5KLVE

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 5klvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5klvE02
2BCCE 4QCKA 1NDOA 1NYKA 1FQTA 2FYNC 2YFIA 2YVJB 2BMOA 3H1KE 2BMRA 2B24A 2GBWA 1SQXE 2D2CD 4AIVA 4OGQD 2YFLA 4NBAD 4HM0A 2HMNA 2FYUE 4NBDD 4NB9D 4NBHD 4QDDA 2HMOA 1G8JB 4HKVA 1PPJE 1BCCE 3VCPA 4QURA 5KLIC 3L70E 2Q3WA 3CWBE 4EMJB 2E76D 3VMID 4HM2A 3H1IE 4NBED 2XSOA 3H1HE 3GZYA 3H1JE 3GKEA 2JO6A 4QDCA 1P84E 1PP9E 1O7NA 2I7FA 3CX5E 2NUMA 1SQBE 1ZRTE 2NVGA 2B1XA 3GL0A 3GCEA 2JZAA 3C0DA 3FOUA 5HL4A 4P1CH 1WQLA 1O7MA 2E4PA 4AAYB 1SQVE 2A06E 4HM1A 1NTME 4HM5A 1L0LE 4PD4E 3VCAA 2HMMA 3EQQA 1EG9A 1BE3E 3L73E 3GZXA 3VMHD 3TGUE 4NBBD 4QDFA 3GB4A 1VF5D 2CKFA 4H13D 2NVEA 4QUQA 4HM7A 1ULJA 4QDFB 2E75D 3DQYA 2XSHA 4NBCD 1SQQE 3GTEA 3L74E 1RIEA 4NBFD 1NU1E 3H1LE 2NVFA 3GL2A 4HJLA 3AZCA 5AEWA 4H0LD 5CXMA 5BOKA 4U3FE 3VMGD 1VM9A 3EN1A 4NB8D 1L0NE 2QPZA 2QJKC 1O7WA 2XRXA 4HM4A 1O7GA 4QUPA 2QJYC 2YIUC 1O7PA 3N0QA 3L75E 3D89A 2GBXA 3GOBA 1G8KB 5KLVE 2HMLA 2NWFA 1JM1A 1O7HA 4HM6A 5AEUA 1KB9E 3GTSA 2BMQA 1BGYE 4H44D 1UUVA 2DE7D 2ZYLA 1UUWA 2HMKA 1ULIA 5KKZC 4P1BH 2HMJA 4D6TE 1NTZE 2DE5D 2IBZE 2ZT9D 1Q90C 4HM3A 4PV1D 3L72E 3L71E 2NUKA 3CXHE 1VCKA 4HM8A 2DE6D 2YFJA 1EZVE 4NBGD 1NTKE 2E4QA 1RFSA 2QJPC 1KYOE 2E74D 2XR8A 1SQPE 3BCCE 1SJGA
chains in the Genus database with same CATH superfamily
3D70A 2QE7H 2V7QJ 3N4XA 1NGMB 2IBZG 3A0BE 4H44C 2P7JA 2V7QH 2LXBA 2O3JA 3GHGB 2P67A 2HMNA 3QH9A 1USEA 1G1JA 5EFWB 5K5GB 1HWTC 1PPJE 3CXHH 3OW2O 1JCCA 1SQBG 1LT9B 1IFNA 1SQBK 3GG2A 4H0LB 1N7SB 1Q86Q 2YXQB 3C0DA 4P1CH 3CCQP 3A0BH 1U7JA 2KP8A 4WWIA 1G1IA 1BGYD 1PIXA 1SFCC 3L71D 1RIEA 1X22A 2N1TD 5APXA 1EZVD 2GA1A 2R3CA 4AUWA 4HJLA 1BE3G 3VP9A 2B9BA 1MFTA 1GL2D 3EFGA 4NB8D 1M1JA 2Q5UA 1LP1A 2QJYC 1NU1G 1BDDA 2GBXA 4EYYQ 4EDFA 2L91A 1WRGA 3KXDA 1N73C 3GHGA 5AW9B 1VCKA 1SQVK 1R5SA 2E74D 1JCDA 5CCGD 3S4RA 1ZP0C 2YO3A 1BGYJ 2E75B 2P58A 3H1KE 1L0LD 4XA4A 3IAOA 1IFJA 3L73D 1MKMA 3H1HD 3QWOC 1KB9D 2O1JA 2OYHA 1A02J 3E1IA 4C7NB 1BCCE 3L72D 2Q3WA 5BU8B 3HD7C 4ZMDA 3PP5A 3AEGC 1VQ8P 1JUNA 1H0TB 3M0DA 3L72J 4L75A 1AV1A 1KB9I 1BE3E 4D6TG 2D2CB 1J1DB 2H43A 2CKFA 2KLVA 2OGUA 1J1EB 4L76A 2M3EA 2BASA 3L74J 3AE1C 1LT1A 4NBFD 2R3SA 4UB8E 2WSFH 3HRNA 3G4SP 3CX5H 4DJGA 3CX5D 2IDBA 1VF5C 5AVXB 3L74D 3L70G 3CCEP 1ZW0A 1KILE 5GTHH 3SWFA 1IFPA 2KUBA 1RE3C 1S2EA 3FWLA 1N8RQ 2ZYLA 5H2FE 4D6TE 1N7SD 2GUSA 2PGDA 1NTZK 1NKZB 5M1BA 3VP8A 1SQXJ 4Y28J 3MGNA 2W6JH 4AYCA 1NDOA 1KC8Q 1CI6B 3P8MC 4HJGH 3CC2P 4BRYB 1RY3A 5CJ4A 5DJTB 1NHLA 1K8AQ 1VL2A 3BVHA 1LTAC 5AVWB 5L8RJ 3D6ZA 1IFMA 3SWKA 4QMAA 1SFCB 3H1IE 2C0WA 4NBED 3O8ZA 3GW6A 1OW8A 1S9KE 4QDCA 3BASA 3BCCG 2NVGA 2BEZF 3KPEA 2FYNB 2ZXXA 1DEEG 3CCVP 2Y9YA 3L74G 2HPCA 1YIJP 2BCCG 5GTHE 3HD7A 1AVOA 3B5NC 4H13D 2E75D 1NTZD 2NPSB 2QEXP 3AECC 3M91A 2Q9IA 2A45I 2K3RA 2OTJP 3V4QA 2ZXEB 1EXIA 1Q81Q 1FE6A 3WU2H 1SQQD 1JY2P 3I5CA 3H1LJ 4XFJA 1PV3A 2WQYC 3MIWA 5AEUA 1JM1A 2WSFJ 1RF0A 2I1JA 1Q90D 1W2EA 4PJ0E 1JMMA 1QL2A 2NUKA 2M0BA 1OX3A 1KMIZ 1NTKE 2POHA 3HD7B 1KYOE 1NTMK 4O9BA 2Z4EA 3FWNA 1L0LG 1JO5A 1RE4C 1U7MA 3CD6P 2KNCA 4C7NA 4HM0A 1FS0E 