4EJ4A

Structure of the delta opioid receptor bound to naltrindole
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
442
structure length
442
Chain Sequence
RSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, hydrolase/antagonist
molecule keywords Delta-type opioid receptor, Lysozyme chimera
publication title Structure of the delta opioid receptor bound to naltrindole
pubmed doi rcsb
source organism Mus musculus
total genus 156
structure length 442
sequence length 442
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4ej4A02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4ej4A01
3V2WA 3FI5A 187LA 1L95A 4DJHA 161LA 2YCXA 224LA 1G0KA 243LA 3QJUB 3HTGA 2B7XA 1G0JA 1CWQA 4BWBA 247LA 3BVDB 3SB8A 130LA 1U19A 1I6SA 3UTXA 2B74A 3GULA 4BEYA 1L87A 1L18A 1M0KA 2NTWA 173LA 5AHZA 4I7SA 4BEZA 1GU8A 1L93A 3G3WA 195LA 1QTBA 3COCA 1OVKA 2CUUA 188LA 1PQMA 174LA 4UG2A 4X1HA 1CTWA 4G70B 1L30A 5G2DA 3CDVA 1CUPA 1IW9A 1C6JA 7LZMA 1L56A 2OU9A 2B6ZA 1L70A 3NY8A 150LA 2RBRA 145LA 4IAPA 3SBAA 177LA 1L90A 156LA 5H2NA 5B6XA 3HT9A 2RB1X 1F4ZA 1PQKA 1L72A 1S8JA 152LA 3S8FB 112LA 1G1VA 1JTNA 1PXSA 3UZCA 5B6WA 1HZXA 4QRYA 1G0QA 3HH3A 4DAJA 1M0LA 3NSBA 257LA 231LA 234LA 155LA 5LZMA 1LI3A 1L73A 1DYGA 212LA 1L35A 2OEAX 5I14A 2PEDA 1C6EA 5ITEA 3X3BA 1L36A 2QPDB 240LA 1L28A 233LA 4LZMA 1QUDA 1LWGA 1KY1A 1TLAA 2I21A 1D3JA 1LYFA 1X0SA 3QAPA 3DN4A 1C61A 4L6RA 3VG9A 1QS5A 3NS0A 119LA 2O79A 1C6MA 1CU6A 1L38A 2IGCA 1L15A 2ZIYA 4G7RB 1QTHA 113LA 1L41A 4EXMA 1FBBA 249LA 4Y9HA 1QKPA 125LA 1QUOA 4OO9A 205LA 1BRXA 1T8AA 1S52A 2RB2X 2LC9A 4YXAC 2OU8A 1G0LA 2KS9A 5A8EA 1LGXA 4GRVA 4I7RA 5H2LA 1C6AA 5G53A 1KS3A 3DN3A 1L20A 259LA 140LA 1QT5A 4MBSA 246LA 1SWZA 2I20A 2F32A 2F93A 5G28A 1L44A 237LA 3QJTB 1KMEA 1C6CA 1PQOA 1T8FA 1GUEA 4YX7C 1O0AA 1LI6A 2KSAA 1UAZA 1G0PA 1L77A 1L58A 1KGBA 1BRRA 1KY0A 184LA 258LA 2Y04A 4EA3A 4ARPA 4HWLA 1D2YA 168LA 3C8RA 1SX2A 1TN5A 5TGZA 1L19A 1C63A 2YDVA 1P8UA 2OE4X 3VVKA 1L00A 3NY9A 2I35A 1UCQA 3GUJA 1D3MA 242LA 172LA 180LA 2JAGA 1CV5A 1L68A 2X72A 1L0MA 1L02A 256LA 227LA 3OE8A 3AM6A 1PQJA 223LA 4W54A 2WJLA 4MQTA 1L74A 3DN0A 4WAVA 3WQJA 3HTFA 4EJ4A 144LA 1S54A 2L78A 2ZFEA 4MD1A 5A44A 4W55A 1L0JA 1L48A 3CDRA 1PQIA 3CAPA 1DYFA 2Y03A 4GP8B 2NTHA 1R84A 1FBKA 3DN2A 3VGAA 123LA 1KNIA 3AYMA 3QBKA 2YCWA 1QSBA 209LA 1QUHA 2B75A 1WTHA 3C80A 1DYEA 103LA 5DHHA 139LA 255LA 3DN8A 4ARQA 162LA 1P37A 4E97A 4I7QA 5G54A 1G0GA 1L23A 1L40A 1SSYA 1LYJA 4GYCA 138LA 3S3DB 4HYXA 4WW3A 1MGYA 3MBVA 1AT9A 239LA 4W58A 122LA 229LA 2LZMA 4EKQA 3DNAA 1L82A 1PQDA 3HWLA 216LA 2RBQA 1C6KA 235LA 2B6TA 2VT4A 4W57A 4I7JA 3AYNA 1LYHA 5AHYA 4I7LA 109LA 3HT8A 2Y02A 1L53A 1JV7A 3PBLA 3HT6A 3C9MA 1JFPA 1QT8A 1OV5A 3DN1A 5BR5A 4EKSA 4JQ6A 1C6HA 1L63A 2Z6BA 3HUKA 1L08A 1BM1A 166LA 5B35A 1XJIA 1OWYA 2F2QA 2OE9X 3L2XA 1CU5A 3HUAA 3QBLA 3GUNA 1XIOA 1XMEB 3HARA 3DDLA 1BRDA 3F9LA 1X0I1 2RBNA 4PK0A 2EI4A 2HUMA 2HULA 3DMVA 3LZMA 4OV0A 3SB7A 5G2CA 225LA 1L39A 1H2SA 1LGUA 3QJQB 1C6BA 3T45A 1L42A 2Q9EA 1G06A 3G3XA 4A4MA 1C62A 252LA 2I1XA 3ODUA 2RH1A 1QM8A 4AMJA 4N6HA 1ZWNA 1L25A 1L46A 3UZAA 214LA 1QT7A 1L12A 1L14A 178LA 3C7ZA 158LA 3GUPA 1T8GA 3ABWA 5H2OA 108LA 1L88A 1G07A 3SN6R 1JTMA 5B2NA 1LN6A 5BR2A 2RAYX 1D3FA 3VI0A 4YXCA 1CX6A 1L16A 1JV6A 4PXKA 157LA 5H2IA 3HH4A 2F95A 1IW6A 4LDEA 1CV3A 5DYSA 213LA 1L79A 1L66A 5AWZA 5FJGA 3GUOA 3QAKA 1LYIA 3F8VA 3HDFA 250LA 5C1MA 1L45A 1L80A 1LGWA 3DMZA 3OE9A 1QSQA 2F47A 3HTBA 221LA 2RAZX 1D3NA 3HANA 4GPOA 1C8RA 1L50A 1C67A 3OE0A 141LA 2B6WA 1PXRA 165LA 1P8IA 3HAPA 251LA 5H2KA 171LA 1IXFA 4G7SB 4JKVA 4X31A 1P64A 2B70A 1LYGA 1QTVA 4EKPA 3S3CB 1ZYTA 4XT3A 1L94A 196LA 1B6IA 238LA 4ARJA 2LNLA 1L07A 1L10A 1L17A 1L98A 1C8SA 167LA 181LA 2LCBA 236LA 5JJJA 1GZMA 226LA 5ETZA 2Z73A 4HYJA 1TN0A 1L81A 176LA 1L91A 1L84A 4EPIA 4G71B 4QIDA 3QJVB 1L69A 3UG9A 2RBPA 1C6IA 1XJTA 3DN6A 4DKLA 1R2NA 102LA 107LA 2KSYA 4XXJA 128LA 232LA 244LA 3QDCA 1CV6A 1QTDA 2RBSA 4ZPUA 104LA 2ANVA 1L85A 127LA 1L51A 210LA 2B6XA 111LA 175LA 253LA 3HU9A 3UTWA 1L61A 1L75A 4ARQB 1L71A 3VHZA 4AQNA 5H2PA 3UONA 3JR6A 1F50A 4I7PA 1L67A 1E0PA 2BRDA 1E12A 1DZEA 3C81A 3EH3B 142LA 1VGOA 4W53A 1L83A 3L64A 3RUNA 4XTLA 1EHKB 1M0MA 3HAQA 1P2LA 1C6NA 1C3WA 3OAXA 3G3VA 3CDOA 2QB0B 149LA 159LA 1VJMA 137LA 163LA 1L96A 4XTNA 1L0KA 4XT1A 5ITCA 3QJSB 1OWZA 4N4YB 1L21A 4BVNA 4BV0A 4BUOA 2QPEB 3C8QA 1KW5A 1L03A 3HT7A 4JR8A 3CDTA 3CDQA 3C82A 2M3GA 1L92A 3V2YA 4FPDA 4I7NA 1QTCA 4LDLA 191LA 2B72A 4ARMA 219LA 260LA 1QKOA 4EIYA 5B6VA 1L26A 3OE6A 2L6XA 3RFMA 169LA 3HU8A 2OU0X 1C6QA 4K5YA 1AP9A 2G87A 3C8SA 2Y00A 5H2MA 1L32A 3NYAA 3QBGA 190LA 4MD2A 1L09A 1CX7A 3KJ6A 3QBIA 3ZEVA 5F8UA 2NTUA 1XJUA 1SWYA 198LA 211LA 4N4WA 1L29A 3UTVA 118LA 1DYDA 222LA 4FBZA 5AX1A 1L76A 3S8GB 1CV4A 3ZPQA 1P6YA 183LA 3C9LA 4KLYA 4S0WA 4GBRA 1QUGA 200LA 3HASA 1L24A 1P7SA 3HTDA 1KG9A 3VW7A 3PDSA 1L06A 1G0MA 2J4YA 4FA7B 3X3CA 1DYCA 3EH5B 2B73A 192LA 2NTGA 3FADA 4I7OA 4GP4B 1P2RA 1QT4A 5B34A 114LA 228LA 5EN0A 1DYBA 1P36A 3QJRB 185LA 3C83A 1LW9A 1L99A 2YDOA 2RBOA 4PXFA 5B6YA 3PXOA 1SSWA 129LA 2A4TA 248LA 2OTZX 2YCYA 1C6GA 230LA 3HDEA 1K28A 151LA 1L49A 186LA 3GUMA 2Y01A 1L62A 217LA 1L55A 147LA 4W59A 1OVJA 2ANXA 1OYUA 1L89A 4AMIA 189LA 1CVKA 4LDOA 4IAQA 5B0WA 4I7MA 2WJKA 1OVHA 1NHBA 1KW7A 1C6DA 4IARA 4KNFA 1P46A 2B6YA 1QT3A 3RZEA 4UHRA 2Q9DA 2R4RA 5H2JA 1QHJA 1D9WA 3D4SA 3K2RA 3PWHA 1Q5JA 1L59A 2Z55A 5G36A 197LA 3GUKA 1S8LA 2R4SA 261LA 3GUIA 1KG8A 4G72B 4MQSA 1CUQA 160LA 3EH4B 1XEPA 4TL3A 2QARC 220LA 1P3NA 3DKEX 1L9HA 3SB6A 2O7AA 4ARLA 4L35A 1QT6A 1L31A 1QS9A 2JAFA 2ZZLA 1L33A 1C69A 199LA 1L27A 131LA 1L01A 1T97A 4EKRA 4IB4A 1C68A 2HUKA 4EPFA 4I7TA 1D2WA 3C7YA 1L05A 1H68A 1G1WA 218LA 3SB5A 110LA 1L43A 3C7WA 5JJNA 1CU0A 3CODA 1CU2A 1L13A 206LA 241LA 2AT9A 1L86A 2HPYA 126LA 4QI1A 4W56A 215LA 3UTYA 1JQUA 1C6FA 1P5CA 262LA 3HAOA 1L37A 5J7AA 1L52A 2KSBA 3ZPRA 182LA 1ZURA 2O4WA 1L57A 1LI2A 1JGJA 4NC3A 143LA 5H2HA 1L54A 1L65A 4X32A 254LA 3EMLA 1LLHA 245LA 6LZMA 4J4QA 1S51A 1C65A 1L04A 4GP5B 4FAAB 1L64A 3HH6A 3FA0A 1PY6A 1L97A 1LWKA 5LWEA 120LA 3S3BB 5B6ZA 3A7KA 1EPYA 5G2AA 3REYA 201LA 2YCZA 1F88A 1C6TA 4W51A 3HUQA 1CV1A 4ARMB 5AZDA 146LA 1L22A 1L60A 1C64A 3SBBC 5AX0A 1C66A 1QTZA 4PJZA 5JJEA 1CU3A 5DHGA 4G7QB 1T6HA 3PQRA 1CV0A 1LPYA 4XTOA 1L34A 4I7KA 115LA 1DYAA 3P0GA 2OE7X 1L47A 1OV7A 1LYEA 1SX7A 4W52A 1Q5IA 1P8HA 3SB9A 148LE 164LA 4GBRB 1C6LA 2OTYX 3HH5A 5A45A 3DMXA 1C60A 2RB0X 1L11A 1P56A 1LYDA 170LA 5KKHA 1S53A 1X0K1 3DQBA 1C6PA
chains in the Genus database with same CATH superfamily
1HEWA 3TMXA 4DDAA 1A2YC 4DJHA 2YCXA 1LYZA 3TXKA 3P68A 2B7XA 1G0JA 1ALCA 3BVDB 4NY5A 1REXA 130LA 1B7LA 3UTXA 3A93A 5KXNA 3LZTA 4IASA 4Z98A 1UA6Y 4TSCA 5KKIA 4WL6A 1GU8A 1UIAA 4O34A 3ZVQB 3P64A 4G4HA 4NSHA 1GF9A 3G3WA 4WLDA 1NKHA 2CUUA 1OUDA 5IDDA 1L30A 5II3A 3CDVA 1C6JA 1L56A 2OU9A 2B6ZA 5H2NA 1B7NA 3HT9A 5B6XA 2RB1X 4ETBA 1GFAA 4U3XB 3S8FB 1PXSA 2FYCA 3UZCA 3TXDA 2Z18A 2D4KA 4QRYA 2W1XA 5LINA 1M0LA 3NSBA 1LI3A 1DYGA 5FCPA 1LZCA 1OUIA 2PEDA 4NIJA 1KY1A 1TLAA 2I21A 1VFBC 4WG7A 3QAPA 1C61A 4WO9A 3HBEX 1GE0A 5I5QA 1EQ5A 1HENA 2O79A 4Y9HA 3A6BY 1S52A 205LA 1BRXA 5D5CA 1AT5A 2RB2X 4R6CA 2KS9A 5D5FA 2D4IA 5H2LA 1C6AA 207LA 5G53A 3WUAA 4N9RA 4NSJA 4G4BA 1KXWA 1GUEA 2W1MA 1AT6A 2KSAA 1UAZA 4C5FA 184LA 1F10A 4EA3A 4ARPA 168LA 1GBOA 1IWYA 4BS7A 1WTNA 1UACY 1UCQA 172LA 1CV5A 2X72A 1BB5A 2C8PA 256LA 227LA 4W54A 2WJLA 1L74A 4EJ4A 1S54A 2L78A 1GFUA 3B6LA 4W55A 1L0JA 2Y03A 1QSAA 2G4NA 3DN2A 4OW1A 123LA 3AYMA 4LYCA 4TX7A 1WTHA 1OUFA 1NQIA 4E97A 3DN8A 2BQOA 162LA 1FLQA 1OUEA 4ARQA 1G0GA 1L23A 1YQVY 4H8ZA 138LA 1AT9A 4EKQA 2LZMA 1PQDA 3HWLA 2DQHY 1LYSA 4W57A 3M3UA 4H91A 4I7JA 1LZTA 2FYDA 4HPIA 4B4EA 3PBLA 3C9MA 4AGAA 4N5RA 4JQ6A 1REMA 3A96A 1GEZA 1XJIA 2F2QA 3G3BB 1OUJA 3HUAA 3QBLA 3GUNA 1RE2A 4QEQA 1BRDA 4PRQA 2H9KA 2HULA 3LZMA 5EBHA 4GLVA 5KXWA 3A3QA 1LGUA 4GCBA 2BQAA 1G06A 2EKSC 252LA 3ODUA 1IX0A 1L46A 1XFPL 214LA 3UZAA 158LA 132LA 3ABWA 1LHIA 4LFXA 1G07A 4ML7A 5B2NA 1LZGA 5LVGA 5B06A 4YXCA 1EQEA 1JV6A 1IR9A 2F95A 5F9XA 1GF5A 3GUOA 2LYMA 1L45A 1LGWA 1UIGA 3AZ7A 3OE9A 3HTBA 1QSQA 2F47A 221LA 2MEFA 2MEIA 4GPOA 1C8RA 4NWHA 1SQ2L 1UIHA 251LA 2DQIY 171LA 1IXFA 4G7SB 1P64A 3TXJA 1NWGA 1IIZA 1DKKA 4H92A 4LZTA 1YAQA 1T3PA 3QNGA 4ARJA 1L07A 1L10A 1L98A 181LA 2LCBA 1LZAA 1GB5A 1IOQA 226LA 5ETZA 1AM7A 1L91A 1WQRA 1IWVA 4QIDA 3QJVB 2MEGA 1REZA 5IELA 102LA 4A7DA 2KSYA 3WUMA 128LA 232LA 4IATA 1TAYA 1J1PY 5APDA 4H9IA 104LA 127LA 210LA 4GN3A 5L3IA 175LA 5B1GA 5KXOA 1IP2A 1L61A 4ARQB 4AQNA 1GB9A 4I7PA 1L67A 3C81A 4NGLA 1VGOA 4KPMA 1HEPA 3L64A 3RUNA 1XEJA 3AW7A 3HAQA 3G3VA 3CDOA 2QB0B 163LA 2YSSC 5B59A 1LSGA 1RJCB 3QJSB 1OWZA 3LYTA 4BV0A 1KW5A 1L03A 1LZEA 1QDRA 4I7NA 2W1YA 3CSZA 1QTKA 2BLXA 4II8A 3K3TA 4EIYA 1LMNA 4DT3A 3OE6A 2D4JA 4WL7A 2G87A 3N9EA 4ETCA 1L09A 3QBIA 5F8UA 1SWYA 118LA 1DYDA 1L76A 2IFFY 1CV4A 3ZPQA 4KLYA 4GBRA 1QUGA 1LSEA 3HASA 5LYTA 5E9RA 3VW7A 2FBBA 3X3CA 1G7JC 3FADA 1DI4A 5B07A 1OQMA 228LA 5EN0A 1DYBA 1P36A 1DZBX 1LHKA 1LW9A 2YDOA 1SSWA 1C46A 4QGZA 3LHMA 1L49A 2Y01A 147LA 1JHLA 1OYUA 154LA 1WQNA 189LA 4LDOA 4AMIA 1OVHA 1C6DA 4J0LA 1INUA 1BB4A 4H90A 3K2RA 6LYZA 4LT1A 3PWHA 5G36A 5LAFA 4NGKA 3WU8A 1XGUC 3EMSA 1GBWA 3GUIA 2CWIA 1CUQA 1B7MA 1P3NA 5L3HA 2BQGA 4CFPA 1L31A 2ZZLA 5FHWA 3A3RX 199LA 2Z2EA 1JTPL 4I7TA 4N1EI 1H68A 1G1WA 2BQKA 218LA 110LA 4NHQA 1L43A 1JJ0A 1CU2A 2AT9A 4ETDA 3WPLA 2HPYA 1B5VA 215LA 3UTYA 1LTMA 1IC4Y 2HEAA 2KSBA 182LA 4HSFA 4N1CC 1L57A 1UUZC 1VDSA 3D3DA 4NC3A 3WW6A 254LA 3EMLA 5KXMA 4X32A 4WMGA 245LA 1LZ9A 1LOZA 1UCOA 5LWEA 5JENB 3A7KA 2LYOA 1C64A 1QTZA 3LYOA 4G7QB 1YKXX 2PC2A 4B0DA 4I7KA 3A34A 4GN4A 1DYAA 2X0AA 5HLLA 2RSCA 1L47A 1LMTA 1SX7A 3FI7A 3GXKA 148LE 4DD0A 4GBRB 2DQCY 5T3FA 