KSAA 3GXRA 5H2JA 2EQLA 3VG9A 3ZPRA 1L40A 1IP2A 1EPYA 1L59A 4XADA 1ZV5L 3AM6A 4BEZA 1P36A 1AM7A 4W51A 2H9JA 1SSYA 3CT5A 1L34A 4NG8A 4OWBA 2MEHA 5FELA 4QGZA 2ZWBA 4NG1A 175LA 4GP8B 4XN6A 1LHLA 1L37A 1GF7A 1JJ3A 2HPYA 1UIFA 1CX7A 2HULA 184LA 1L91A 1C66A 1LW9A 1QKOA 3HBDA 1RCMA 5DLAA 5G2AA 1JSEA 7LYZA 132LA 4OV0A 5JJNA 2YBNA 4YOPA 1V7SA 1TCYA 2BQJA 2B72A 1RI8B 2BQGA 4XJBA 1LYJA 2Y04A 4X31A 4NEBA 4S0WA 1G7IC 3K3TA 1CV6A 3W6DA 3G3VA 1F6SA 1JHLA 1PS5A 2F2NA 5IELA 1LMCA 4B4JA 4D9ZA 3QBGA 3DKEX 4W94A 1LSDA 1CV3A 3S8FB 1L88A 3HT8A 4HYXA 4L6RA 2B75A 137LA 1L97A 1IY4A 1L29A 3FA0A 3G3BB 2HEFA 4ET8A 2G4PA 2R4SA 1LHHA 1Z55A 4OW1A 1G0MA 1VDTA 1TN0A 1HNLA 4CHXA 2L6XA 4NGJA 1QTCA 5HLLA 1L24A 3C80A 4BAFA 4FPDA 3RFMA 4ZIXA 3HAOA 1HSWA 3HAPA 5AZDA 1G07A 1KXWA 1XGUC 1MLCE 2H5ZA 3A96A 1KY0A 1F50A 139LA 2ZIYA 4NSHA 4LT2A 3DN3A 3A8ZA 249LA 2RAZX 1JWRA 1IIZA 4O34A 5D5CA 2DQAA 1L46A 1UIBA 1HEQA 1PQOA 216LA 2YCYA 1BM1A 1L39A 4ZFPA 4XT1A 5ETZA 3REYA 3TXGA 241LA 2JAFA 1IWZA 1QTEA 1HEOA 1HC0A 3QBLA 1BB3A 151LA 1GPQC 3UTVA 1G1WA 1GDWA 3HUAA 159LA 5M1YA 1LZTA 1XMEB 2YSSC 173LA 1L93A 5KY1A 3HUKA 6LYZA 3DN2A 4LZMA 2I6ZA 4PRQA 4Z98A 1GBWA 5AWZA 1OVJA 2Y01A 1XEJA 4NGOA 2PEDA 4EMNA 4DAJA 1L96A 1C61A 3N9AA 4LYOA 4G4HA 140LA 2HEDA 2MEFA 238LA 2A7FA 4WL6A 2RBRA 4DD7A 2C8OA 1L80A 3AZ6A 3DMZA 1L38A 3CSRA 128LA 1LLHA 1G0QA 1D2WA 4IASA 2BQFA 4GN5C 1YKZX 4XJHA 5ILCA 1OUEA 240LA 4GPOA 1AZFA 1S52A 4G7QB 3AYQA 4NWHA 5B07A 5B59A 2Q0MX 236LA 3IWRA 3A91A 2XJWA 1L62A 1P8HA 3B72A 192LA 1KIPC 2MEEA 165LA 154LA 2NTWA 5G36A 1L69A 2BAAA 4ETCA 2FBBA 4GCEA 4H93A 5AX0A 2BQKA 3A92A 1J1PY 1PXSA 4DQ7A 3P0GA 1LSBA 1L67A 1D9UA 4N0JA 2KSYA 1B7MA 1LSZA 1L23A 1LYYA 3X3BA 1NBZC 1L76A 1DI3A 4EIYA 4DKLA 1LSNA 1CJ8A 3TMXA 4HV1A 2Y02A 3QBIA 2BQLA 4GBRB 5LYZA 3D9AC 1SSWA 1LSYA 4LYMA 1L27A 1S8JA 5LXWA 1VDSA 4H9BA 2VT4A 1OUCA 3LN2A 3TXKA 2CDSA 1C46A 1BWJA 169LA 1G7JC 1P64A 4H91A 4EA3A 1QDRA 4N4YB 4IB4A 2WJLA 219LA 5J7AA 1OUIA 3CT1A 2FYDA 5II3A 4XTOA 1U19A 4EKSA 1CVKA 1IO5A 3HDFA 4B0DA 4GCBA 1KW5A 4IATA 4FDYA 5C1MA 5B1FA 1DKJA 1YROA 1DZBX 2D4IA 1T6HA 5H2LA 161LA 1LSCA 3NY9A 4G49A 237LA 1LZNA 5DM9A 1PQKA 1GZMA 1FKQA 1QIOA 1L74A 1ZVYB 1L68A 5C6LA 5LVJA 1GE2A 3LYZA 1EQ4A 1VATA 3QJQB 2YVBA 5H2IA 1KGBA 3TMVA 4I7TA 142LA 1K28A 5JENB 3ZEVA 3UTYA 1IWXA 4I7JA 3NYAA 1GHLA 1L99A 2ZQ3A 1JQUA 1NF5A 1HFYA 207LA 1L56A 1NDMC 3AGGG 4FJRA 4WO6A 1ZVHL 1JV6A 1XEKA 1YL1X 208LA 4N1EI 114LA 2HEAA 3FI5A 3N9EA 1L32A 1SQ2L 256LA 2BQDA 4ARQB 2F30A 152LA 1LZ6A 5IHGA 3ZEKA 3HBEX 102LA 3L64A 1CKFA 4WM3A 233LA 2JAGA 5HMVA 5F9XA 2NTUA 1FLWA 163LA 4Z3MA 2D91A 1XSFA 4C5FA 1XGQC 3DNAA 2R4RA 4HV2A 3RZEA 3X3CA 2W1MA 3OAXA 4CGEA 5ITEA 1IXFA 3TMUA 5F16A 1GF5A 1P3NA 1GF8A 1LMTA 1WVVA 4MD2A 115LA 2B74A 2YCZA 1L72A 1GB6A 248LA 3EMLA 1XJTA 1UIAA 3A3RX 1H87A 1PZYA 172LA 4EPFA 2ZILA 1LWGA 4GRVA 1ZWNA 1FN5A 2B5ZA 3AW6A 4H92A 3SN6R 244LA 5HNLA 1F0WA 4TTDA 1L10A 1LZ8A 1UUZC 4NGVA 5G2CA 3HH5A 1T8GA 4PK0A 5KXLA 2W1YA 2LZTA 4UWUA 171LA 1LOZA 1WQOA 3BKHA 3D4SA 1L31A 4P2EA 1LMPA 4PXKA 1H2SA 4EPIA 5KKJA 1LHJA 1C64A 3AZ7A 1TLAA 4H9FA 1L63A 2EIZC 5A8EA 2YBJA 4E97A 2B6ZA 4TSCA 1QTVA 1C6NA 5BR2A 1G0GA 1GF3A 133LA 3HASA 3QJSB 2XBSA 3TXEA 1B5UA 1BVXA 1VFBC 2OU9A 4LFXA 4W52A 5A3EA 1CKGA 2RBNA 4QIDA 1QUHA 4XJDA 1IVMA 210LA 4I7RA 2Q9DA 4B1AA 4DDAA 4DQ5A 2YDOA 3K2RA 155LA 2XBRA 3A6CY 1LGUA 2OE9X 2RBOA 4WLXA 3V2YA 3GUKA 2MEIA 1QSBA 4DS7E 3QJUB 4BUOA 1UACY 144LA 2BQCA 3G3AB 2CWIA 199LA 3E3DA 1JFPA 5B06A 1D3FA 1LYSA 1XEPA 1L41A 3VWOA 3AZ4A 1L04A 4AMIA 4QY9A 5G28A 3A3QA 215LA 1XJIA 4I0CA 1DQJC 1DYDA 3QDCA 2LC9A 3LHMA 1P5CA 3P64A 4EXMA 3HTFA 1QTDA 4NSJA 1L00A 1L17A 4WW3A 2ZFEA 2OE7X 4YF2A 143LA 1L55A 1I1ZA 1O0AA 1OWYA 1UBZA 1WQQA 3CT0A 4GN4A 1L22A 1FBBA 4NGLA 109LA 1IC4Y 4RLNA 1L98A 1CUQA 4XTNA 209LA 4KL7A 5E4PA 3GUJA 4XENA 4JR8A 4I7PA 226LA 4AQNA 4WM4A 1C68A 3M18B 2WARA 5LAFA 1LYFA 3EH4B 4Z46A 4DDBA 3D3DA 2HUKA 4ARMB 1VDPA 2G4QA 181LA 4LFPA 2CJLA 1L86A 3J4GA 3WH1A 2HU1A 3WQJA 2RH1A 1B7NA 1T8FA 4W57A 1LI2A 4W55A 5HQ1A 3WU8A 1NBYC 4B4IA 1L85A 3C7WA 1C67A 4DDCA 212LA 3RZ4A 4WO9A 3VW7A 1GFGA 3TXFA 188LA 230LA 3WVYA 4KXIA 1ZYTA 2X72A 4YEOA 1WQNA 1RE2A 1DYBA 5H2KA 1C45A 3WUMA 5DN4A 1I56A 221LA 2BQOA 2RB2X 1OUDA 1GB7A 1C6PA 4M6DA 2HUMA 1JPOA 1CU6A 1GB8A 2LZ2A 2EPEA 4UHRA 5TGZA 4ETEA 3BKVA 4G7RB 5B0WA 1P2CC 2BQMA 5HMJA 1QKPA 4I7LA 5I54A 1FLQA 5T3FA 5KXRA 4I7OA 1GB5A 1LJ4A 1UAZA 1LYDA 1LI6A 1OVHA 1KIRC 5KXWA 4G9SA 186LA 1JGJA 213LA 4R0FA 3ATNA 4WLTA 5APEA 1GFJA 4FBZA 1LPYA 3C7ZA 2QPEB 4LYZA 1G0JA 1S51A 2Y8PA 1LMOA 1JUGA 4C3WA 4UWNA 4NHTA 1OP9B 1X0I1 1B7LA 2HUBA 1LYOA 1PQIA 4KLYA 3QJVB 1LPIA 257LA 4J4QA 3EXDA 1WTMA 1D2YA 195LA 1LZ9A 1LZ5A 1GU8A 1F6RA 2XQOA 1C6KA 1L19A 1HMKA 2HEBA 3W6EA 1UICA 1H68A 4A7DA 1C65A 1IC7Y 1D0KA 1JKAA 5EBHA 2ANVA 1IC5Y 4OWEA 7LZMA 5B1GA 1C6GA 1P2RA 261LA 1IOTA 1LJKA 2MEAA 1XIOA 4MBSA 158LA 1LSMA 4N9RA 1SWYA 5FDJA 3HANA 2QB0B 1YIKA 1OUJA 1D9WA 3UTWA 1CJ6A 214LA 1REXA 1E0PA 1KNIA 4YEMA 1GBZA 1SLYA 259LA 104LA 1LYIA 4H1PA 3HH3A 3UZCA 1BB6A 3M3UA 1LJNA 1GE4A 1LKSA 1L51A 1QS9A 4YENA 1NQIA 3HT6A 5IDDA 1REMA 3FI7A 2RB1X 2YCXA 1L54A 4H9IA 3WVXA 164LA 253LA 4W58A 5H2MA 1IW6A 189LA 3C7YA 225LA 3LYOA 2I1XA 1OWZA 2ANXA 4HTKA 3S8GB 4OWCA 3WPJA 2NWDX 3QNGA 1IP6A 1CV0A 1L65A 2ZQ4A 3WUNA 1C8RA 2DQHY 1GBOA 1L0KA 1QTZA 3WULA 4YXAC 1L9HA 3MBVA 4NGIA 1C6MA 1RJCB 201LA 5KJ9A 1Q5IA 6LZMA 4X32A 1L0JA 183LA 5ITCA 2IFFY 4ET9A 3DN0A 2D4JA 3HH4A 157LA 162LA 2BQAA 1L48A 2DQDY 224LA 1KG9A 1DPXA 5APFA 5G53A 4TX7A 5DYSA 127LA 1WTHA 1QUGA 1BRXA 5LAGA 1T3PA 4WG1A 4HYJA 1C6IA 2F4AA 2DQCY 2AUBA 1TDYA 1GFTA 1ALCA 3FADA 3DMXA 3FE0A 4II8A 3V2WA 3PWHA 1L82A 3OE9A 4RW2A 3PXOA 1HELA 4Y9HA 1P8UA 4I7MA 1B7QA 180LA 1IR7A 2MEDA 4ETDA 1FDLY 4B49A 2I26L 4LDLA 1QQYA 1B5YA 1CKHA 1MELL 235LA 1QSQA 2F32A 5F14A 4LGKA 3QAKA 1O23A 3PDSA 5B6ZA 1GFAA 2F4GA 5KXSA 3OE6A 3AJNA 4R6CA 2BLYA 2F93A 4GP5B 1LSFA 4MR1A 120LA 4LT1A 1BB7A 1YAQA 1DPWA 1WTNA 1GD6A 4WG7A 1JSFA 3PQRA 1IR9A 1DYCA 5FCPA 1GFUA 1L02A 4IARA 4DJHA 1P56A 2YBHA 4H8YA 1UIHA 156LA 1CWQA 3IJUA 1L01A 2Y00A 5A3ZA 2Z2FA 1VAUA 1OQMA 1L57A 1AT9A 3S3BB 5AMYA 1C63A 2ZIJA 3VHZA 1VDQA 1GAYA 1BRDA 1CU0A 1IW9A 126LA 1LZCA 260LA 1JTMA 4NGZA 1CNSA 5KXKA 3NS0A 2Z39A 4PJ2C 1EHKB 1EL1A 1B0DA 3QJTB 4ARLA 2BQBA 1D3JA 2DQFC 3AYMA 3AB6A 1R2NA 5LIOA 5KXXA 3KAMA 138LA 4H9HA 2BQNA 3B0OA 206LA 4PRUA 4L35A 1L18A 3KJ6A 3HTGA 1WQRA 3WUAA 4G71B 2ZNWY 4WL7A 4RLMA 1L28A 4J7VA 4H8XA 1IOQA 1L47A 153LA 1A2YC 182LA 5B35A 1C6JA 243LA 1C43A 1LJIA 3WPKA 5AHZA 5DN5A 1L09A 1VEDA 1JTOL 5I4YA 4MCKA 1DI5A 3RUNA 141LA 103LA 4YM8A 1HSXA 2LYZA 3A95A 1H6MA 4BV0A 2RB0X 228LA 3OK0A 2OEAX 4X3BA 1HFXA 4J0LA 1GXV2 1X0K1 3A34A 1S53A 1IP1A 3WMKA 3HTBA 255LA 1LHMA 1VGOA 1KMEA 3UTXA 4NHPA 197LA 4N1CC 1E12A 1JTPL 3W6BA 1GF4A 3CDOA 2DQEY 1L50A 5B6VA 5B2NA 170LA 1L07A 4I8SA 1L92A 1LTMA 3HU8A 2M3GA 1QUTA 4PPOA 3SBAA 2WJKA 1G7HC 1GFKA 118LA 1C69A 1B6IA 4JQ6A 2I20A 4OOTA 2YBIA 231LA 4GLVA 1GF6A 1SWZA 1IOCA 1XGRC 1G06A 3C8QA 4NHSA 2OTYX 1UIEA 123LA 2I25L 4WM2A 239LA 2A4TA 3HT7A 2NTGA 258LA 3CDVA 1OUHA 1HEPA 4CFOA 1L64A 3ZVQA 4AGAA 1LN6A 2I35A 3B0KA 232LA 4LYCA 2B6WA 1X0SA 4NGYA 1MGYA 1GFEA 1IP3A 113LA 2RAYX 4DWXA 4UWVA 3DN1A 4H9CA 1HZXA 2BQHA 1OUAA 1W08A 1YANA 5FEKA 4W96A 5DHHA 3CDQA 5H2OA 1B7OA 1HENA 1L21A 250LA 1YL0X 1V7TA 2MEGA 1LZRA 5LZMA 3WYHA 1B7RA 1LZ1A 1L66A 1IP5A 4L41A 190LA 4NSGA 2HEEA 1QTKA 1CKDA 1SX7A 1C6QA 1P7SA 3F6ZA 2Z6BA 4B4EA 2KSBA 2Z19A 5B6WA 4QRYA 5FJGA 4MD1A 5D5FA 2ZIKA 2IHLA 1IP4A 4KNFA 3B0IA 3VVKA 2YDGA 4GCCA 1LYGA 2B73A 1IOSA 4NY5A 3SP3A 4NFVA 3ZVQB 1LSGA 1CV4A 2DBTA 1TN5A 4G7SB 1JJ0A 5KKHA 1W6ZA 1L11A 1CX6A 3GUIA 5LA5A 3UG9A 146LA 1XJUA 1L03A 3W6CA 1C6CA 1XFPL 4EKRA 1BB5A 1HMLA 4BAPA 1L20A 1C10A 4GP4B 4NGWA 4BVNA 1KY1A 3ABWA 3WU9A 5I53A 2PC2A 1L70A 4HTQA 4WLDA 4GN3A 3MGWA 191LA 1OV7A 1J1OY 3DDLA 4IAPA 1JITA 1D3MA 4ML7A 3WPLA 5FSTA 129LA 4A4MA 5LVIA 1OUGA 194LA 4FAAB 2I21A 1L61A 4I7NA 4BS7A 1LZDA 5KXMA 2Z18A 1L49A 1GB9A 1LI3A 2BLXA 1L79A 3QY4A 5LA8A 1BRRA 4YX7C 2CGIA 1LJEA 1I6SA 3CSZA 2BRDA 4WM5A 2YDVA 5H2PA 187LA 1LZBA 1OYUA 223LA 1HERA 1PQDA 1BB4A 1KXYA 1B9OA 4DC4A 242LA 3IJVA 1BWIA 2X0AA 2DQJY 1C62A 4WLYA 4I7QA 1L94A 4NHIA 1BHZA 1IWWA 247LA 1LMQA 4TSBA 3QAPA 3LZ2A 1HFZA 1FBKA 1C7PA 9LYZA 4WAVA 2NTHA 4KPMA 1ZMYL 1LCNA 2Z73A 4FA7B 3OE0A 4X1HA 1NDGC 1T6VL 2YBMA 1DKKA 108LA 1C6EA 4J1BA 1OVKA 4K5YA 149LA 4RW1A 4JKVA 1L12A 1C6BA 1NHEA 4LDOA 5B05A 8LYZA 4DD2A 4I7KA 147LA 5G2DA 1L05A 4HP0A 3TXIA 1GEVA 3GUNA 1L08A 1FLUA 3RW8A 1CU3A 1JIYA 1M0LA 4W53A 3SB7A 1QT7A 1L87A 4XJIA 1JV7A 1OV5A 4LT0A 3A67Y 1P37A 185LA 3HTDA 1B2KA 3HWLA 1CU2A 3HBHA 3G3XA 4WOAA 1INUA 1G0LA 2DQGY 3HAQA 5LVKA 125LA 2DKVA 1G0PA 1KIQC 1T8AA 5H2NA 1LZEA