1T2KD 3H1IG 1G8JB 3VMAA 1KQSO 1QL1A 2QM8A 4WY4A 4EMJB 5CHXA 1LWUB 4H44B 3L70J 2WSCJ 3A2AA 1SQBE 1ZRTE 2FBWC 1PPJG 1CI6A 1GK4A 3E7KA 1SQVE 2KXPB 1BE3J 2PFXA 1KFNA 1LTJC 1T8ZA 1PZQA 4N78E 3GF3A 2K88A 2M5AA 1FBMA 4ZKUA 1SVFA 1NOHA 1BCCJ 5AVVB 3VYIA 2O01N 3T97A 1A02F 2QJKC 1E79H 5E79H 1EZVI 2HMLA 3H1HG 3TF5A 3LW5J 1BGYE 1L0NJ 3SSUA 4HM3A 5CCHC 1SQVJ 1EZVE 2R5DA 4K35A 2FXPA 1SQBJ 3D71A 1RF0C 5C39A 2NVFA 1NWQA 1AJYA 2YFIA 2FYNC 2WPRA 4JF7A 3OA7A 2KNCB 3OAKA 1LT9A 2KOGA 2QIWA 4MN4C 3B5NB 3LW5H 1S3JA 2ZFCA 3TNUA 4YPCA 2NPSC 4LC1A 2OYHB 2E75C 2C9LY 3CWBJ 3NTNA 1VQ4P 1KFMA 2JZAA 5HL4A 2IFNA 3HUSC 2E4PA 1RHZB 4HM1A 1FJKA 3CL3D 1LTGC 3EQQA 1OWAA 2ZVOB 1S4XA 3GB4A 2QG4A 3AE5C 1ULJA 3CCJP 3L71G 1SQVG 1PGQA 1FAVA 3H1LE 1FDOA 1BSNA 3L75D 1FZCC 1M7LA 3JCUE 1LTJA 2PRRA 2KYVA 1N86A 5CXMA 2G3AA 3CCRP 4IFFA 3BATA 1J1EC 3M0DC 4H13B 2CPBA 3H25A 1VQPP 2OYOA 2YIUC 1G8KB 3GTSA 1VQNP 1S5LX 4H44D 3VMXA 1JY3O 1GW3A 2FXOA 2ZT9D 4U3FG 3RK3C 1Q90C 1VF5B 5KLVD 2KSEA 2JWDA 2CK3H 2MKVA 2KSJA 1KZUB 1VQLP 1NYKA 2HLOA 3TGUJ 5KAIE 4L74A 1S9KD 1LTJB 1ZR4A 2IX7C 2R5BA 1YBKA 1ZOYC 4TT3H 3HE4A 5AVSB 2JO6A 1P84E 1PP9E 3TYYA 3MTUE 1YTZI 5TISH 1OW6A 5AW1B 1NTME 3JSVC 5KJ7A 4CPGA 1S1CX 1SQQK 3H1LG 2I8DA 3TSIA 3P8CE 5AVTB 1EDKA 2C9NY 1LTTC 4HH2A 1FZCA 1AA0A 3GL2A 2WWWA 3B5ND 4GT1A 3AE8C 2XU6A 4W7YA 2Q3EA 3VN0A 2WT7A 3CI9A 2RN0A 3D89A 1JY2O 1MV8A 1KYOD 3CWBG 1HBWA 2ZYDA 2RMZA 1L0LK 5KAFH 2OTKE 3L72E 1Y9BA 1PGOA 3ITKA 3FX0A 2I1KA 1BSHA 2E4QA 2OYHC 1Y8AA 2W83C 2B87B 1NTKK 2P1JA 1QEXA 1G2CB 2YVJB 2BMOA 3F89A 1SQPJ 3T97B 2GBWA 2OYIA 4NPEA 5KKZB 1T3JA 5APUA 5KLVG 2WSSH 1U57A 2IPPA 1WT6A 2OYIB 2N1TA 3VMID 1GD2E 4UB8H 3L37A 1VQKP 2IBZI 3CX5E 3GL0A 1VDFA 1ZMEC 3CC4P 1WQLA 4H13C 3L35A 2YIUB 3VMHD 1VF5D 4WY4D 3V2PA 1JMBA 1LWUC 2NVEA 4L73A 3C8VA 3H1HJ 3RK3B 3TGUD 1NYHA 2PP6A 1IFIA 3RL0B 1VPCA 3L71J 3KQGA 3L75G 1KV4A 4U3FE 4KJMA 5CCGA 3U59A 5AW2B 1SQVD 2ITAA 3A0HE 2KZJA 1LNQA 3VOPA 1KORA 3M9BA 1IO4A 5KLVJ 1K04A 1RE3A 3Q2YA 4ASVA 5AW0B 3P8CD 2WPQA 4OGQB 2E76C 2QJKB 3K5BA 2OQQA 4NBGD 4UB6E 1SJGA 5CBOA 3A5TA 4EIJA 2DW3A 2J58A 2IYOA 1AFOA 2HYNA 4AIVA 3VTPC 3H1JD 4C7RA 1FDMA 3E1RA 1N7LA 2WSEH 4IL6E 1XTGB 1JY3P 4HM2A 2LXCB 2HODA 5CCHA 1O7NA 3KDPB 4U7JA 1IFDA 4BXLA 2P10A 2FFDA 2PAJA 4DT0A 4U3FJ 4HM5A 3VCAA 3AEEC 1SQXD 1FU1A 3MP7B 2KLUA 4GODA 4NPDA 1SQQE 3I56P 3HUSB 1DX7A 3L73G 1PL5A 3CLQA 3MUDA 3V5BA 4KT0J 2BCCD 3GF7A 2YNYA 1O7WA 4YXWH 4QUPA 3L75E 2NWFA 1NTKD 3JC22 3B4SA 2WPVB 2BMQA 3Q5SA 1FZCB 1S5LE 1NJIQ 3R4YA 3RK2C 1HH0A 5KKZC 5B5EE 1T3UA 2GM4A 2HODB 1SQPG 1UIXA 2Y0CA 2QJPC 4OH8B 1EDIA 1SQPE 1BDCA 1DD4A 3PLNA 5GTIH 3RBZA 5E79E 5BVZA 4ASWA 2JJLA 2FYUK 3TGUG 3P32A 4A7PA 1NU1K 1PP9G 1GDTA 4NBAD 1PP9D 2G8YA 4NBDD 4NBHD 4R4MA 1T2KC 3VMYA 1ZR2A 3GKEA 2JP3A 1NAFA 3RL0C 3PHLA 3GCEA 3L70D 1KILD 2WSEJ 2O01J 2WT7B 4Z1MH 2XZRA 4WBAA 3BRTB 1SQPK 1M8OB 1HTLC 4RO0A 2Q6QA 1HVVA 2SPZA 4LLHA 2QM7A 5TJHA 2A45H 2XKMA 1FZFA 2QPZA 2UWJE 1W5CE 3LIDA 1NTMD 2YKPA 3KZIH 3GOBA 1EDJA 3L75J 1O7HA 2W6BA 1KD1Q 2KI7B 1XTCC 2ZJSE 2P2UA 1URQA 5KJ7C 4OVNF 4P1BH 2DE5D 3I55P 1EC5A 3C1LA 4WVZA 1CW5A 3VMZA 4I1LA 1RFSA 1NTZJ 4AQRD 