1FLUA 5A45A 4OWCA 1LYDA 170LA 2LHMA 4LYTA 208LA 1KIPC 1U19A 4NHIA 4XJFA 3TMVA 1L18A 2NTWA 4MR1A 173LA 2YBHA 1B5YA 5C6LA 3WL2A 3CT0A 1NMMA 2MEAA 4UG2A 4YEOA 4X1HA 4C3WA 5LYZA 4LT0A 7LZMA 1YKZX 3BKHA 1WQQA 1LYYA 1L90A 2XBSA 1S8JA 1UIDA 1IR7A 1JTNA 1G7MC 1LZBA 3AJNA 4HJZA 3LYMA 1LJFA 4YF2A 155LA 1L73A 2OEAX 1B5XA 1C6EA 1GAYA 1L28A 2Z2FA 1D3JA 3AB6A 1NBYC 4YOPA 4RW2A 2HEDA 5DM9A 2ZIYA 1L38A 2IGCA 1HEMA 4G7RB 4G49A 4NGVA 4EXMA 1FBBA 1QKPA 125LA 4QY9A 4H9AA 4YXAC 1G0LA 4DS7E 3J4GA 5APEA 4GRVA 1F0WA 2YBLA 1QSWA 4I7RA 1KS3A 2BQEA 1L20A 259LA 140LA 1QT5A 2YBIA 246LA 1C10A 2F32A 4HV1A 237LA 3QJTB 1C6CA 5ILCA 4XJBA 1G0PA 1L58A 1KGBA 1N4FA 2Z12A 5TGZA 1YAPA 1P8UA 1L00A 3NY9A 2I35A 4Z46A 5LYMA 180LA 2JAGA 4LFPA 1C08C 1IP7A 4MQTA 3B0OA 3DN0A 4DD1A 3WQJA 2ZFEA 2YDGA 3ZEKA 1D0KA 1KNIA 4HPEA 2YCWA 5DN4A 1QUHA 3BKVA 5DHHA 5LVJA 1P37A 1LYJA 4B1AA 3S3DB 4DD2A 4XJHA 239LA 1GFVA 1TDYA 229LA 4W58A 2RBQA 235LA 2XBRA 4N8ZA 3AYNA 1LYHA 5AHYA 4I7LA 4RLNA 109LA 4BAFA 1JV7A 4YENA 1JFPA 1QT8A 1XGQC 2XTHA 5APCA 1L08A 5B35A 1CKHA 4B4JA 1GHLA 1LJ4A 1LMQA 3L2XA 1GFJA 2RBNA 1JJ3A 2HUMA 1XEKA 4DYGA 2HEEA 2DQJY 4OV0A 3EXDA 225LA 3A91A 3QJQB 1HFZA 1JITA 3T45A 2Q9EA 4N0JA 5C6JA 2I1XA 5IHGA 1GXXA 4BADA 4N6HA 1HERA 3GUPA 1EL1A 1T8GA 1JKDA 1G7LC 1FKVA 5KXXA 1LN6A 2WARA 4J7VA 3VI0A 4UWNA 4D9ZA 1GF4A 1L16A 5LVKA 4PXKA 157LA 1GB3A 3AZ4A 1IW6A 1CKCA 1L79A 2LZ2A 1L66A 4RDSA 3QAKA 1LYIA 1VATA 5C1MA 1L80A 1ZMYL 2RAZX 1L50A 3TXHA 1PXRA 2B6WA 4BAPA 5LIOA 3WXTA 5LA5A 5LVHA 4JKVA 4X31A 1BVXA 3S3CB 1IP1A 1QIOA 2BQIA 4LYZA 2LNLA 3RW8A 5APFA 167LA 1J1XY 1GF0A 1L81A 1L84A 4UWUA 1C6IA 3DN6A 3TXBA 107LA 4XXJA 3QDCA 3W6AA 1QTDA 1IY3A 2HECA 2ANVA 3ATOA 1L85A 1L51A 5F16A 3N9AA 3HU9A 4LT3A 1B9OA 1JWRA 1DKJA 1L75A 4DQ7A 4OWHA 2H9JA 5H2PA 2MEHA 3JR6A 1MLCE 2MEBA 1LJKA 1QDTA 1DZEA 4GCDA 4NGWA 3IJUA 4WO6A 2D6BA 1EHKB 159LA 1IWWA 1VJMA 137LA 1L96A 1LMOA 5ITCA 4N4YB 3T6UA 2QPEB 4JR8A 3HT7A 1BVKC 3C82A 3V2YA 4FPDA 1T6VL 1QTCA 191LA 2B72A 1TCYA 3A6CY 219LA 260LA 4MSTA 4WG1A 3RZ4A 1GF3A 1L26A 1IY4A 1LZ8A 1PS5A 4K5YA 4GCEA 2NWDX 3KJ6A 1LHMA 3WXUA 2Y8PA 1FLYA 222LA 1OUBA 1LJJA 3QY4A 183LA 3C9LA 4S0WA 2BQCA 3TMUA 4HTNA 1L24A 3HTDA 2LYZA 2ZQ3A 4G9SA 3PDSA 1L06A 1GFHA 1G0MA 4FA7B 1GB0A 2NTGA 1QT4A 5B34A 1CNSA 3A94A 3LZ2A 3QJRB 135LA 1FDLY 2DKVA 1YANA 4PXFA 4WLYA 5B6YA 2OTZX 1VDTA 1JSEA 230LA 1I56A 1K28A 186LA 3GUMA 1L55A 4W59A 1OVJA 2ANXA 4WM6A 1L89A 4NGYA 5B0WA 4I7MA 2WJKA 1NHBA 4IARA 4KNFA 1P46A 2B6YA 4H1PA 4HJVA 5LVIA 2DQFC 4UHRA 2Z37A 1S8LA 1LSBA 5FSTA 4MQSA 133LA 3EH4B 2VB1A 1XEPA 4TL3A 2QARC 1LJHA 1REYA 220LA 1L9HA 4G4CA 1NDMC 4NFVA 2YBMA 4MCKA 3RU5A 1QS9A 3B0KA 3A90A 1L33A 1C69A 2HUKA 1LZSA 2DQEY 3SB5A 1HEQA 3W6FA 4ETEA 1CJ9A 1CU0A 1GWDA 206LA 241LA 1GEVA 1C6FA 5LA8A 1P5CA 5J7AA 1JUGA 2DBTA 3ZPRA 1ZURA 2O4WA 1GDXA 5H2HA 1L65A 1LLHA 6LZMA 4J4QA 3WYHA 1L04A 1L64A 1B5ZA 1H87A 120LA 3WPJA 3D9AC 1EPYA 5G2AA 3REYA 3HUQA 1CV1A 1B2KA 1L22A 5AX0A 1QQYA 2CGIA 1T6HA 4NG1A 2ZQ4A 5F9UA 115LA 1LJNA 4LYMA 3GXRA 1OV7A 1TEWA 4W52A 1IP3A 2W1LA 1LYOA 1P8HA 3SB9A 164LA 2HTXA 1UC0A 2OTYX 4H9CA 3HH5A 1LHHA 5HNCA 3DMXA 1C60A 5FELA 2RB0X 1LJGA 1FKQA 5KXLA 3V2WA 3FI5A 1QTEA 187LA 1L95A 1GAZA 1FLWA 224LA 1G0KA 243LA 1LMPA 3HTGA 1GE1A 1D6QA 2XQOA 1CWQA 1ZV5L 2EIZC 1KIQC 1M0KA 5AHZA 4I7SA 1DPWA 2ZWBA 195LA 3COCA 3AGIA 1PQMA 174LA 1MELL 2IHLA 4NWEA 1YAOA 4ZIXA 150LA 2RBRA 4IAPA 5I54A 177LA 193LA 1HSWA 1L72A 152LA 1XGPC 112LA 1HZXA 1G0QA 4DAJA 5KKJA 231LA 234LA 1L35A 5I14A 5ITEA 2QPDB 240LA 233LA 4LZMA 1LWGA 1XGRC 1KXYA 1LYFA 1X0SA 3DN4A 1GB7A 4H94A 4DWXA 3NS0A 119LA 1GE2A 3E3DA 3W3EA 1BWIA 1C6MA 4IJ4A 4PPOA 1L15A 1QTHA 1QUOA 4OO9A 1T8AA 5I4WA 1DQJC 2LC9A 1UICA 2MECA 2DQAA 1DXJA 1SWZA 2I20A 4ZFPA 4DD9A 1KMEA 4HTKA 1LSYA 1PQOA 1T8FA 5HQ1A 4YX7C 1O0AA 3M18B 1BRRA 1LZ6A 258LA 4NSIA 3HBHA 3N9CA 4LYOA 1IWZA 1D2YA 3SP3A 5FDJA 1TN5A 1EQ4A 1L19A 1C63A 3VVKA 1D3MA 5KXKA 3G3AB 1L68A 1JISA 1GFRA 1L0MA 4HP0A 1L02A 3AM6A 1PQJA 223LA 1GBXA 4WAVA 3HTFA 1YIKA 144LA 4AXTA 2BLYA 4MD1A 5A44A 1LAAA 1L48A 2BQBA 1LMAA 2NTHA 2ZYPA 1FBKA 2ZIKA 3QBKA 1RI8B 1JTOL 4B4IA 1QSBA 209LA 1WQOA 2B75A 3C80A 1JIYA 103LA 1AKIA 4HV2A 4I7QA 5G54A 1L40A 1SSYA 4X3BA 1Z55A 4WW3A 2HEFA 2BQNA 3MBVA 1IR8A 1L82A 3DNAA 1QUSA 216LA 1GFTA 1C6KA 2B6TA 5J7CA 1JKBA 5KJ9A 3J6KA 1VAUA 5DLAA 4FDYA 3P4ZA 3DN1A 5BR5A 4EKSA 1C6HA 3FE0A 1L63A 2Z6BA 3HUKA 166LA 1IORA 2OE9X 1LZYA 2ZNXY 4ETAA 1XMEB 3HARA 1V7SA 2EI4A 1NDGC 3DMVA 3SB7A 5G2CA 5KXYA 3MGWA 4KXIA 1H2SA 4QDNA 1L42A 4A4MA 1C62A 4NHPA 2RH1A 4AMJA 1QT7A 1L12A 1L14A 3C7ZA 4H9BA 5H2OA 108LA 1L88A 3SN6R 1JTMA 1LZ4A 1D3FA 5A3ZA 1CX6A 4WM5A 5H2IA 3IJVA 1CV3A 5DYSA 213LA 1BB6A 5FJGA 2XJWA 3F8VA 1GFGA 3WUNA 5KXTA 3DMZA 1FBIX 1B7RA 1LJIA 1B7OA 4ET9A 3OE0A 5K7OA 3HAPA 5H2KA 4WLXA 2B70A 4CJ2A 3AW6A 2F30A 4XT3A 4PRUA 1L94A 1B6IA 1KXXA 1UBZA 1L17A 1C8SA 2AUBA 1I1ZA 2DQDY 1GZMA 2Z73A 1CJ6A 5E4PA 1VDQA 2RBPA 4DD3A 4LGKA 4H8YA 1VEDA 244LA 2ZIJA 3CB7A 4NHSA 1G7HC 253LA 3UTWA 1BB7A 3VHZA 1F6SA 2GV0A 1F50A 2BQDA 3WVXA 1E12A 2H5ZA 142LA 1L83A 3CSRA 3WU7A 4YM8A 4Z3MA 3W6DA 4XTLA 1M0MA 4CHXA 1P2LA 5A3EA 4XADA 1C3WA 3WU9A 3OAXA 149LA 2DQGY 1L0KA 5F14A 4BVNA 3CDQA 2M3GA 1L92A 1GPQC 2D91A 4LDLA 4NSGA 2Z19A 1QKOA 3A92A 5B6VA 3RFMA 3IWRA 1AP9A 3QE8A 1LZ5A 3C8SA 2Y00A 1L32A 190LA 4MD2A 1CX7A 1GBZA 4NGIA 3ZEVA 3A95A 3CQLA 4NHTA 2BAAA 4N4WA 1L29A 3KAMA 4FBZA 1QUTA 1TBYA 4H9FA 1GB2A 4UWVA 2B73A 4I7OA 1P2RA 6LYTA 3P66A 1F6RA 1HF4A 185LA 1LSCA 3C83A 3F6ZA 5KXZA 129LA 248LA 2YCYA 151LA 1B0DA 1C43A 1LSAA 5KXPA 1L62A 1IO5A 3WPKA 1NBZC 4IAQA 1KW7A 4OWBA 2R4RA 2A7DA 1HHLA 1QHJA 5H2JA 3EO5A 2Z55A 1WVUA 2R4SA 4G72B 3CT5A 3WH1A 4HTQA 4WLTA 160LA 1HNLA 1XGTC 3DKEX 4XENA 4ARLA 1QT6A 3AZ6A 4WM4A 3W6EA 2JAFA 1IP5A 1L27A 131LA 4IB4A 3CSQA 4EKRA 4XJGA 2LZTA 4EPFA 3C7YA 1L05A 1WTMA 1E8LA 4W94A 4I0CA 3CODA 1LJ3A 126LA 4QI1A 1WVVA 1JQUA 4XYYA 4W96A 1L52A 1JGJA 143LA 1L54A 1SLYA 4EOFA 3TXFA 5KY1A 1YROA 3FA0A 1L97A 1LWKA 3P65A 5B6ZA 3LYZA 1LJEA 2YCZA 7LYZA 1F88A 4W51A 1XSFA 5AZDA 3WW5A 146LA 1L60A 4FJRA 5JJEA 1JSFA 1CU3A 5DHGA 8LYZA 2HEBA 1HFYA 3PQRA 1L34A 1HMKA 1LZDA 1HC0A 3P0GA 4Z41A 3T36A 1JTTL 1A4VA 3TXEA 2ZILA 1NHEA 1S53A 1C6PA 1GBYA 1LSDA 1PZYA 161LA 1JJ1A 4DDCA 1CKGA 3QJUB 4ANRA 4HJYA 4XN6A 4BWBA 247LA 3SB8A 1I6SA 5B05A 2B74A 3GULA 4BEYA 1DPXA 1L87A 1B5UA 1LSMA 4BEZA 1L93A 1LSFA 1QTBA 5C6IA 1OVKA 1AZFA 2EQLA 188LA 1LSPA 5KXRA 1CTWA 4G70B 5G2DA 4E3UA 1CUPA 5DN5A 1IW9A 1L70A 3NY8A 4DDBA 145LA 1LZRA 3SBAA 156LA 3AZ5A 4PGJB 1F4ZA 1PQKA 1ZVYB 1G1VA 1RCMA 5B6WA 3OJPA 4RLMA 3HH3A 257LA 5HMJA 1LZNA 5LZMA 212LA 3X3BA 1GFEA 1BWJA 1L36A 1QUDA 2Q0MX 4GCFA 4L6RA 3VG9A 1QS5A 2BQJA 1W6ZA 1IC7Y 4WOAA 1CU6A 2ZNWY 4KT3A 2BQFA 113LA 1L41A 1HEOA 249LA 1LZ1A 5FEKA 2F4GA 5A8EA 2OU8A 4NGZA 1LGXA 5F81A 3DN3A 2CJLA 1GFKA 4MBSA 1NF5A 2F93A 5I53A 5G28A 1L44A 1YKYX 1LI6A 1L77A 1YAMA 1KY0A 2Y04A 4L41A 1OUHA 4HWLA 1LSZA 3C8RA 1SX2A 2YDVA 2OE4X 4PJ2C 4DD7A 4I8SA 3GUJA 242LA 1GF7A 4NGJA 4DQJA 1GB8A 3OE8A 1BHZA 1HMLA 2BQLA 4H9EA 3CDRA 1PQIA 4OWAA 1DYFA 3CAPA 4GP8B 1R84A 1XEIA 2HU3A 3VGAA 2HUBA 1GF6A 1DYEA 139LA 255LA 1LSNA 4CFOA 2I26L 4GYCA 1CKFA 4HYXA 1GBSA 1CJ7A 1MGYA 122LA 3B0IA 1UIFA 3A67Y 2VT4A 4GLAA 4P2EA 1B7SA 3HT8A 2Y02A 1L53A 2YBNA 3HT6A 1OV5A 5B1FA 4OOOA 3WMKA 3ULRA 1BM1A 1OWYA 9LYZA 1GD6A 1CU5A 1XIOA 1LKRA 4M6DA 3DDLA 3HFMY 3F9LA 1X0I1 1RFPA 1O23A 4H93A 4PK0A 3OK0A 1IOCA 2Z38A 1L39A 1W08A 3TXGA 1C6BA 4OWEA 1HELA 3G3XA 1QM8A 1ZWNA 1L25A 1C45A 178LA 1IP6A 1BB3A 4WM1A 1BWHA 3HBDA 5BR2A 2RAYX 1LPIA 1WQMA 1J1OY 1FN5A 1LHJA 3HH4A 4NGOA 4LDEA 4YEMA 3AGGG 1B7PA 1WQPA 2CDSA 5AWZA 3VWOA 1IP4A 3HDFA 1YILA 250LA 4TWSA 4J1BA 4ET8A 3AGHA 2B5ZA 3HANA 1D3NA 1C67A 141LA 165LA 1P8IA 3CT1A 4ZEEA 1P2CC 2MEDA 1B7QA 1LYGA 1QTVA 4EKPA 1C7PA 1ZYTA 2F2NA 238LA 196LA 1BGIA 4TSBA 236LA 5JJJA 4KL7A 1G7IC 4HYJA 1TN0A 176LA 1JEFA 4EPIA 4G71B 1L69A 3UG9A 1XJTA 4DKLA 1R2NA 2EPEA 5HNLA 1CV6A 2RBSA 4ZPUA 3TXIA 3ATNA 2BPUA 4OOTA 2B6XA 1B5WA 111LA 1IEEA 1IOTA 1L71A 3WULA 1IWXA 3UONA 1IOSA 1E0PA 2BRDA 3EH3B 4W53A 5DL9A 4LYBA 1OUCA 1IWTA 1C6NA 1D6PA 2YVBA 4WM3A 1D0MA 1V7TA 4TTDA 4XTNA 4XT1A 4B49A 2N5ZA 1JKAA 1L21A 2C8OA 4BUOA 3C8QA 3CDTA 4NEBA 1OP9B 4ARMA 3LN2A 1UIEA 1LHLA 2L6XA 169LA 3HU8A 5AMYA 2OU0X 3B72A 1C6QA 4DC4A 5H2MA 1GF8A 3NYAA 3QBGA 5I4YA 1VDPA 2ZYCA 2FBDA 2NTUA 1XJUA 198LA 211LA 3UTVA 1DI5A 3S8GB 2Z39A 5AX1A 1P6YA 4RW1A 1CKDA 200LA 1HSXA 1P7SA 1JPOA 1KG9A 2J4YA 1YL0X 1DYCA 1GE4A 2YBJA 4XJIA 3EH5B 192LA 4GP4B 1KIRC 114LA 2MEEA 1BQLY 1D9UA 2BQHA 1IC5Y 4GN5C 1L99A 2RBOA 4XJDA 3WVYA 3PXOA 2A4TA 1YL1X 1HFXA 1C6GA 3HDEA 2G4QA 5KXSA 5L9JA 217LA 3ZVQA 1CVKA 194LA 4J1AA 1QT3A 3RZEA 2Q9DA 4H8XA 1D9WA 3D4SA 5LAGA 4TUNA 1Q5JA 1L59A 4CGEA 2I25L 197LA 3GUKA 3W6BA 261LA 1GE3A 1KG8A 4R0FA 1H6MA 3SB6A 2O7AA 1D0LA 4L35A 1UIBA 5ILFA 1OUAA 1I20A 1LKSA 1L01A 1T97A 1C68A 4DQ5A 1D2WA 1DI3A 5I4XA 1LMCA 3W6CA 4EMNA 1GB6A 2BQMA 1LCNA 5JJNA 3C7WA 5HMVA 1L13A 1ZVHL 3AYQA 1IVMA 1L86A 4W56A 1CJ8A 262LA 3HAOA 1L37A 1LI2A 1S51A 1C65A 4GP5B 4FAAB 3HH6A 1PY6A 4WM2A 3S3BB 201LA 4H9HA 5M1YA 1C6TA 4ARMB 2HU1A 3SBBC 2F4AA 2I6ZA 1C66A 2G4PA 4PJZA 4M4OA 1CV0A 1LPYA 4XTOA 4PHIA 2OE7X 1OUGA 4NG8A 3RNXA 1LYEA 3EBAB 3A8ZA 1JKCA 1GDWA 5LXWA 134LA 4GCCA 1Q5IA 3TMWA 1C6LA 1IWUA 4LT2A 153LA 2A7FA 3RT5X 1L11A 1P56A 5KKHA 1X0K1 3DQBA 1GXV2
chains in the Genus database with same CATH topology