chains in the Genus database with same CATH topology
1L0MA 150LA 2FYCA 4PGJB 4HJZA 4EKPA 2G4NA 1L44A 3RNXA 4H9AA 2Q9EA 3A90A 1DZEA 1OUFA 1LMAA 2MECA 3A7KA 4BWBA 5LVHA 1GUEA 111LA 1C08C 3RT5X 3SB6A 2HECA 112LA 3WW6A 3EO5A 3SBBC 1IORA 3C81A 6LYTA 1EQEA 1OUBA 148LE 1CJ9A 1QHJA 4I7SA 5LINA 1RFPA 1QT8A 3JR6A 217LA 1N4FA 2YCWA 251LA 1B7PA 4GYCA 3C9LA 4LDEA 2B6TA 1L14A 4EJ4A 4TWSA 4H90A 1LZSA 3CSQA 2LYOA 5LYMA 2KS9A 2F2QA 4W56A 3C8RA 1CUPA 2OU0X 1L95A 1GWDA 1C6FA 1YAOA 4HWLA 5G54A 1L60A 1GBSA 1J1XY 1GE3A 1NHBA 3COCA 1QT4A 4DT3A 1LZ4A 1NKHA 2DQIY 3ULRA 5H2HA 3W6AA 2F95A 2D4KA 1NWGA 2LCBA 130LA 1LJJA 3HARA 1XGTC 1LYEA 5KXOA 3HDEA 4G72B 3AZ5A 3P68A 1L71A 1LAAA 3F9LA 3SB9A 5APCA 1C6HA 2LHMA 3AW7A 5L3HA 262LA 1C6LA 2ZZLA 2Z55A 2Z38A 1B7SA 4WM1A 4YXCA 1CU5A 1QDTA 1D0LA 1SX2A 229LA 1UC0A 1GB0A 3QJRB 5JJEA 122LA 4UG2A 3T6UA 1GFRA 4GCFA 4HPEA 4EOFA 222LA 3WL2A 3OJPA 1L84A 1GXXA 5KXYA 3HU9A 1GE1A 4HJYA 2ZYPA 1G7LC 4DD1A 3TXHA 2W1XA 4DQJA 1C6AA 1AKIA 1G7MC 4XXJA 1NMMA 2CUUA 1DXJA 2F47A 4E3UA 2RBSA 5LWEA 4WM6A 1BVKC 3NSBA 4GBRA 198LA 1B5XA 167LA 3G3WA 3ODUA 1TBYA 3SB8A 3QBKA 4IJ4A 3SB5A 1L77A 119LA 5FHWA 1GF9A 1YAPA 1L06A 3VGAA 4CFPA 4EKQA 1QSWA 1CV5A 4WMGA 5DL9A 1KW7A 4NGKA 2Y03A 145LA 3W3EA 1QSAA 1QUDA 1GFVA 1HEMA 1QUOA 1DYAA 1GAZA 1CJ7A 1C3WA 1B5VA 4PJZA 1DYGA 4TL3A 211LA 1P6YA 1KG8A 2OE4X 205LA 1E8LA 246LA 254LA 4GLAA 4W59A 3L2XA 4LZTA 3EH5B 4TUNA 1D6PA 4ETAA 3PBLA 1YILA 5F81A 1AT5A 1LJHA 1IWUA 1C60A 2MEBA 4H8ZA 4PXFA 4MSTA 1D3NA 177LA 2OU8A 5KXNA 1LMNA 1L89A 3W6FA 4NWEA 2Z2EA 5B34A 4LYTA 2Z37A 2J4YA 107LA 1LSEA 2C8PA 2ZNXY 1FKVA 1LZAA 2B6YA 1G1VA 2QARC 1G0KA 4BEYA 1L26A 1L90A 1HF4A 3HFMY 196LA 5A44A 1L15A 2O79A 1A4VA 3TXDA 2XTHA 178LA 4M4OA 4XJFA 3A93A 2W1LA 3N9CA 5EN0A 3DN6A 3P4ZA 1LYHA 5APDA 4ARQA 5K7OA 220LA 4G70B 2Z12A 1IWTA 1BGIA 3DN4A 4XYYA 4H94A 5KXZA 4NHQA 1IWVA 1L16A 1YKYX 2QPDB 1CV1A 1B5ZA 3CDTA 174LA 4HJVA 1C8SA 4G4BA 3DQBA 2O4WA 4HPIA 2FBDA 3GULA 1LZYA 4KT3A 4NIJA 5F9UA 5DHGA 1IR8A 1UIDA 4LT3A 5JJJA 4NSIA 3AYNA 2HU3A 1UA6Y 1GDXA 160LA 3QE8A 4N8ZA 1HEWA 4OWAA 1B5WA 1KXXA 3S3CB 1UCQA 1QTBA 5BR5A 1JKBA 1L36A 1YKXX 3C9MA 1GE0A 1L58A 1L83A 1Q5JA 5B6YA 3CDRA 166LA 1JEFA 1LYZA 4QI1A 2H9KA 5AHYA 1QS5A 3LYTA 1HHLA 3OE8A 3WXTA 4CJ2A 1PQMA 3TXBA 1XEIA 4U3XB 110LA 1TAYA 1P46A 3GUMA 3EH3B 1LSAA 2YBLA 1QT6A 3ZPQA 5KXTA 3P65A 1IY3A 3VI0A 4ANRA 1C6DA 3HT9A 1XGPC 1WQPA 2B7XA 4DD3A 5C6IA 3CAPA 4DYGA 3T36A 2LNLA 3LZTA 1LHKA 4W54A 1L25A 2GV0A 1CKCA 1L35A 1L53A 4G4CA 5LVGA 1DYEA 3J6KA 245LA 3CB7A 1PY6A 1L43A 3B6LA 5KXPA 5HNCA 3BVDB 3AGHA 3T45A 3DMVA 1IX0A 1S54A 1M0MA 135LA 1F10A 2O7AA 4IAQA 3UONA 2EKSC 1REZA 227LA 4GCDA 3TXJA 1L52A 1DI4A 1GBXA 1GEZA 1LKRA 4AMJA 1JISA 1GBYA 1GB3A 168LA 5KKIA 1UCOA 3C82A 1L45A 1YQVY 4BADA 2AT9A 3GUOA 218LA 4RDSA 1QT3A 3NY8A 4N5RA 2BPUA 1FBIX 4N6HA 5I14A 5I4XA 5I5QA 3ATOA 5E9RA 4MQTA 4N4WA 1DYFA 4AXTA 1REYA 5B6XA 1LSPA 1WVUA 1M0KA 2N5ZA 200LA 4Z41A 4XT3A 3CQLA 4HSFA 1PQJA 2VB1A 4QEQA 5LYTA 3C83A 4OOOA 1JKCA 1BWHA 1AT6A 4ETBA 4HTNA 3HH6A 1JTTL 3AGIA 1D6QA 2RBQA 2RSCA 4J1AA 3F8VA 2LYMA 1GFHA 1T97A 131LA 5A45A 1IP7A 2OTZX 3GUPA 5L9JA 1L73A 3A94A 1FLYA 1BQLY 4XTLA 1LGWA 2EI4A 3DN8A 1LGXA 3HUQA 1PXRA 1LWKA 1LHIA 1JTNA 3WU7A 1F4ZA 1AP9A 1F88A 2G87A 1UIGA 4PHIA 4ARJA 1QM8A 2ZYCA 1WQMA 3S3DB 1GB2A 1L30A 2IGCA 3UZAA 234LA 1C6TA 5L3IA 1QTHA 2LZMA 1LJFA 3LZMA 4ARMA 5C6JA 1I20A 1KS3A 1L33A 1QUSA 3C8SA 1LJGA 5AX1A 1IWYA 3WW5A 4QDNA 2HTXA 1L75A 4H9EA 1GF0A 1TEWA 176LA 5ILFA 2B6XA 4ZEEA 1QT5A 4ARPA 1LZGA 1R84A 3GXKA 5J7CA 3CODA 2BQEA 1ZURA 2B70A 4NC3A 4DD0A 4DD9A 1JJ1A 3WXUA 4MQSA 3P66A 1EQ5A 1CTWA 2L78A 4XJGA 1L42A 1VJMA 3EBAB 252LA 3A6BY 4OO9A 1P8IA 4LYBA 1P2LA 1S8LA 1JKDA 1YAMA 1D0MA 5F8UA 3EMSA 134LA 2D6BA 2A7DA 2BQIA 1LJ3A 193LA 4ZPUA 1IEEA 3LYMA 2RBPA 1L81A 3RU5A 1L13A 4OWHA 3TMWA 5I4WA 2KSAA 3GXRA 5H2JA 2EQLA 3VG9A 3ZPRA 1L40A 1IP2A 1EPYA 1L59A 4XADA 1ZV5L 3AM6A 4BEZA 1P36A 1AM7A 4W51A 2H9JA 1SSYA 3CT5A 1L34A 4NG8A 4OWBA 2MEHA 5FELA 4QGZA 2ZWBA 4NG1A 175LA 4GP8B 4XN6A 1LHLA 1L37A 1GF7A 1JJ3A 2HPYA 1UIFA 1CX7A 2HULA 184LA 1L91A 1C66A 1LW9A 1QKOA 3HBDA 1RCMA 5DLAA 5G2AA 1JSEA 7LYZA 132LA 4OV0A 5JJNA 2YBNA 4YOPA 1V7SA 1TCYA 2BQJA 2B72A 1RI8B 2BQGA 4XJBA 1LYJA 2Y04A 4X31A 4NEBA 4S0WA 1G7IC 3K3TA 1CV6A 3W6DA 3G3VA 1F6SA 1JHLA 1PS5A 2F2NA 5IELA 1LMCA 4B4JA 4D9ZA 3QBGA 3DKEX 4W94A 1LSDA 1CV3A 3S8FB 1L88A 3HT8A 4HYXA 4L6RA 2B75A 137LA 1L97A 1IY4A 1L29A 3FA0A 3G3BB 2HEFA 4ET8A 2G4PA 2R4SA 1LHHA 1Z55A 4OW1A 1G0MA 1VDTA 1TN0A 1HNLA 4CHXA 2L6XA 4NGJA 1QTCA 5HLLA 1L24A 3C80A 4BAFA 4FPDA 3RFMA 4ZIXA 3HAOA 1HSWA 3HAPA 5AZDA 1G07A 1KXWA 1XGUC 1MLCE 2H5ZA 3A96A 1KY0A 1F50A 139LA 2ZIYA 4NSHA 4LT2A 3DN3A 3A8ZA 249LA 2RAZX 1JWRA 1IIZA 4O34A 5D5CA 2DQAA 1L46A 1UIBA 1HEQA 1PQOA 216LA 2YCYA 1BM1A 1L39A 4ZFPA 4XT1A 5ETZA 3REYA 3TXGA 241LA 2JAFA 1IWZA 1QTEA 1HEOA 1HC0A 3QBLA 1BB3A 151LA 1GPQC 3UTVA 1G1WA 1GDWA 3HUAA 159LA 5M1YA 1LZTA 1XMEB 2YSSC 173LA 1L93A 5KY1A 3HUKA 6LYZA 3DN2A 4LZMA 2I6ZA 4PRQA 4Z98A 1GBWA 5AWZA 1OVJA 2Y01A 1XEJA 4NGOA 2PEDA 4EMNA 4DAJA 1L96A 1C61A 3N9AA 4LYOA 4G4HA 140LA 2HEDA 2MEFA 238LA 2A7FA 4WL6A 2RBRA 4DD7A 2C8OA 1L80A 3AZ6A 3DMZA 1L38A 3CSRA 128LA 1LLHA 1G0QA 1D2WA 4IASA 2BQFA 4GN5C 1YKZX 4XJHA 5ILCA 1OUEA 240LA 4GPOA 1AZFA 1S52A 4G7QB 3AYQA 4NWHA 5B07A 5B59A 2Q0MX 236LA 3IWRA 3A91A 2XJWA 1L62A 1P8HA 3B72A 192LA 1KIPC 2MEEA 165LA 154LA 2NTWA 5G36A 1L69A 2BAAA 4ETCA 2FBBA 4GCEA 4H93A 5AX0A 2BQKA 3A92A 1J1PY 1PXSA 4DQ7A 3P0GA 1LSBA 1L67A 1D9UA 4N0JA 2KSYA 1B7MA 1LSZA 1L23A 1LYYA 3X3BA 1NBZC 1L76A 1DI3A 4EIYA 4DKLA 1LSNA 1CJ8A 3TMXA 4HV1A 2Y02A 3QBIA 2BQLA 4GBRB 5LYZA 3D9AC 1SSWA 1LSYA 4LYMA 1L27A 1S8JA 5LXWA 1VDSA 4H9BA 2VT4A 1OUCA 3LN2A 3TXKA 2CDSA 1C46A 1BWJA 169LA 1G7JC 1P64A 4H91A 4EA3A 1QDRA 4N4YB 4IB4A 2WJLA 219LA 5J7AA 1OUIA 3CT1A 2FYDA 5II3A 4XTOA 1U19A 4EKSA 1CVKA 1IO5A 3HDFA 4B0DA 4GCBA 1KW5A 4IATA 4FDYA 5C1MA 5B1FA 1DKJA 1YROA 1DZBX 2D4IA 1T6HA 5H2LA 161LA 1LSCA 3NY9A 4G49A 237LA 1LZNA 5DM9A 1PQKA 1GZMA 1FKQA 1QIOA 1L74A 1ZVYB 1L68A 5C6LA 5LVJA 1GE2A 3LYZA 1EQ4A 1VATA 3QJQB 2YVBA 5H2IA 1KGBA 3TMVA 4I7TA 142LA 1K28A 5JENB 3ZEVA 3UTYA 1IWXA 4I7JA 3NYAA 1GHLA 1L99A 2ZQ3A 1JQUA 1NF5A 1HFYA 207LA 1L56A 1NDMC 3AGGG 4FJRA 4WO6A 1ZVHL 1JV6A 1XEKA 1YL1X 208LA 4N1EI 114LA 2HEAA 3FI5A 3N9EA 1L32A 1SQ2L 256LA 2BQDA 4ARQB 2F30A 152LA 1LZ6A 5IHGA 3ZEKA 3HBEX 102LA 3L64A 1CKFA 4WM3A 233LA 2JAGA 5HMVA 5F9XA 2NTUA 1FLWA 163LA 4Z3MA 2D91A 1XSFA 4C5FA 1XGQC 3DNAA 2R4RA 4HV2A 3RZEA 3X3CA 2W1MA 3OAXA 4CGEA 5ITEA 1IXFA 3TMUA 5F16A 1GF5A 1P3NA 1GF8A 1LMTA 1WVVA 4MD2A 115LA 2B74A 2YCZA 1L72A 1GB6A 248LA 3EMLA 1XJTA 1UIAA 3A3RX 1H87A 1PZYA 172LA 4EPFA 2ZILA 1LWGA 4GRVA 1ZWNA 1FN5A 2B5ZA 3AW6A 4H92A 3SN6R 244LA 5HNLA 1F0WA 4TTDA 1L10A 1LZ8A 1UUZC 4NGVA 5G2CA 3HH5A 1T8GA 4PK0A 5KXLA 2W1YA 2LZTA 4UWUA 171LA 1LOZA 1WQOA 3BKHA 3D4SA 1L31A 4P2EA 1LMPA 4PXKA 1H2SA 4EPIA 5KKJA 1LHJA 1C64A 3AZ7A 1TLAA 4H9FA 1L63A 2EIZC 5A8EA 2YBJA 4E97A 2B6ZA 4TSCA 1QTVA 1C6NA 5BR2A 1G0GA 1GF3A 133LA 3HASA 3QJSB 2XBSA 3TXEA 1B5UA 1BVXA 1VFBC 2OU9A 4LFXA 4W52A 5A3EA 1CKGA 2RBNA 4QIDA 1QUHA 4XJDA 1IVMA 210LA 4I7RA 2Q9DA 4B1AA 4DDAA 4DQ5A 2YDOA 3K2RA 155LA 2XBRA 3A6CY 1LGUA 2OE9X 2RBOA 4WLXA 3V2YA 3GUKA 2MEIA 1QSBA 4DS7E 3QJUB 4BUOA 1UACY 144LA 2BQCA 3G3AB 2CWIA 199LA 3E3DA 1JFPA 5B06A 1D3FA 1LYSA 1XEPA 1L41A 3VWOA 3AZ4A 1L04A 4AMIA 4QY9A 5G28A 3A3QA 215LA 1XJIA 4I0CA 1DQJC 1DYDA 3QDCA 2LC9A 3LHMA 1P5CA 3P64A 4EXMA 3HTFA 1QTDA 4NSJA 1L00A 1L17A 4WW3A 2ZFEA 2OE7X 4YF2A 143LA 1L55A 1I1ZA 1O0AA 1OWYA 1UBZA 1WQQA 3CT0A 4GN4A 1L22A 1FBBA 4NGLA 109LA 1IC4Y 4RLNA 1L98A 1CUQA 4XTNA 209LA 4KL7A 5E4PA 3GUJA 4XENA 4JR8A 4I7PA 226LA 4AQNA 4WM4A 1C68A 3M18B 2WARA 5LAFA 1LYFA 3EH4B 4Z46A 4DDBA 3D3DA 2HUKA 4ARMB 1VDPA 2G4QA 181LA 4LFPA 2CJLA 1L86A 3J4GA 3WH1A 2HU1A 3WQJA 2RH1A 1B7NA 1T8FA 4W57A 1LI2A 4W55A 5HQ1A 3WU8A 1NBYC 4B4IA 1L85A 3C7WA 1C67A 4DDCA 212LA 3RZ4A 4WO9A 3VW7A 1GFGA 3TXFA 188LA 230LA 3WVYA 4KXIA 1ZYTA 2X72A 4YEOA 1WQNA 1RE2A 1DYBA 5H2KA 1C45A 3WUMA 5DN4A 1I56A 221LA 2BQOA 2RB2X 1OUDA 1GB7A 1C6PA 4M6DA 2HUMA 1JPOA 1CU6A 1GB8A 2LZ2A 2EPEA 4UHRA 5TGZA 4ETEA 3BKVA 4G7RB 5B0WA 1P2CC 2BQMA 5HMJA 1QKPA 4I7LA 5I54A 1FLQA 5T3FA 5KXRA 4I7OA 1GB5A 1LJ4A 