1SQQJ 1EQ7A 3BCCE 4DCKA 3WUUA 3GMAA 4I6MC 1J2JB 1LWUA 3W68A 2FY8A 1IK7A 2BMRA 3CWBD 2XDJA 1L4AA 2D2CD 2K37A 3USSA 3AE4C 2J5UA 4QDDA 2FYZA 2HMOA 1G2CA 5CJ0A 1Y47A 2B87A 2WITA 2I7FA 5AVYB 2K9JB 1KQFB 2B1XA 3FXDA 1SFCA 1FZGA 4AAYB 3RK2D 3Q1MA 3H1LD 2OTLP 3BRVB 2OYIC 4YXDC 3H32A 3AE7C 3A7OA 2IZ0A 5AW5B 1RF1B 3G71P 3RK2B 5APSA 4PD4D 5AW4B 1TU3F 2JDIH 1URQD 2JEEA 1SP4A 1FOSE 1SQXK 3KYQA 2Y9ZA 2QJPB 1VM9A 1IZNB 1ZLLA 4PV1C 1KQGB 5KLVE 5AW7B 2E43A 1R8EA 5KAIH 2NPSA 3H6PA 2BCCJ 4U3FD 3L71E 3CXHE 3NXSA 4R4LA 3AE2C 3MD0A 3TNUB 3G9RA 4IFDK 3WU2E 3RL0g 1QX8A 1SS1A 3HE4B 2E42A 4JYCA 1FZBA 2C0XA 5APQA 2W6AA 2IBZD 3L72G 3CXHI 2B24A 1X0TA 4OGQC 2E76B 3M0AA 3MHVA 1WMKA 2VRSA 1QVFO 1USDA 2FYUE 4YTPC 1Z56A 4QURA 5APVA 1AQTA 4WB4A 1NU1J 3H1JE 2JR8A 3O6QB 1GL2C 2KZIA 2QRXA 1L2PA 2AXTH 3FOUA 1PGPA 2HR3A 3L73J 3PRJA 1L0LE 2NZ2A 4ZNCA 3L73E 1HJ0A 4B86A 1P84D 1RE4A 3WUVA 3S9OA 3W67A 2Z5IA 5CCHD 4IL6H 4NBCD 2M3BA 3H1JJ 2M5AB 1NU1E 1YHQP 1S72P 3AEBC 2IYPA 3AZCA 1YJ9P 2R44A 1P84I 4TLFA 1JB0J 1Q7YQ 2B88A 1O7PA 3CPWO 5AW6B 2GUVA 2FKWB 4HM6A 1YITP 1OW7A 4JPZB 1SLQA 2JO1A 2DE7D 3U1CA 2HMKA 1ULIA 2HMJA 1URQC 1JY2N 1YI2P 4BWNA 2DE6D 4EI2A 3JCUH 2V4HA 2YXRB 3AEFC 2IZ1A 2YO2A 2MJZA 2K9YA 2BCCE 1E5WA 4QCKA 2KB7P 3B5NA 2A06D 1LTBC 1OMIA 3KZIE 2WTYA 1Q82Q 2HFED 1Q2NA 1GW4A 1JNMA 1LTIC 5B66E 4HKVA 4D6TD 1PP9J 4GDOA 3RK3D 3A3YB 2Q3IA 5APTA 3V2NA 1N7SA 2NUMA 1MFZA 1KTMA 4GOFA 2L5GB 3RL0D 2H89C 3MZWB 1LGHB 2N9YB 3GZXA 1RH5B 1NAYA 2YMKA 3F5HA 4IFMA 3TGUE 4QUQA 5AW3B 4QDFB 1FZEA 3DQYA 1X8YA 1RQUA 2JKVA 5H2FH 1PPJD 3ABVC 2ZYGA 3ZDMA 1LP1B 2N9BA 3CCSP 1M1JB 1L4AC 2WSCH 2YKOA 2H88C 4HM4A 4PD4H 1O7GA 2B89A 5GTIE 1OXZA 3EQ2A 3NFQA 4HYTB 2R32A 1HF9A 1UUVA 3BCCJ 2Z5HA 1QVGO 1DD3A 1NTZE 4ZKPA 4IOIH 3V6IA 3IR9A 4KHXA 2WVRA 1KYOI 4I7ZB 4NPFX 2XNXA 5KJ7D 1SQQG 2ZAEB 1DEBA 3IN6A 1SQXE 2K9JA 1GU5A 2AEJA 2BEQD 2O01H 4IL6X 3AEAC 3CWBE 1ZN5A 4N3YB 5CCGC 1FJPA 4DOJA 3L4FA 2FFDC 1QGKB 1MUUA 4RKUJ 1HJBA 3H1KD 2FXMA 4PD4E 3M9HA 1NKNA 4M3LA 4QDFA 1PGJA 2WMMA 5AVUB 1YJNP 4HM7A 3HTKA 1VQMP 3GTEA 3L74E 2HG5D 3AEDC 4GKGA 1BCCD 2ZYAA 1LJ2A 1URQB 3RBXA 2KS1A 3Q5PA 1YQ3C 5BOKA 3EN1A 1L0NE 2RKLA 2K1AA 1RQVA 1RF1C 1JTHB 4WY4B 3SFDC 2FYUG 5APYA 2HPCB 5CBNA 1GU4A 2QA4P 4EOTA 1KILC 1UUWA 1M56D 4PV1D 1L0LJ 1GZLA 1AQ5A 4Y99C 3V2QA 3O6QA 4W7ZA 4PV1B 2YFJA 3GHGC 5AW8B 3V2RA 1NVOA 2KK7A 1YTZT 2W27A 1FC2C 3TDKA 1OIPA 1JTHA 2OARA 4K3AA 4H0LC 1N7SC 1KB9H 3H1ID 2WPSA 2M8RA 2YFLA 2FYUJ 2Q1KA 1SQPD 4NB9D 1QLED 2Y0DA 1L4AD 3L70E 3CXHD 1YJWP 2E76D 1AVYA 4HKZH 3HTKB 1CSBA 1M90Q 5DJUB 2FYUD 2YKQA 1EDLA 2Y0EA 1M1JC 3UIAA 3LIEA 3RGUA 2NRGA 3IFMA 2HMMA 4LGDE 5AVQB 2N1TC 1HGVA 2QVAA 1SFCD 4OWFA 3CCMP 3CMAP 1GL2B 3FGAD 5B66H 2XSHA 4I2LC 3V4WA 5KAFE 1W2BO 1OVRA 3N7NA 1NTKJ 5AEWA 3VMGD 3HE5B 2XRXA 1BCCG 1ZXGA 3N0QA 3H32B 2XV5A 3EFFK 1KB9E 1R5LA 1KILA 2E74C 3M9QA 1OVVA 3EWKA 1JY3N 3WUTA 2CPSA 1DH3A 1KN7A 3H1KG 1NTMG 2RH0A 3B71A 1D7MA 4DZOA 1ZV8A 1NTZG 2ZT9B 4HB1A 2E5YA 1M57D 2FFDB 1L0ND 1VQ6P 4GIFA 2E5TA 3KHUA 3PJSK 1BE3D 1DIPA 1EZVG 4W80A 3BCCD 1FDIA 1K05A 1JEKA 5B5EH 1K9MQ 3MUDC 5KLIC 1N73A 1BGYG 3AE3C 1UIIA 1L0NK 3D6YA 4UB6H 