1HEWA 3TMXA 4DDAA 1A2YC 4DJHA 2YCXA 1LYZA 3TXKA 3P68A 2B7XA 1G0JA 1ALCA 3BVDB 4NY5A 1REXA 130LA 1B7LA 3UTXA 3A93A 5KXNA 3LZTA 4IASA 4Z98A 1UA6Y 4TSCA 5KKIA 4WL6A 1GU8A 1UIAA 4O34A 3ZVQB 3P64A 4G4HA 4NSHA 1GF9A 3G3WA 4WLDA 1NKHA 2CUUA 1OUDA 5IDDA 1L30A 5II3A 3CDVA 1C6JA 1L56A 2OU9A 2B6ZA 5H2NA 1B7NA 3HT9A 5B6XA 2RB1X 4ETBA 1GFAA 4U3XB 3S8FB 1PXSA 2FYCA 3UZCA 3TXDA 2Z18A 2D4KA 4QRYA 2W1XA 5LINA 1M0LA 3NSBA 1LI3A 1DYGA 5FCPA 1LZCA 1OUIA 2PEDA 4NIJA 1KY1A 1TLAA 2I21A 1VFBC 4WG7A 3QAPA 1C61A 4WO9A 3HBEX 1GE0A 5I5QA 1EQ5A 1HENA 2O79A 4Y9HA 3A6BY 1S52A 205LA 1BRXA 5D5CA 1AT5A 2RB2X 4R6CA 2KS9A 5D5FA 2D4IA 5H2LA 1C6AA 207LA 5G53A 3WUAA 4N9RA 4NSJA 4G4BA 1KXWA 1GUEA 2W1MA 1AT6A 2KSAA 1UAZA 4C5FA 184LA 1F10A 4EA3A 4ARPA 168LA 1GBOA 1IWYA 4BS7A 1WTNA 1UACY 1UCQA 172LA 1CV5A 2X72A 1BB5A 2C8PA 256LA 227LA 4W54A 2WJLA 1L74A 4EJ4A 1S54A 2L78A 1GFUA 3B6LA 4W55A 1L0JA 2Y03A 1QSAA 2G4NA 3DN2A 4OW1A 123LA 3AYMA 4LYCA 4TX7A 1WTHA 1OUFA 1NQIA 4E97A 3DN8A 2BQOA 162LA 1FLQA 1OUEA 4ARQA 1G0GA 1L23A 1YQVY 4H8ZA 138LA 1AT9A 4EKQA 2LZMA 1PQDA 3HWLA 2DQHY 1LYSA 4W57A 3M3UA 4H91A 4I7JA 1LZTA 2FYDA 4HPIA 4B4EA 3PBLA 3C9MA 4AGAA 4N5RA 4JQ6A 1REMA 3A96A 1GEZA 1XJIA 2F2QA 3G3BB 1OUJA 3HUAA 3QBLA 3GUNA 1RE2A 4QEQA 1BRDA 4PRQA 2H9KA 2HULA 3LZMA 5EBHA 4GLVA 5KXWA 3A3QA 1LGUA 4GCBA 2BQAA 1G06A 2EKSC 252LA 3ODUA 1IX0A 1L46A 1XFPL 214LA 3UZAA 158LA 132LA 3ABWA 1LHIA 4LFXA 1G07A 4ML7A 5B2NA 1LZGA 5LVGA 5B06A 4YXCA 1EQEA 1JV6A 1IR9A 2F95A 5F9XA 1GF5A 3GUOA 2LYMA 1L45A 1LGWA 1UIGA 3AZ7A 3OE9A 3HTBA 1QSQA 2F47A 221LA 2MEFA 2MEIA 4GPOA 1C8RA 4NWHA 1SQ2L 1UIHA 251LA 2DQIY 171LA 1IXFA 4G7SB 1P64A 3TXJA 1NWGA 1IIZA 1DKKA 4H92A 4LZTA 1YAQA 1T3PA 3QNGA 4ARJA 1L07A 1L10A 1L98A 181LA 2LCBA 1LZAA 1GB5A 1IOQA 226LA 5ETZA 1AM7A 1L91A 1WQRA 1IWVA 4QIDA 3QJVB 2MEGA 1REZA 5IELA 102LA 4A7DA 2KSYA 3WUMA 128LA 232LA 4IATA 1TAYA 1J1PY 5APDA 4H9IA 104LA 127LA 210LA 4GN3A 5L3IA 175LA 5B1GA 5KXOA 1IP2A 1L61A 4ARQB 4AQNA 1GB9A 4I7PA 1L67A 3C81A 4NGLA 1VGOA 4KPMA 1HEPA 3L64A 3RUNA 1XEJA 3AW7A 3HAQA 3G3VA 3CDOA 2QB0B 163LA 2YSSC 5B59A 1LSGA 1RJCB 3QJSB 1OWZA 3LYTA 4BV0A 1KW5A 1L03A 1LZEA 1QDRA 4I7NA 2W1YA 3CSZA 1QTKA 2BLXA 4II8A 3K3TA 4EIYA 1LMNA 4DT3A 3OE6A 2D4JA 4WL7A 2G87A 3N9EA 4ETCA 1L09A 3QBIA 5F8UA 1SWYA 118LA 1DYDA 1L76A 2IFFY 1CV4A 3ZPQA 4KLYA 4GBRA 1QUGA 1LSEA 3HASA 5LYTA 5E9RA 3VW7A 2FBBA 3X3CA 1G7JC 3FADA 1DI4A 5B07A 1OQMA 228LA 5EN0A 1DYBA 1P36A 1DZBX 1LHKA 1LW9A 2YDOA 1SSWA 1C46A 4QGZA 3LHMA 1L49A 2Y01A 147LA 1JHLA 1OYUA 154LA 1WQNA 189LA 4LDOA 4AMIA 1OVHA 1C6DA 4J0LA 1INUA 1BB4A 4H90A 3K2RA 6LYZA 4LT1A 3PWHA 5G36A 5LAFA 4NGKA 3WU8A 1XGUC 3EMSA 1GBWA 3GUIA 2CWIA 1CUQA 1B7MA 1P3NA 5L3HA 2BQGA 4CFPA 1L31A 2ZZLA 5FHWA 3A3RX 199LA 2Z2EA 1JTPL 4I7TA 4N1EI 1H68A 1G1WA 2BQKA 218LA 110LA 4NHQA 1L43A 1JJ0A 1CU2A 2AT9A 4ETDA 3WPLA 2HPYA 1B5VA 215LA 3UTYA 1LTMA 1IC4Y 2HEAA 2KSBA 182LA 4HSFA 4N1CC 1L57A 1UUZC 1VDSA 3D3DA 4NC3A 3WW6A 254LA 3EMLA 5KXMA 4X32A 4WMGA 245LA 1LZ9A 1LOZA 1UCOA 5LWEA 5JENB 3A7KA 2LYOA 1C64A 1QTZA 3LYOA 4G7QB 1YKXX 2PC2A 4B0DA 4I7KA 3A34A 4GN4A 1DYAA 2X0AA 5HLLA 2RSCA 1L47A 1LMTA 1SX7A 3FI7A 3GXKA 148LE 4DD0A 4GBRB 2DQCY 5T3FA 1FLUA 5A45A 4OWCA 1LYDA 170LA 2LHMA 4LYTA 208LA 1KIPC 1U19A 4NHIA 4XJFA 3TMVA 1L18A 2NTWA 4MR1A 173LA 2YBHA 1B5YA 5C6LA 3WL2A 3CT0A 1NMMA 2MEAA 4UG2A 4YEOA 4X1HA 4C3WA 5LYZA 4LT0A 7LZMA 1YKZX 3BKHA 1WQQA 1LYYA 1L90A 2XBSA 1S8JA 1UIDA 1IR7A 1JTNA 1G7MC 1LZBA 3AJNA 4HJZA 3LYMA 1LJFA 4YF2A 155LA 1L73A 2OEAX 1B5XA 1C6EA 1GAYA 1L28A 2Z2FA 1D3JA 3AB6A 1NBYC 4YOPA 4RW2A 2HEDA 5DM9A 2ZIYA 1L38A 2IGCA 1HEMA 4G7RB 4G49A 4NGVA 4EXMA 1FBBA 1QKPA 125LA 4QY9A 4H9AA 4YXAC 1G0LA 4DS7E 3J4GA 5APEA 4GRVA 1F0WA 2YBLA 1QSWA 4I7RA 1KS3A 2BQEA 1L20A 259LA 140LA 1QT5A 2YBIA 246LA 1C10A 2F32A 4HV1A 237LA 3QJTB 1C6CA 5ILCA 4XJBA 1G0PA 1L58A 1KGBA 1N4FA 2Z12A 5TGZA 1YAPA 1P8UA 1L00A 3NY9A 2I35A 4Z46A 5LYMA 180LA 2JAGA 4LFPA 1C08C 1IP7A 4MQTA 3B0OA 3DN0A 4DD1A 3WQJA 2ZFEA 2YDGA 3ZEKA 1D0KA 1KNIA 4HPEA 2YCWA 5DN4A 1QUHA 3BKVA 5DHHA 5LVJA 1P37A 1LYJA 4B1AA 3S3DB 4DD2A 4XJHA 239LA 1GFVA 1TDYA 229LA 4W58A 2RBQA 235LA 2XBRA 4N8ZA 3AYNA 1LYHA 5AHYA 4I7LA 4RLNA 109LA 4BAFA 1JV7A 4YENA 1JFPA 1QT8A 1XGQC 2XTHA 5APCA 1L08A 5B35A 1CKHA 4B4JA 1GHLA 1LJ4A 1LMQA 3L2XA 1GFJA 2RBNA 1JJ3A 2HUMA 1XEKA 4DYGA 2HEEA 2DQJY 4OV0A 3EXDA 225LA 3A91A 3QJQB 1HFZA 1JITA 3T45A 2Q9EA 4N0JA 5C6JA 2I1XA 5IHGA 1GXXA 4BADA 4N6HA 1HERA 3GUPA 1EL1A 1T8GA 1JKDA 1G7LC 1FKVA 5KXXA 1LN6A 2WARA 4J7VA 3VI0A 4UWNA 4D9ZA 1GF4A 1L16A 5LVKA 4PXKA 157LA 1GB3A 3AZ4A 1IW6A 1CKCA 1L79A 2LZ2A 1L66A 4RDSA 3QAKA 1LYIA 1VATA 5C1MA 1L80A 1ZMYL 2RAZX 1L50A 3TXHA 1PXRA 2B6WA 4BAPA 5LIOA 3WXTA 5LA5A 5LVHA 4JKVA 4X31A 1BVXA 3S3CB 1IP1A 1QIOA 2BQIA 4LYZA 2LNLA 3RW8A 5APFA 167LA 1J1XY 1GF0A 1L81A 1L84A 4UWUA 1C6IA 3DN6A 3TXBA 107LA 4XXJA 3QDCA 3W6AA 1QTDA 1IY3A 2HECA 2ANVA 3ATOA 1L85A 1L51A 5F16A 3N9AA 3HU9A 4LT3A 1B9OA 1JWRA 1DKJA 1L75A 4DQ7A 4OWHA 2H9JA 5H2PA 2MEHA 3JR6A 1MLCE 2MEBA 1LJKA 1QDTA 1DZEA 4GCDA 4NGWA 3IJUA 4WO6A 2D6BA 1EHKB 159LA 1IWWA 1VJMA 137LA 1L96A 1LMOA 5ITCA 4N4YB 3T6UA 2QPEB 4JR8A 3HT7A 1BVKC 3C82A 3V2YA 4FPDA 1T6VL 1QTCA 191LA 2B72A 1TCYA 3A6CY 219LA 260LA 4MSTA 4WG1A 3RZ4A 1GF3A 1L26A 1IY4A 1LZ8A 1PS5A 4K5YA 4GCEA 2NWDX 3KJ6A 1LHMA 3WXUA 2Y8PA 1FLYA 222LA 1OUBA 1LJJA 3QY4A 183LA 3C9LA 4S0WA 2BQCA 3TMUA 4HTNA 1L24A 3HTDA 2LYZA 2ZQ3A 4G9SA 3PDSA 1L06A 1GFHA 1G0MA 4FA7B 1GB0A 2NTGA 1QT4A 5B34A 1CNSA 3A94A 3LZ2A 3QJRB 135LA 1FDLY 2DKVA 1YANA 4PXFA 4WLYA 5B6YA 2OTZX 1VDTA 1JSEA 230LA 1I56A 1K28A 186LA 3GUMA 1L55A 4W59A 1OVJA 2ANXA 4WM6A 1L89A 4NGYA 5B0WA 4I7MA 2WJKA 1NHBA 4IARA 4KNFA 1P46A 2B6YA 4H1PA 4HJVA 5LVIA 2DQFC 4UHRA 2Z37A 1S8LA 1LSBA 5FSTA 4MQSA 133LA 3EH4B 2VB1A 1XEPA 4TL3A 2QARC 1LJHA 1REYA 220LA 1L9HA 4G4CA 1NDMC 4NFVA 2YBMA 4MCKA 3RU5A 1QS9A 3B0KA 3A90A 1L33A 1C69A 2HUKA 1LZSA 2DQEY 3SB5A 1HEQA 3W6FA 4ETEA 1CJ9A 1CU0A 1GWDA 206LA 241LA 1GEVA 1C6FA 5LA8A 1P5CA 5J7AA 1JUGA 2DBTA 3ZPRA 1ZURA 2O4WA 1GDXA 5H2HA 1L65A 1LLHA 6LZMA 4J4QA 3WYHA 1L04A 1L64A 1B5ZA 1H87A 120LA 3WPJA 3D9AC 1EPYA 5G2AA 3REYA 3HUQA 1CV1A 1B2KA 1L22A 5AX0A 1QQYA 2CGIA 1T6HA 4NG1A 2ZQ4A 5F9UA 115LA 1LJNA 4LYMA 3GXRA 1OV7A 1TEWA 4W52A 1IP3A 2W1LA 1LYOA 1P8HA 3SB9A 164LA 2HTXA 1UC0A 2OTYX 4H9CA 3HH5A 1LHHA 5HNCA 3DMXA 1C60A 5FELA 2RB0X 1LJGA 1FKQA 5KXLA 3V2WA 3FI5A 1QTEA 187LA 1L95A 1GAZA 1FLWA 224LA 1G0KA 243LA 1LMPA 3HTGA 1GE1A 1D6QA 2XQOA 1CWQA 1ZV5L 2EIZC 1KIQC 1M0KA 5AHZA 4I7SA 1DPWA 2ZWBA 195LA 3COCA 3AGIA 1PQMA 174LA 1MELL 2IHLA 4NWEA 1YAOA 4ZIXA 150LA 2RBRA 4IAPA 5I54A 177LA 193LA 1HSWA 1L72A 152LA 1XGPC 112LA 1HZXA 1G0QA 4DAJA 5KKJA 231LA 234LA 1L35A 5I14A 5ITEA 2QPDB 240LA 233LA 4LZMA 1LWGA 1XGRC 1KXYA 1LYFA 1X0SA 3DN4A 1GB7A 4H94A 4DWXA 3NS0A 119LA 1GE2A 3E3DA 3W3EA 1BWIA 1C6MA 4IJ4A 4PPOA 1L15A 1QTHA 1QUOA 4OO9A 1T8AA 5I4WA 1DQJC 2LC9A 1UICA 2MECA 2DQAA 1DXJA 1SWZA 2I20A 4ZFPA 4DD9A 1KMEA 4HTKA 1LSYA 1PQOA 1T8FA 5HQ1A 4YX7C 1O0AA 3M18B 1BRRA 1LZ6A 258LA 4NSIA 3HBHA 3N9CA 4LYOA 1IWZA 1D2YA 3SP3A 5FDJA 1TN5A 1EQ4A 1L19A 1C63A 3VVKA 1D3MA 5KXKA 3G3AB 1L68A 1JISA 1GFRA 1L0MA 4HP0A 1L02A 3AM6A 1PQJA 223LA 1GBXA 4WAVA 3HTFA 1YIKA 144LA 4AXTA 2BLYA 4MD1A 5A44A 1LAAA 1L48A 2BQBA 1LMAA 2NTHA 2ZYPA 1FBKA 2ZIKA 3QBKA 1RI8B 1JTOL 4B4IA 1QSBA 209LA 1WQOA 2B75A 3C80A 1JIYA 103LA 1AKIA 4HV2A 4I7QA 5G54A 1L40A 1SSYA 4X3BA 1Z55A 4WW3A 2HEFA 2BQNA 3MBVA 1IR8A 1L82A 3DNAA 1QUSA 216LA 1GFTA 1C6KA 2B6TA 5J7CA 1JKBA 5KJ9A 3J6KA 1VAUA 5DLAA 4FDYA 3P4ZA 3DN1A 5BR5A 4EKSA 1C6HA 3FE0A 1L63A 2Z6BA 3HUKA 166LA 1IORA 2OE9X 1LZYA 2ZNXY 4ETAA 1XMEB 3HARA 1V7SA 2EI4A 1NDGC 3DMVA 3SB7A 5G2CA 5KXYA 3MGWA 4KXIA 1H2SA 4QDNA 1L42A 4A4MA 1C62A 4NHPA 2RH1A 4AMJA 1QT7A 1L12A 1L14A 3C7ZA 4H9BA 5H2OA 108LA 1L88A 3SN6R 1JTMA 1LZ4A 1D3FA 5A3ZA 1CX6A 4WM5A 5H2IA 3IJVA 1CV3A 5DYSA 213LA 1BB6A 5FJGA 2XJWA 3F8VA 1GFGA 3WUNA 5KXTA 3DMZA 1FBIX 1B7RA 1LJIA 1B7OA 4ET9A 3OE0A 5K7OA 3HAPA 5H2KA 4WLXA 2B70A 4CJ2A 3AW6A 2F30A 4XT3A 4PRUA 1L94A 1B6IA 1KXXA 1UBZA 1L17A 1C8SA 2AUBA 1I1ZA 2DQDY 1GZMA 2Z73A 1CJ6A 5E4PA 1VDQA 2RBPA 4DD3A 4LGKA 4H8YA 1VEDA 244LA 2ZIJA 3CB7A 4NHSA 1G7HC 253LA 3UTWA 1BB7A 3VHZA 1F6SA 2GV0A 1F50A 2BQDA 3WVXA 1E12A 2H5ZA 142LA 1L83A 3CSRA 3WU7A 4YM8A 4Z3MA 3W6DA 4XTLA 1M0MA 4CHXA 1P2LA 5A3EA 4XADA 1C3WA 3WU9A 3OAXA 149LA 2DQGY 1L0KA 5F14A 4BVNA 3CDQA 2M3GA 1L92A 1GPQC 2D91A 4LDLA 4NSGA 2Z19A 1QKOA 3A92A 5B6VA 3RFMA 3IWRA 1AP9A 3QE8A 1LZ5A 3C8SA 2Y00A 1L32A 190LA 4MD2A 1CX7A 1GBZA 4NGIA 3ZEVA 3A95A 3CQLA 4NHTA 2BAAA 4N4WA 1L29A 3KAMA 4FBZA 1QUTA 1TBYA 4H9FA 1GB2A 4UWVA 2B73A 4I7OA 1P2RA 6LYTA 3P66A 1F6RA 1HF4A 185LA 1LSCA 3C83A 3F6ZA 5KXZA 129LA 248LA 2YCYA 151LA 1B0DA 1C43A 1LSAA 5KXPA 1L62A 1IO5A 3WPKA 1NBZC 4IAQA 1KW7A 4OWBA 2R4RA 2A7DA 1HHLA 1QHJA 5H2JA 3EO5A 2Z55A 1WVUA 2R4SA 4G72B 3CT5A 3WH1A 4HTQA 4WLTA 160LA 1HNLA 1XGTC 3DKEX 4XENA 4ARLA 1QT6A 3AZ6A 4WM4A 3W6EA 2JAFA 1IP5A 1L27A 131LA 4IB4A 3CSQA 4EKRA 4XJGA 2LZTA 4EPFA 3C7YA 1L05A 1WTMA 1E8LA 4W94A 4I0CA 3CODA 1LJ3A 126LA 4QI1A 1WVVA 1JQUA 4XYYA 4W96A 1L52A 1JGJA 143LA 1L54A 1SLYA 4EOFA 3TXFA 5KY1A 1YROA 3FA0A 1L97A 1LWKA 3P65A 5B6ZA 3LYZA 1LJEA 2YCZA 7LYZA 1F88A 4W51A 1XSFA 5AZDA 3WW5A 146LA 1L60A 4FJRA 5JJEA 1JSFA 1CU3A 5DHGA 8LYZA 2HEBA 1HFYA 3PQRA 1L34A 1HMKA 1LZDA 1HC0A 3P0GA 4Z41A 3T36A 1JTTL 1A4VA 3TXEA 2ZILA 1NHEA 1S53A 1C6PA 1GBYA 1LSDA 1PZYA 161LA 1JJ1A 4DDCA 1CKGA 3QJUB 4ANRA 4HJYA 4XN6A 4BWBA 247LA 3SB8A 1I6SA 5B05A 2B74A 3GULA 4BEYA 1DPXA 1L87A 1B5UA 1LSMA 4BEZA 1L93A 1LSFA 1QTBA 5C6IA 1OVKA 1AZFA 2EQLA 188LA 1LSPA 5KXRA 1CTWA 4G70B 5G2DA 4E3UA 1CUPA 5DN5A 1IW9A 1L70A 3NY8A 4DDBA 145LA 1LZRA 3SBAA 156LA 3AZ5A 4PGJB 1F4ZA 1PQKA 1ZVYB 1G1VA 1RCMA 5B6WA 3OJPA 4RLMA 3HH3A 257LA 5HMJA 1LZNA 5LZMA 212LA 3X3BA 1GFEA 1BWJA 1L36A 1QUDA 2Q0MX 4GCFA 4L6RA 3VG9A 1QS5A 2BQJA 1W6ZA 1IC7Y 4WOAA 1CU6A 2ZNWY 4KT3A 2BQFA 113LA 1L41A 1HEOA 249LA 1LZ1A 5FEKA 2F4GA 5A8EA 2OU8A 4NGZA 1LGXA 5F81A 3DN3A 2CJLA 1GFKA 4MBSA 1NF5A 2F93A 5I53A 5G28A 1L44A 1YKYX 1LI6A 1L77A 1YAMA 1KY0A 2Y04A 4L41A 1OUHA 4HWLA 1LSZA 3C8RA 1SX2A 2YDVA 2OE4X 4PJ2C 4DD7A 4I8SA 3GUJA 242LA 1GF7A 4NGJA 4DQJA 1GB8A 3OE8A 1BHZA 