1UAZA 1LYDA 1LI6A 1OVHA 1KIRC 5KXWA 4G9SA 186LA 1JGJA 213LA 4R0FA 3ATNA 4WLTA 5APEA 1GFJA 4FBZA 1LPYA 3C7ZA 2QPEB 4LYZA 1G0JA 1S51A 2Y8PA 1LMOA 1JUGA 4C3WA 4UWNA 4NHTA 1OP9B 1X0I1 1B7LA 2HUBA 1LYOA 1PQIA 4KLYA 3QJVB 1LPIA 257LA 4J4QA 3EXDA 1WTMA 1D2YA 195LA 1LZ9A 1LZ5A 1GU8A 1F6RA 2XQOA 1C6KA 1L19A 1HMKA 2HEBA 3W6EA 1UICA 1H68A 4A7DA 1C65A 1IC7Y 1D0KA 1JKAA 5EBHA 2ANVA 1IC5Y 4OWEA 7LZMA 5B1GA 1C6GA 1P2RA 261LA 1IOTA 1LJKA 2MEAA 1XIOA 4MBSA 158LA 1LSMA 4N9RA 1SWYA 5FDJA 3HANA 2QB0B 1YIKA 1OUJA 1D9WA 3UTWA 1CJ6A 214LA 1REXA 1E0PA 1KNIA 4YEMA 1GBZA 1SLYA 259LA 104LA 1LYIA 4H1PA 3HH3A 3UZCA 1BB6A 3M3UA 1LJNA 1GE4A 1LKSA 1L51A 1QS9A 4YENA 1NQIA 3HT6A 5IDDA 1REMA 3FI7A 2RB1X 2YCXA 1L54A 4H9IA 3WVXA 164LA 253LA 4W58A 5H2MA 1IW6A 189LA 3C7YA 225LA 3LYOA 2I1XA 1OWZA 2ANXA 4HTKA 3S8GB 4OWCA 3WPJA 2NWDX 3QNGA 1IP6A 1CV0A 1L65A 2ZQ4A 3WUNA 1C8RA 2DQHY 1GBOA 1L0KA 1QTZA 3WULA 4YXAC 1L9HA 3MBVA 4NGIA 1C6MA 1RJCB 201LA 5KJ9A 1Q5IA 6LZMA 4X32A 1L0JA 183LA 5ITCA 2IFFY 4ET9A 3DN0A 2D4JA 3HH4A 157LA 162LA 2BQAA 1L48A 2DQDY 224LA 1KG9A 1DPXA 5APFA 5G53A 4TX7A 5DYSA 127LA 1WTHA 1QUGA 1BRXA 5LAGA 1T3PA 4WG1A 4HYJA 1C6IA 2F4AA 2DQCY 2AUBA 1TDYA 1GFTA 1ALCA 3FADA 3DMXA 3FE0A 4II8A 3V2WA 3PWHA 1L82A 3OE9A 4RW2A 3PXOA 1HELA 4Y9HA 1P8UA 4I7MA 1B7QA 180LA 1IR7A 2MEDA 4ETDA 1FDLY 4B49A 2I26L 4LDLA 1QQYA 1B5YA 1CKHA 1MELL 235LA 1QSQA 2F32A 5F14A 4LGKA 3QAKA 1O23A 3PDSA 5B6ZA 1GFAA 2F4GA 5KXSA 3OE6A 3AJNA 4R6CA 2BLYA 2F93A 4GP5B 1LSFA 4MR1A 120LA 4LT1A 1BB7A 1YAQA 1DPWA 1WTNA 1GD6A 4WG7A 1JSFA 3PQRA 1IR9A 1DYCA 5FCPA 1GFUA 1L02A 4IARA 4DJHA 1P56A 2YBHA 4H8YA 1UIHA 156LA 1CWQA 3IJUA 1L01A 2Y00A 5A3ZA 2Z2FA 1VAUA 1OQMA 1L57A 1AT9A 3S3BB 5AMYA 1C63A 2ZIJA 3VHZA 1VDQA 1GAYA 1BRDA 1CU0A 1IW9A 126LA 1LZCA 260LA 1JTMA 4NGZA 1CNSA 5KXKA 3NS0A 2Z39A 4PJ2C 1EHKB 1EL1A 1B0DA 3QJTB 4ARLA 2BQBA 1D3JA 2DQFC 3AYMA 3AB6A 1R2NA 5LIOA 5KXXA 3KAMA 138LA 4H9HA 2BQNA 3B0OA 206LA 4PRUA 4L35A 1L18A 3KJ6A 3HTGA 1WQRA 3WUAA 4G71B 2ZNWY 4WL7A 4RLMA 1L28A 4J7VA 4H8XA 1IOQA 1L47A 153LA 1A2YC 182LA 5B35A 1C6JA 243LA 1C43A 1LJIA 3WPKA 5AHZA 5DN5A 1L09A 1VEDA 1JTOL 5I4YA 4MCKA 1DI5A 3RUNA 141LA 103LA 4YM8A 1HSXA 2LYZA 3A95A 1H6MA 4BV0A 2RB0X 228LA 3OK0A 2OEAX 4X3BA 1HFXA 4J0LA 1GXV2 1X0K1 3A34A 1S53A 1IP1A 3WMKA 3HTBA 255LA 1LHMA 1VGOA 1KMEA 3UTXA 4NHPA 197LA 4N1CC 1E12A 1JTPL 3W6BA 1GF4A 3CDOA 2DQEY 1L50A 5B6VA 5B2NA 170LA 1L07A 4I8SA 1L92A 1LTMA 3HU8A 2M3GA 1QUTA 4PPOA 3SBAA 2WJKA 1G7HC 1GFKA 118LA 1C69A 1B6IA 4JQ6A 2I20A 4OOTA 2YBIA 231LA 4GLVA 1GF6A 1SWZA 1IOCA 1XGRC 1G06A 3C8QA 4NHSA 2OTYX 1UIEA 123LA 2I25L 4WM2A 239LA 2A4TA 3HT7A 2NTGA 258LA 3CDVA 1OUHA 1HEPA 4CFOA 1L64A 3ZVQA 4AGAA 1LN6A 2I35A 3B0KA 232LA 4LYCA 2B6WA 1X0SA 4NGYA 1MGYA 1GFEA 1IP3A 113LA 2RAYX 4DWXA 4UWVA 3DN1A 4H9CA 1HZXA 2BQHA 1OUAA 1W08A 1YANA 5FEKA 4W96A 5DHHA 3CDQA 5H2OA 1B7OA 1HENA 1L21A 250LA 1YL0X 1V7TA 2MEGA 1LZRA 5LZMA 3WYHA 1B7RA 1LZ1A 1L66A 1IP5A 4L41A 190LA 4NSGA 2HEEA 1QTKA 1CKDA 1SX7A 1C6QA 1P7SA 3F6ZA 2Z6BA 4B4EA 2KSBA 2Z19A 5B6WA 4QRYA 5FJGA 4MD1A 5D5FA 2ZIKA 2IHLA 1IP4A 4KNFA 3B0IA 3VVKA 2YDGA 4GCCA 1LYGA 2B73A 1IOSA 4NY5A 3SP3A 4NFVA 3ZVQB 1LSGA 1CV4A 2DBTA 1TN5A 4G7SB 1JJ0A 5KKHA 1W6ZA 1L11A 1CX6A 3GUIA 5LA5A 3UG9A 146LA 1XJUA 1L03A 3W6CA 1C6CA 1XFPL 4EKRA 1BB5A 1HMLA 4BAPA 1L20A 1C10A 4GP4B 4NGWA 4BVNA 1KY1A 3ABWA 3WU9A 5I53A 2PC2A 1L70A 4HTQA 4WLDA 4GN3A 3MGWA 191LA 1OV7A 1J1OY 3DDLA 4IAPA 1JITA 1D3MA 4ML7A 3WPLA 5FSTA 129LA 4A4MA 5LVIA 1OUGA 194LA 4FAAB 2I21A 1L61A 4I7NA 4BS7A 1LZDA 5KXMA 2Z18A 1L49A 1GB9A 1LI3A 2BLXA 1L79A 3QY4A 5LA8A 1BRRA 4YX7C 2CGIA 1LJEA 1I6SA 3CSZA 2BRDA 4WM5A 2YDVA 5H2PA 187LA 1LZBA 1OYUA 223LA 1HERA 1PQDA 1BB4A 1KXYA 1B9OA 4DC4A 242LA 3IJVA 1BWIA 2X0AA 2DQJY 1C62A 4WLYA 4I7QA 1L94A 4NHIA 1BHZA 1IWWA 247LA 1LMQA 4TSBA 3QAPA 3LZ2A 1HFZA 1FBKA 1C7PA 9LYZA 4WAVA 2NTHA 4KPMA 1ZMYL 1LCNA 2Z73A 4FA7B 3OE0A 4X1HA 1NDGC 1T6VL 2YBMA 1DKKA 108LA 1C6EA 4J1BA 1OVKA 4K5YA 149LA 4RW1A 4JKVA 1L12A 1C6BA 1NHEA 4LDOA 5B05A 8LYZA 4DD2A 4I7KA 147LA 5G2DA 1L05A 4HP0A 3TXIA 1GEVA 3GUNA 1L08A 1FLUA 3RW8A 1CU3A 1JIYA 1M0LA 4W53A 3SB7A 1QT7A 1L87A 4XJIA 1JV7A 1OV5A 4LT0A 3A67Y 1P37A 185LA 3HTDA 1B2KA 3HWLA 1CU2A 3HBHA 3G3XA 4WOAA 1INUA 1G0LA 2DQGY 3HAQA 5LVKA 125LA 2DKVA 1G0PA 1KIQC 1T8AA 5H2NA 1LZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 102L A;  3L64 A;  3S3D B;  1L0M A;  150L A;  1L30 A;  3V2W A;  2IGC A;  3UZA A;  234L A;  1C6T A;  3PWH A;  1L82 A;  3OE9 A;  3PXO A;  233L A;  4EKP A;  2JAG A;  2NTU A;  4Y9H A;  1QTH A;  2LZM A;  3LZM A;  1L44 A;  1P8U A;  4ARM A;  4I7M A;  163L A;  1KS3 A;  1L33 A;  2Q9E A;  3C8S A;  1DZE A;  5AX1 A;  180L A;  3A7K A;  4BWB A;  1L75 A;  1GUE A;  111L A;  176L A;  3DNA A;  2B6X A;  3SB6 A;  4LDL A;  112L A;  3SBB C;  3C81 A;  235L A;  1QT5 A;  4ARP A;  148L E;  2R4R A;  1QSQ A;  1R84 A;  2F32 A;  3RZE A;  3X3C A;  3OAX A;  5ITE A;  3QAK A;  1IXF A;  3COD A;  1QHJ A;  3PDS A;  4I7S A;  1ZUR A;  5B6Z A;  2B70 A;  4NC3 A;  3OE6 A;  4MQS A;  1P3N A;  1QT8 A;  3JR6 A;  217L A;  2F93 A;  2YCW A;  251L A;  4GP5 B;  4GYC A;  1CTW A;  3C9L A;  2L78 A;  4LDE A;  1L42 A;  1VJM A;  4MD2 A;  115L A;  1L14 A;  252L A;  2B6T A;  120L A;  4OO9 A;  2B74 A;  4EJ4 A;  1L72 A;  1P8I A;  2YCZ A;  1P2L A;  248L A;  3EML A;  1S8L A;  1XJT A;  2F2Q A;  4W56 A;  2KS9 A;  3C8R A;  5F8U A;  1CUP A;  2OU0 X;  1L95 A;  1C6F A;  172L A;  3PQR A;  4HWL A;  4EPF A;  5G54 A;  1L60 A;  1LWG A;  4GRV A;  1DYC A;  1ZWN A;  1L02 A;  4IAR A;  3SN6 R;  1NHB A;  244L A;  1P56 A;  4ZPU A;  4DJH A;  3COC A;  1QT4 A;  1L10 A;  156L A;  1CWQ A;  2RBP A;  5G2C A;  1L01 A;  2Y00 A;  1L81 A;  3HH5 A;  5H2H A;  1L13 A;  2F95 A;  2LCB A;  130L A;  1T8G A;  4PK0 A;  2KSA A;  3HAR A;  1L57 A;  1LYE A;  5H2J A;  1AT9 A;  3S3B B;  3VG9 A;  3HDE A;  4G72 B;  3ZPR A;  1L40 A;  1C63 A;  1EPY A;  1L59 A;  171L A;  3AM6 A;  3VHZ A;  1L71 A;  1P36 A;  4BEZ A;  3D4S A;  3F9L A;  4W51 A;  3SB9 A;  1BRD A;  1L31 A;  1CU0 A;  1C6H A;  1SSY A;  1IW9 A;  126L A;  260L A;  1L34 A;  4PXK A;  1H2S A;  4EPI A;  1JTM A;  1C64 A;  1TLA A;  262L A;  1L63 A;  1C6L A;  3NS0 A;  2ZZL A;  2Z55 A;  5A8E A;  175L A;  4GP8 B;  4YXC A;  4E97 A;  2B6Z A;  1EHK B;  1CU5 A;  3QJT B;  4ARL A;  1L37 A;  1D3J A;  1QTV A;  3AYM A;  1C6N A;  1R2N A;  5BR2 A;  1G0G A;  2HPY A;  1CX7 A;  2HUL A;  1SX2 A;  3HAS A;  184L A;  138L A;  3QJS B;  229L A;  206L A;  2OU9 A;  1L91 A;  4L35 A;  4W52 A;  1C66 A;  1L18 A;  1LW9 A;  2RBN A;  3KJ6 A;  4QID A;  1QKO A;  3QJR B;  1QUH A;  210L A;  4I7R A;  2Q9D A;  122L A;  5G2A A;  4UG2 A;  5JJE A;  3HTG A;  4OV0 A;  2YDO A;  5JJN A;  4G71 B;  3K2R A;  155L A;  1LGU A;  1L28 A;  2OE9 X;  222L A;  2RBO A;  1L84 A;  1L47 A;  3HU9 A;  3V2Y A;  2B72 A;  3GUK A;  1QSB A;  3QJU B;  182L A;  1LYJ A;  4BUO A;  2Y04 A;  4X31 A;  5B35 A;  1C6J A;  243L A;  144L A;  1C6A A;  5AHZ A;  4XXJ A;  4S0W A;  2CUU A;  1L09 A;  199L A;  1CV6 A;  2F47 A;  2RBS A;  1JFP A;  3G3V A;  5LWE A;  1D3F A;  3NSB A;  4GBR A;  1XEP A;  198L A;  1L41 A;  3RUN A;  167L A;  3G3W A;  141L A;  3ODU A;  3QBG A;  1L04 A;  103L A;  4AMI A;  3SB8 A;  3DKE X;  3QBK A;  5G28 A;  3SB5 A;  1CV3 A;  1L77 A;  119L A;  3S8F B;  1L88 A;  215L A;  3HT8 A;  4HYX A;  4L6R A;  1L06 A;  3VGA A;  4BV0 A;  2RB0 X;  2B75 A;  1XJI A;  137L A;  1L97 A;  1L29 A;  4EKQ A;  228L A;  3FA0 A;  1CV5 A;  1DYD A;  3QDC A;  2OEA X;  2LC9 A;  1KW7 A;  1X0K 1;  2R4S A;  1S53 A;  2Y03 A;  1P5C A;  3HTB A;  145L A;  4EXM A;  1G0M A;  255L A;  1QUD A;  1VGO A;  1KME A;  3HTF A;  1QTD A;  1QUO A;  1TN0 A;  1DYA A;  3UTX A;  1L00 A;  1L17 A;  2L6X A;  197L A;  1E12 A;  4WW3 A;  1C3W A;  2ZFE A;  2OE7 X;  1QTC A;  143L A;  1L24 A;  3CDO A;  4PJZ A;  1DYG A;  3C80 A;  1L55 A;  211L A;  4TL3 A;  1P6Y A;  1O0A A;  1L50 A;  1KG8 A;  5B6V A;  5B2N A;  2OE4 X;  1OWY A;  4FPD A;  170L A;  3RFM A;  205L A;  3HAO A;  246L A;  1L07 A;  254L A;  1L92 A;  3HAP A;  4W59 A;  5AZD A;  1L22 A;  1FBB A;  3L2X A;  109L A;  1G07 A;  3EH5 B;  1L98 A;  1CUQ A;  4XTN A;  209L A;  3HU8 A;  3GUJ A;  3PBL A;  2M3G A;  3SBA A;  1KY0 A;  1F50 A;  2WJK A;  139L A;  2ZIY A;  4JR8 A;  4I7P A;  118L A;  226L A;  3DN3 A;  1C69 A;  4AQN A;  249L A;  1B6I A;  1C60 A;  1C68 A;  2RAZ X;  4JQ6 A;  2I20 A;  4PXF A;  1LYF A;  1D3N A;  231L A;  1L46 A;  1SWZ A;  3EH4 B;  177L A;  2OU8 A;  1PQO A;  1G06 A;  