1J1DC 3H1IJ 1K73Q 3H1HE 3R2PA 3L36A 2XSOA 3GZYA 1MZ9A 3G6EP 2KIKA 3C9IA 3G3ZA 2JWAA 3PH0A 5KLVK 2IFMA 3P7KA 2LKMA 1O7MA 3RK3E 1OZHA 3S1KA 1GMJA 2A06E 2Q7CA 4WY4C 4NBBD 1FZAA 4PD4I 1JOCA 1M1KQ 3Q5RA 1S5LH 1LT9C 1KILB 2LR2A 3TK1A 3HUSA 4Y99B 1L0NG 1H0TA 4H0LD 1GK6A 3HE5A 4N78D 4D6TJ 1SQBD 1ZRTD 1X79B 1YYCA 1JM0A 2W90A 1H89A 3Q3DA 1PFIA 1X9VA 1NH4A 1OFCX 1N2DC 1NTKG 1L4AB 2IBZE 3CX5I 3SFEC 2J59M 1H88A 4HM8A 1YQ4C 3CCLP 4BRYA 3II6A 5BU5A 5KTBA 2XR8A 4RJTA 1HUCA 2QJYB 2AXTE 1H8AA 1FQTA 2A06G 3A0HH 2AEFA 4C46A 3AE6C 3M06A 4OGQD 2N1TB 4JYBA 2H7HA 1VQOP 4PJ0H 1NO4A 3OJAB 1N73B 4I7ZC 5APWA 3VCPA 3HD7D 1SQXG 5CMZA 1HGZA 1KQLA 3GLMA 2W8ZA 1VQ7P 2YMYA 1EXJA 1IJDB 3CC7P 2WZ7A 1VQ5P 2AEMA 2A45G 1EG9A 1NTMJ 4JQ0D 3H1KJ 1T6AA 1VQ9P 2NPSD 2E74B 1IC2A 4JBZA 1RF1A 3H1JG 5AVZB 3AE9C 3NMDA 3CMEP 3WMM0 2ZVNB 1P84H 5AVRB 4GOEA 4XE5B 1KYOH 2ZT9C 1CZQA 3PTZA 2AXCA 2QSIA 5TISE 1NU1D 2KS1B 2D2CC 1OVUA 3CCUP 4RESB 3U1AA 3SWYA 3FXEA 3B8EB 1IK9A 2O1KA 1GL2A 1LTSC 4N6JA 1GTWA 2H8PD 5KLIB 1FOSF 2XNDH 3IF4A
chains in the Genus database with same CATH topology
2BCCE 4QCKA 1NDOA 1NYKA 1FQTA 2FYNC 2YFIA 2YVJB 2BMOA 3H1KE 2BMRA 2B24A 2GBWA 1SQXE 2D2CD 4AIVA 4OGQD 2YFLA 4NBAD 4HM0A 2HMNA 2FYUE 4NBDD 4NB9D 4NBHD 4QDDA 2HMOA 1G8JB 4HKVA 1PPJE 1BCCE 3VCPA 4QURA 5KLIC 3L70E 2Q3WA 3CWBE 4EMJB 2E76D 3VMID 4HM2A 3H1IE 4NBED 2XSOA 3H1HE 3GZYA 3H1JE 3GKEA 2JO6A 4QDCA 1P84E 1PP9E 1O7NA 2I7FA 3CX5E 2NUMA 1SQBE 1ZRTE 2NVGA 2B1XA 3GL0A 3GCEA 2JZAA 3C0DA 3FOUA 5HL4A 4P1CH 1WQLA 1O7MA 2E4PA 4AAYB 1SQVE 2A06E 4HM1A 1NTME 4HM5A 1L0LE 4PD4E 3VCAA 2HMMA 3EQQA 1EG9A 1BE3E 3L73E 3GZXA 3VMHD 3TGUE 4NBBD 4QDFA 3GB4A 1VF5D 2CKFA 4H13D 2NVEA 4QUQA 4HM7A 1ULJA 4QDFB 2E75D 3DQYA 2XSHA 4NBCD 1SQQE 3GTEA 3L74E 1RIEA 4NBFD 1NU1E 3H1LE 2NVFA 3GL2A 4HJLA 3AZCA 5AEWA 4H0LD 5CXMA 5BOKA 4U3FE 3VMGD 1VM9A 3EN1A 4NB8D 1L0NE 2QPZA 2QJKC 1O7WA 2XRXA 4HM4A 1O7GA 4QUPA 2QJYC 2YIUC 1O7PA 3N0QA 3L75E 3D89A 2GBXA 3GOBA 1G8KB 5KLVE 2HMLA 2NWFA 1JM1A 1O7HA 4HM6A 5AEUA 1KB9E 3GTSA 2BMQA 1BGYE 4H44D 1UUVA 2DE7D 2ZYLA 1UUWA 2HMKA 1ULIA 5KKZC 4P1BH 2HMJA 4D6TE 1NTZE 2DE5D 2IBZE 2ZT9D 1Q90C 4HM3A 4PV1D 3L72E 3L71E 2NUKA 3CXHE 1VCKA 4HM8A 2DE6D 2YFJA 1EZVE 4NBGD 1NTKE 2E4QA 1RFSA 2QJPC 1KYOE 2E74D 2XR8A 1SQPE 3BCCE 1SJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC E;  4QCK A;  1NDO A;  1NYK A;  1FQT A;  2FYN C;  2YFI A;  2YVJ B;  2BMO A;  3H1K E;  2BMR A;  2B24 A;  2GBW A;  1SQX E;  2D2C D;  4AIV A;  4OGQ D;  2YFL A;  4NBA D;  4HM0 A;  2HMN A;  2FYU E;  4NBD D;  4NB9 D;  4NBH D;  4QDD A;  2HMO A;  1G8J B;  4HKV A;  1PPJ E;  1BCC E;  3VCP A;  4QUR A;  5KLI C;  3L70 E;  2Q3W A;  3CWB E;  4EMJ B;  2E76 D;  3VMI D;  4HM2 A;  3H1I E;  4NBE D;  2XSO A;  3H1H E;  3GZY A;  3H1J E;  3GKE A;  2JO6 A;  4QDC A;  1P84 E;  1PP9 E;  1O7N A;  2I7F A;  3CX5 E;  2NUM A;  1SQB E;  1ZRT E;  2NVG A;  2B1X A;  3GL0 A;  3GCE A;  2JZA A;  3C0D A;  3FOU A;  5HL4 A;  4P1C H;  1WQL A;  1O7M A;  2E4P A;  4AAY B;  1SQV E;  2A06 E;  4HM1 A;  1NTM E;  4HM5 A;  1L0L E;  4PD4 E;  3VCA A;  2HMM A;  3EQQ A;  1EG9 A;  1BE3 E;  3L73 E;  3GZX A;  