1HMLA 2BQLA 4H9EA 3CDRA 1PQIA 4OWAA 1DYFA 3CAPA 4GP8B 1R84A 1XEIA 2HU3A 3VGAA 2HUBA 1GF6A 1DYEA 139LA 255LA 1LSNA 4CFOA 2I26L 4GYCA 1CKFA 4HYXA 1GBSA 1CJ7A 1MGYA 122LA 3B0IA 1UIFA 3A67Y 2VT4A 4GLAA 4P2EA 1B7SA 3HT8A 2Y02A 1L53A 2YBNA 3HT6A 1OV5A 5B1FA 4OOOA 3WMKA 3ULRA 1BM1A 1OWYA 9LYZA 1GD6A 1CU5A 1XIOA 1LKRA 4M6DA 3DDLA 3HFMY 3F9LA 1X0I1 1RFPA 1O23A 4H93A 4PK0A 3OK0A 1IOCA 2Z38A 1L39A 1W08A 3TXGA 1C6BA 4OWEA 1HELA 3G3XA 1QM8A 1ZWNA 1L25A 1C45A 178LA 1IP6A 1BB3A 4WM1A 1BWHA 3HBDA 5BR2A 2RAYX 1LPIA 1WQMA 1J1OY 1FN5A 1LHJA 3HH4A 4NGOA 4LDEA 4YEMA 3AGGG 1B7PA 1WQPA 2CDSA 5AWZA 3VWOA 1IP4A 3HDFA 1YILA 250LA 4TWSA 4J1BA 4ET8A 3AGHA 2B5ZA 3HANA 1D3NA 1C67A 141LA 165LA 1P8IA 3CT1A 4ZEEA 1P2CC 2MEDA 1B7QA 1LYGA 1QTVA 4EKPA 1C7PA 1ZYTA 2F2NA 238LA 196LA 1BGIA 4TSBA 236LA 5JJJA 4KL7A 1G7IC 4HYJA 1TN0A 176LA 1JEFA 4EPIA 4G71B 1L69A 3UG9A 1XJTA 4DKLA 1R2NA 2EPEA 5HNLA 1CV6A 2RBSA 4ZPUA 3TXIA 3ATNA 2BPUA 4OOTA 2B6XA 1B5WA 111LA 1IEEA 1IOTA 1L71A 3WULA 1IWXA 3UONA 1IOSA 1E0PA 2BRDA 3EH3B 4W53A 5DL9A 4LYBA 1OUCA 1IWTA 1C6NA 1D6PA 2YVBA 4WM3A 1D0MA 1V7TA 4TTDA 4XTNA 4XT1A 4B49A 2N5ZA 1JKAA 1L21A 2C8OA 4BUOA 3C8QA 3CDTA 4NEBA 1OP9B 4ARMA 3LN2A 1UIEA 1LHLA 2L6XA 169LA 3HU8A 5AMYA 2OU0X 3B72A 1C6QA 4DC4A 5H2MA 1GF8A 3NYAA 3QBGA 5I4YA 1VDPA 2ZYCA 2FBDA 2NTUA 1XJUA 198LA 211LA 3UTVA 1DI5A 3S8GB 2Z39A 5AX1A 1P6YA 4RW1A 1CKDA 200LA 1HSXA 1P7SA 1JPOA 1KG9A 2J4YA 1YL0X 1DYCA 1GE4A 2YBJA 4XJIA 3EH5B 192LA 4GP4B 1KIRC 114LA 2MEEA 1BQLY 1D9UA 2BQHA 1IC5Y 4GN5C 1L99A 2RBOA 4XJDA 3WVYA 3PXOA 2A4TA 1YL1X 1HFXA 1C6GA 3HDEA 2G4QA 5KXSA 5L9JA 217LA 3ZVQA 1CVKA 194LA 4J1AA 1QT3A 3RZEA 2Q9DA 4H8XA 1D9WA 3D4SA 5LAGA 4TUNA 1Q5JA 1L59A 4CGEA 2I25L 197LA 3GUKA 3W6BA 261LA 1GE3A 1KG8A 4R0FA 1H6MA 3SB6A 2O7AA 1D0LA 4L35A 1UIBA 5ILFA 1OUAA 1I20A 1LKSA 1L01A 1T97A 1C68A 4DQ5A 1D2WA 1DI3A 5I4XA 1LMCA 3W6CA 4EMNA 1GB6A 2BQMA 1LCNA 5JJNA 3C7WA 5HMVA 1L13A 1ZVHL 3AYQA 1IVMA 1L86A 4W56A 1CJ8A 262LA 3HAOA 1L37A 1LI2A 1S51A 1C65A 4GP5B 4FAAB 3HH6A 1PY6A 4WM2A 3S3BB 201LA 4H9HA 5M1YA 1C6TA 4ARMB 2HU1A 3SBBC 2F4AA 2I6ZA 1C66A 2G4PA 4PJZA 4M4OA 1CV0A 1LPYA 4XTOA 4PHIA 2OE7X 1OUGA 4NG8A 3RNXA 1LYEA 3EBAB 3A8ZA 1JKCA 1GDWA 5LXWA 134LA 4GCCA 1Q5IA 3TMWA 1C6LA 1IWUA 4LT2A 153LA 2A7FA 3RT5X 1L11A 1P56A 5KKHA 1X0K1 3DQBA 1GXV2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2W A;  3FI5 A;  187L A;  1L95 A;  4DJH A;  161L A;  2YCX A;  224L A;  1G0K A;  243L A;  3QJU B;  3HTG A;  2B7X A;  1G0J A;  1CWQ A;  4BWB A;  247L A;  3BVD B;  3SB8 A;  130L A;  1U19 A;  1I6S A;  3UTX A;  2B74 A;  3GUL A;  4BEY A;  1L87 A;  1L18 A;  1M0K A;  2NTW A;  173L A;  5AHZ A;  4I7S A;  4BEZ A;  1GU8 A;  1L93 A;  3G3W A;  195L A;  1QTB A;  3COC A;  1OVK A;  2CUU A;  188L A;  1PQM A;  174L A;  4UG2 A;  4X1H A;  1CTW A;  4G70 B;  1L30 A;  5G2D A;  3CDV A;  1CUP A;  1IW9 A;  1C6J A;  7LZM A;  1L56 A;  2OU9 A;  2B6Z A;  1L70 A;  3NY8 A;  150L A;  2RBR A;  145L A;  4IAP A;  3SBA A;  177L A;  1L90 A;  156L A;  5H2N A;  5B6X A;  3HT9 A;  2RB1 X;  1F4Z A;  1PQK A;  1L72 A;  1S8J A;  152L A;  3S8F B;  112L A;  1G1V A;  1JTN A;  1PXS A;  3UZC A;  5B6W A;  1HZX A;  4QRY A;  1G0Q A;  3HH3 A;  4DAJ A;  1M0L A;  3NSB A;  257L A;  231L A;  234L A;  155L A;  5LZM A;  1LI3 A;  1L73 A;  1DYG A;  212L A;  1L35 A;  2OEA X;  5I14 A;  2PED A;  1C6E A;  5ITE A;  3X3B A;  1L36 A;  2QPD B;  240L A;  1L28 A;  233L A;  4LZM A;  1QUD A;  1LWG A;  1KY1 A;  1TLA A;  2I21 A;  1D3J A;  1LYF A;  1X0S A;  3QAP A;  3DN4 A;  1C61 A;  4L6R A;  3VG9 A;  1QS5 A;  3NS0 A;  119L A;  2O79 A;  1C6M A;  1CU6 A;  1L38 A;  2IGC A;  1L15 A;  2ZIY A;  4G7R B;  1QTH A;  113L A;  1L41 A;  4EXM A;  1FBB A;  249L A;  4Y9H A;  1QKP A;  125L A;  1QUO A;  4OO9 A;  205L A;  1BRX A;  1T8A A;  1S52 A;  2RB2 X;  2LC9 A;  4YXA C;  2OU8 A;  1G0L A;  2KS9 A;  5A8E A;  1LGX A;  4GRV A;  4I7R A;  5H2L A;  1C6A A;  5G53 A;  1KS3 A;  3DN3 A;  1L20 A;  259L A;  140L A;  1QT5 A;  4MBS A;  246L A;  1SWZ A;  2I20 A;  2F32 A;  2F93 A;  5G28 A;  1L44 A;  237L A;  3QJT B;  1KME A;  1C6C A;  1PQO A;  1T8F A;  1GUE A;  4YX7 C;  1O0A A;  1LI6 A;  2KSA A;  1UAZ A;  1G0P A;  1L77 A;  1L58 A;  1KGB A;  1BRR A;  1KY0 A;  184L A;  258L A;  2Y04 A;  4EA3 A;  4ARP A;  4HWL A;  1D2Y A;  168L A;  3C8R A;  1SX2 A;  1TN5 A;  5TGZ A;  1L19 A;  1C63 A;  2YDV A;  1P8U A;  2OE4 X;  3VVK A;  1L00 A;  3NY9 A;  2I35 A;  1UCQ A;  3GUJ A;  1D3M A;  242L A;  172L A;  180L A;  2JAG A;  1CV5 A;  1L68 A;  2X72 A;  1L0M A;  1L02 A;  256L A;  227L A;  3OE8 A;  3AM6 A;  1PQJ A;  223L A;  4W54 A;  2WJL A;  4MQT A;  1L74 A;  3DN0 A;  4WAV A;  3WQJ A;  3HTF A;  4EJ4 A;  144L A;  1S54 A;  2L78 A;  2ZFE A;  4MD1 A;  5A44 A;  4W55 A;  1L0J A;  1L48 A;  3CDR A;  1PQI A;  3CAP A;  1DYF A;  2Y03 A;  4GP8 B;  2NTH A;  1R84 A;  1FBK A;  3DN2 A;  3VGA A;  123L A;  1KNI A;  3AYM A;  3QBK A;  2YCW A;  1QSB A;  209L A;  1QUH A;  2B75 A;  1WTH A;  3C80 A;  1DYE A;  103L A;  5DHH A;  139L A;  255L A;  3DN8 A;  4ARQ A;  162L A;  1P37 A;  4E97 A;  4I7Q A;  5G54 A;  1G0G A;  1L23 A;  1L40 A;  1SSY A;  1LYJ A;  4GYC A;  138L A;  3S3D B;  4HYX A;  4WW3 A;  1MGY A;  3MBV A;  1AT9 A;  239L A;  4W58 A;  122L A;  229L A;  2LZM A;  4EKQ A;  3DNA A;  1L82 A;  1PQD A;  3HWL A;  216L A;  2RBQ A;  1C6K A;  235L A;  2B6T A;  2VT4 A;  4W57 A;  4I7J A;  3AYN A;  1LYH A;  5AHY A;  4I7L A;  109L A;  3HT8 A;  2Y02 A;  1L53 A;  1JV7 A;  3PBL A;  3HT6 A;  3C9M A;  1JFP A;  1QT8 A;  1OV5 A;  3DN1 A;  5BR5 A;  4EKS A;  4JQ6 A;  1C6H A;  1L63 A;  2Z6B A;  3HUK A;  1L08 A;  1BM1 A;  166L A;  5B35 A;  1XJI A;  1OWY A;  2F2Q A;  2OE9 X;  3L2X A;  1CU5 A;  3HUA A;  3QBL A;  3GUN A;  1XIO A;  1XME B;  3HAR A;  3DDL A;  1BRD A;  3F9L A;  1X0I 1;  2RBN A;  4PK0 A;  2EI4 A;  2HUM A;  2HUL A;  3DMV A;  3LZM A;  4OV0 A;  3SB7 A;  5G2C A;  225L A;  1L39 A;  1H2S A;  1LGU A;  3QJQ B;  1C6B A;  3T45 A;  1L42 A;  2Q9E A;  1G06 A;  3G3X A;  4A4M A;  1C62 A;  252L A;  2I1X A;  3ODU A;  2RH1 A;  1QM8 A;  4AMJ A;  4N6H A;  1ZWN A;  1L25 A;  1L46 A;  3UZA A;  214L A;  1QT7 A;  1L12 A;  1L14 A;  178L A;  3C7Z A;  158L A;  3GUP A;  1T8G A;  3ABW A;  5H2O A;  108L A;  1L88 A;  1G07 A;  3SN6 R;  1JTM A;  5B2N A;  1LN6 A;  5BR2 A;  2RAY X;  1D3F A;  3VI0 A;  4YXC A;  1CX6 A;  1L16 A;  1JV6 A;  4PXK A;  157L A;  5H2I A;  3HH4 A;  2F95 A;  1IW6 A;  4LDE A;  1CV3 A;  5DYS A;  213L A;  1L79 A;  1L66 A;  5AWZ A;  5FJG A;  3GUO A;  3QAK A;  1LYI A;  3F8V A;  3HDF A;  250L A;  5C1M A;  1L45 A;  1L80 A;  1LGW A;  3DMZ A;  3OE9 A;  1QSQ A;  2F47 A;  3HTB A;  221L A;  2RAZ X;  1D3N A;  3HAN A;  4GPO A;  1C8R A;  1L50 A;  1C67 A;  3OE0 A;  141L A;  2B6W A;  1PXR A;  165L A;  1P8I A;  3HAP A;  251L A;  5H2K A;  171L A;  1IXF A;  4G7S B;  4JKV A;  4X31 A;  1P64 A;  2B70 A;  1LYG A;  1QTV A;  4EKP A;  3S3C B;  1ZYT A;  4XT3 A;  1L94 A;  196L A;  1B6I A;  238L A;  4ARJ A;  2LNL A;  1L07 A;  1L10 A;  1L17 A;  1L98 A;  1C8S A;  167L A;  181L A;  2LCB A;  236L A;  5JJJ A;  1GZM A;  226L A;  5ETZ A;  2Z73 A;  4HYJ A;  1TN0 A;  1L81 A;  176L A;  1L91 A;  1L84 A;  4EPI A;  4G71 B;  4QID A;  3QJV B;  1L69 A;  3UG9 A;  2RBP A;  1C6I A;  1XJT A;  3DN6 A;  4DKL A;  1R2N A;  102L A;  107L A;  2KSY A;  4XXJ A;  128L A;  232L A;  244L A;  3QDC A;  1CV6 A;  1QTD A;  2RBS A;  4ZPU A;  104L A;  2ANV A;  1L85 A;  127L A;  1L51 A;  210L A;  2B6X A;  111L A;  175L A;  253L A;  3HU9 A;  3UTW A;  1L61 A;  1L75 A;  4ARQ B;  1L71 A;  3VHZ A;  4AQN A;  5H2P A;  3UON A;  3JR6 A;  1F50 A;  4I7P A;  1L67 A;  1E0P A;  2BRD A;  1E12 A;  1DZE A;  3C81 A;  3EH3 B;  142L A;  1VGO A;  4W53 A;  1L83 A;  3L64 A;  3RUN A;  4XTL A;  1EHK B;  1M0M A;  3HAQ A;  1P2L A;  1C6N A;  1C3W A;  3OAX A;  3G3V A;  3CDO A;  2QB0 B;  149L A;  159L A;  1VJM A;  137L A;  163L A;  1L96 A;  4XTN A;  1L0K A;  4XT1 A;  5ITC A;  3QJS B;  1OWZ A;  4N4Y B;  1L21 A;  4BVN A;  4BV0 A;  4BUO A;  2QPE B;  3C8Q A;  1KW5 A;  1L03 A;  3HT7 A;  4JR8 A;  3CDT A;  3CDQ A;  3C82 A;  2M3G A;  1L92 A;  3V2Y A;  4FPD A;  4I7N A;  1QTC A;  4LDL A;  191L A;  2B72 A;  4ARM A;  219L A;  260L A;  1QKO A;  4EIY A;  5B6V A;  1L26 A;  3OE6 A;  2L6X A;  3RFM A;  169L A;  3HU8 A;  2OU0 X;  1C6Q A;  4K5Y A;  1AP9 A;  2G87 A;  3C8S A;  2Y00 A;  5H2M A;  1L32 A;  3NYA A;  3QBG A;  190L A;  4MD2 A;  1L09 A;  1CX7 A;  3KJ6 A;  3QBI A;  3ZEV A;  5F8U A;  2NTU A;  1XJU A;  1SWY A;  198L A;  211L A;  4N4W A;  1L29 A;  3UTV A;  118L A;  1DYD A;  222L A;  4FBZ A;  5AX1 A;  1L76 A;  3S8G B;  1CV4 A;  3ZPQ A;  1P6Y A;  183L A;  3C9L A;  4KLY A;  4S0W A;  4GBR A;  1QUG A;  200L A;  3HAS A;  1L24 A;  1P7S A;  3HTD A;  1KG9 A;  3VW7 A;  3PDS A;  1L06 A;  1G0M A;  2J4Y A;  4FA7 B;  3X3C A;  1DYC A;  3EH5 B;  2B73 A;  192L A;  2NTG A;  3FAD A;  4I7O A;  4GP4 B;  1P2R A;  1QT4 A;  5B34 A;  114L A;  228L A;  5EN0 A;  1DYB A;  1P36 A;  3QJR B;  185L A;  3C83 A;  1LW9 A;  1L99 A;  2YDO A;  2RBO A;  4PXF A;  5B6Y A;  3PXO A;  1SSW A;  129L A;  2A4T A;  248L A;  2OTZ X;  2YCY A;  1C6G A;  230L A;  3HDE A;  1K28 A;  151L A;  1L49 A;  186L A;  3GUM A;  2Y01 A;  1L62 A;  217L A;  1L55 A;  147L A;  4W59 A;  1OVJ A;  2ANX A;  1OYU A;  1L89 A;  4AMI A;  189L A;  1CVK A;  4LDO A;  4IAQ A;  5B0W A;  4I7M A;  2WJK A;  1OVH A;  1NHB A;  1KW7 A;  1C6D A;  4IAR A;  4KNF A;  1P46 A;  2B6Y A;  1QT3 A;  3RZE A;  4UHR A;  2Q9D A;  2R4R A;  5H2J A;  1QHJ A;  1D9W A;  3D4S A;  3K2R A;  3PWH A;  1Q5J A;  1L59 A;  2Z55 A;  5G36 A;  197L A;  3GUK A;  1S8L A;  2R4S A;  261L A;  3GUI A;  1KG8 A;  4G72 B;  4MQS A;  1CUQ A;  160L A;  3EH4 B;  1XEP A;  4TL3 A;  2QAR C;  220L A;  1P3N A;  3DKE X;  1L9H A;  3SB6 A;  2O7A A;  4ARL A;  4L35 A;  1QT6 A;  1L31 A;  1QS9 A;  2JAF A;  2ZZL A;  1L33 A;  1C69 A;  199L A;  1L27 A;  131L A;  1L01 A;  1T97 A;  4EKR A;  4IB4 A;  1C68 A;  2HUK A;  4EPF A;  4I7T A;  1D2W A;  3C7Y A;  1L05 A;  1H68 A;  1G1W A;  218L A;  3SB5 A;  110L A;  1L43 A;  3C7W A;  5JJN A;  1CU0 A;  3COD A;  1CU2 A;  1L13 A;  206L A;  241L A;  2AT9 A;  1L86 A;  2HPY A;  126L A;  4QI1 A;  4W56 A;  215L A;  3UTY A;  1JQU A;  1C6F A;  1P5C A;  262L A;  3HAO A;  1L37 A;  5J7A A;  1L52 A;  2KSB A;  3ZPR A;  182L A;  1ZUR A;  2O4W A;  1L57 A;  1LI2 A;  1JGJ A;  4NC3 A;  143L A;  5H2H A;  1L54 A;  1L65 A;  4X32 A;  254L A;  3EML A;  1LLH A;  245L A;  6LZM A;  4J4Q A;  1S51 A;  1C65 A;  1L04 A;  4GP5 B;  4FAA B;  1L64 A;  3HH6 A;  3FA0 A;  1PY6 A;  1L97 A;  1LWK A;  5LWE A;  120L A;  3S3B B;  5B6Z A;  3A7K A;  1EPY A;  5G2A A;  3REY A;  201L A;  2YCZ A;  1F88 A;  1C6T A;  4W51 A;  3HUQ A;  1CV1 A;  4ARM B;  5AZD A;  146L A;  1L22 A;  1L60 A;  1C64 A;  3SBB C;  5AX0 A;  1C66 A;  1QTZ A;  4PJZ A;  5JJE A;  1CU3 A;  5DHG A;  4G7Q B;  1T6H A;  3PQR A;  1CV0 A;  1LPY A;  4XTO A;  1L34 A;  4I7K A;  115L A;  1DYA A;  3P0G A;  2OE7 X;  1L47 A;  1OV7 A;  1LYE A;  1SX7 A;  4W52 A;  1Q5I A;  1P8H A;  3SB9 A;  148L E;  164L A;  4GBR B;  1C6L A;  2OTY X;  3HH5 A;  5A45 A;  3DMX A;  1C60 A;  2RB0 X;  1L11 A;  1P56 A;  1LYD A;  170L A;  5KKH A;  1S53 A;  1X0K 1;  3DQB A;  1C6P A; 