216L A;  2HUK A;  2OTY X;  3C8Q A;  4ARM B;  2YCY A;  181L A;  123L A;  1BM1 A;  1L89 A;  239L A;  1L86 A;  1L39 A;  2A4T A;  3HT7 A;  2NTG A;  4XT1 A;  258L A;  2RH1 A;  3CDV A;  5B34 A;  3WQJ A;  1T8F A;  2J4Y A;  5ETZ A;  3REY A;  107L A;  4W57 A;  1LI2 A;  241L A;  4W55 A;  1L64 A;  2JAF A;  2B6Y A;  2QAR C;  1LN6 A;  1G1V A;  2I35 A;  1G0K A;  4BEY A;  1L85 A;  232L A;  3C7W A;  3QBL A;  1L26 A;  151L A;  2B6W A;  1X0S A;  1C67 A;  3UTV A;  1G1W A;  1MGY A;  1L90 A;  113L A;  2RAY X;  3HUA A;  159L A;  196L A;  212L A;  3DN1 A;  5A44 A;  1L15 A;  2O79 A;  1HZX A;  1XME B;  3VW7 A;  188L A;  173L A;  178L A;  1L93 A;  230L A;  3HUK A;  1ZYT A;  3DN2 A;  4LZM A;  2X72 A;  5DHH A;  1QM8 A;  5H2K A;  1DYB A;  5EN0 A;  3CDQ A;  1OVJ A;  2Y01 A;  5AWZ A;  3DN6 A;  1L21 A;  250L A;  5H2O A;  2PED A;  1LYH A;  4ARQ A;  221L A;  4DAJ A;  1L96 A;  220L A;  5LZM A;  2RB2 X;  1C61 A;  4G70 B;  1L66 A;  140L A;  1C6P A;  190L A;  3DN4 A;  2HUM A;  1SX7 A;  1CU6 A;  1C6Q A;  238L A;  1L16 A;  1P7S A;  2Z6B A;  2RBR A;  2KSB A;  2QPD B;  1CV1 A;  1L80 A;  3CDT A;  174L A;  3DMZ A;  4UHR A;  1L38 A;  5TGZ A;  5B6W A;  4QRY A;  128L A;  1C8S A;  5FJG A;  4G7R B;  1LLH A;  1G0Q A;  3DQB A;  2O4W A;  4MD1 A;  1D2W A;  5B0W A;  3GUL A;  1QKP A;  4KNF A;  4I7L A;  3VVK A;  1LYG A;  2B73 A;  240L A;  4GPO A;  4I7O A;  5DHG A;  1UAZ A;  1S52 A;  4G7Q B;  1CV4 A;  1LYD A;  1LI6 A;  1TN5 A;  4G7S B;  1OVH A;  5JJJ A;  3AYN A;  5KKH A;  186L A;  160L A;  1JGJ A;  213L A;  236L A;  1L11 A;  1CX6 A;  4FBZ A;  1LPY A;  3C7Z A;  3GUI A;  3UG9 A;  2QPE B;  146L A;  1L62 A;  1XJU A;  1L03 A;  1P8H A;  1C6C A;  192L A;  3S3C B;  165L A;  1G0J A;  4EKR A;  1S51 A;  1UCQ A;  2NTW A;  5G36 A;  1L69 A;  1QTB A;  5BR5 A;  1L36 A;  3C9M A;  1L20 A;  1L58 A;  4GP4 B;  1X0I 1;  1PQI A;  4BVN A;  1KY1 A;  3ABW A;  1L83 A;  1Q5J A;  4KLY A;  3QJV B;  257L A;  3CDR A;  166L A;  5B6Y A;  5AX0 A;  4J4Q A;  4QI1 A;  1PXS A;  1D2Y A;  3P0G A;  195L A;  5AHY A;  1GU8 A;  1QS5 A;  1L70 A;  1L67 A;  1C6K A;  3OE8 A;  1L19 A;  1PQM A;  191L A;  1OV7 A;  3DDL A;  2KSY A;  4IAP A;  1H68 A;  1D3M A;  1C65 A;  110L A;  1P46 A;  3GUM A;  1L23 A;  3EH3 B;  3X3B A;  1QT6 A;  2ANV A;  1L76 A;  129L A;  3ZPQ A;  4EIY A;  4A4M A;  4DKL A;  7LZM A;  3VI0 A;  1C6D A;  3HT9 A;  1C6G A;  2Y02 A;  1P2R A;  3QBI A;  2B7X A;  4FAA B;  261L A;  2I21 A;  1L61 A;  4I7N A;  1XIO A;  4MBS A;  158L A;  4GBR B;  3CAP A;  1SWY A;  3HAN A;  2QB0 B;  1L49 A;  1SSW A;  1LI3 A;  2LNL A;  4W54 A;  1L27 A;  1S8J A;  1D9W A;  3UTW A;  1L25 A;  1L79 A;  1L35 A;  1L53 A;  1BRR A;  1DYE A;  2VT4 A;  245L A;  214L A;  4YX7 C;  1PY6 A;  1L43 A;  1E0P A;  3BVD B;  1KNI A;  3T45 A;  1I6S A;  3DMV A;  2BRD A;  1S54 A;  259L A;  1M0M A;  2YDV A;  104L A;  187L A;  169L A;  1LYI A;  1OYU A;  5H2P A;  2O7A A;  223L A;  3HH3 A;  1PQD A;  1P64 A;  3UZC A;  4EA3 A;  4IAQ A;  4N4Y B;  4IB4 A;  3UON A;  2WJL A;  219L A;  1L51 A;  1QS9 A;  5J7A A;  227L A;  1L52 A;  242L A;  3HT6 A;  4AMJ A;  4XTO A;  1U19 A;  168L A;  1C62 A;  4EKS A;  1CVK A;  3HDF A;  3C82 A;  2RB1 X;  4I7Q A;  1L45 A;  2YCX A;  1L54 A;  1L94 A;  164L A;  253L A;  4W58 A;  5H2M A;  1IW6 A;  1KW5 A;  189L A;  3C7Y A;  2AT9 A;  225L A;  3GUO A;  218L A;  5C1M A;  2I1X A;  1OWZ A;  247L A;  1QT3 A;  2ANX A;  3QAP A;  3NY8 A;  3S8G B;  1FBK A;  4N6H A;  5I14 A;  4WAV A;  1T6H A;  5H2L A;  161L A;  2NTH A;  1CV0 A;  4MQT A;  4N4W A;  1L65 A;  2Z73 A;  1DYF A;  3NY9 A;  4FA7 B;  237L A;  1C8R A;  3OE0 A;  1PQK A;  1GZM A;  1L0K A;  1QTZ A;  4X1H A;  1L74 A;  4YXA C;  1L9H A;  1L68 A;  3MBV A;  108L A;  1C6E A;  5B6X A;  1M0K A;  1OVK A;  200L A;  1C6M A;  4K5Y A;  149L A;  201L A;  4XT3 A;  1Q5I A;  4JKV A;  1L12 A;  6LZM A;  1C6B A;  4X32 A;  1PQJ A;  1L0J A;  4LDO A;  183L A;  5ITC A;  3QJQ B;  5H2I A;  4I7K A;  3C83 A;  1KGB A;  147L A;  5G2D A;  1L05 A;  3DN0 A;  3HH4 A;  157L A;  4I7T A;  142L A;  162L A;  1K28 A;  3GUN A;  3HH6 A;  3ZEV A;  1L08 A;  3UTY A;  4I7J A;  1CU3 A;  2RBQ A;  3NYA A;  1L48 A;  1M0L A;  4W53 A;  3F8V A;  1L99 A;  3SB7 A;  1QT7 A;  224L A;  1KG9 A;  1L87 A;  1JQU A;  1T97 A;  131L A;  5A45 A;  1L56 A;  1JV7 A;  5G53 A;  1OV5 A;  2OTZ X;  3GUP A;  5DYS A;  127L A;  1P37 A;  1WTH A;  1QUG A;  1BRX A;  1JV6 A;  1L73 A;  185L A;  3HTD A;  4XTL A;  1LGW A;  3HWL A;  1CU2 A;  2EI4 A;  4HYJ A;  114L A;  3DN8 A;  1C6I A;  3G3X A;  3FI5 A;  1G0L A;  1LGX A;  3HUQ A;  1PXR A;  1L32 A;  1LWK A;  256L A;  1JTN A;  3FAD A;  4ARQ B;  1F4Z A;  3HAQ A;  3DMX A;  152L A;  1AP9 A;  1F88 A;  125L A;  2G87 A;  1G0P A;  1T8A A;  5H2N A;  4ARJ A; 
#chains in the Genus database with same CATH topology
 1L0M A;  150L A;  2FYC A;  4PGJ B;  4HJZ A;  4EKP A;  2G4N A;  1L44 A;  3RNX A;  4H9A A;  2Q9E A;  3A90 A;  1DZE A;  1OUF A;  1LMA A;  2MEC A;  3A7K A;  4BWB A;  5LVH A;  1GUE A;  111L A;  1C08 C;  3RT5 X;  3SB6 A;  2HEC A;  112L A;  3WW6 A;  3EO5 A;  3SBB C;  1IOR A;  3C81 A;  6LYT A;  1EQE A;  1OUB A;  148L E;  1CJ9 A;  1QHJ A;  4I7S A;  5LIN A;  1RFP A;  1QT8 A;  3JR6 A;  217L A;  1N4F A;  2YCW A;  251L A;  1B7P A;  4GYC A;  3C9L A;  4LDE A;  2B6T A;  1L14 A;  4EJ4 A;  4TWS A;  4H90 A;  1LZS A;  3CSQ A;  2LYO A;  5LYM A;  2KS9 A;  2F2Q A;  4W56 A;  3C8R A;  1CUP A;  2OU0 X;  1L95 A;  1GWD A;  1C6F A;  1YAO A;  4HWL A;  5G54 A;  1L60 A;  1GBS A;  1J1X Y;  1GE3 A;  1NHB A;  3COC A;  1QT4 A;  4DT3 A;  1LZ4 A;  1NKH A;  2DQI Y;  3ULR A;  5H2H A;  3W6A A;  2F95 A;  2D4K A;  1NWG A;  2LCB A;  130L A;  1LJJ A;  3HAR A;  1XGT C;  1LYE A;  5KXO A;  3HDE A;  4G72 B;  3AZ5 A;  3P68 A;  1L71 A;  1LAA A;  3F9L A;  3SB9 A;  5APC A;  1C6H A;  2LHM A;  3AW7 A;  5L3H A;  262L A;  1C6L A;  2ZZL A;  2Z55 A;  2Z38 A;  1B7S A;  4WM1 A;  4YXC A;  1CU5 A;  1QDT A;  1D0L A;  1SX2 A;  229L A;  1UC0 A;  1GB0 A;  3QJR B;  5JJE A;  122L A;  4UG2 A;  3T6U A;  1GFR A;  4GCF A;  4HPE A;  4EOF A;  222L A;  3WL2 A;  3OJP A;  1L84 A;  1GXX A;  5KXY A;  3HU9 A;  1GE1 A;  4HJY A;  2ZYP A;  1G7L C;  4DD1 A;  3TXH A;  2W1X A;  4DQJ A;  1C6A A;  1AKI A;  1G7M C;  4XXJ A;  1NMM A;  2CUU A;  1DXJ A;  2F47 A;  4E3U A;  2RBS A;  5LWE A;  4WM6 A;  1BVK C;  3NSB A;  4GBR A;  198L A;  1B5X A;  167L A;  3G3W A;  3ODU A;  1TBY A;  3SB8 A;  3QBK A;  4IJ4 A;  3SB5 A;  1L77 A;  119L A;  5FHW A;  1GF9 A;  1YAP A;  1L06 A;  3VGA A;  4CFP A;  4EKQ A;  1QSW A;  1CV5 A;  4WMG A;  5DL9 A;  1KW7 A;  4NGK A;  2Y03 A;  145L A;  3W3E A;  1QSA A;  1QUD A;  1GFV A;  1HEM A;  1QUO A;  1DYA A;  1GAZ A;  1CJ7 A;  1C3W A;  1B5V A;  4PJZ A;  1DYG A;  4TL3 A;  211L A;  1P6Y A;  1KG8 A;  2OE4 X;  205L A;  1E8L A;  246L A;  254L A;  4GLA A;  4W59 A;  3L2X A;  4LZT A;  3EH5 B;  4TUN A;  1D6P A;  4ETA A;  3PBL A;  1YIL A;  5F81 A;  1AT5 A;  1LJH A;  1IWU A;  1C60 A;  2MEB A;  4H8Z A;  4PXF A;  4MST A;  1D3N A;  177L A;  2OU8 A;  5KXN A;  1LMN A;  1L89 A;  3W6F A;  4NWE A;  2Z2E A;  5B34 A;  4LYT A;  2Z37 A;  2J4Y A;  107L A;  1LSE A;  2C8P A;  2ZNX Y;  1FKV A;  1LZA A;  2B6Y A;  1G1V A;  2QAR C;  1G0K A;  4BEY A;  1L26 A;  1L90 A;  1HF4 A;  3HFM Y;  196L A;  5A44 A;  1L15 A;  2O79 A;  1A4V A;  3TXD A;  2XTH A;  178L A;  4M4O A;  4XJF A;  3A93 A;  2W1L A;  3N9C A;  5EN0 A;  3DN6 A;  3P4Z A;  1LYH A;  5APD A;  4ARQ A;  5K7O A;  220L A;  4G70 B;  2Z12 A;  1IWT A;  1BGI A;  3DN4 A;  4XYY A;  4H94 A;  5KXZ A;  4NHQ A;  1IWV A;  1L16 A;  1YKY X;  2QPD B;  1CV1 A;  1B5Z A;  3CDT A;  174L A;  4HJV A;  1C8S A;  4G4B A;  3DQB A;  2O4W A;  4HPI A;  2FBD A;  3GUL A;  1LZY A;  4KT3 A;  4NIJ A;  5F9U A;  5DHG A;  1IR8 A;  1UID A;  4LT3 A;  5JJJ A;  4NSI A;  3AYN A;  2HU3 A;  1UA6 Y;  1GDX A;  160L A;  3QE8 A;  4N8Z A;  1HEW A;  4OWA A;  1B5W A;  1KXX A;  3S3C B;  1UCQ A;  1QTB A;  5BR5 A;  1JKB A;  1L36 A;  1YKX X;  3C9M A;  1GE0 A;  1L58 A;  1L83 A;  1Q5J A;  5B6Y A;  3CDR A;  166L A;  1JEF A;  1LYZ A;  4QI1 A;  2H9K A;  5AHY A;  1QS5 A;  3LYT A;  1HHL A;  3OE8 A;  3WXT A;  4CJ2 A;  1PQM A;  3TXB A;  1XEI A;  4U3X B;  110L A;  1TAY A;  1P46 A;  3GUM A;  3EH3 B;  1LSA A;  2YBL A;  1QT6 A;  3ZPQ A;  5KXT A;  3P65 A;  1IY3 A;  3VI0 A;  4ANR A;  1C6D A;  3HT9 A;  1XGP C;  1WQP A;  2B7X A;  4DD3 A;  5C6I A;  3CAP A;  4DYG A;  3T36 A;  2LNL A;  3LZT A;  1LHK A;  4W54 A;  1L25 A;  2GV0 A;  1CKC A;  1L35 A;  1L53 A;  4G4C A;  5LVG A;  1DYE