3VMH D;  3TGU E;  4NBB D;  4QDF A;  3GB4 A;  1VF5 D;  2CKF A;  4H13 D;  2NVE A;  4QUQ A;  4HM7 A;  1ULJ A;  4QDF B;  2E75 D;  3DQY A;  2XSH A;  4NBC D;  1SQQ E;  3GTE A;  3L74 E;  1RIE A;  4NBF D;  1NU1 E;  3H1L E;  2NVF A;  3GL2 A;  4HJL A;  3AZC A;  5AEW A;  4H0L D;  5CXM A;  5BOK A;  4U3F E;  3VMG D;  1VM9 A;  3EN1 A;  4NB8 D;  1L0N E;  2QPZ A;  2QJK C;  1O7W A;  2XRX A;  4HM4 A;  1O7G A;  4QUP A;  2QJY C;  2YIU C;  1O7P A;  3N0Q A;  3L75 E;  3D89 A;  2GBX A;  3GOB A;  1G8K B;  5KLV E;  2HML A;  2NWF A;  1JM1 A;  1O7H A;  4HM6 A;  5AEU A;  1KB9 E;  3GTS A;  2BMQ A;  1BGY E;  4H44 D;  1UUV A;  2DE7 D;  2ZYL A;  1UUW A;  2HMK A;  1ULI A;  5KKZ C;  4P1B H;  2HMJ A;  4D6T E;  1NTZ E;  2DE5 D;  2IBZ E;  2ZT9 D;  1Q90 C;  4HM3 A;  4PV1 D;  3L72 E;  3L71 E;  2NUK A;  3CXH E;  1VCK A;  4HM8 A;  2DE6 D;  2YFJ A;  1EZV E;  4NBG D;  1NTK E;  2E4Q A;  1RFS A;  2QJP C;  1KYO E;  2E74 D;  2XR8 A;  1SQP E;  3BCC E;  1SJG A; 
#chains in the Genus database with same CATH topology
 3D70 A;  2QE7 H;  2V7Q J;  3N4X A;  1NGM B;  2IBZ G;  3A0B E;  4H44 C;  2P7J A;  2V7Q H;  2LXB A;  2O3J A;  3GHG B;  2P67 A;  2HMN A;  3QH9 A;  1USE A;  1G1J A;  5EFW B;  5K5G B;  1HWT C;  1PPJ E;  3CXH H;  3OW2 O;  1JCC A;  1SQB G;  1LT9 B;  1IFN A;  1SQB K;  3GG2 A;  4H0L B;  1N7S B;  1Q86 Q;  2YXQ B;  3C0D A;  4P1C H;  3CCQ P;  3A0B H;  1U7J A;  2KP8 A;  4WWI A;  1G1I A;  1BGY D;  1PIX A;  1SFC C;  3L71 D;  1RIE A;  1X22 A;  2N1T D;  5APX A;  1EZV D;  2GA1 A;  2R3C A;  4AUW A;  4HJL A;  1BE3 G;  3VP9 A;  2B9B A;  1MFT A;  1GL2 D;  3EFG A;  4NB8 D;  1M1J A;  2Q5U A;  1LP1 A;  2QJY C;  1NU1 G;  1BDD A;  2GBX A;  4EYY Q;  4EDF A;  2L91 A;  1WRG A;  3KXD A;  1N73 C;  3GHG A;  5AW9 B;  1VCK A;  1SQV K;  1R5S A;  2E74 D;  1JCD A;  5CCG D;  3S4R A;  1ZP0 C;  2YO3 A;  1BGY J;  2E75 B;  2P58 A;  3H1K E;  1L0L D;  4XA4 A;  3IAO A;  1IFJ A;  3L73 D;  1MKM A;  3H1H D;  3QWO C;  1KB9 D;  2O1J A;  2OYH A;  1A02 J;  3E1I A;  4C7N B;  1BCC E;  3L72 D;  2Q3W A;  5BU8 B;  3HD7 C;  4ZMD A;  3PP5 A;  3AEG C;  1VQ8 P;  1JUN A;  1H0T B;  3M0D A;  3L72 J;  4L75 A;  1AV1 A;  1KB9 I;  1BE3 E;  4D6T G;  2D2C B;  1J1D B;  2H43 A;  2CKF A;  2KLV A;  2OGU A;  1J1E B;  4L76 A;  2M3E A;  2BAS A;  3L74 J;  3AE1 C;  1LT1 A;  4NBF D;  2R3S A;  4UB8 E;  2WSF H;  3HRN A;  3G4S P;  3CX5 H;  4DJG A;  3CX5 D;  2IDB A;  1VF5 C;  5AVX B;  3L74 D;  3L70 G;  3CCE P;  1ZW0 A;  1KIL E;  5GTH H;  3SWF A;  1IFP A;  2KUB A;  1RE3 C;  1S2E A;  3FWL A;  1N8R Q;  2ZYL A;  5H2F E;  4D6T E;  1N7S D;  2GUS A;  2PGD A;  1NTZ K;  1NKZ B;  5M1B A;  3VP8 A;  1SQX J;  4Y28 J;  3MGN A;  2W6J H;  4AYC A;  1NDO A;  1KC8 Q;  1CI6 B;  3P8M C;  4HJG H;  3CC2 P;  4BRY B;  1RY3 A;  5CJ4 A;  5DJT B;  1NHL A;  1K8A Q;  1VL2 A;  3BVH A;  1LTA C;  5AVW B;  5L8R J;  3D6Z A;  1IFM A;  3SWK A;  4QMA A;  1SFC B;  3H1I E;  2C0W A;  4NBE D;  3O8Z A;  3GW6 A;  1OW8 A;  1S9K E;  4QDC A;  3BAS A;  3BCC G;  2NVG A;  2BEZ F;  3KPE A;  2FYN B;  2ZXX A;  1DEE G;  3CCV P;  2Y9Y A;  3L74 G;  2HPC A;  1YIJ P;  2BCC G;  5GTH E;  3HD7 A;  1AVO A;  3B5N