#chains in the Genus database with same CATH topology
 1HEW A;  3TMX A;  4DDA A;  1A2Y C;  4DJH A;  2YCX A;  1LYZ A;  3TXK A;  3P68 A;  2B7X A;  1G0J A;  1ALC A;  3BVD B;  4NY5 A;  1REX A;  130L A;  1B7L A;  3UTX A;  3A93 A;  5KXN A;  3LZT A;  4IAS A;  4Z98 A;  1UA6 Y;  4TSC A;  5KKI A;  4WL6 A;  1GU8 A;  1UIA A;  4O34 A;  3ZVQ B;  3P64 A;  4G4H A;  4NSH A;  1GF9 A;  3G3W A;  4WLD A;  1NKH A;  2CUU A;  1OUD A;  5IDD A;  1L30 A;  5II3 A;  3CDV A;  1C6J A;  1L56 A;  2OU9 A;  2B6Z A;  5H2N A;  1B7N A;  3HT9 A;  5B6X A;  2RB1 X;  4ETB A;  1GFA A;  4U3X B;  3S8F B;  1PXS A;  2FYC A;  3UZC A;  3TXD A;  2Z18 A;  2D4K A;  4QRY A;  2W1X A;  5LIN A;  1M0L A;  3NSB A;  1LI3 A;  1DYG A;  5FCP A;  1LZC A;  1OUI A;  2PED A;  4NIJ A;  1KY1 A;  1TLA A;  2I21 A;  1VFB C;  4WG7 A;  3QAP A;  1C61 A;  4WO9 A;  3HBE X;  1GE0 A;  5I5Q A;  1EQ5 A;  1HEN A;  2O79 A;  4Y9H A;  3A6B Y;  1S52 A;  205L A;  1BRX A;  5D5C A;  1AT5 A;  2RB2 X;  4R6C A;  2KS9 A;  5D5F A;  2D4I A;  5H2L A;  1C6A A;  207L A;  5G53 A;  3WUA A;  4N9R A;  4NSJ A;  4G4B A;  1KXW A;  1GUE A;  2W1M A;  1AT6 A;  2KSA A;  1UAZ A;  4C5F A;  184L A;  1F10 A;  4EA3 A;  4ARP A;  168L A;  1GBO A;  1IWY A;  4BS7 A;  1WTN A;  1UAC Y;  1UCQ A;  172L A;  1CV5 A;  2X72 A;  1BB5 A;  2C8P A;  256L A;  227L A;  4W54 A;  2WJL A;  1L74 A;  4EJ4 A;  1S54 A;  2L78 A;  1GFU A;  3B6L A;  4W55 A;  1L0J A;  2Y03 A;  1QSA A;  2G4N A;  3DN2 A;  4OW1 A;  123L A;  3AYM A;  4LYC A;  4TX7 A;  1WTH A;  1OUF A;  1NQI A;  4E97 A;  3DN8 A;  2BQO A;  162L A;  1FLQ A;  1OUE A;  4ARQ A;  1G0G A;  1L23 A;  1YQV Y;  4H8Z A;  138L A;  1AT9 A;  4EKQ A;  2LZM A;  1PQD A;  3HWL A;  2DQH Y;  1LYS A;  4W57 A;  3M3U A;  4H91 A;  4I7J A;  1LZT A;  2FYD A;  4HPI A;  4B4E A;  3PBL A;  3C9M A;  4AGA A;  4N5R A;  4JQ6 A;  1REM A;  3A96 A;  1GEZ A;  1XJI A;  2F2Q A;  3G3B B;  1OUJ A;  3HUA A;  3QBL A;  3GUN A;  1RE2 A;  4QEQ A;  1BRD A;  4PRQ A;  2H9K A;  2HUL A;  3LZM A;  5EBH A;  4GLV A;  5KXW A;  3A3Q A;  1LGU A;  4GCB A;  2BQA A;  1G06 A;  2EKS C;  252L A;  3ODU A;  1IX0 A;  1L46 A;  1XFP L;  214L A;  3UZA A;  158L A;  132L A;  3ABW A;  1LHI A;  4LFX A;  1G07 A;  4ML7 A;  5B2N A;  1LZG A;  5LVG A;  5B06 A;  4YXC A;  1EQE A;  1JV6 A;  1IR9 A;  2F95 A;  5F9X A;  1GF5 A;  3GUO A;  2LYM A;  1L45 A;  1LGW A;  1UIG A;  3AZ7 A;  3OE9 A;  3HTB A;  1QSQ A;  2F47 A;  221L A;  2MEF A;  2MEI A;  4GPO A;  1C8R A;  4NWH A;  1SQ2 L;  1UIH A;  251L A;  2DQI Y;  171L A;  1IXF A;  4G7S B;  1P64 A;  3TXJ A;  1NWG A;  1IIZ A;  1DKK A;  4H92 A;  4LZT A;  1YAQ A;  1T3P A;  3QNG A;  4ARJ A;  1L07 A;  1L10 A;  1L98 A;  181L A;  2LCB A;  1LZA A;  1GB5 A;  1IOQ A;  226L A;  5ETZ A;  1AM7 A;  1L91 A;  1WQR A;  1IWV A;  4QID A;  3QJV B;  2MEG A;  1REZ A;  5IEL A;  102L A;  4A7D A;  2KSY A;  3WUM A;  128L A;  232L A;  4IAT A;  1TAY A;  1J1P Y;  5APD A;  4H9I A;  104L A;  127L A;  210L A;  4GN3 A;  5L3I A;  175L A;  5B1G A;  5KXO A;  1IP2 A;  1L61 A;  4ARQ B;  4AQN A;  1GB9 A;  4I7P A;  1L67 A;  3C81 A;  4NGL A;  1VGO A;  4KPM A;  1HEP A;  3L64 A;  3RUN A;  1XEJ A;  3AW7 A;  3HAQ A;  3G3V A;  3CDO A;  2QB0 B;  163L A;  2YSS C;  5B59 A;  1LSG A;  1RJC B;  3QJS B;  1OWZ A;  3LYT A;  4BV0 A;  1KW5 A;  1L03 A;  1LZE A;  1QDR A;  4I7N A;  2W1Y A;  3CSZ A;  1QTK A;  2BLX A;  4II8 A;  3K3T A;  4EIY A;  1LMN A;  4DT3 A;  3OE6 A;  2D4J A;  4WL7 A;  2G87 A;  3N9E A;  4ETC A;  1L09 A;  3QBI A;  5F8U A;  1SWY A;  118L A;  1DYD A;  1L76 A;  2IFF Y;  1CV4 A;  3ZPQ A;  4KLY A;  4GBR A;  1QUG A;  1LSE A;  3HAS A;  5LYT A;  5E9R A;  3VW7 A;  2FBB A;  3X3C A;  1G7J C;  3FAD A;  1DI4 A;  5B07 A;  1OQM A;  228L A;  5EN0 A;  1DYB A;  1P36 A;  1DZB X;  1LHK A;  1LW9 A;  2YDO A;  1SSW A;  1C46 A;  4QGZ A;  3LHM A;  1L49 A;  2Y01 A;  147L A;  1JHL A;  1OYU A;  154L A;  1WQN A;  189L A;  4LDO A;  4AMI A;  1OVH A;  1C6D A;  4J0L A;  1INU A;  1BB4 A;  4H90 A;  3K2R A;  6LYZ A;  4LT1 A;  3PWH A;  5G36 A;  5LAF A;  4NGK A;  3WU8 A;  1XGU C;  3EMS A;  1GBW A;  3GUI A;  2CWI A;  1CUQ A;  1B7M A;  1P3N A;  5L3H A;  2BQG A;  4CFP A;  1L31 A;  2ZZL A;  5FHW A;  3A3R X;  199L A;  2Z2E A;  1JTP L;  4I7T A;  4N1E I;  1H68 A;  1G1W A;  2BQK A;  218L A;  110L A;  4NHQ A;  1L43 A;  1JJ0 A;  1CU2 A;  2AT9 A;  4ETD A;  3WPL A;  2HPY A;  1B5V A;  215L A;  3UTY A;  1LTM A;  1IC4 Y;  2HEA A;  2KSB A;  182L A;  4HSF A;  4N1C C;  1L57 A;  1UUZ C;  1VDS A;  3D3D A;  4NC3 A;  3WW6 A;  254L A;  3EML A;  5KXM A;  4X32 A;  4WMG A;  245L A;  1LZ9 A;  1LOZ A;  1UCO A;  5LWE A;  5JEN B;  3A7K A;  2LYO A;  1C64 A;  1QTZ A;  3LYO A;  4G7Q B;  1YKX X;  2PC2 A;  4B0D A;  4I7K A;  3A34 A;  4GN4 A;  1DYA A;  2X0A A;  5HLL A;  2RSC A;  1L47 A;  1LMT A;  1SX7 A;  3FI7 A;  3GXK A;  148L E;  4DD0 A;  4GBR B;  2DQC Y;  5T3F A;  1FLU A;  5A45 A;  4OWC A;  1LYD A;  170L A;  2LHM A;  4LYT A;  208L A;  1KIP C;  1U19 A;  4NHI A;  4XJF A;  3TMV A;  1L18 A;  2NTW A;  4MR1 A;  173L A;  2YBH A;  1B5Y A;  5C6L A;  3WL2 A;  3CT0 A;  1NMM A;  2MEA A;  4UG2 A;  4YEO A;  4X1H A;  4C3W A;  5LYZ A;  4LT0 A;  7LZM A;  1YKZ X;  3BKH A;  1WQQ A;  1LYY A;  1L90 A;  2XBS A;  1S8J A;  1UID A;  1IR7 A;  1JTN A;  1G7M C;  1LZB A;  3AJN A;  4HJZ A;  3LYM A;  1LJF A;  4YF2 A;  155L A;  1L73 A;  2OEA X;  1B5X A;  1C6E A;  1GAY A;  1L28 A;  2Z2F A;  1D3J A;  3AB6 A;  1NBY C;  4YOP A;  4RW2 A;  2HED A;  5DM9 A;  2ZIY A;  1L38 A;  2IGC A;  1HEM A;  4G7R B;  4G49 A;  4NGV A;  4EXM A;  1FBB A;  1QKP A;  125L A;  4QY9 A;  4H9A A;  4YXA C;  1G0L A;  4DS7 E;  3J4G A;  5APE A;  4GRV A;  1F0W A;  2YBL A;  1QSW A;  4I7R A;  1KS3 A;  2BQE A;  1L20 A;  259L A;  140L A;  1QT5 A;  2YBI A;  246L A;  1C10 A;  2F32 A;  4HV1 A;  237L A;  3QJT B;  1C6C A;  5ILC A;  4XJB A;  1G0P A;  1L58 A;  1KGB A;  1N4F A;  2Z12 A;  5TGZ A;  1YAP A;  1P8U A;  1L00 A;  3NY9 A;  2I35 A;  4Z46 A;  5LYM A;  180L A;  2JAG A;  4LFP A;  1C08 C;  1IP7 A;  4MQT A;  3B0O A;  3DN0 A;  4DD1 A;  3WQJ A;  2ZFE A;  2YDG A;  3ZEK A;  1D0K A;  1KNI A;  4HPE A;  2YCW A;  5DN4 A;  1QUH A;  3BKV A;  5DHH A;  5LVJ A;  1P37 A;  1LYJ A;  4B1A A;  3S3D B;  4DD2 A;  4XJH A;  239L A;  1GFV A;  1TDY A;  229L A;  4W58 A;  2RBQ A;  235L A;  2XBR A;  4N8Z A;  3AYN A;  1LYH A;  5AHY A;  4I7L A;  4RLN A;  109L A;  4BAF A;  1JV7 A;  4YEN A;  1JFP A;  1QT8 A;  1XGQ C;  2XTH A;  5APC A;  1L08 A;  5B35 A;  1CKH A;  4B4J A;  1GHL A;  1LJ4 A;  1LMQ A;  3L2X A;  1GFJ A;  2RBN A;  1JJ3 A;  2HUM A;  1XEK A;  4DYG A;  2HEE A;  2DQJ Y;  4OV0 A;  3EXD A;  225L A;  3A91 A;  3QJQ B;  1HFZ A;  1JIT A;  3T45 A;  2Q9E A;  4N0J A;  5C6J A;  2I1X A;  5IHG A;  1GXX A;  4BAD A;  4N6H A;  1HER A;  3GUP A;  1EL1 A;  1T8G A;  1JKD A;  1G7L C;  1FKV A;  5KXX A;  1LN6 A;  2WAR A;  4J7V A;  3VI0 A;  4UWN A;  4D9Z A;  1GF4 A;  1L16 A;  5LVK A;  4PXK A;  157L A;  1GB3 A;  3AZ4 A;  1IW6 A;  1CKC A;  1L79 A;  2LZ2 A;  1L66 A;  4RDS A;  3QAK A;  1LYI A;  1VAT A;  5C1M A;  1L80 A;  1ZMY L;  2RAZ X;  1L50 A;  3TXH A;  1PXR A;  2B6W A;  4BAP A;  5LIO A;  3WXT A;  5LA5 A;  5LVH A;  4JKV A;  4X31 A;  1BVX A;  3S3C B;  1IP1 A;  1QIO A;  2BQI A;  4LYZ A;  2LNL A;  3RW8 A;  5APF A;  167L A;  1J1X Y;  1GF0 A;  1L81 A;  1L84 A;  4UWU A;  1C6I A;  3DN6 A;  3TXB A;  107L A;  4XXJ A;  3QDC A;  3W6A A;  1QTD A;  1IY3 A;  2HEC A;  2ANV A;  3ATO A;  1L85 A;  1L51 A;  5F16 A;  3N9A A;  3HU9 A;  4LT3 A;  1B9O A;  1JWR A;  1DKJ A;  1L75 A;  4DQ7 A;  4OWH A;  2H9J A;  5H2P A;  2MEH A;  3JR6 A;  1MLC E;  2MEB A;  1LJK A;  1QDT A;  1DZE A;  4GCD A;  4NGW A;  3IJU A;  4WO6 A;  2D6B A;  1EHK B;  159L A;  1IWW A;  1VJM A;  137L A;  1L96 A;  1LMO A;  5ITC A;  4N4Y B;  3T6U A;  2QPE B;  4JR8 A;  3HT7 A;  1BVK C;  3C82 A;  3V2Y A;  4FPD A;  1T6V L;  1QTC A;  191L A;  2B72 A;  1TCY A;  3A6C Y;  219L A;  260L A;  4MST A;  4WG1 A;  3RZ4 A;  1GF3 A;  1L26 A;  1IY4 A;  1LZ8 A;  1PS5 A;  4K5Y A;  4GCE A;  2NWD X;  3KJ6 A;  1LHM A;  3WXU A;  2Y8P A;  1FLY A;  222L A;  1OUB A;  1LJJ A;  3QY4 A;  183L A;  3C9L A;  4S0W A;  2BQC A;  3TMU A;  4HTN A;  1L24 A;  3HTD A;  2LYZ A;  2ZQ3 A;  4G9S A;  3PDS A;  1L06 A;  1GFH A;  1G0M A;  4FA7 B;  1GB0 A;  2NTG A;  1QT4 A;  5B34 A;  1CNS A;  3A94 A;  3LZ2 A;  3QJR B;  135L A;  1FDL Y;  2DKV A;  1YAN A;  4PXF A;  