A;  3J6K A;  245L A;  3CB7 A;  1PY6 A;  1L43 A;  3B6L A;  5KXP A;  5HNC A;  3BVD B;  3AGH A;  3T45 A;  3DMV A;  1IX0 A;  1S54 A;  1M0M A;  135L A;  1F10 A;  2O7A A;  4IAQ A;  3UON A;  2EKS C;  1REZ A;  227L A;  4GCD A;  3TXJ A;  1L52 A;  1DI4 A;  1GBX A;  1GEZ A;  1LKR A;  4AMJ A;  1JIS A;  1GBY A;  1GB3 A;  168L A;  5KKI A;  1UCO A;  3C82 A;  1L45 A;  1YQV Y;  4BAD A;  2AT9 A;  3GUO A;  218L A;  4RDS A;  1QT3 A;  3NY8 A;  4N5R A;  2BPU A;  1FBI X;  4N6H A;  5I14 A;  5I4X A;  5I5Q A;  3ATO A;  5E9R A;  4MQT A;  4N4W A;  1DYF A;  4AXT A;  1REY A;  5B6X A;  1LSP A;  1WVU A;  1M0K A;  2N5Z A;  200L A;  4Z41 A;  4XT3 A;  3CQL A;  4HSF A;  1PQJ A;  2VB1 A;  4QEQ A;  5LYT A;  3C83 A;  4OOO A;  1JKC A;  1BWH A;  1AT6 A;  4ETB A;  4HTN A;  3HH6 A;  1JTT L;  3AGI A;  1D6Q A;  2RBQ A;  2RSC A;  4J1A A;  3F8V A;  2LYM A;  1GFH A;  1T97 A;  131L A;  5A45 A;  1IP7 A;  2OTZ X;  3GUP A;  5L9J A;  1L73 A;  3A94 A;  1FLY A;  1BQL Y;  4XTL A;  1LGW A;  2EI4 A;  3DN8 A;  1LGX A;  3HUQ A;  1PXR A;  1LWK A;  1LHI A;  1JTN A;  3WU7 A;  1F4Z A;  1AP9 A;  1F88 A;  2G87 A;  1UIG A;  4PHI A;  4ARJ A;  1QM8 A;  2ZYC A;  1WQM A;  3S3D B;  1GB2 A;  1L30 A;  2IGC A;  3UZA A;  234L A;  1C6T A;  5L3I A;  1QTH A;  2LZM A;  1LJF A;  3LZM A;  4ARM A;  5C6J A;  1I20 A;  1KS3 A;  1L33 A;  1QUS A;  3C8S A;  1LJG A;  5AX1 A;  1IWY A;  3WW5 A;  4QDN A;  2HTX A;  1L75 A;  4H9E A;  1GF0 A;  1TEW A;  176L A;  5ILF A;  2B6X A;  4ZEE A;  1QT5 A;  4ARP A;  1LZG A;  1R84 A;  3GXK A;  5J7C A;  3COD A;  2BQE A;  1ZUR A;  2B70 A;  4NC3 A;  4DD0 A;  4DD9 A;  1JJ1 A;  3WXU A;  4MQS A;  3P66 A;  1EQ5 A;  1CTW A;  2L78 A;  4XJG A;  1L42 A;  1VJM A;  3EBA B;  252L A;  3A6B Y;  4OO9 A;  1P8I A;  4LYB A;  1P2L A;  1S8L A;  1JKD A;  1YAM A;  1D0M A;  5F8U A;  3EMS A;  134L A;  2D6B A;  2A7D A;  2BQI A;  1LJ3 A;  193L A;  4ZPU A;  1IEE A;  3LYM A;  2RBP A;  1L81 A;  3RU5 A;  1L13 A;  4OWH A;  3TMW A;  5I4W A;  2KSA A;  3GXR A;  5H2J A;  2EQL A;  3VG9 A;  3ZPR A;  1L40 A;  1IP2 A;  1EPY A;  1L59 A;  4XAD A;  1ZV5 L;  3AM6 A;  4BEZ A;  1P36 A;  1AM7 A;  4W51 A;  2H9J A;  1SSY A;  3CT5 A;  1L34 A;  4NG8 A;  4OWB A;  2MEH A;  5FEL A;  4QGZ A;  2ZWB A;  4NG1 A;  175L A;  4GP8 B;  4XN6 A;  1LHL A;  1L37 A;  1GF7 A;  1JJ3 A;  2HPY A;  1UIF A;  1CX7 A;  2HUL A;  184L A;  1L91 A;  1C66 A;  1LW9 A;  1QKO A;  3HBD A;  1RCM A;  5DLA A;  5G2A A;  1JSE A;  7LYZ A;  132L A;  4OV0 A;  5JJN A;  2YBN A;  4YOP A;  1V7S A;  1TCY A;  2BQJ A;  2B72 A;  1RI8 B;  2BQG A;  4XJB A;  1LYJ A;  2Y04 A;  4X31 A;  4NEB A;  4S0W A;  1G7I C;  3K3T A;  1CV6 A;  3W6D A;  3G3V A;  1F6S A;  1JHL A;  1PS5 A;  2F2N A;  5IEL A;  1LMC A;  4B4J A;  4D9Z A;  3QBG A;  3DKE X;  4W94 A;  1LSD A;  1CV3 A;  3S8F B;  1L88 A;  3HT8 A;  4HYX A;  4L6R A;  2B75 A;  137L A;  1L97 A;  1IY4 A;  1L29 A;  3FA0 A;  3G3B B;  2HEF A;  4ET8 A;  2G4P A;  2R4S A;  1LHH A;  1Z55 A;  4OW1 A;  1G0M A;  1VDT A;  1TN0 A;  1HNL A;  4CHX A;  2L6X A;  4NGJ A;  1QTC A;  5HLL A;  1L24 A;  3C80 A;  4BAF A;  4FPD A;  3RFM A;  4ZIX A;  3HAO A;  1HSW A;  3HAP A;  5AZD A;  1G07 A;  1KXW A;  1XGU C;  1MLC E;  2H5Z A;  3A96 A;  1KY0 A;  1F50 A;  139L A;  2ZIY A;  4NSH A;  4LT2 A;  3DN3 A;  3A8Z A;  249L A;  2RAZ X;  1JWR A;  1IIZ A;  4O34 A;  5D5C A;  2DQA A;  1L46 A;  1UIB A;  1HEQ A;  1PQO A;  216L A;  2YCY A;  1BM1 A;  1L39 A;  4ZFP A;  4XT1 A;  5ETZ A;  3REY A;  3TXG A;  241L A;  2JAF A;  1IWZ A;  1QTE A;  1HEO A;  1HC0 A;  3QBL A;  1BB3 A;  151L A;  1GPQ C;  3UTV A;  1G1W A;  1GDW A;  3HUA A;  159L A;  5M1Y A;  1LZT A;  1XME B;  2YSS C;  173L A;  1L93 A;  5KY1 A;  3HUK A;  6LYZ A;  3DN2 A;  4LZM A;  2I6Z A;  4PRQ A;  4Z98 A;  1GBW A;  5AWZ A;  1OVJ A;  2Y01 A;  1XEJ A;  4NGO A;  2PED A;  4EMN A;  4DAJ A;  1L96 A;  1C61 A;  3N9A A;  4LYO A;  4G4H A;  140L A;  2HED A;  2MEF A;  238L A;  2A7F A;  4WL6 A;  2RBR A;  4DD7 A;  2C8O A;  1L80 A;  3AZ6 A;  3DMZ A;  1L38 A;  3CSR A;  128L A;  1LLH A;  1G0Q A;  1D2W A;  4IAS A;  2BQF A;  4GN5 C;  1YKZ X;  4XJH A;  5ILC A;  1OUE A;  240L A;  4GPO A;  1AZF A;  1S52 A;  4G7Q B;  3AYQ A;  4NWH A;  5B07 A;  5B59 A;  2Q0M X;  236L A;  3IWR A;  3A91 A;  2XJW A;  1L62 A;  1P8H A;  3B72 A;  192L A;  1KIP C;  2MEE A;  165L A;  154L A;  2NTW A;  5G36 A;  1L69 A;  2BAA A;  4ETC A;  2FBB A;  4GCE A;  4H93 A;  5AX0 A;  2BQK A;  3A92 A;  1J1P Y;  1PXS A;  4DQ7 A;  3P0G A;  1LSB A;  1L67 A;  1D9U A;  4N0J A;  2KSY A;  1B7M A;  1LSZ A;  1L23 A;  1LYY A;  3X3B A;  1NBZ C;  1L76 A;  1DI3 A;  4EIY A;  4DKL A;  1LSN A;  1CJ8 A;  3TMX A;  4HV1 A;  2Y02 A;  3QBI A;  2BQL A;  4GBR B;  5LYZ A;  3D9A C;  1SSW A;  1LSY A;  4LYM A;  1L27 A;  1S8J A;  5LXW A;  1VDS A;  4H9B A;  2VT4 A;  1OUC A;  3LN2 A;  3TXK A;  2CDS A;  1C46 A;  1BWJ A;  169L A;  1G7J C;  1P64 A;  4H91 A;  4EA3 A;  1QDR A;  4N4Y B;  4IB4 A;  2WJL A;  219L A;  5J7A A;  1OUI A;  3CT1 A;  2FYD A;  5II3 A;  4XTO A;  1U19 A;  4EKS A;  1CVK A;  1IO5 A;  3HDF A;  4B0D A;  4GCB A;  1KW5 A;  4IAT A;  4FDY A;  5C1M A;  5B1F A;  1DKJ A;  1YRO A;  1DZB X;  2D4I A;  1T6H A;  5H2L A;  161L A;  1LSC A;  3NY9 A;  4G49 A;  237L A;  1LZN A;  5DM9 A;  1PQK A;  1GZM A;  1FKQ A;  1QIO A;  1L74 A;  1ZVY B;  1L68 A;  5C6L A;  5LVJ A;  1GE2 A;  3LYZ A;  1EQ4 A;  1VAT A;  3QJQ B;  2YVB A;  5H2I A;  1KGB A;  3TMV A;  4I7T A;  142L A;  1K28 A;  5JEN B;  3ZEV A;  3UTY A;  1IWX A;  4I7J A;  3NYA A;  1GHL A;  1L99 A;  2ZQ3 A;  1JQU A;  1NF5 A;  1HFY A;  207L A;  1L56 A;  1NDM C;  3AGG G;  4FJR A;  4WO6 A;  1ZVH L;  1JV6 A;  1XEK A;  1YL1 X;  208L A;  4N1E I;  114L A;  2HEA A;  3FI5 A;  3N9E A;  1L32 A;  1SQ2 L;  256L A;  2BQD A;  4ARQ B;  2F30 A;  152L A;  1LZ6 A;  5IHG A;  3ZEK A;  3HBE X;  102L A;  3L64 A;  1CKF A;  4WM3 A;  233L A;  2JAG A;  5HMV A;  5F9X A;  2NTU A;  1FLW A;  163L A;  4Z3M A;  2D91 A;  1XSF A;  4C5F A;  1XGQ C;  3DNA A;  2R4R A;  4HV2 A;  3RZE A;  3X3C A;  2W1M A;  3OAX A;  4CGE A;  5ITE A;  1IXF A;  3TMU A;  5F16 A;  1GF5 A;  1P3N A;  1GF8 A;  1LMT A;  1WVV A;  4MD2 A;  115L A;  2B74 A;  2YCZ A;  1L72 A;  1GB6 A;  248L A;  3EML A;  1XJT A;  1UIA A;  3A3R X;  1H87 A;  1PZY A;  172L A;  4EPF A;  2ZIL A;  1LWG A;  4GRV A;  1ZWN A;  1FN5 A;  2B5Z A;  3AW6 A;  4H92 A;  3SN6 R;  244L A;  5HNL A;  1F0W A;  4TTD A;  1L10 A;  1LZ8 A;  1UUZ C;  4NGV A;  5G2C A;  3HH5 A;  1T8G A;  4PK0 A;  5KXL A;  2W1Y A;  2LZT A;  4UWU A;  171L A;  1LOZ A;  1WQO A;  3BKH A;  3D4S A;  1L31 A;  4P2E A;  1LMP A;  4PXK A;  1H2S A;  4EPI A;  5KKJ A;  1LHJ A;  1C64 A;  3AZ7 A;  1TLA A;  4H9F A;  1L63 A;  2EIZ C;  5A8E A;  2YBJ A;  4E97 A;  2B6Z A;  4TSC A;  1QTV A;  1C6N A;  5BR2 A;  1G0G A;  1GF3 A;  133L A;  3HAS A;  3QJS B;  2XBS A;  3TXE A;  1B5U A;  1BVX A;  1VFB C;  2OU9 A;  4LFX A;  4W52 A;  5A3E A;  1CKG A;  2RBN A;  4QID A;  1QUH A;  4XJD A;  1IVM A;  210L A;  4I7R A;  2Q9D A;  4B1A A;  4DDA A;  4DQ5 A;  2YDO A;  3K2R A;  155L A;  2XBR A;  3A6C Y;  1LGU A;  2OE9 X;  2RBO A;  4WLX A;  3V2Y A;  3GUK A;  2MEI A;  1QSB A;  4DS7 E;  3QJU B;  4BUO A;  1UAC Y;  144L A;  2BQC A;  3G3A B;  2CWI A;  199L A;  3E3D A;  1JFP A;  5B06 A;  1D3F A;  1LYS A;  1XEP A;  1L41 A;  3VWO A;  3AZ4 A;  1L04 A;  4AMI A;  4QY9 A;  5G28 A;  3A3Q A;  215L A;  1XJI A;  4I0C A;  1DQJ C;  1DYD A;  3QDC A;  2LC9 A;  3LHM A;  1P5C A;  3P64 A;  4EXM A;  3HTF A;  1QTD A;  4NSJ A;  1L00 A;  1L17 A;  4WW3 A;  2ZFE A;  2OE7 X;  4YF2 A;  143L A;  1L55 A;  1I1Z A;  1O0A A;  1OWY A;  1UBZ A;  1WQQ A;  3CT0 A;  4GN4 A;  1L22 A;  1FBB A;  4NGL A;  109L A;  1IC4 Y;  4RLN A;  1L98 A;  1CUQ A;  4XTN A;  209L A;  4KL7 A;  5E4P A;  3GUJ A;  4XEN A;  4JR8 A;  4I7P A;  226L A;  4AQN A;  4WM4 A;  1C68 A;  3M18 B;  2WAR A;  5LAF A;  1LYF A;  3EH4 B;  4Z46 A;  4DDB A;  3D3D A;  2HUK A;  4ARM B;  1VDP A;  2G4Q A;  181L A;  4LFP A;  2CJL A;  1L86 A;  3J4G A;  3WH1 A;  2HU1 A;  3WQJ A;  2RH1 A;  1B7N A;  1T8F A;  4W57 A;  1LI2 A;  4W55 A;  5HQ1 A;  3WU8 A;  1NBY C;  4B4I A;  1L85 A;  3C7W A;  1C67 A;  4DDC A;  212L A;  3RZ4 A;  4WO9 A;  3VW7 A;  1GFG A;  3TXF A;  188L A;  230L A;  3WVY A;  4KXI A;  1ZYT A;  2X72 A;  4YEO A;  1WQN A;  1RE2 A;  1DYB A;  5H2K A;  1C45 A;  3WUM A;  5DN4 A;  1I56 A;  221L A;  2BQO A;  2RB2 X;  1OUD A;  1GB7 A;  1C6P A;  4M6D A;  2HUM A;  1JPO A;  1CU6 A;  1GB8 A;  2LZ2 A;  2EPE A;  4UHR A;  5TGZ A;  4ETE A;  3BKV A;  4G7R B;  5B0W A;  1P2C