C;  4H13 D;  2E75 D;  1NTZ D;  2NPS B;  2QEX P;  3AEC C;  3M91 A;  2Q9I A;  2A45 I;  2K3R A;  2OTJ P;  3V4Q A;  2ZXE B;  1EXI A;  1Q81 Q;  1FE6 A;  3WU2 H;  1SQQ D;  1JY2 P;  3I5C A;  3H1L J;  4XFJ A;  1PV3 A;  2WQY C;  3MIW A;  5AEU A;  1JM1 A;  2WSF J;  1RF0 A;  2I1J A;  1Q90 D;  1W2E A;  4PJ0 E;  1JMM A;  1QL2 A;  2NUK A;  2M0B A;  1OX3 A;  1KMI Z;  1NTK E;  2POH A;  3HD7 B;  1KYO E;  1NTM K;  4O9B A;  2Z4E A;  3FWN A;  1L0L G;  1JO5 A;  1RE4 C;  1U7M A;  3CD6 P;  2KNC A;  4C7N A;  4HM0 A;  1FS0 E;  1T2K D;  3H1I G;  1G8J B;  3VMA A;  1KQS O;  1QL1 A;  2QM8 A;  4WY4 A;  4EMJ B;  5CHX A;  1LWU B;  4H44 B;  3L70 J;  2WSC J;  3A2A A;  1SQB E;  1ZRT E;  2FBW C;  1PPJ G;  1CI6 A;  1GK4 A;  3E7K A;  1SQV E;  2KXP B;  1BE3 J;  2PFX A;  1KFN A;  1LTJ C;  1T8Z A;  1PZQ A;  4N78 E;  3GF3 A;  2K88 A;  2M5A A;  1FBM A;  4ZKU A;  1SVF A;  1NOH A;  1BCC J;  5AVV B;  3VYI A;  2O01 N;  3T97 A;  1A02 F;  2QJK C;  1E79 H;  5E79 H;  1EZV I;  2HML A;  3H1H G;  3TF5 A;  3LW5 J;  1BGY E;  1L0N J;  3SSU A;  4HM3 A;  5CCH C;  1SQV J;  1EZV E;  2R5D A;  4K35 A;  2FXP A;  1SQB J;  3D71 A;  1RF0 C;  5C39 A;  2NVF A;  1NWQ A;  1AJY A;  2YFI A;  2FYN C;  2WPR A;  4JF7 A;  3OA7 A;  2KNC B;  3OAK A;  1LT9 A;  2KOG A;  2QIW A;  4MN4 C;  3B5N B;  3LW5 H;  1S3J A;  2ZFC A;  3TNU A;  4YPC A;  2NPS C;  4LC1 A;  2OYH B;  2E75 C;  2C9L Y;  3CWB J;  3NTN A;  1VQ4 P;  1KFM A;  2JZA A;  5HL4 A;  2IFN A;  3HUS C;  2E4P A;  1RHZ B;  4HM1 A;  1FJK A;  3CL3 D;  1LTG C;  3EQQ A;  1OWA A;  2ZVO B;  1S4X A;  3GB4 A;  2QG4 A;  3AE5 C;  1ULJ A;  3CCJ P;  3L71 G;  1SQV G;  1PGQ A;  1FAV A;  3H1L E;  1FDO A;  1BSN A;  3L75 D;  1FZC C;  1M7L A;  3JCU E;  1LTJ A;  2PRR A;  2KYV A;  1N86 A;  5CXM A;  2G3A A;  3CCR P;  4IFF A;  3BAT A;  1J1E C;  3M0D C;  4H13 B;  2CPB A;  3H25 A;  1VQP P;  2OYO A;  2YIU C;  1G8K B;  3GTS A;  1VQN P;  1S5L X;  4H44 D;  3VMX A;  1JY3 O;  1GW3 A;  2FXO A;  2ZT9 D;  4U3F G;  3RK3 C;  1Q90 C;  1VF5 B;  5KLV D;  2KSE A;  2JWD A;  2CK3 H;  2MKV A;  2KSJ A;  1KZU B;  1VQL P;  1NYK A;  2HLO A;  3TGU J;  5KAI E;  4L74 A;  1S9K D;  1LTJ B;  1ZR4 A;  2IX7 C;  2R5B A;  1YBK A;  1ZOY C;  4TT3 H;  3HE4 A;  5AVS B;  2JO6 A;  1P84 E;  1PP9 E;  3TYY A;  3MTU E;  1YTZ I;  5TIS H;  1OW6 A;  5AW1 B;  1NTM E;  3JSV C;  5KJ7 A;  4CPG A;  1S1C X;  1SQQ K;  3H1L G;  2I8D A;  3TSI A;  3P8C E;  5AVT B;  1EDK A;  2C9N Y;  1LTT C;  4HH2 A;  1FZC A;  1AA0 A;  3GL2 A;  2WWW A;  3B5N D;  4GT1 A;  3AE8 C;  2XU6 A;  4W7Y A;  2Q3E A;  3VN0 A;  2WT7 A;  3CI9 A;  2RN0 A;  3D89 A;  1JY2 O;  1MV8 A;  1KYO D;  3CWB G;  1HBW A;  2ZYD A;  2RMZ A;  1L0L K;  5KAF H;  2OTK E;  3L72 E;  1Y9B A;  1PGO A;  3ITK A;  3FX0 A;  2I1K A;  1BSH A;  2E4Q A;  2OYH C;  1Y8A A;  2W83 C;  2B87 B;  1NTK K;  2P1J A;  1QEX A;  1G2C B;  2YVJ B;  2BMO A;  3F89 A;  1SQP J;  3T97 B;  2GBW A;  2OYI A;  4NPE A;  5KKZ B;  1T3J A;  5APU A;  5KLV G;  2WSS H;  1U57 A;  2IPP A;  1WT6 A;  2OYI B;  2N1T A;  3VMI D;  1GD2 E;  4UB8 H;  3L37 A;  1VQK P;  2IBZ I;  3CX5 E;  3GL0 A;  1VDF A;  1ZME C;  3CC4 P;  1WQL A;  4H13 C;  