4WLY A;  5B6Y A;  2OTZ X;  1VDT A;  1JSE A;  230L A;  1I56 A;  1K28 A;  186L A;  3GUM A;  1L55 A;  4W59 A;  1OVJ A;  2ANX A;  4WM6 A;  1L89 A;  4NGY A;  5B0W A;  4I7M A;  2WJK A;  1NHB A;  4IAR A;  4KNF A;  1P46 A;  2B6Y A;  4H1P A;  4HJV A;  5LVI A;  2DQF C;  4UHR A;  2Z37 A;  1S8L A;  1LSB A;  5FST A;  4MQS A;  133L A;  3EH4 B;  2VB1 A;  1XEP A;  4TL3 A;  2QAR C;  1LJH A;  1REY A;  220L A;  1L9H A;  4G4C A;  1NDM C;  4NFV A;  2YBM A;  4MCK A;  3RU5 A;  1QS9 A;  3B0K A;  3A90 A;  1L33 A;  1C69 A;  2HUK A;  1LZS A;  2DQE Y;  3SB5 A;  1HEQ A;  3W6F A;  4ETE A;  1CJ9 A;  1CU0 A;  1GWD A;  206L A;  241L A;  1GEV A;  1C6F A;  5LA8 A;  1P5C A;  5J7A A;  1JUG A;  2DBT A;  3ZPR A;  1ZUR A;  2O4W A;  1GDX A;  5H2H A;  1L65 A;  1LLH A;  6LZM A;  4J4Q A;  3WYH A;  1L04 A;  1L64 A;  1B5Z A;  1H87 A;  120L A;  3WPJ A;  3D9A C;  1EPY A;  5G2A A;  3REY A;  3HUQ A;  1CV1 A;  1B2K A;  1L22 A;  5AX0 A;  1QQY A;  2CGI A;  1T6H A;  4NG1 A;  2ZQ4 A;  5F9U A;  115L A;  1LJN A;  4LYM A;  3GXR A;  1OV7 A;  1TEW A;  4W52 A;  1IP3 A;  2W1L A;  1LYO A;  1P8H A;  3SB9 A;  164L A;  2HTX A;  1UC0 A;  2OTY X;  4H9C A;  3HH5 A;  1LHH A;  5HNC A;  3DMX A;  1C60 A;  5FEL A;  2RB0 X;  1LJG A;  1FKQ A;  5KXL A;  3V2W A;  3FI5 A;  1QTE A;  187L A;  1L95 A;  1GAZ A;  1FLW A;  224L A;  1G0K A;  243L A;  1LMP A;  3HTG A;  1GE1 A;  1D6Q A;  2XQO A;  1CWQ A;  1ZV5 L;  2EIZ C;  1KIQ C;  1M0K A;  5AHZ A;  4I7S A;  1DPW A;  2ZWB A;  195L A;  3COC A;  3AGI A;  1PQM A;  174L A;  1MEL L;  2IHL A;  4NWE A;  1YAO A;  4ZIX A;  150L A;  2RBR A;  4IAP A;  5I54 A;  177L A;  193L A;  1HSW A;  1L72 A;  152L A;  1XGP C;  112L A;  1HZX A;  1G0Q A;  4DAJ A;  5KKJ A;  231L A;  234L A;  1L35 A;  5I14 A;  5ITE A;  2QPD B;  240L A;  233L A;  4LZM A;  1LWG A;  1XGR C;  1KXY A;  1LYF A;  1X0S A;  3DN4 A;  1GB7 A;  4H94 A;  4DWX A;  3NS0 A;  119L A;  1GE2 A;  3E3D A;  3W3E A;  1BWI A;  1C6M A;  4IJ4 A;  4PPO A;  1L15 A;  1QTH A;  1QUO A;  4OO9 A;  1T8A A;  5I4W A;  1DQJ C;  2LC9 A;  1UIC A;  2MEC A;  2DQA A;  1DXJ A;  1SWZ A;  2I20 A;  4ZFP A;  4DD9 A;  1KME A;  4HTK A;  1LSY A;  1PQO A;  1T8F A;  5HQ1 A;  4YX7 C;  1O0A A;  3M18 B;  1BRR A;  1LZ6 A;  258L A;  4NSI A;  3HBH A;  3N9C A;  4LYO A;  1IWZ A;  1D2Y A;  3SP3 A;  5FDJ A;  1TN5 A;  1EQ4 A;  1L19 A;  1C63 A;  3VVK A;  1D3M A;  5KXK A;  3G3A B;  1L68 A;  1JIS A;  1GFR A;  1L0M A;  4HP0 A;  1L02 A;  3AM6 A;  1PQJ A;  223L A;  1GBX A;  4WAV A;  3HTF A;  1YIK A;  144L A;  4AXT A;  2BLY A;  4MD1 A;  5A44 A;  1LAA A;  1L48 A;  2BQB A;  1LMA A;  2NTH A;  2ZYP A;  1FBK A;  2ZIK A;  3QBK A;  1RI8 B;  1JTO L;  4B4I A;  1QSB A;  209L A;  1WQO A;  2B75 A;  3C80 A;  1JIY A;  103L A;  1AKI A;  4HV2 A;  4I7Q A;  5G54 A;  1L40 A;  1SSY A;  4X3B A;  1Z55 A;  4WW3 A;  2HEF A;  2BQN A;  3MBV A;  1IR8 A;  1L82 A;  3DNA A;  1QUS A;  216L A;  1GFT A;  1C6K A;  2B6T A;  5J7C A;  1JKB A;  5KJ9 A;  3J6K A;  1VAU A;  5DLA A;  4FDY A;  3P4Z A;  3DN1 A;  5BR5 A;  4EKS A;  1C6H A;  3FE0 A;  1L63 A;  2Z6B A;  3HUK A;  166L A;  1IOR A;  2OE9 X;  1LZY A;  2ZNX Y;  4ETA A;  1XME B;  3HAR A;  1V7S A;  2EI4 A;  1NDG C;  3DMV A;  3SB7 A;  5G2C A;  5KXY A;  3MGW A;  4KXI A;  1H2S A;  4QDN A;  1L42 A;  4A4M A;  1C62 A;  4NHP A;  2RH1 A;  4AMJ A;  1QT7 A;  1L12 A;  1L14 A;  3C7Z A;  4H9B A;  5H2O A;  108L A;  1L88 A;  3SN6 R;  1JTM A;  1LZ4 A;  1D3F A;  5A3Z A;  1CX6 A;  4WM5 A;  5H2I A;  3IJV A;  1CV3 A;  5DYS A;  213L A;  1BB6 A;  5FJG A;  2XJW A;  3F8V A;  1GFG A;  3WUN A;  5KXT A;  3DMZ A;  1FBI X;  1B7R A;  1LJI A;  1B7O A;  4ET9 A;  3OE0 A;  5K7O A;  3HAP A;  5H2K A;  4WLX A;  2B70 A;  4CJ2 A;  3AW6 A;  2F30 A;  4XT3 A;  4PRU A;  1L94 A;  1B6I A;  1KXX A;  1UBZ A;  1L17 A;  1C8S A;  2AUB A;  1I1Z A;  2DQD Y;  1GZM A;  2Z73 A;  1CJ6 A;  5E4P A;  1VDQ A;  2RBP A;  4DD3 A;  4LGK A;  4H8Y A;  1VED A;  244L A;  2ZIJ A;  3CB7 A;  4NHS A;  1G7H C;  253L A;  3UTW A;  1BB7 A;  3VHZ A;  1F6S A;  2GV0 A;  1F50 A;  2BQD A;  3WVX A;  1E12 A;  2H5Z A;  142L A;  1L83 A;  3CSR A;  3WU7 A;  4YM8 A;  4Z3M A;  3W6D A;  4XTL A;  1M0M A;  4CHX A;  1P2L A;  5A3E A;  4XAD A;  1C3W A;  3WU9 A;  3OAX A;  149L A;  2DQG Y;  1L0K A;  5F14 A;  4BVN A;  3CDQ A;  2M3G A;  1L92 A;  1GPQ C;  2D91 A;  4LDL A;  4NSG A;  2Z19 A;  1QKO A;  3A92 A;  5B6V A;  3RFM A;  3IWR A;  1AP9 A;  3QE8 A;  1LZ5 A;  3C8S A;  2Y00 A;  1L32 A;  190L A;  4MD2 A;  1CX7 A;  1GBZ A;  4NGI A;  3ZEV A;  3A95 A;  3CQL A;  4NHT A;  2BAA A;  4N4W A;  1L29 A;  3KAM A;  4FBZ A;  1QUT A;  1TBY A;  4H9F A;  1GB2 A;  4UWV A;  2B73 A;  4I7O A;  1P2R A;  6LYT A;  3P66 A;  1F6R A;  1HF4 A;  185L A;  1LSC A;  3C83 A;  3F6Z A;  5KXZ A;  129L A;  248L A;  2YCY A;  151L A;  1B0D A;  1C43 A;  1LSA A;  5KXP A;  1L62 A;  1IO5 A;  3WPK A;  1NBZ C;  4IAQ A;  1KW7 A;  4OWB A;  2R4R A;  2A7D A;  1HHL A;  1QHJ A;  5H2J A;  3EO5 A;  2Z55 A;  1WVU A;  2R4S A;  4G72 B;  3CT5 A;  3WH1 A;  4HTQ A;  4WLT A;  160L A;  1HNL A;  1XGT C;  3DKE X;  4XEN A;  4ARL A;  1QT6 A;  3AZ6 A;  4WM4 A;  3W6E A;  2JAF A;  1IP5 A;  1L27 A;  131L A;  4IB4 A;  3CSQ A;  4EKR A;  4XJG A;  2LZT A;  4EPF A;  3C7Y A;  1L05 A;  1WTM A;  1E8L A;  4W94 A;  4I0C A;  3COD A;  1LJ3 A;  126L A;  4QI1 A;  1WVV A;  1JQU A;  4XYY A;  4W96 A;  1L52 A;  1JGJ A;  143L A;  1L54 A;  1SLY A;  4EOF A;  3TXF A;  5KY1 A;  1YRO A;  3FA0 A;  1L97 A;  1LWK A;  3P65 A;  5B6Z A;  3LYZ A;  1LJE A;  2YCZ A;  7LYZ A;  1F88 A;  4W51 A;  1XSF A;  5AZD A;  3WW5 A;  146L A;  1L60 A;  4FJR A;  5JJE A;  1JSF A;  1CU3 A;  5DHG A;  8LYZ A;  2HEB A;  1HFY A;  3PQR A;  1L34 A;  1HMK A;  1LZD A;  1HC0 A;  3P0G A;  4Z41 A;  3T36 A;  1JTT L;  1A4V A;  3TXE A;  2ZIL A;  1NHE A;  1S53 A;  1C6P A;  1GBY A;  1LSD A;  1PZY A;  161L A;  1JJ1 A;  4DDC A;  1CKG A;  3QJU B;  4ANR A;  4HJY A;  4XN6 A;  4BWB A;  247L A;  3SB8 A;  1I6S A;  5B05 A;  2B74 A;  3GUL A;  4BEY A;  1DPX A;  1L87 A;  1B5U A;  1LSM A;  4BEZ A;  1L93 A;  1LSF A;  1QTB A;  5C6I A;  1OVK A;  1AZF A;  2EQL A;  188L A;  1LSP A;  5KXR A;  1CTW A;  4G70 B;  5G2D A;  4E3U A;  1CUP A;  5DN5 A;  1IW9 A;  1L70 A;  3NY8 A;  4DDB A;  145L A;  1LZR A;  3SBA A;  156L A;  3AZ5 A;  4PGJ B;  1F4Z A;  1PQK A;  1ZVY B;  1G1V A;  1RCM A;  5B6W A;  3OJP A;  4RLM A;  3HH3 A;  257L A;  5HMJ A;  1LZN A;  5LZM A;  212L A;  3X3B A;  1GFE A;  1BWJ A;  1L36 A;  1QUD A;  2Q0M X;  4GCF A;  4L6R A;  3VG9 A;  1QS5 A;  2BQJ A;  1W6Z A;  1IC7 Y;  4WOA A;  1CU6 A;  2ZNW Y;  4KT3 A;  2BQF A;  113L A;  1L41 A;  1HEO A;  249L A;  1LZ1 A;  5FEK A;  2F4G A;  5A8E A;  2OU8 A;  4NGZ A;  1LGX A;  5F81 A;  3DN3 A;  2CJL A;  1GFK A;  4MBS A;  1NF5 A;  2F93 A;  5I53 A;  5G28 A;  1L44 A;  1YKY X;  1LI6 A;  1L77 A;  1YAM A;  1KY0 A;  2Y04 A;  4L41 A;  1OUH A;  4HWL A;  1LSZ A;  3C8R A;  1SX2 A;  2YDV A;  2OE4 X;  4PJ2 C;  4DD7 A;  4I8S A;  3GUJ A;  242L A;  1GF7 A;  4NGJ A;  4DQJ A;  1GB8 A;  3OE8 A;  1BHZ A;  1HML A;  2BQL A;  4H9E A;  3CDR A;  1PQI A;  4OWA A;  1DYF A;  3CAP A;  4GP8 B;  1R84 A;  1XEI A;  2HU3 A;  3VGA A;  2HUB A;  1GF6 A;  1DYE A;  139L A;  255L A;  1LSN A;  4CFO A;  2I26 L;  4GYC A;  1CKF A;  4HYX A;  1GBS A;  1CJ7 A;  1MGY A;  122L A;  3B0I A;  1UIF A;  3A67 Y;  2VT4 A;  4GLA A;  4P2E A;  1B7S A;  3HT8 A;  2Y02 A;  1L53 A;  2YBN A;  3HT6 A;  1OV5 A;  5B1F A;  4OOO A;  3WMK A;  3ULR A;  1BM1 A;  1OWY A;  9LYZ A;  1GD6 A;  1CU5 A;  1XIO A;  1LKR A;  4M6D A;  3DDL A;  3HFM Y;  3F9L A;  1X0I 1;  1RFP A;  1O23 A;  4H93 A;  4PK0 A;  3OK0 A;  1IOC A;  2Z38 A;  1L39 A;  1W08 A;  3TXG A;  1C6B A;  4OWE A;  1HEL A;  3G3X A;  1QM8 A;  1ZWN A;  1L25 A;  1C45 A;  178L A;  1IP6 A;  1BB3 A;  4WM1 A;  1BWH A;  3HBD A;  5BR2 A;  2RAY X;  1LPI A;  1WQM A;  1J1O Y;  1FN5 A;  1LHJ A;  3HH4 A;  4NGO A;  4LDE A;  4YEM A;  3AGG G;  1B7P A;  1WQP A;  2CDS A;  5AWZ A;  3VWO A;  1IP4 A;  3HDF A;  1YIL A;  250L A;  4TWS A;  4J1B A;  4ET8 A;  3AGH A;  2B5Z A;  3HAN A;  1D3N A;  1C67 A;  141L A;  165L A;  1P8I A;  3CT1 A;  4ZEE A;  1P2C C;  2MED A;  1B7Q A;  1LYG A;  1QTV A;  4EKP A;  1C7P A;  1ZYT A;  2F2N A;  238L A;  196L A;  1BGI A;  4TSB A;  236L A;  5JJJ A;  4KL7 A;  1G7I C;  4HYJ A;  1TN0 A;  176L A;  1JEF A;  4EPI A;  4G71 B;  1L69 A;  3UG9 A;  1XJT A;  4DKL A;  1R2N A;  2EPE A;  5HNL A;  1CV6 A;  2RBS A;  4ZPU A;  3TXI A;  3ATN A;  2BPU A;  4OOT A;  2B6X A;  1B5W A;  111L A;  1IEE A;  1IOT A;  1L71 A;  3WUL A;  1IWX A;  3UON A;  1IOS A;  1E0P A;  2BRD A;  3EH3 B;  4W53 A;  5DL9 A;  4LYB A;  1OUC A;  1IWT A;  1C6N A;  1D6P A;  2YVB A;  4WM3 A;  1D0M A;  1V7T A;  4TTD A;  4XTN A;  4XT1 A;  4B49 A;  2N5Z A;  1JKA A;  1L21 A;  2C8O A;  4BUO A;  3C8Q A;  3CDT A;  4NEB A;  1OP9 B;  4ARM A;  3LN2 A;  1UIE A;  1LHL A;  2L6X A;  169L A;  3HU8 A;  5AMY A;  2OU0 X;  3B72 A;  1C6Q A;  4DC4 A;  5H2M A;  1GF8 A;  3NYA A;  3QBG A;  5I4Y A;  1VDP A;  2ZYC A;  2FBD A;  2NTU A;  1XJU A;  198L A;  211L A;  3UTV A;  1DI5 A;  3S8G B;  2Z39 A;  5AX1 A;  1P6Y A;  4RW1 A;  1CKD A;  200L A;  1HSX A;  1P7S A;  1JPO A;  1KG9 A;  2J4Y A;  1YL0 X;  1DYC A;  1GE4 A;  2YBJ A;  4XJI A;  3EH5 B;  192L A;  4GP4 B;  1KIR C;  114L A;  2MEE A;  1BQL Y;  1D9U A;  2BQH A;  1IC5 Y;  4GN5 C;  1L99 A;  2RBO A;  4XJD A;  3WVY A;  3PXO A;  2A4T A;  1YL1 X;  1HFX A;  1C6G A;  3HDE A;  2G4Q A;  5KXS A;  5L9J A;  217L A;  3ZVQ A;  1CVK A;  194L A;  4J1A A;  1QT3 A;  3RZE A;  2Q9D A;  4H8X A;  1D9W A;  3D4S A;  5LAG A;  4TUN A;  1Q5J A;  1L59 A;  4CGE A;  2I25 L;  197L A;  3GUK A;  3W6B A;  261L A;  1GE3 A;  1KG8 A;  4R0F A;  1H6M A;  3SB6 A;  2O7A A;  1D0L A;  4L35 A;  1UIB A;  5ILF A;  1OUA A;  1I20 A;  1LKS A;  1L01 A;  1T97 A;  1C68 A;  4DQ5 A;  1D2W A;  1DI3 A;  5I4X A;  1LMC A;  3W6C A;  4EMN A;  1GB6 A;  2BQM A;  1LCN A;  5JJN A;  3C7W A;  5HMV A;  1L13 A;  1ZVH L;  3AYQ A;  1IVM A;  1L86 A;  4W56 A;  1CJ8 A;  262L A;  3HAO A;  1L37 A;  1LI2 A;  1S51 A;  1C65 A;  4GP5 B;  4FAA B;  3HH6 A;  1PY6 A;  4WM2 A;  3S3B B;  201L A;  4H9H A;  5M1Y A;  1C6T A;  4ARM B;  2HU1 A;  3SBB C;  2F4A A;  2I6Z A;  1C66 A;  2G4P A;  4PJZ A;  4M4O A;  1CV0 A;  1LPY A;  4XTO A;  4PHI A;  2OE7 X;  1OUG A;  4NG8 A;  3RNX A;  1LYE A;  3EBA B;  3A8Z A;  1JKC A;  1GDW A;  5LXW A;  134L A;  4GCC A;  1Q5I A;  3TMW A;  1C6L A;  1IWU A;  4LT2 A;  153L A;  2A7F A;  3RT5 X;  1L11 A;  1P56 A;  5KKH A;  1X0K 1;  3DQB A;  1GXV 2; 