C;  2BQM A;  5HMJ A;  1QKP A;  4I7L A;  5I54 A;  1FLQ A;  5T3F A;  5KXR A;  4I7O A;  1GB5 A;  1LJ4 A;  1UAZ A;  1LYD A;  1LI6 A;  1OVH A;  1KIR C;  5KXW A;  4G9S A;  186L A;  1JGJ A;  213L A;  4R0F A;  3ATN A;  4WLT A;  5APE A;  1GFJ A;  4FBZ A;  1LPY A;  3C7Z A;  2QPE B;  4LYZ A;  1G0J A;  1S51 A;  2Y8P A;  1LMO A;  1JUG A;  4C3W A;  4UWN A;  4NHT A;  1OP9 B;  1X0I 1;  1B7L A;  2HUB A;  1LYO A;  1PQI A;  4KLY A;  3QJV B;  1LPI A;  257L A;  4J4Q A;  3EXD A;  1WTM A;  1D2Y A;  195L A;  1LZ9 A;  1LZ5 A;  1GU8 A;  1F6R A;  2XQO A;  1C6K A;  1L19 A;  1HMK A;  2HEB A;  3W6E A;  1UIC A;  1H68 A;  4A7D A;  1C65 A;  1IC7 Y;  1D0K A;  1JKA A;  5EBH A;  2ANV A;  1IC5 Y;  4OWE A;  7LZM A;  5B1G A;  1C6G A;  1P2R A;  261L A;  1IOT A;  1LJK A;  2MEA A;  1XIO A;  4MBS A;  158L A;  1LSM A;  4N9R A;  1SWY A;  5FDJ A;  3HAN A;  2QB0 B;  1YIK A;  1OUJ A;  1D9W A;  3UTW A;  1CJ6 A;  214L A;  1REX A;  1E0P A;  1KNI A;  4YEM A;  1GBZ A;  1SLY A;  259L A;  104L A;  1LYI A;  4H1P A;  3HH3 A;  3UZC A;  1BB6 A;  3M3U A;  1LJN A;  1GE4 A;  1LKS A;  1L51 A;  1QS9 A;  4YEN A;  1NQI A;  3HT6 A;  5IDD A;  1REM A;  3FI7 A;  2RB1 X;  2YCX A;  1L54 A;  4H9I A;  3WVX A;  164L A;  253L A;  4W58 A;  5H2M A;  1IW6 A;  189L A;  3C7Y A;  225L A;  3LYO A;  2I1X A;  1OWZ A;  2ANX A;  4HTK A;  3S8G B;  4OWC A;  3WPJ A;  2NWD X;  3QNG A;  1IP6 A;  1CV0 A;  1L65 A;  2ZQ4 A;  3WUN A;  1C8R A;  2DQH Y;  1GBO A;  1L0K A;  1QTZ A;  3WUL A;  4YXA C;  1L9H A;  3MBV A;  4NGI A;  1C6M A;  1RJC B;  201L A;  5KJ9 A;  1Q5I A;  6LZM A;  4X32 A;  1L0J A;  183L A;  5ITC A;  2IFF Y;  4ET9 A;  3DN0 A;  2D4J A;  3HH4 A;  157L A;  162L A;  2BQA A;  1L48 A;  2DQD Y;  224L A;  1KG9 A;  1DPX A;  5APF A;  5G53 A;  4TX7 A;  5DYS A;  127L A;  1WTH A;  1QUG A;  1BRX A;  5LAG A;  1T3P A;  4WG1 A;  4HYJ A;  1C6I A;  2F4A A;  2DQC Y;  2AUB A;  1TDY A;  1GFT A;  1ALC A;  3FAD A;  3DMX A;  3FE0 A;  4II8 A;  3V2W A;  3PWH A;  1L82 A;  3OE9 A;  4RW2 A;  3PXO A;  1HEL A;  4Y9H A;  1P8U A;  4I7M A;  1B7Q A;  180L A;  1IR7 A;  2MED A;  4ETD A;  1FDL Y;  4B49 A;  2I26 L;  4LDL A;  1QQY A;  1B5Y A;  1CKH A;  1MEL L;  235L A;  1QSQ A;  2F32 A;  5F14 A;  4LGK A;  3QAK A;  1O23 A;  3PDS A;  5B6Z A;  1GFA A;  2F4G A;  5KXS A;  3OE6 A;  3AJN A;  4R6C A;  2BLY A;  2F93 A;  4GP5 B;  1LSF A;  4MR1 A;  120L A;  4LT1 A;  1BB7 A;  1YAQ A;  1DPW A;  1WTN A;  1GD6 A;  4WG7 A;  1JSF A;  3PQR A;  1IR9 A;  1DYC A;  5FCP A;  1GFU A;  1L02 A;  4IAR A;  4DJH A;  1P56 A;  2YBH A;  4H8Y A;  1UIH A;  156L A;  1CWQ A;  3IJU A;  1L01 A;  2Y00 A;  5A3Z A;  2Z2F A;  1VAU A;  1OQM A;  1L57 A;  1AT9 A;  3S3B B;  5AMY A;  1C63 A;  2ZIJ A;  3VHZ A;  1VDQ A;  1GAY A;  1BRD A;  1CU0 A;  1IW9 A;  126L A;  1LZC A;  260L A;  1JTM A;  4NGZ A;  1CNS A;  5KXK A;  3NS0 A;  2Z39 A;  4PJ2 C;  1EHK B;  1EL1 A;  1B0D A;  3QJT B;  4ARL A;  2BQB A;  1D3J A;  2DQF C;  3AYM A;  3AB6 A;  1R2N A;  5LIO A;  5KXX A;  3KAM A;  138L A;  4H9H A;  2BQN A;  3B0O A;  206L A;  4PRU A;  4L35 A;  1L18 A;  3KJ6 A;  3HTG A;  1WQR A;  3WUA A;  4G71 B;  2ZNW Y;  4WL7 A;  4RLM A;  1L28 A;  4J7V A;  4H8X A;  1IOQ A;  1L47 A;  153L A;  1A2Y C;  182L A;  5B35 A;  1C6J A;  243L A;  1C43 A;  1LJI A;  3WPK A;  5AHZ A;  5DN5 A;  1L09 A;  1VED A;  1JTO L;  5I4Y A;  4MCK A;  1DI5 A;  3RUN A;  141L A;  103L A;  4YM8 A;  1HSX A;  2LYZ A;  3A95 A;  1H6M A;  4BV0 A;  2RB0 X;  228L A;  3OK0 A;  2OEA X;  4X3B A;  1HFX A;  4J0L A;  1GXV 2;  1X0K 1;  3A34 A;  1S53 A;  1IP1 A;  3WMK A;  3HTB A;  255L A;  1LHM A;  1VGO A;  1KME A;  3UTX A;  4NHP A;  197L A;  4N1C C;  1E12 A;  1JTP L;  3W6B A;  1GF4 A;  3CDO A;  2DQE Y;  1L50 A;  5B6V A;  5B2N A;  170L A;  1L07 A;  4I8S A;  1L92 A;  1LTM A;  3HU8 A;  2M3G A;  1QUT A;  4PPO A;  3SBA A;  2WJK A;  1G7H C;  1GFK A;  118L A;  1C69 A;  1B6I A;  4JQ6 A;  2I20 A;  4OOT A;  2YBI A;  231L A;  4GLV A;  1GF6 A;  1SWZ A;  1IOC A;  1XGR C;  1G06 A;  3C8Q A;  4NHS A;  2OTY X;  1UIE A;  123L A;  2I25 L;  4WM2 A;  239L A;  2A4T A;  3HT7 A;  2NTG A;  258L A;  3CDV A;  1OUH A;  1HEP A;  4CFO A;  1L64 A;  3ZVQ A;  4AGA A;  1LN6 A;  2I35 A;  3B0K A;  232L A;  4LYC A;  2B6W A;  1X0S A;  4NGY A;  1MGY A;  1GFE A;  1IP3 A;  113L A;  2RAY X;  4DWX A;  4UWV A;  3DN1 A;  4H9C A;  1HZX A;  2BQH A;  1OUA A;  1W08 A;  1YAN A;  5FEK A;  4W96 A;  5DHH A;  3CDQ A;  5H2O A;  1B7O A;  1HEN A;  1L21 A;  250L A;  1YL0 X;  1V7T A;  2MEG A;  1LZR A;  5LZM A;  3WYH A;  1B7R A;  1LZ1 A;  1L66 A;  1IP5 A;  4L41 A;  190L A;  4NSG A;  2HEE A;  1QTK A;  1CKD A;  1SX7 A;  1C6Q A;  1P7S A;  3F6Z A;  2Z6B A;  4B4E A;  2KSB A;  2Z19 A;  5B6W A;  4QRY A;  5FJG A;  4MD1 A;  5D5F A;  2ZIK A;  2IHL A;  1IP4 A;  4KNF A;  3B0I A;  3VVK A;  2YDG A;  4GCC A;  1LYG A;  2B73 A;  1IOS A;  4NY5 A;  3SP3 A;  4NFV A;  3ZVQ B;  1LSG A;  1CV4 A;  2DBT A;  1TN5 A;  4G7S B;  1JJ0 A;  5KKH A;  1W6Z A;  1L11 A;  1CX6 A;  3GUI A;  5LA5 A;  3UG9 A;  146L A;  1XJU A;  1L03 A;  3W6C A;  1C6C A;  1XFP L;  4EKR A;  1BB5 A;  1HML A;  4BAP A;  1L20 A;  1C10 A;  4GP4 B;  4NGW A;  4BVN A;  1KY1 A;  3ABW A;  3WU9 A;  5I53 A;  2PC2 A;  1L70 A;  4HTQ A;  4WLD A;  4GN3 A;  3MGW A;  191L A;  1OV7 A;  1J1O Y;  3DDL A;  4IAP A;  1JIT A;  1D3M A;  4ML7 A;  3WPL A;  5FST A;  129L A;  4A4M A;  5LVI A;  1OUG A;  194L A;  4FAA B;  2I21 A;  1L61 A;  4I7N A;  4BS7 A;  1LZD A;  5KXM A;  2Z18 A;  1L49 A;  1GB9 A;  1LI3 A;  2BLX A;  1L79 A;  3QY4 A;  5LA8 A;  1BRR A;  4YX7 C;  2CGI A;  1LJE A;  1I6S A;  3CSZ A;  2BRD A;  4WM5 A;  2YDV A;  5H2P A;  187L A;  1LZB A;  1OYU A;  223L A;  1HER A;  1PQD A;  1BB4 A;  1KXY A;  1B9O A;  4DC4 A;  242L A;  3IJV A;  1BWI A;  2X0A A;  2DQJ Y;  1C62 A;  4WLY A;  4I7Q A;  1L94 A;  4NHI A;  1BHZ A;  1IWW A;  247L A;  1LMQ A;  4TSB A;  3QAP A;  3LZ2 A;  1HFZ A;  1FBK A;  1C7P A;  9LYZ A;  4WAV A;  2NTH A;  4KPM A;  1ZMY L;  1LCN A;  2Z73 A;  4FA7 B;  3OE0 A;  4X1H A;  1NDG C;  1T6V L;  2YBM A;  1DKK A;  108L A;  1C6E A;  4J1B A;  1OVK A;  4K5Y A;  149L A;  4RW1 A;  4JKV A;  1L12 A;  1C6B A;  1NHE A;  4LDO A;  5B05 A;  8LYZ A;  4DD2 A;  4I7K A;  147L A;  5G2D A;  1L05 A;  4HP0 A;  3TXI A;  1GEV A;  3GUN A;  1L08 A;  1FLU A;  3RW8 A;  1CU3 A;  1JIY A;  1M0L A;  4W53 A;  3SB7 A;  1QT7 A;  1L87 A;  4XJI A;  1JV7 A;  1OV5 A;  4LT0 A;  3A67 Y;  1P37 A;  185L A;  3HTD A;  1B2K A;  3HWL A;  1CU2 A;  3HBH A;  3G3X A;  4WOA A;  1INU A;  1G0L A;  2DQG Y;  3HAQ A;  5LVK A;  125L A;  2DKV A;  1G0P A;  1KIQ C;  1T8A A;  5H2N A;  1LZE A; 
#chains in the Genus database with same CATH homology
 1L0M A;  150L A;  2FYC A;  4PGJ B;  4HJZ A;  4EKP A;  2G4N A;  1L44 A;  3RNX A;  4H9A A;  2Q9E A;  3A90 A;  1DZE A;  1OUF A;  1LMA A;  2MEC A;  3A7K A;  4BWB A;  5LVH A;  1GUE A;  111L A;  1C08 C;  3RT5 X;  3SB6 A;  2HEC A;  112L A;  3WW6 A;  3EO5 A;  3SBB C;  1IOR A;  3C81 A;  6LYT A;  1EQE A;  1OUB A;  148L E;  1CJ9 A;  1QHJ A;  4I7S A;  5LIN A;  1RFP A;  1QT8 A;  3JR6 A;  217L A;  1N4F A;  2YCW A;  251L A;  1B7P A;  4GYC A;  3C9L A;  4LDE A;  2B6T A;  1L14 A;  4EJ4 A;  4TWS A;  4H90 A;  1LZS A;  3CSQ A;  2LYO A;  5LYM A;  2KS9 A;  2F2Q A;  4W56 A;  3C8R A;  1CUP A;  2OU0 X;  1L95 A;  1GWD A;  1C6F A;  1YAO A;  4HWL A;  5G54 A;  1L60 A;  1GBS A;  1J1X Y;  1GE3 A;  1NHB A;  3COC A;  1QT4 A;  4DT3 A;  1LZ4 A;  1NKH A;  2DQI Y;  3ULR A;  5H2H A;  3W6A A;  2F95 A;  2D4K A;  1NWG A;  2LCB A;  130L A;  1LJJ A;  3HAR A;  1XGT C;  1LYE A;  5KXO A;  3HDE A;  4G72 B;  3AZ5 A;  3P68 A;  1L71 A;  1LAA A;  3F9L A;  3SB9 A;  5APC A;  1C6H A;  2LHM A;  3AW7 A;  5L3H A;  262L A;  1C6L A;  2ZZL A;  2Z55 A;  2Z38 A;  1B7S A;  4WM1 A;  4YXC A;  1CU5 A;  1QDT A;  1D0L A;  1SX2 A;  229L A;  1UC0 A;  1GB0 A;  3QJR B;  5JJE A;  122L A;  4UG2 A;  3T6U A;  1GFR A;  4GCF A;  4HPE A;  4EOF A;  222L A;  3WL2 A;  3OJP A;  1L84 A;  1GXX A;  5KXY A;  3HU9 A;  1GE1 A;  4HJY A;  2ZYP A;  1G7L C;  4DD1 A;  3TXH A;  2W1X A;  4DQJ A;  1C6A A;  1AKI A;  1G7M C;  4XXJ A;  1NMM A;  2CUU A;  1DXJ A;  2F47 A;  4E3U A;  2RBS A;  5LWE A;  4WM6 A;  1BVK C;  3NSB A;  4GBR A;  198L A;  1B5X A;  167L A;  3G3W A;  3ODU A;  1TBY A;  3SB8 A;  3QBK A;  4IJ4 A;  3SB5 A;  1L77 A;  119L A;  5FHW A;  1GF9 A;  1YAP A;  1L06 A;  3VGA A;  4CFP A;  4EKQ A;  1QSW A;  1CV5 A;  4WMG A;  5DL9 A;  1KW7 A;  4NGK A;  2Y03 A;  145L A;  3W3E A;  1QSA A;  1QUD A;  1GFV A;  1HEM A;  1QUO A;  