3L35 A;  2YIU B;  3VMH D;  1VF5 D;  4WY4 D;  3V2P A;  1JMB A;  1LWU C;  2NVE A;  4L73 A;  3C8V A;  3H1H J;  3RK3 B;  3TGU D;  1NYH A;  2PP6 A;  1IFI A;  3RL0 B;  1VPC A;  3L71 J;  3KQG A;  3L75 G;  1KV4 A;  4U3F E;  4KJM A;  5CCG A;  3U59 A;  5AW2 B;  1SQV D;  2ITA A;  3A0H E;  2KZJ A;  1LNQ A;  3VOP A;  1KOR A;  3M9B A;  1IO4 A;  5KLV J;  1K04 A;  1RE3 A;  3Q2Y A;  4ASV A;  5AW0 B;  3P8C D;  2WPQ A;  4OGQ B;  2E76 C;  2QJK B;  3K5B A;  2OQQ A;  4NBG D;  4UB6 E;  1SJG A;  5CBO A;  3A5T A;  4EIJ A;  2DW3 A;  2J58 A;  2IYO A;  1AFO A;  2HYN A;  4AIV A;  3VTP C;  3H1J D;  4C7R A;  1FDM A;  3E1R A;  1N7L A;  2WSE H;  4IL6 E;  1XTG B;  1JY3 P;  4HM2 A;  2LXC B;  2HOD A;  5CCH A;  1O7N A;  3KDP B;  4U7J A;  1IFD A;  4BXL A;  2P10 A;  2FFD A;  2PAJ A;  4DT0 A;  4U3F J;  4HM5 A;  3VCA A;  3AEE C;  1SQX D;  1FU1 A;  3MP7 B;  2KLU A;  4GOD A;  4NPD A;  1SQQ E;  3I56 P;  3HUS B;  1DX7 A;  3L73 G;  1PL5 A;  3CLQ A;  3MUD A;  3V5B A;  4KT0 J;  2BCC D;  3GF7 A;  2YNY A;  1O7W A;  4YXW H;  4QUP A;  3L75 E;  2NWF A;  1NTK D;  3JC2 2;  3B4S A;  2WPV B;  2BMQ A;  3Q5S A;  1FZC B;  1S5L E;  1NJI Q;  3R4Y A;  3RK2 C;  1HH0 A;  5KKZ C;  5B5E E;  1T3U A;  2GM4 A;  2HOD B;  1SQP G;  1UIX A;  2Y0C A;  2QJP C;  4OH8 B;  1EDI A;  1SQP E;  1BDC A;  1DD4 A;  3PLN A;  5GTI H;  3RBZ A;  5E79 E;  5BVZ A;  4ASW A;  2JJL A;  2FYU K;  3TGU G;  3P32 A;  4A7P A;  1NU1 K;  1PP9 G;  1GDT A;  4NBA D;  1PP9 D;  2G8Y A;  4NBD D;  4NBH D;  4R4M A;  1T2K C;  3VMY A;  1ZR2 A;  3GKE A;  2JP3 A;  1NAF A;  3RL0 C;  3PHL A;  3GCE A;  3L70 D;  1KIL D;  2WSE J;  2O01 J;  2WT7 B;  4Z1M H;  2XZR A;  4WBA A;  3BRT B;  1SQP K;  1M8O B;  1HTL C;  4RO0 A;  2Q6Q A;  1HVV A;  2SPZ A;  4LLH A;  2QM7 A;  5TJH A;  2A45 H;  2XKM A;  1FZF A;  2QPZ A;  2UWJ E;  1W5C E;  3LID A;  1NTM D;  2YKP A;  3KZI H;  3GOB A;  1EDJ A;  3L75 J;  1O7H A;  2W6B A;  1KD1 Q;  2KI7 B;  1XTC C;  2ZJS E;  2P2U A;  1URQ A;  5KJ7 C;  4OVN F;  4P1B H;  2DE5 D;  3I55 P;  1EC5 A;  3C1L A;  4WVZ A;  1CW5 A;  3VMZ A;  4I1L A;  1RFS A;  1NTZ J;  4AQR D;  1SQQ J;  1EQ7 A;  3BCC E;  4DCK A;  3WUU A;  3GMA A;  4I6M C;  1J2J B;  1LWU A;  3W68 A;  2FY8 A;  1IK7 A;  2BMR A;  3CWB D;  2XDJ A;  1L4A A;  2D2C D;  2K37 A;  3USS A;  3AE4 C;  2J5U A;  4QDD A;  2FYZ A;  2HMO A;  1G2C A;  5CJ0 A;  1Y47 A;  2B87 A;  2WIT A;  2I7F A;  5AVY B;  2K9J B;  1KQF B;  2B1X A;  3FXD A;  1SFC A;  1FZG A;  4AAY B;  3RK2 D;  3Q1M A;  3H1L D;  2OTL P;  3BRV B;  2OYI C;  4YXD C;  3H32 A;  3AE7 C;  3A7O A;  2IZ0 A;  5AW5 B;  1RF1 B;  3G71 P;  3RK2 B;  5APS A;  4PD4 D;  5AW4 B;  1TU3 F;  2JDI H;  1URQ D;  2JEE A;  1SP4 A;  1FOS E;  1SQX K;  3KYQ A;  2Y9Z A;  2QJP B;  1VM9 A;  1IZN B;  1ZLL A;  4PV1 C;  1KQG B;  5KLV E;  5AW7 B;  2E43 A;  1R8E A;  5KAI H;  2NPS A;  3H6P A;  2BCC J;  4U3F D;  3L71 E;  3CXH E;  3NXS A;  4R4L A;  3AE2 C;  3MD0 A;  3TNU B;  3G9R A;  4IFD K;  3WU2 E;  3RL0 g;  1QX8 A;  1SS1 A;  3HE4 B;  2E42 A;  4JYC A;  1FZB A;  2C0X A;  5APQ A;  2W6A A;  2IBZ D;  3L72 G;  3CXH I;  2B24 A;  1X0T A;  4OGQ C;  2E76 B;  3M0A A;  3MHV A;  