#chains in the Genus database with same CATH homology
 1HEW A;  3TMX A;  4DDA A;  1A2Y C;  4DJH A;  2YCX A;  1LYZ A;  3TXK A;  3P68 A;  2B7X A;  1G0J A;  1ALC A;  3BVD B;  4NY5 A;  1REX A;  130L A;  1B7L A;  3UTX A;  3A93 A;  5KXN A;  3LZT A;  4IAS A;  4Z98 A;  1UA6 Y;  4TSC A;  5KKI A;  4WL6 A;  1GU8 A;  1UIA A;  4O34 A;  3ZVQ B;  3P64 A;  4G4H A;  4NSH A;  1GF9 A;  3G3W A;  4WLD A;  1NKH A;  2CUU A;  1OUD A;  5IDD A;  1L30 A;  5II3 A;  3CDV A;  1C6J A;  1L56 A;  2OU9 A;  2B6Z A;  5H2N A;  1B7N A;  3HT9 A;  5B6X A;  2RB1 X;  4ETB A;  1GFA A;  4U3X B;  3S8F B;  1PXS A;  2FYC A;  3UZC A;  3TXD A;  2Z18 A;  2D4K A;  4QRY A;  2W1X A;  5LIN A;  1M0L A;  3NSB A;  1LI3 A;  1DYG A;  5FCP A;  1LZC A;  1OUI A;  2PED A;  4NIJ A;  1KY1 A;  1TLA A;  2I21 A;  1VFB C;  4WG7 A;  3QAP A;  1C61 A;  4WO9 A;  3HBE X;  1GE0 A;  5I5Q A;  1EQ5 A;  1HEN A;  2O79 A;  4Y9H A;  3A6B Y;  1S52 A;  205L A;  1BRX A;  5D5C A;  1AT5 A;  2RB2 X;  4R6C A;  2KS9 A;  5D5F A;  2D4I A;  5H2L A;  1C6A A;  207L A;  5G53 A;  3WUA A;  4N9R A;  4NSJ A;  4G4B A;  1KXW A;  1GUE A;  2W1M A;  1AT6 A;  2KSA A;  1UAZ A;  4C5F A;  184L A;  1F10 A;  4EA3 A;  4ARP A;  168L A;  1GBO A;  1IWY A;  4BS7 A;  1WTN A;  1UAC Y;  1UCQ A;  172L A;  1CV5 A;  2X72 A;  1BB5 A;  2C8P A;  256L A;  227L A;  4W54 A;  2WJL A;  1L74 A;  4EJ4 A;  1S54 A;  2L78 A;  1GFU A;  3B6L A;  4W55 A;  1L0J A;  2Y03 A;  1QSA A;  2G4N A;  3DN2 A;  4OW1 A;  123L A;  3AYM A;  4LYC A;  4TX7 A;  1WTH A;  1OUF A;  1NQI A;  4E97 A;  3DN8 A;  2BQO A;  162L A;  1FLQ A;  1OUE A;  4ARQ A;  1G0G A;  1L23 A;  1YQV Y;  4H8Z A;  138L A;  1AT9 A;  4EKQ A;  2LZM A;  1PQD A;  3HWL A;  2DQH Y;  1LYS A;  4W57 A;  3M3U A;  4H91 A;  4I7J A;  1LZT A;  2FYD A;  4HPI A;  4B4E A;  3PBL A;  3C9M A;  4AGA A;  4N5R A;  4JQ6 A;  1REM A;  3A96 A;  1GEZ A;  1XJI A;  2F2Q A;  3G3B B;  1OUJ A;  3HUA A;  3QBL A;  3GUN A;  1RE2 A;  4QEQ A;  1BRD A;  4PRQ A;  2H9K A;  2HUL A;  3LZM A;  5EBH A;  4GLV A;  5KXW A;  3A3Q A;  1LGU A;  4GCB A;  2BQA A;  1G06 A;  2EKS C;  252L A;  3ODU A;  1IX0 A;  1L46 A;  1XFP L;  214L A;  3UZA A;  158L A;  132L A;  3ABW A;  1LHI A;  4LFX A;  1G07 A;  4ML7 A;  5B2N A;  1LZG A;  5LVG A;  5B06 A;  4YXC A;  1EQE A;  1JV6 A;  1IR9 A;  2F95 A;  5F9X A;  1GF5 A;  3GUO A;  2LYM A;  1L45 A;  1LGW A;  1UIG A;  3AZ7 A;  3OE9 A;  3HTB A;  1QSQ A;  2F47 A;  221L A;  2MEF A;  2MEI A;  4GPO A;  1C8R A;  4NWH A;  1SQ2 L;  1UIH A;  251L A;  2DQI Y;  171L A;  1IXF A;  4G7S B;  1P64 A;  3TXJ A;  1NWG A;  1IIZ A;  1DKK A;  4H92 A;  4LZT A;  1YAQ A;  1T3P A;  3QNG A;  4ARJ A;  1L07 A;  1L10 A;  1L98 A;  181L A;  2LCB A;  1LZA A;  1GB5 A;  1IOQ A;  226L A;  5ETZ A;  1AM7 A;  1L91 A;  1WQR A;  1IWV A;  4QID A;  3QJV B;  2MEG A;  1REZ A;  5IEL A;  102L A;  4A7D A;  2KSY A;  3WUM A;  128L A;  232L A;  4IAT A;  1TAY A;  1J1P Y;  5APD A;  4H9I A;  104L A;  127L A;  210L A;  4GN3 A;  5L3I A;  175L A;  5B1G A;  5KXO A;  1IP2 A;  1L61 A;  4ARQ B;  4AQN A;  1GB9 A;  4I7P A;  1L67 A;  3C81 A;  4NGL A;  1VGO A;  4KPM A;  1HEP A;  3L64 A;  3RUN A;  1XEJ A;  3AW7 A;  3HAQ A;  3G3V A;  3CDO A;  2QB0 B;  163L A;  2YSS C;  5B59 A;  1LSG A;  1RJC B;  3QJS B;  1OWZ A;  3LYT A;  4BV0 A;  1KW5 A;  1L03 A;  1LZE A;  1QDR A;  4I7N A;  2W1Y A;  3CSZ A;  1QTK A;  2BLX A;  4II8 A;  3K3T A;  4EIY A;  1LMN A;  4DT3 A;  3OE6 A;  2D4J A;  4WL7 A;  2G87 A;  3N9E A;  4ETC A;  1L09 A;  3QBI A;  5F8U A;  1SWY A;  118L A;  1DYD A;  1L76 A;  2IFF Y;  1CV4 A;  3ZPQ A;  4KLY A;  4GBR A;  1QUG A;  1LSE A;  3HAS A;  5LYT A;  5E9R A;  3VW7 A;  2FBB A;  3X3C A;  1G7J C;  3FAD A;  1DI4 A;  5B07 A;  1OQM A;  228L A;  5EN0 A;  1DYB A;  1P36 A;  1DZB X;  1LHK A;  1LW9 A;  2YDO A;  1SSW A;  1C46 A;  4QGZ A;  3LHM A;  1L49 A;  2Y01 A;  147L A;  1JHL A;  1OYU A;  154L A;  1WQN A;  189L A;  4LDO A;  4AMI A;  1OVH A;  1C6D A;  4J0L A;  1INU A;  1BB4 A;  4H90 A;  3K2R A;  6LYZ A;  4LT1 A;  3PWH A;  5G36 A;  5LAF A;  4NGK A;  3WU8 A;  1XGU C;  3EMS A;  1GBW A;  3GUI A;  2CWI A;  1CUQ A;  1B7M A;  1P3N A;  5L3H A;  2BQG A;  4CFP A;  1L31 A;  2ZZL A;  5FHW A;  3A3R X;  199L A;  2Z2E A;  1JTP L;  4I7T A;  4N1E I;  1H68 A;  1G1W A;  2BQK A;  218L A;  110L A;  4NHQ A;  1L43 A;  1JJ0 A;  1CU2 A;  2AT9 A;  4ETD A;  3WPL A;  2HPY A;  1B5V A;  215L A;  3UTY A;  1LTM A;  1IC4 Y;  2HEA A;  2KSB A;  182L A;  4HSF A;  4N1C C;  1L57 A;  1UUZ C;  1VDS A;  3D3D A;  4NC3 A;  3WW6 A;  254L A;  3EML A;  5KXM A;  4X32 A;  4WMG A;  245L A;  1LZ9 A;  1LOZ A;  1UCO A;  5LWE A;  5JEN B;  3A7K A;  2LYO A;  1C64 A;  1QTZ A;  3LYO A;  4G7Q B;  1YKX X;  2PC2 A;  4B0D A;  4I7K A;  3A34 A;  4GN4 A;  1DYA A;  2X0A A;  5HLL A;  2RSC A;  1L47 A;  1LMT A;  1SX7 A;  3FI7 A;  3GXK A;  148L E;  4DD0 A;  4GBR B;  2DQC Y;  5T3F A;  1FLU A;  5A45 A;  4OWC A;  1LYD A;  170L A;  2LHM A;  4LYT A;  208L A;  1KIP C;  1U19 A;  4NHI A;  4XJF A;  3TMV A;  1L18 A;  2NTW A;  4MR1 A;  173L A;  2YBH A;  1B5Y A;  5C6L A;  3WL2 A;  3CT0 A;  1NMM A;  2MEA A;  4UG2 A;  4YEO A;  4X1H A;  4C3W A;  5LYZ A;  4LT0 A;  7LZM A;  1YKZ X;  3BKH A;  1WQQ A;  1LYY A;  1L90 A;  2XBS A;  1S8J A;  1UID A;  1IR7 A;  1JTN A;  1G7M C;  1LZB A;  3AJN A;  4HJZ A;  3LYM A;  1LJF A;  4YF2 A;  155L A;  1L73 A;  2OEA X;  1B5X A;  1C6E A;  1GAY A;  1L28 A;  2Z2F A;  1D3J A;  3AB6 A;  1NBY C;  4YOP A;  4RW2 A;  2HED A;  5DM9 A;  2ZIY A;  1L38 A;  2IGC A;  1HEM A;  4G7R B;  4G49 A;  4NGV A;  4EXM A;  1FBB A;  1QKP A;  125L A;  4QY9 A;  4H9A A;  4YXA C;  1G0L A;  4DS7 E;  3J4G A;  5APE A;  4GRV A;  1F0W A;  2YBL A;  1QSW A;  4I7R A;  1KS3 A;  2BQE A;  1L20 A;  259L A;  140L A;  1QT5 A;  2YBI A;  246L A;  1C10 A;  2F32 A;  4HV1 A;  237L A;  3QJT B;  1C6C A;  5ILC A;  4XJB A;  1G0P A;  1L58 A;  1KGB A;  1N4F A;  2Z12 A;  5TGZ A;  1YAP A;  1P8U A;  1L00 A;  3NY9 A;  2I35 A;  4Z46 A;  5LYM A;  180L A;  2JAG A;  4LFP A;  1C08 C;  1IP7 A;  4MQT A;  3B0O A;  3DN0 A;  4DD1 A;  3WQJ A;  2ZFE A;  2YDG A;  3ZEK A;  1D0K A;  1KNI A;  4HPE A;  2YCW A;  5DN4 A;  1QUH A;  3BKV A;  5DHH A;  5LVJ A;  1P37 A;  1LYJ A;  4B1A A;  3S3D B;  4DD2 A;  4XJH A;  239L A;  1GFV A;  1TDY A;  229L A;  4W58 A;  2RBQ A;  235L A;  2XBR A;  4N8Z A;  3AYN A;  1LYH A;  5AHY A;  4I7L A;  4RLN A;  109L A;  4BAF A;  1JV7 A;  4YEN A;  1JFP A;  1QT8 A;  1XGQ C;  2XTH A;  5APC A;  1L08 A;  5B35 A;  1CKH A;  4B4J A;  1GHL A;  1LJ4 A;  1LMQ A;  3L2X A;  1GFJ A;  2RBN A;  1JJ3 A;  2HUM A;  1XEK A;  4DYG A;  2HEE A;  2DQJ Y;  4OV0 A;  3EXD A;  225L A;  3A91 A;  3QJQ B;  1HFZ A;  1JIT A;  3T45 A;  2Q9E A;  4N0J A;  5C6J A;  2I1X A;  5IHG A;  1GXX A;  4BAD A;  4N6H A;  1HER A;  3GUP A;  1EL1 A;  1T8G A;  1JKD A;  1G7L C;  1FKV A;  5KXX A;  1LN6 A;  2WAR A;  4J7V A;  3VI0 A;  4UWN A;  4D9Z A;  1GF4 A;  1L16 A;  5LVK A;  4PXK A;  157L A;  1GB3 A;  3AZ4 A;  1IW6 A;  1CKC A;  1L79 A;  2LZ2 A;  1L66 A;  4RDS A;  3QAK A;  1LYI A;  1VAT A;  5C1M A;  1L80 A;  1ZMY L;  2RAZ X;  1L50 A;  3TXH A;  1PXR A;  2B6W A;  4BAP A;  5LIO A;  3WXT A;  5LA5 A;  5LVH A;  4JKV A;  4X31 A;  1BVX A;  3S3C B;  1IP1 A;  1QIO A;  2BQI A;  4LYZ A;  2LNL A;  3RW8 A;  5APF A;  167L A;  1J1X Y;  1GF0 A;  1L81 A;  1L84 A;  4UWU A;  1C6I A;  3DN6 A;  3TXB A;  107L A;  4XXJ A;  3QDC A;  3W6A A;  1QTD A;  1IY3 A;  2HEC A;  2ANV A;  3ATO A;  1L85 A;  1L51 A;  5F16 A;  3N9A A;  3HU9 A;  4LT3 A;  1B9O A;  1JWR A;  1DKJ A;  1L75 A;  4DQ7 A;  4OWH A;  2H9J A;  5H2P A;  2MEH A;  3JR6 A;  1MLC E;  2MEB A;  1LJK A;  1QDT A;  1DZE A;  4GCD A;  4NGW A;  3IJU A;  4WO6 A;  2D6B A;  1EHK B;  159L A;  1IWW A;  1VJM A;  137L A;  1L96 A;  1LMO A;  5ITC A;  4N4Y B;  3T6U A;  2QPE B;  4JR8 A;  3HT7 A;  1BVK C;  3C82 A;  3V2Y A;  4FPD A;  1T6V L;  1QTC A;  191L A;  2B72 A;  1TCY A;  3A6C Y;  219L A;  260L A;  4MST A;  4WG1 A;  3RZ4 A;  1GF3 A;  1L26 A;  1IY4 A;  1LZ8 A;  1PS5 A;  4K5Y A;  4GCE A;  2NWD X;  3KJ6 A;  1LHM A;  3WXU A;  2Y8P A;  1FLY A;  222L A;  1OUB A;  1LJJ A;  3QY4 A;  183L A;  3C9L A;  4S0W A;  2BQC A;  3TMU A;  4HTN A;  1L24 A;  3HTD A;  2LYZ A;  2ZQ3 A;  4G9S A;  3PDS A;  1L06 A;  1GFH A;  1G0M A;  4FA7 B;  1GB0 A;  2NTG A;  1QT4 A;  5B34 A;  1CNS A;  3A94 A;  3LZ2 A;  3QJR B;  135L A;  1FDL Y;  2DKV A;  1YAN A;  4PXF A;  4WLY A;  5B6Y A;  2OTZ X;  1VDT A;  1JSE A;  230L A;  1I56 A;  1K28 A;  186L A;  3GUM A;  1L55 A;  4W59 A;  1OVJ A;  2ANX A;  4WM6 A;  1L89 A;  4NGY A;  5B0W A;  4I7M A;  2WJK A;  1NHB A;  4IAR A;  4KNF A;  1P46 A;  2B6Y A;  4H1P A;  4HJV A;  5LVI A;  2DQF C;  4UHR A;  2Z37 A;  1S8L A;  1LSB A;  5FST A;  4MQS A;  133L A;  3EH4 B;  2VB1 A;  1XEP A;  4TL3 A;  2QAR C;  1LJH A;  1REY A;  220L A;  1L9H A;  4G4C A;  1NDM C;  4NFV A;  2YBM A;  4MCK A;  3RU5 A;  1QS9 A;  3B0K A;  3A90 A;  1L33 A;  1C69 A;  2HUK A;  1LZS A;  2DQE Y;  3SB5 A;  1HEQ A;  3W6F A;  4ETE A;  1CJ9 A;  1CU0 A;  1GWD A;  206L A;  241L A;  1GEV A;  1C6F A;  5LA8 A;  1P5C A;  5J7A A;  1JUG A;  2DBT A;  3ZPR A;  1ZUR A;  2O4W A;  1GDX A;  