1DYA A;  1GAZ A;  1CJ7 A;  1C3W A;  1B5V A;  4PJZ A;  1DYG A;  4TL3 A;  211L A;  1P6Y A;  1KG8 A;  2OE4 X;  205L A;  1E8L A;  246L A;  254L A;  4GLA A;  4W59 A;  3L2X A;  4LZT A;  3EH5 B;  4TUN A;  1D6P A;  4ETA A;  3PBL A;  1YIL A;  5F81 A;  1AT5 A;  1LJH A;  1IWU A;  1C60 A;  2MEB A;  4H8Z A;  4PXF A;  4MST A;  1D3N A;  177L A;  2OU8 A;  5KXN A;  1LMN A;  1L89 A;  3W6F A;  4NWE A;  2Z2E A;  5B34 A;  4LYT A;  2Z37 A;  2J4Y A;  107L A;  1LSE A;  2C8P A;  2ZNX Y;  1FKV A;  1LZA A;  2B6Y A;  1G1V A;  2QAR C;  1G0K A;  4BEY A;  1L26 A;  1L90 A;  1HF4 A;  3HFM Y;  196L A;  5A44 A;  1L15 A;  2O79 A;  1A4V A;  3TXD A;  2XTH A;  178L A;  4M4O A;  4XJF A;  3A93 A;  2W1L A;  3N9C A;  5EN0 A;  3DN6 A;  3P4Z A;  1LYH A;  5APD A;  4ARQ A;  5K7O A;  220L A;  4G70 B;  2Z12 A;  1IWT A;  1BGI A;  3DN4 A;  4XYY A;  4H94 A;  5KXZ A;  4NHQ A;  1IWV A;  1L16 A;  1YKY X;  2QPD B;  1CV1 A;  1B5Z A;  3CDT A;  174L A;  4HJV A;  1C8S A;  4G4B A;  3DQB A;  2O4W A;  4HPI A;  2FBD A;  3GUL A;  1LZY A;  4KT3 A;  4NIJ A;  5F9U A;  5DHG A;  1IR8 A;  1UID A;  4LT3 A;  5JJJ A;  4NSI A;  3AYN A;  2HU3 A;  1UA6 Y;  1GDX A;  160L A;  3QE8 A;  4N8Z A;  1HEW A;  4OWA A;  1B5W A;  1KXX A;  3S3C B;  1UCQ A;  1QTB A;  5BR5 A;  1JKB A;  1L36 A;  1YKX X;  3C9M A;  1GE0 A;  1L58 A;  1L83 A;  1Q5J A;  5B6Y A;  3CDR A;  166L A;  1JEF A;  1LYZ A;  4QI1 A;  2H9K A;  5AHY A;  1QS5 A;  3LYT A;  1HHL A;  3OE8 A;  3WXT A;  4CJ2 A;  1PQM A;  3TXB A;  1XEI A;  4U3X B;  110L A;  1TAY A;  1P46 A;  3GUM A;  3EH3 B;  1LSA A;  2YBL A;  1QT6 A;  3ZPQ A;  5KXT A;  3P65 A;  1IY3 A;  3VI0 A;  4ANR A;  1C6D A;  3HT9 A;  1XGP C;  1WQP A;  2B7X A;  4DD3 A;  5C6I A;  3CAP A;  4DYG A;  3T36 A;  2LNL A;  3LZT A;  1LHK A;  4W54 A;  1L25 A;  2GV0 A;  1CKC A;  1L35 A;  1L53 A;  4G4C A;  5LVG A;  1DYE A;  3J6K A;  245L A;  3CB7 A;  1PY6 A;  1L43 A;  3B6L A;  5KXP A;  5HNC A;  3BVD B;  3AGH A;  3T45 A;  3DMV A;  1IX0 A;  1S54 A;  1M0M A;  135L A;  1F10 A;  2O7A A;  4IAQ A;  3UON A;  2EKS C;  1REZ A;  227L A;  4GCD A;  3TXJ A;  1L52 A;  1DI4 A;  1GBX A;  1GEZ A;  1LKR A;  4AMJ A;  1JIS A;  1GBY A;  1GB3 A;  168L A;  5KKI A;  1UCO A;  3C82 A;  1L45 A;  1YQV Y;  4BAD A;  2AT9 A;  3GUO A;  218L A;  4RDS A;  1QT3 A;  3NY8 A;  4N5R A;  2BPU A;  1FBI X;  4N6H A;  5I14 A;  5I4X A;  5I5Q A;  3ATO A;  5E9R A;  4MQT A;  4N4W A;  1DYF A;  4AXT A;  1REY A;  5B6X A;  1LSP A;  1WVU A;  1M0K A;  2N5Z A;  200L A;  4Z41 A;  4XT3 A;  3CQL A;  4HSF A;  1PQJ A;  2VB1 A;  4QEQ A;  5LYT A;  3C83 A;  4OOO A;  1JKC A;  1BWH A;  1AT6 A;  4ETB A;  4HTN A;  3HH6 A;  1JTT L;  3AGI A;  1D6Q A;  2RBQ A;  2RSC A;  4J1A A;  3F8V A;  2LYM A;  1GFH A;  1T97 A;  131L A;  5A45 A;  1IP7 A;  2OTZ X;  3GUP A;  5L9J A;  1L73 A;  3A94 A;  1FLY A;  1BQL Y;  4XTL A;  1LGW A;  2EI4 A;  3DN8 A;  1LGX A;  3HUQ A;  1PXR A;  1LWK A;  1LHI A;  1JTN A;  3WU7 A;  1F4Z A;  1AP9 A;  1F88 A;  2G87 A;  1UIG A;  4PHI A;  4ARJ A;  1QM8 A;  2ZYC A;  1WQM A;  3S3D B;  1GB2 A;  1L30 A;  2IGC A;  3UZA A;  234L A;  1C6T A;  5L3I A;  1QTH A;  2LZM A;  1LJF A;  3LZM A;  4ARM A;  5C6J A;  1I20 A;  1KS3 A;  1L33 A;  1QUS A;  3C8S A;  1LJG A;  5AX1 A;  1IWY A;  3WW5 A;  4QDN A;  2HTX A;  1L75 A;  4H9E A;  1GF0 A;  1TEW A;  176L A;  5ILF A;  2B6X A;  4ZEE A;  1QT5 A;  4ARP A;  1LZG A;  1R84 A;  3GXK A;  5J7C A;  3COD A;  2BQE A;  1ZUR A;  2B70 A;  4NC3 A;  4DD0 A;  4DD9 A;  1JJ1 A;  3WXU A;  4MQS A;  3P66 A;  1EQ5 A;  1CTW A;  2L78 A;  4XJG A;  1L42 A;  1VJM A;  3EBA B;  252L A;  3A6B Y;  4OO9 A;  1P8I A;  4LYB A;  1P2L A;  1S8L A;  1JKD A;  1YAM A;  1D0M A;  5F8U A;  3EMS A;  134L A;  2D6B A;  2A7D A;  2BQI A;  1LJ3 A;  193L A;  4ZPU A;  1IEE A;  3LYM A;  2RBP A;  1L81 A;  3RU5 A;  1L13 A;  4OWH A;  3TMW A;  5I4W A;  2KSA A;  3GXR A;  5H2J A;  2EQL A;  3VG9 A;  3ZPR A;  1L40 A;  1IP2 A;  1EPY A;  1L59 A;  4XAD A;  1ZV5 L;  3AM6 A;  4BEZ A;  1P36 A;  1AM7 A;  4W51 A;  2H9J A;  1SSY A;  3CT5 A;  1L34 A;  4NG8 A;  4OWB A;  2MEH A;  5FEL A;  4QGZ A;  2ZWB A;  4NG1 A;  175L A;  4GP8 B;  4XN6 A;  1LHL A;  1L37 A;  1GF7 A;  1JJ3 A;  2HPY A;  1UIF A;  1CX7 A;  2HUL A;  184L A;  1L91 A;  1C66 A;  1LW9 A;  1QKO A;  3HBD A;  1RCM A;  5DLA A;  5G2A A;  1JSE A;  7LYZ A;  132L A;  4OV0 A;  5JJN A;  2YBN A;  4YOP A;  1V7S A;  1TCY A;  2BQJ A;  2B72 A;  1RI8 B;  2BQG A;  4XJB A;  1LYJ A;  2Y04 A;  4X31 A;  4NEB A;  4S0W A;  1G7I C;  3K3T A;  1CV6 A;  3W6D A;  3G3V A;  1F6S A;  1JHL A;  1PS5 A;  2F2N A;  5IEL A;  1LMC A;  4B4J A;  4D9Z A;  3QBG A;  3DKE X;  4W94 A;  1LSD A;  1CV3 A;  3S8F B;  1L88 A;  3HT8 A;  4HYX A;  4L6R A;  2B75 A;  137L A;  1L97 A;  1IY4 A;  1L29 A;  3FA0 A;  3G3B B;  2HEF A;  4ET8 A;  2G4P A;  2R4S A;  1LHH A;  1Z55 A;  4OW1 A;  1G0M A;  1VDT A;  1TN0 A;  1HNL A;  4CHX A;  2L6X A;  4NGJ A;  1QTC A;  5HLL A;  1L24 A;  3C80 A;  4BAF A;  4FPD A;  3RFM A;  4ZIX A;  3HAO A;  1HSW A;  3HAP A;  5AZD A;  1G07 A;  1KXW A;  1XGU C;  1MLC E;  2H5Z A;  3A96 A;  1KY0 A;  1F50 A;  139L A;  2ZIY A;  4NSH A;  4LT2 A;  3DN3 A;  3A8Z A;  249L A;  2RAZ X;  1JWR A;  1IIZ A;  4O34 A;  5D5C A;  2DQA A;  1L46 A;  1UIB A;  1HEQ A;  1PQO A;  216L A;  2YCY A;  1BM1 A;  1L39 A;  4ZFP A;  4XT1 A;  5ETZ A;  3REY A;  3TXG A;  241L A;  2JAF A;  1IWZ A;  1QTE A;  1HEO A;  1HC0 A;  3QBL A;  1BB3 A;  151L A;  1GPQ C;  3UTV A;  1G1W A;  1GDW A;  3HUA A;  159L A;  5M1Y A;  1LZT A;  1XME B;  2YSS C;  173L A;  1L93 A;  5KY1 A;  3HUK A;  6LYZ A;  3DN2 A;  4LZM A;  2I6Z A;  4PRQ A;  4Z98 A;  1GBW A;  5AWZ A;  1OVJ A;  2Y01 A;  1XEJ A;  4NGO A;  2PED A;  4EMN A;  4DAJ A;  1L96 A;  1C61 A;  3N9A A;  4LYO A;  4G4H A;  140L A;  2HED A;  2MEF A;  238L A;  2A7F A;  4WL6 A;  2RBR A;  4DD7 A;  2C8O A;  1L80 A;  3AZ6 A;  3DMZ A;  1L38 A;  3CSR A;  128L A;  1LLH A;  1G0Q A;  1D2W A;  4IAS A;  2BQF A;  4GN5 C;  1YKZ X;  4XJH A;  5ILC A;  1OUE A;  240L A;  4GPO A;  1AZF A;  1S52 A;  4G7Q B;  3AYQ A;  4NWH A;  5B07 A;  5B59 A;  2Q0M X;  236L A;  3IWR A;  3A91 A;  2XJW A;  1L62 A;  1P8H A;  3B72 A;  192L A;  1KIP C;  2MEE A;  165L A;  154L A;  2NTW A;  5G36 A;  1L69 A;  2BAA A;  4ETC A;  2FBB A;  4GCE A;  4H93 A;  5AX0 A;  2BQK A;  3A92 A;  1J1P Y;  1PXS A;  4DQ7 A;  3P0G A;  1LSB A;  1L67 A;  1D9U A;  4N0J A;  2KSY A;  1B7M A;  1LSZ A;  1L23 A;  1LYY A;  3X3B A;  1NBZ C;  1L76 A;  1DI3 A;  4EIY A;  4DKL A;  1LSN A;  1CJ8 A;  3TMX A;  4HV1 A;  2Y02 A;  3QBI A;  2BQL A;  4GBR B;  5LYZ A;  3D9A C;  1SSW A;  1LSY A;  4LYM A;  1L27 A;  1S8J A;  5LXW A;  1VDS A;  4H9B A;  2VT4 A;  1OUC A;  3LN2 A;  3TXK A;  2CDS A;  1C46 A;  1BWJ A;  169L A;  1G7J C;  1P64 A;  4H91 A;  4EA3 A;  1QDR A;  4N4Y B;  4IB4 A;  2WJL A;  219L A;  5J7A A;  1OUI A;  3CT1 A;  2FYD A;  5II3 A;  4XTO A;  1U19 A;  4EKS A;  1CVK A;  1IO5 A;  3HDF A;  4B0D A;  4GCB A;  1KW5 A;  4IAT A;  4FDY A;  5C1M A;  5B1F A;  1DKJ A;  1YRO A;  1DZB X;  2D4I A;  1T6H A;  5H2L A;  161L A;  1LSC A;  3NY9 A;  4G49 A;  237L A;  1LZN A;  5DM9 A;  1PQK A;  1GZM A;  1FKQ A;  1QIO A;  1L74 A;  1ZVY B;  1L68 A;  5C6L A;  5LVJ A;  1GE2 A;  3LYZ A;  1EQ4 A;  1VAT A;  3QJQ B;  2YVB A;  5H2I A;  1KGB A;  3TMV A;  4I7T A;  142L A;  1K28 A;  5JEN B;  3ZEV A;  3UTY A;  1IWX A;  4I7J A;  3NYA A;  1GHL A;  1L99 A;  2ZQ3 A;  1JQU A;  1NF5 A;  1HFY A;  207L A;  1L56 A;  1NDM C;  3AGG G;  4FJR A;  4WO6 A;  1ZVH L;  1JV6 A;  1XEK A;  1YL1 X;  208L A;  4N1E I;  114L A;  2HEA A;  3FI5 A;  3N9E A;  1L32 A;  1SQ2 L;  256L A;  2BQD A;  4ARQ B;  2F30 A;  152L A;  1LZ6 A;  5IHG A;  3ZEK A;  3HBE X;  102L A;  3L64 A;  1CKF A;  4WM3 A;  233L A;  2JAG A;  5HMV A;  5F9X A;  2NTU A;  1FLW A;  163L A;  4Z3M A;  2D91 A;  1XSF A;  4C5F A;  1XGQ C;  3DNA A;  2R4R A;  4HV2 A;  3RZE A;  3X3C A;  2W1M A;  3OAX A;  4CGE A;  5ITE A;  1IXF A;  3TMU A;  5F16 A;  1GF5 A;  1P3N A;  1GF8 A;  1LMT A;  1WVV A;  4MD2 A;  115L A;  2B74 A;  2YCZ A;  1L72 A;  1GB6 A;  248L A;  3EML A;  1XJT A;  1UIA A;  3A3R X;  1H87 A;  1PZY A;  172L A;  4EPF A;  2ZIL A;  1LWG A;  4GRV A;  1ZWN A;  1FN5 A;  2B5Z A;  3AW6 A;  4H92 A;  3SN6 R;  244L A;  5HNL A;  1F0W A;  4TTD A;  1L10 A;  1LZ8 A;  1UUZ C;  4NGV A;  5G2C A;  3HH5 A;  1T8G A;  4PK0 A;  5KXL A;  2W1Y A;  2LZT A;  4UWU A;  171L A;  1LOZ A;  1WQO A;  3BKH A;  3D4S A;  1L31 A;  4P2E A;  1LMP A;  4PXK A;  1H2S A;  4EPI A;  5KKJ A;  1LHJ A;  1C64 A;  3AZ7 A;  1TLA A;  4H9F A;  