5H2H A;  1L65 A;  1LLH A;  6LZM A;  4J4Q A;  3WYH A;  1L04 A;  1L64 A;  1B5Z A;  1H87 A;  120L A;  3WPJ A;  3D9A C;  1EPY A;  5G2A A;  3REY A;  3HUQ A;  1CV1 A;  1B2K A;  1L22 A;  5AX0 A;  1QQY A;  2CGI A;  1T6H A;  4NG1 A;  2ZQ4 A;  5F9U A;  115L A;  1LJN A;  4LYM A;  3GXR A;  1OV7 A;  1TEW A;  4W52 A;  1IP3 A;  2W1L A;  1LYO A;  1P8H A;  3SB9 A;  164L A;  2HTX A;  1UC0 A;  2OTY X;  4H9C A;  3HH5 A;  1LHH A;  5HNC A;  3DMX A;  1C60 A;  5FEL A;  2RB0 X;  1LJG A;  1FKQ A;  5KXL A;  3V2W A;  3FI5 A;  1QTE A;  187L A;  1L95 A;  1GAZ A;  1FLW A;  224L A;  1G0K A;  243L A;  1LMP A;  3HTG A;  1GE1 A;  1D6Q A;  2XQO A;  1CWQ A;  1ZV5 L;  2EIZ C;  1KIQ C;  1M0K A;  5AHZ A;  4I7S A;  1DPW A;  2ZWB A;  195L A;  3COC A;  3AGI A;  1PQM A;  174L A;  1MEL L;  2IHL A;  4NWE A;  1YAO A;  4ZIX A;  150L A;  2RBR A;  4IAP A;  5I54 A;  177L A;  193L A;  1HSW A;  1L72 A;  152L A;  1XGP C;  112L A;  1HZX A;  1G0Q A;  4DAJ A;  5KKJ A;  231L A;  234L A;  1L35 A;  5I14 A;  5ITE A;  2QPD B;  240L A;  233L A;  4LZM A;  1LWG A;  1XGR C;  1KXY A;  1LYF A;  1X0S A;  3DN4 A;  1GB7 A;  4H94 A;  4DWX A;  3NS0 A;  119L A;  1GE2 A;  3E3D A;  3W3E A;  1BWI A;  1C6M A;  4IJ4 A;  4PPO A;  1L15 A;  1QTH A;  1QUO A;  4OO9 A;  1T8A A;  5I4W A;  1DQJ C;  2LC9 A;  1UIC A;  2MEC A;  2DQA A;  1DXJ A;  1SWZ A;  2I20 A;  4ZFP A;  4DD9 A;  1KME A;  4HTK A;  1LSY A;  1PQO A;  1T8F A;  5HQ1 A;  4YX7 C;  1O0A A;  3M18 B;  1BRR A;  1LZ6 A;  258L A;  4NSI A;  3HBH A;  3N9C A;  4LYO A;  1IWZ A;  1D2Y A;  3SP3 A;  5FDJ A;  1TN5 A;  1EQ4 A;  1L19 A;  1C63 A;  3VVK A;  1D3M A;  5KXK A;  3G3A B;  1L68 A;  1JIS A;  1GFR A;  1L0M A;  4HP0 A;  1L02 A;  3AM6 A;  1PQJ A;  223L A;  1GBX A;  4WAV A;  3HTF A;  1YIK A;  144L A;  4AXT A;  2BLY A;  4MD1 A;  5A44 A;  1LAA A;  1L48 A;  2BQB A;  1LMA A;  2NTH A;  2ZYP A;  1FBK A;  2ZIK A;  3QBK A;  1RI8 B;  1JTO L;  4B4I A;  1QSB A;  209L A;  1WQO A;  2B75 A;  3C80 A;  1JIY A;  103L A;  1AKI A;  4HV2 A;  4I7Q A;  5G54 A;  1L40 A;  1SSY A;  4X3B A;  1Z55 A;  4WW3 A;  2HEF A;  2BQN A;  3MBV A;  1IR8 A;  1L82 A;  3DNA A;  1QUS A;  216L A;  1GFT A;  1C6K A;  2B6T A;  5J7C A;  1JKB A;  5KJ9 A;  3J6K A;  1VAU A;  5DLA A;  4FDY A;  3P4Z A;  3DN1 A;  5BR5 A;  4EKS A;  1C6H A;  3FE0 A;  1L63 A;  2Z6B A;  3HUK A;  166L A;  1IOR A;  2OE9 X;  1LZY A;  2ZNX Y;  4ETA A;  1XME B;  3HAR A;  1V7S A;  2EI4 A;  1NDG C;  3DMV A;  3SB7 A;  5G2C A;  5KXY A;  3MGW A;  4KXI A;  1H2S A;  4QDN A;  1L42 A;  4A4M A;  1C62 A;  4NHP A;  2RH1 A;  4AMJ A;  1QT7 A;  1L12 A;  1L14 A;  3C7Z A;  4H9B A;  5H2O A;  108L A;  1L88 A;  3SN6 R;  1JTM A;  1LZ4 A;  1D3F A;  5A3Z A;  1CX6 A;  4WM5 A;  5H2I A;  3IJV A;  1CV3 A;  5DYS A;  213L A;  1BB6 A;  5FJG A;  2XJW A;  3F8V A;  1GFG A;  3WUN A;  5KXT A;  3DMZ A;  1FBI X;  1B7R A;  1LJI A;  1B7O A;  4ET9 A;  3OE0 A;  5K7O A;  3HAP A;  5H2K A;  4WLX A;  2B70 A;  4CJ2 A;  3AW6 A;  2F30 A;  4XT3 A;  4PRU A;  1L94 A;  1B6I A;  1KXX A;  1UBZ A;  1L17 A;  1C8S A;  2AUB A;  1I1Z A;  2DQD Y;  1GZM A;  2Z73 A;  1CJ6 A;  5E4P A;  1VDQ A;  2RBP A;  4DD3 A;  4LGK A;  4H8Y A;  1VED A;  244L A;  2ZIJ A;  3CB7 A;  4NHS A;  1G7H C;  253L A;  3UTW A;  1BB7 A;  3VHZ A;  1F6S A;  2GV0 A;  1F50 A;  2BQD A;  3WVX A;  1E12 A;  2H5Z A;  142L A;  1L83 A;  3CSR A;  3WU7 A;  4YM8 A;  4Z3M A;  3W6D A;  4XTL A;  1M0M A;  4CHX A;  1P2L A;  5A3E A;  4XAD A;  1C3W A;  3WU9 A;  3OAX A;  149L A;  2DQG Y;  1L0K A;  5F14 A;  4BVN A;  3CDQ A;  2M3G A;  1L92 A;  1GPQ C;  2D91 A;  4LDL A;  4NSG A;  2Z19 A;  1QKO A;  3A92 A;  5B6V A;  3RFM A;  3IWR A;  1AP9 A;  3QE8 A;  1LZ5 A;  3C8S A;  2Y00 A;  1L32 A;  190L A;  4MD2 A;  1CX7 A;  1GBZ A;  4NGI A;  3ZEV A;  3A95 A;  3CQL A;  4NHT A;  2BAA A;  4N4W A;  1L29 A;  3KAM A;  4FBZ A;  1QUT A;  1TBY A;  4H9F A;  1GB2 A;  4UWV A;  2B73 A;  4I7O A;  1P2R A;  6LYT A;  3P66 A;  1F6R A;  1HF4 A;  185L A;  1LSC A;  3C83 A;  3F6Z A;  5KXZ A;  129L A;  248L A;  2YCY A;  151L A;  1B0D A;  1C43 A;  1LSA A;  5KXP A;  1L62 A;  1IO5 A;  3WPK A;  1NBZ C;  4IAQ A;  1KW7 A;  4OWB A;  2R4R A;  2A7D A;  1HHL A;  1QHJ A;  5H2J A;  3EO5 A;  2Z55 A;  1WVU A;  2R4S A;  4G72 B;  3CT5 A;  3WH1 A;  4HTQ A;  4WLT A;  160L A;  1HNL A;  1XGT C;  3DKE X;  4XEN A;  4ARL A;  1QT6 A;  3AZ6 A;  4WM4 A;  3W6E A;  2JAF A;  1IP5 A;  1L27 A;  131L A;  4IB4 A;  3CSQ A;  4EKR A;  4XJG A;  2LZT A;  4EPF A;  3C7Y A;  1L05 A;  1WTM A;  1E8L A;  4W94 A;  4I0C A;  3COD A;  1LJ3 A;  126L A;  4QI1 A;  1WVV A;  1JQU A;  4XYY A;  4W96 A;  1L52 A;  1JGJ A;  143L A;  1L54 A;  1SLY A;  4EOF A;  3TXF A;  5KY1 A;  1YRO A;  3FA0 A;  1L97 A;  1LWK A;  3P65 A;  5B6Z A;  3LYZ A;  1LJE A;  2YCZ A;  7LYZ A;  1F88 A;  4W51 A;  1XSF A;  5AZD A;  3WW5 A;  146L A;  1L60 A;  4FJR A;  5JJE A;  1JSF A;  1CU3 A;  5DHG A;  8LYZ A;  2HEB A;  1HFY A;  3PQR A;  1L34 A;  1HMK A;  1LZD A;  1HC0 A;  3P0G A;  4Z41 A;  3T36 A;  1JTT L;  1A4V A;  3TXE A;  2ZIL A;  1NHE A;  1S53 A;  1C6P A;  1GBY A;  1LSD A;  1PZY A;  161L A;  1JJ1 A;  4DDC A;  1CKG A;  3QJU B;  4ANR A;  4HJY A;  4XN6 A;  4BWB A;  247L A;  3SB8 A;  1I6S A;  5B05 A;  2B74 A;  3GUL A;  4BEY A;  1DPX A;  1L87 A;  1B5U A;  1LSM A;  4BEZ A;  1L93 A;  1LSF A;  1QTB A;  5C6I A;  1OVK A;  1AZF A;  2EQL A;  188L A;  1LSP A;  5KXR A;  1CTW A;  4G70 B;  5G2D A;  4E3U A;  1CUP A;  5DN5 A;  1IW9 A;  1L70 A;  3NY8 A;  4DDB A;  145L A;  1LZR A;  3SBA A;  156L A;  3AZ5 A;  4PGJ B;  1F4Z A;  1PQK A;  1ZVY B;  1G1V A;  1RCM A;  5B6W A;  3OJP A;  4RLM A;  3HH3 A;  257L A;  5HMJ A;  1LZN A;  5LZM A;  212L A;  3X3B A;  1GFE A;  1BWJ A;  1L36 A;  1QUD A;  2Q0M X;  4GCF A;  4L6R A;  3VG9 A;  1QS5 A;  2BQJ A;  1W6Z A;  1IC7 Y;  4WOA A;  1CU6 A;  2ZNW Y;  4KT3 A;  2BQF A;  113L A;  1L41 A;  1HEO A;  249L A;  1LZ1 A;  5FEK A;  2F4G A;  5A8E A;  2OU8 A;  4NGZ A;  1LGX A;  5F81 A;  3DN3 A;  2CJL A;  1GFK A;  4MBS A;  1NF5 A;  2F93 A;  5I53 A;  5G28 A;  1L44 A;  1YKY X;  1LI6 A;  1L77 A;  1YAM A;  1KY0 A;  2Y04 A;  4L41 A;  1OUH A;  4HWL A;  1LSZ A;  3C8R A;  1SX2 A;  2YDV A;  2OE4 X;  4PJ2 C;  4DD7 A;  4I8S A;  3GUJ A;  242L A;  1GF7 A;  4NGJ A;  4DQJ A;  1GB8 A;  3OE8 A;  1BHZ A;  1HML A;  2BQL A;  4H9E A;  3CDR A;  1PQI A;  4OWA A;  1DYF A;  3CAP A;  4GP8 B;  1R84 A;  1XEI A;  2HU3 A;  3VGA A;  2HUB A;  1GF6 A;  1DYE A;  139L A;  255L A;  1LSN A;  4CFO A;  2I26 L;  4GYC A;  1CKF A;  4HYX A;  1GBS A;  1CJ7 A;  1MGY A;  122L A;  3B0I A;  1UIF A;  3A67 Y;  2VT4 A;  4GLA A;  4P2E A;  1B7S A;  3HT8 A;  2Y02 A;  1L53 A;  2YBN A;  3HT6 A;  1OV5 A;  5B1F A;  4OOO A;  3WMK A;  3ULR A;  1BM1 A;  1OWY A;  9LYZ A;  1GD6 A;  1CU5 A;  1XIO A;  1LKR A;  4M6D A;  3DDL A;  3HFM Y;  3F9L A;  1X0I 1;  1RFP A;  1O23 A;  4H93 A;  4PK0 A;  3OK0 A;  1IOC A;  2Z38 A;  1L39 A;  1W08 A;  3TXG A;  1C6B A;  4OWE A;  1HEL A;  3G3X A;  1QM8 A;  1ZWN A;  1L25 A;  1C45 A;  178L A;  1IP6 A;  1BB3 A;  4WM1 A;  1BWH A;  3HBD A;  5BR2 A;  2RAY X;  1LPI A;  1WQM A;  1J1O Y;  1FN5 A;  1LHJ A;  3HH4 A;  4NGO A;  4LDE A;  4YEM A;  3AGG G;  1B7P A;  1WQP A;  2CDS A;  5AWZ A;  3VWO A;  1IP4 A;  3HDF A;  1YIL A;  250L A;  4TWS A;  4J1B A;  4ET8 A;  3AGH A;  2B5Z A;  3HAN A;  1D3N A;  1C67 A;  141L A;  165L A;  1P8I A;  3CT1 A;  4ZEE A;  1P2C C;  2MED A;  1B7Q A;  1LYG A;  1QTV A;  4EKP A;  1C7P A;  1ZYT A;  2F2N A;  238L A;  196L A;  1BGI A;  4TSB A;  236L A;  5JJJ A;  4KL7 A;  1G7I C;  4HYJ A;  1TN0 A;  176L A;  1JEF A;  4EPI A;  4G71 B;  1L69 A;  3UG9 A;  1XJT A;  4DKL A;  1R2N A;  2EPE A;  5HNL A;  1CV6 A;  2RBS A;  4ZPU A;  3TXI A;  3ATN A;  2BPU A;  4OOT A;  2B6X A;  1B5W A;  111L A;  1IEE A;  1IOT A;  1L71 A;  3WUL A;  1IWX A;  3UON A;  1IOS A;  1E0P A;  2BRD A;  3EH3 B;  4W53 A;  5DL9 A;  4LYB A;  1OUC A;  1IWT A;  1C6N A;  1D6P A;  2YVB A;  4WM3 A;  1D0M A;  1V7T A;  4TTD A;  4XTN A;  4XT1 A;  4B49 A;  2N5Z A;  1JKA A;  1L21 A;  2C8O A;  4BUO A;  3C8Q A;  3CDT A;  4NEB A;  1OP9 B;  4ARM A;  3LN2 A;  1UIE A;  1LHL A;  2L6X A;  169L A;  3HU8 A;  5AMY A;  2OU0 X;  3B72 A;  1C6Q A;  4DC4 A;  5H2M A;  1GF8 A;  3NYA A;  3QBG A;  5I4Y A;  1VDP A;  2ZYC A;  2FBD A;  2NTU A;  1XJU A;  198L A;  211L A;  3UTV A;  1DI5 A;  3S8G B;  2Z39 A;  5AX1 A;  1P6Y A;  4RW1 A;  1CKD A;  200L A;  1HSX A;  1P7S A;  1JPO A;  1KG9 A;  2J4Y A;  1YL0 X;  1DYC A;  1GE4 A;  2YBJ A;  4XJI A;  3EH5 B;  192L A;  4GP4 B;  1KIR C;  114L A;  2MEE A;  1BQL Y;  1D9U A;  2BQH A;  1IC5 Y;  4GN5 C;  1L99 A;  2RBO A;  4XJD A;  3WVY A;  3PXO A;  2A4T A;  1YL1 X;  1HFX A;  1C6G A;  3HDE A;  2G4Q A;  5KXS A;  5L9J A;  217L A;  3ZVQ A;  1CVK A;  194L A;  4J1A A;  1QT3 A;  3RZE A;  2Q9D A;  4H8X A;  1D9W A;  3D4S A;  5LAG A;  4TUN A;  1Q5J A;  1L59 A;  4CGE A;  2I25 L;  197L A;  3GUK A;  3W6B A;  261L A;  1GE3 A;  1KG8 A;  4R0F A;  1H6M A;  3SB6 A;  2O7A A;  1D0L A;  4L35 A;  1UIB A;  5ILF A;  1OUA A;  1I20 A;  1LKS A;  1L01 A;  1T97 A;  1C68 A;  4DQ5 A;  1D2W A;  1DI3 A;  5I4X A;  1LMC A;  3W6C A;  4EMN A;  1GB6 A;  2BQM A;  1LCN A;  5JJN A;  3C7W A;  5HMV A;  1L13 A;  1ZVH L;  3AYQ A;  1IVM A;  1L86 A;  4W56 A;  1CJ8 A;  262L A;  3HAO A;  1L37 A;  1LI2 A;  1S51 A;  1C65 A;  4GP5 B;  4FAA B;  3HH6 A;  1PY6 A;  4WM2 A;  3S3B B;  201L A;  4H9H A;  5M1Y A;  1C6T A;  4ARM B;  2HU1 A;  3SBB C;  2F4A A;  2I6Z A;  1C66 A;  2G4P A;  4PJZ A;  4M4O A;  1CV0 A;  1LPY A;  4XTO A;  4PHI A;  2OE7 X;  1OUG A;  4NG8 A;  3RNX A;  1LYE A;  3EBA B;  3A8Z A;  1JKC A;  1GDW A;  5LXW A;  134L A;  4GCC A;  1Q5I A;  3TMW A;  1C6L A;  1IWU A;  4LT2 A;  153L A;  2A7F A;  3RT5 X;  1L11 A;  1P56 A;  5KKH A;  1X0K 1;  3DQB A;  1GXV 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...