1L63 A;  2EIZ C;  5A8E A;  2YBJ A;  4E97 A;  2B6Z A;  4TSC A;  1QTV A;  1C6N A;  5BR2 A;  1G0G A;  1GF3 A;  133L A;  3HAS A;  3QJS B;  2XBS A;  3TXE A;  1B5U A;  1BVX A;  1VFB C;  2OU9 A;  4LFX A;  4W52 A;  5A3E A;  1CKG A;  2RBN A;  4QID A;  1QUH A;  4XJD A;  1IVM A;  210L A;  4I7R A;  2Q9D A;  4B1A A;  4DDA A;  4DQ5 A;  2YDO A;  3K2R A;  155L A;  2XBR A;  3A6C Y;  1LGU A;  2OE9 X;  2RBO A;  4WLX A;  3V2Y A;  3GUK A;  2MEI A;  1QSB A;  4DS7 E;  3QJU B;  4BUO A;  1UAC Y;  144L A;  2BQC A;  3G3A B;  2CWI A;  199L A;  3E3D A;  1JFP A;  5B06 A;  1D3F A;  1LYS A;  1XEP A;  1L41 A;  3VWO A;  3AZ4 A;  1L04 A;  4AMI A;  4QY9 A;  5G28 A;  3A3Q A;  215L A;  1XJI A;  4I0C A;  1DQJ C;  1DYD A;  3QDC A;  2LC9 A;  3LHM A;  1P5C A;  3P64 A;  4EXM A;  3HTF A;  1QTD A;  4NSJ A;  1L00 A;  1L17 A;  4WW3 A;  2ZFE A;  2OE7 X;  4YF2 A;  143L A;  1L55 A;  1I1Z A;  1O0A A;  1OWY A;  1UBZ A;  1WQQ A;  3CT0 A;  4GN4 A;  1L22 A;  1FBB A;  4NGL A;  109L A;  1IC4 Y;  4RLN A;  1L98 A;  1CUQ A;  4XTN A;  209L A;  4KL7 A;  5E4P A;  3GUJ A;  4XEN A;  4JR8 A;  4I7P A;  226L A;  4AQN A;  4WM4 A;  1C68 A;  3M18 B;  2WAR A;  5LAF A;  1LYF A;  3EH4 B;  4Z46 A;  4DDB A;  3D3D A;  2HUK A;  4ARM B;  1VDP A;  2G4Q A;  181L A;  4LFP A;  2CJL A;  1L86 A;  3J4G A;  3WH1 A;  2HU1 A;  3WQJ A;  2RH1 A;  1B7N A;  1T8F A;  4W57 A;  1LI2 A;  4W55 A;  5HQ1 A;  3WU8 A;  1NBY C;  4B4I A;  1L85 A;  3C7W A;  1C67 A;  4DDC A;  212L A;  3RZ4 A;  4WO9 A;  3VW7 A;  1GFG A;  3TXF A;  188L A;  230L A;  3WVY A;  4KXI A;  1ZYT A;  2X72 A;  4YEO A;  1WQN A;  1RE2 A;  1DYB A;  5H2K A;  1C45 A;  3WUM A;  5DN4 A;  1I56 A;  221L A;  2BQO A;  2RB2 X;  1OUD A;  1GB7 A;  1C6P A;  4M6D A;  2HUM A;  1JPO A;  1CU6 A;  1GB8 A;  2LZ2 A;  2EPE A;  4UHR A;  5TGZ A;  4ETE A;  3BKV A;  4G7R B;  5B0W A;  1P2C C;  2BQM A;  5HMJ A;  1QKP A;  4I7L A;  5I54 A;  1FLQ A;  5T3F A;  5KXR A;  4I7O A;  1GB5 A;  1LJ4 A;  1UAZ A;  1LYD A;  1LI6 A;  1OVH A;  1KIR C;  5KXW A;  4G9S A;  186L A;  1JGJ A;  213L A;  4R0F A;  3ATN A;  4WLT A;  5APE A;  1GFJ A;  4FBZ A;  1LPY A;  3C7Z A;  2QPE B;  4LYZ A;  1G0J A;  1S51 A;  2Y8P A;  1LMO A;  1JUG A;  4C3W A;  4UWN A;  4NHT A;  1OP9 B;  1X0I 1;  1B7L A;  2HUB A;  1LYO A;  1PQI A;  4KLY A;  3QJV B;  1LPI A;  257L A;  4J4Q A;  3EXD A;  1WTM A;  1D2Y A;  195L A;  1LZ9 A;  1LZ5 A;  1GU8 A;  1F6R A;  2XQO A;  1C6K A;  1L19 A;  1HMK A;  2HEB A;  3W6E A;  1UIC A;  1H68 A;  4A7D A;  1C65 A;  1IC7 Y;  1D0K A;  1JKA A;  5EBH A;  2ANV A;  1IC5 Y;  4OWE A;  7LZM A;  5B1G A;  1C6G A;  1P2R A;  261L A;  1IOT A;  1LJK A;  2MEA A;  1XIO A;  4MBS A;  158L A;  1LSM A;  4N9R A;  1SWY A;  5FDJ A;  3HAN A;  2QB0 B;  1YIK A;  1OUJ A;  1D9W A;  3UTW A;  1CJ6 A;  214L A;  1REX A;  1E0P A;  1KNI A;  4YEM A;  1GBZ A;  1SLY A;  259L A;  104L A;  1LYI A;  4H1P A;  3HH3 A;  3UZC A;  1BB6 A;  3M3U A;  1LJN A;  1GE4 A;  1LKS A;  1L51 A;  1QS9 A;  4YEN A;  1NQI A;  3HT6 A;  5IDD A;  1REM A;  3FI7 A;  2RB1 X;  2YCX A;  1L54 A;  4H9I A;  3WVX A;  164L A;  253L A;  4W58 A;  5H2M A;  1IW6 A;  189L A;  3C7Y A;  225L A;  3LYO A;  2I1X A;  1OWZ A;  2ANX A;  4HTK A;  3S8G B;  4OWC A;  3WPJ A;  2NWD X;  3QNG A;  1IP6 A;  1CV0 A;  1L65 A;  2ZQ4 A;  3WUN A;  1C8R A;  2DQH Y;  1GBO A;  1L0K A;  1QTZ A;  3WUL A;  4YXA C;  1L9H A;  3MBV A;  4NGI A;  1C6M A;  1RJC B;  201L A;  5KJ9 A;  1Q5I A;  6LZM A;  4X32 A;  1L0J A;  183L A;  5ITC A;  2IFF Y;  4ET9 A;  3DN0 A;  2D4J A;  3HH4 A;  157L A;  162L A;  2BQA A;  1L48 A;  2DQD Y;  224L A;  1KG9 A;  1DPX A;  5APF A;  5G53 A;  4TX7 A;  5DYS A;  127L A;  1WTH A;  1QUG A;  1BRX A;  5LAG A;  1T3P A;  4WG1 A;  4HYJ A;  1C6I A;  2F4A A;  2DQC Y;  2AUB A;  1TDY A;  1GFT A;  1ALC A;  3FAD A;  3DMX A;  3FE0 A;  4II8 A;  3V2W A;  3PWH A;  1L82 A;  3OE9 A;  4RW2 A;  3PXO A;  1HEL A;  4Y9H A;  1P8U A;  4I7M A;  1B7Q A;  180L A;  1IR7 A;  2MED A;  4ETD A;  1FDL Y;  4B49 A;  2I26 L;  4LDL A;  1QQY A;  1B5Y A;  1CKH A;  1MEL L;  235L A;  1QSQ A;  2F32 A;  5F14 A;  4LGK A;  3QAK A;  1O23 A;  3PDS A;  5B6Z A;  1GFA A;  2F4G A;  5KXS A;  3OE6 A;  3AJN A;  4R6C A;  2BLY A;  2F93 A;  4GP5 B;  1LSF A;  4MR1 A;  120L A;  4LT1 A;  1BB7 A;  1YAQ A;  1DPW A;  1WTN A;  1GD6 A;  4WG7 A;  1JSF A;  3PQR A;  1IR9 A;  1DYC A;  5FCP A;  1GFU A;  1L02 A;  4IAR A;  4DJH A;  1P56 A;  2YBH A;  4H8Y A;  1UIH A;  156L A;  1CWQ A;  3IJU A;  1L01 A;  2Y00 A;  5A3Z A;  2Z2F A;  1VAU A;  1OQM A;  1L57 A;  1AT9 A;  3S3B B;  5AMY A;  1C63 A;  2ZIJ A;  3VHZ A;  1VDQ A;  1GAY A;  1BRD A;  1CU0 A;  1IW9 A;  126L A;  1LZC A;  260L A;  1JTM A;  4NGZ A;  1CNS A;  5KXK A;  3NS0 A;  2Z39 A;  4PJ2 C;  1EHK B;  1EL1 A;  1B0D A;  3QJT B;  4ARL A;  2BQB A;  1D3J A;  2DQF C;  3AYM A;  3AB6 A;  1R2N A;  5LIO A;  5KXX A;  3KAM A;  138L A;  4H9H A;  2BQN A;  3B0O A;  206L A;  4PRU A;  4L35 A;  1L18 A;  3KJ6 A;  3HTG A;  1WQR A;  3WUA A;  4G71 B;  2ZNW Y;  4WL7 A;  4RLM A;  1L28 A;  4J7V A;  4H8X A;  1IOQ A;  1L47 A;  153L A;  1A2Y C;  182L A;  5B35 A;  1C6J A;  243L A;  1C43 A;  1LJI A;  3WPK A;  5AHZ A;  5DN5 A;  1L09 A;  1VED A;  1JTO L;  5I4Y A;  4MCK A;  1DI5 A;  3RUN A;  141L A;  103L A;  4YM8 A;  1HSX A;  2LYZ A;  3A95 A;  1H6M A;  4BV0 A;  2RB0 X;  228L A;  3OK0 A;  2OEA X;  4X3B A;  1HFX A;  4J0L A;  1GXV 2;  1X0K 1;  3A34 A;  1S53 A;  1IP1 A;  3WMK A;  3HTB A;  255L A;  1LHM A;  1VGO A;  1KME A;  3UTX A;  4NHP A;  197L A;  4N1C C;  1E12 A;  1JTP L;  3W6B A;  1GF4 A;  3CDO A;  2DQE Y;  1L50 A;  5B6V A;  5B2N A;  170L A;  1L07 A;  4I8S A;  1L92 A;  1LTM A;  3HU8 A;  2M3G A;  1QUT A;  4PPO A;  3SBA A;  2WJK A;  1G7H C;  1GFK A;  118L A;  1C69 A;  1B6I A;  4JQ6 A;  2I20 A;  4OOT A;  2YBI A;  231L A;  4GLV A;  1GF6 A;  1SWZ A;  1IOC A;  1XGR C;  1G06 A;  3C8Q A;  4NHS A;  2OTY X;  1UIE A;  123L A;  2I25 L;  4WM2 A;  239L A;  2A4T A;  3HT7 A;  2NTG A;  258L A;  3CDV A;  1OUH A;  1HEP A;  4CFO A;  1L64 A;  3ZVQ A;  4AGA A;  1LN6 A;  2I35 A;  3B0K A;  232L A;  4LYC A;  2B6W A;  1X0S A;  4NGY A;  1MGY A;  1GFE A;  1IP3 A;  113L A;  2RAY X;  4DWX A;  4UWV A;  3DN1 A;  4H9C A;  1HZX A;  2BQH A;  1OUA A;  1W08 A;  1YAN A;  5FEK A;  4W96 A;  5DHH A;  3CDQ A;  5H2O A;  1B7O A;  1HEN A;  1L21 A;  250L A;  1YL0 X;  1V7T A;  2MEG A;  1LZR A;  5LZM A;  3WYH A;  1B7R A;  1LZ1 A;  1L66 A;  1IP5 A;  4L41 A;  190L A;  4NSG A;  2HEE A;  1QTK A;  1CKD A;  1SX7 A;  1C6Q A;  1P7S A;  3F6Z A;  2Z6B A;  4B4E A;  2KSB A;  2Z19 A;  5B6W A;  4QRY A;  5FJG A;  4MD1 A;  5D5F A;  2ZIK A;  2IHL A;  1IP4 A;  4KNF A;  3B0I A;  3VVK A;  2YDG A;  4GCC A;  1LYG A;  2B73 A;  1IOS A;  4NY5 A;  3SP3 A;  4NFV A;  3ZVQ B;  1LSG A;  1CV4 A;  2DBT A;  1TN5 A;  4G7S B;  1JJ0 A;  5KKH A;  1W6Z A;  1L11 A;  1CX6 A;  3GUI A;  5LA5 A;  3UG9 A;  146L A;  1XJU A;  1L03 A;  3W6C A;  1C6C A;  1XFP L;  4EKR A;  1BB5 A;  1HML A;  4BAP A;  1L20 A;  1C10 A;  4GP4 B;  4NGW A;  4BVN A;  1KY1 A;  3ABW A;  3WU9 A;  5I53 A;  2PC2 A;  1L70 A;  4HTQ A;  4WLD A;  4GN3 A;  3MGW A;  191L A;  1OV7 A;  1J1O Y;  3DDL A;  4IAP A;  1JIT A;  1D3M A;  4ML7 A;  3WPL A;  5FST A;  129L A;  4A4M A;  5LVI A;  1OUG A;  194L A;  4FAA B;  2I21 A;  1L61 A;  4I7N A;  4BS7 A;  1LZD A;  5KXM A;  2Z18 A;  1L49 A;  1GB9 A;  1LI3 A;  2BLX A;  1L79 A;  3QY4 A;  5LA8 A;  1BRR A;  4YX7 C;  2CGI A;  1LJE A;  1I6S A;  3CSZ A;  2BRD A;  4WM5 A;  2YDV A;  5H2P A;  187L A;  1LZB A;  1OYU A;  223L A;  1HER A;  1PQD A;  1BB4 A;  1KXY A;  1B9O A;  4DC4 A;  242L A;  3IJV A;  1BWI A;  2X0A A;  2DQJ Y;  1C62 A;  4WLY A;  4I7Q A;  1L94 A;  4NHI A;  1BHZ A;  1IWW A;  247L A;  1LMQ A;  4TSB A;  3QAP A;  3LZ2 A;  1HFZ A;  1FBK A;  1C7P A;  9LYZ A;  4WAV A;  2NTH A;  4KPM A;  1ZMY L;  1LCN A;  2Z73 A;  4FA7 B;  3OE0 A;  4X1H A;  1NDG C;  1T6V L;  2YBM A;  1DKK A;  108L A;  1C6E A;  4J1B A;  1OVK A;  4K5Y A;  149L A;  4RW1 A;  4JKV A;  1L12 A;  1C6B A;  1NHE A;  4LDO A;  5B05 A;  8LYZ A;  4DD2 A;  4I7K A;  147L A;  5G2D A;  1L05 A;  4HP0 A;  3TXI A;  1GEV A;  3GUN A;  1L08 A;  1FLU A;  3RW8 A;  1CU3 A;  1JIY A;  1M0L A;  4W53 A;  3SB7 A;  1QT7 A;  1L87 A;  4XJI A;  1JV7 A;  1OV5 A;  4LT0 A;  3A67 Y;  1P37 A;  185L A;  3HTD A;  1B2K A;  3HWL A;  1CU2 A;  3HBH A;  3G3X A;  4WOA A;  1INU A;  1G0L A;  2DQG Y;  3HAQ A;  5LVK A;  125L A;  2DKV A;  1G0P A;  1KIQ C;  1T8A A;  5H2N A;  1LZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...