1WMK A;  2VRS A;  1QVF O;  1USD A;  2FYU E;  4YTP C;  1Z56 A;  4QUR A;  5APV A;  1AQT A;  4WB4 A;  1NU1 J;  3H1J E;  2JR8 A;  3O6Q B;  1GL2 C;  2KZI A;  2QRX A;  1L2P A;  2AXT H;  3FOU A;  1PGP A;  2HR3 A;  3L73 J;  3PRJ A;  1L0L E;  2NZ2 A;  4ZNC A;  3L73 E;  1HJ0 A;  4B86 A;  1P84 D;  1RE4 A;  3WUV A;  3S9O A;  3W67 A;  2Z5I A;  5CCH D;  4IL6 H;  4NBC D;  2M3B A;  3H1J J;  2M5A B;  1NU1 E;  1YHQ P;  1S72 P;  3AEB C;  2IYP A;  3AZC A;  1YJ9 P;  2R44 A;  1P84 I;  4TLF A;  1JB0 J;  1Q7Y Q;  2B88 A;  1O7P A;  3CPW O;  5AW6 B;  2GUV A;  2FKW B;  4HM6 A;  1YIT P;  1OW7 A;  4JPZ B;  1SLQ A;  2JO1 A;  2DE7 D;  3U1C A;  2HMK A;  1ULI A;  2HMJ A;  1URQ C;  1JY2 N;  1YI2 P;  4BWN A;  2DE6 D;  4EI2 A;  3JCU H;  2V4H A;  2YXR B;  3AEF C;  2IZ1 A;  2YO2 A;  2MJZ A;  2K9Y A;  2BCC E;  1E5W A;  4QCK A;  2KB7 P;  3B5N A;  2A06 D;  1LTB C;  1OMI A;  3KZI E;  2WTY A;  1Q82 Q;  2HFE D;  1Q2N A;  1GW4 A;  1JNM A;  1LTI C;  5B66 E;  4HKV A;  4D6T D;  1PP9 J;  4GDO A;  3RK3 D;  3A3Y B;  2Q3I A;  5APT A;  3V2N A;  1N7S A;  2NUM A;  1MFZ A;  1KTM A;  4GOF A;  2L5G B;  3RL0 D;  2H89 C;  3MZW B;  1LGH B;  2N9Y B;  3GZX A;  1RH5 B;  1NAY A;  2YMK A;  3F5H A;  4IFM A;  3TGU E;  4QUQ A;  5AW3 B;  4QDF B;  1FZE A;  3DQY A;  1X8Y A;  1RQU A;  2JKV A;  5H2F H;  1PPJ D;  3ABV C;  2ZYG A;  3ZDM A;  1LP1 B;  2N9B A;  3CCS P;  1M1J B;  1L4A C;  2WSC H;  2YKO A;  2H88 C;  4HM4 A;  4PD4 H;  1O7G A;  2B89 A;  5GTI E;  1OXZ A;  3EQ2 A;  3NFQ A;  4HYT B;  2R32 A;  1HF9 A;  1UUV A;  3BCC J;  2Z5H A;  1QVG O;  1DD3 A;  1NTZ E;  4ZKP A;  4IOI H;  3V6I A;  3IR9 A;  4KHX A;  2WVR A;  1KYO I;  4I7Z B;  4NPF X;  2XNX A;  5KJ7 D;  1SQQ G;  2ZAE B;  1DEB A;  3IN6 A;  1SQX E;  2K9J A;  1GU5 A;  2AEJ A;  2BEQ D;  2O01 H;  4IL6 X;  3AEA C;  3CWB E;  1ZN5 A;  4N3Y B;  5CCG C;  1FJP A;  4DOJ A;  3L4F A;  2FFD C;  1QGK B;  1MUU A;  4RKU J;  1HJB A;  3H1K D;  2FXM A;  4PD4 E;  3M9H A;  1NKN A;  4M3L A;  4QDF A;  1PGJ A;  2WMM A;  5AVU B;  1YJN P;  4HM7 A;  3HTK A;  1VQM P;  3GTE A;  3L74 E;  2HG5 D;  3AED C;  4GKG A;  1BCC D;  2ZYA A;  1LJ2 A;  1URQ B;  3RBX A;  2KS1 A;  3Q5P A;  1YQ3 C;  5BOK A;  3EN1 A;  1L0N E;  2RKL A;  2K1A A;  1RQV A;  1RF1 C;  1JTH B;  4WY4 B;  3SFD C;  2FYU G;  5APY A;  2HPC B;  5CBN A;  1GU4 A;  2QA4 P;  4EOT A;  1KIL C;  1UUW A;  1M56 D;  4PV1 D;  1L0L J;  1GZL A;  1AQ5 A;  4Y99 C;  3V2Q A;  3O6Q A;  4W7Z A;  4PV1 B;  2YFJ A;  3GHG C;  5AW8 B;  3V2R A;  1NVO A;  2KK7 A;  1YTZ T;  2W27 A;  1FC2 C;  3TDK A;  1OIP A;  1JTH A;  2OAR A;  4K3A A;  4H0L C;  1N7S C;  1KB9 H;  3H1I D;  2WPS A;  2M8R A;  2YFL A;  2FYU J;  2Q1K A;  1SQP D;  4NB9 D;  1QLE D;  2Y0D A;  1L4A D;  3L70 E;  3CXH D;  1YJW P;  2E76 D;  1AVY A;  4HKZ H;  3HTK B;  1CSB A;  1M90 Q;  5DJU B;  2FYU D;  2YKQ A;  1EDL A;  2Y0E A;  1M1J C;  3UIA A;  3LIE A;  3RGU A;  2NRG A;  3IFM A;  2HMM A;  4LGD E;  5AVQ B;  2N1T C;  1HGV A;  2QVA A;  1SFC D;  4OWF A;  3CCM P;  3CMA P;  1GL2 B;  3FGA D;  5B66 H;  2XSH A;  4I2L C;  3V4W A;  5KAF E;  1W2B O;  1OVR A;  3N7N A;  1NTK J;  5AEW A;  3VMG D;  3HE5 B;  2XRX A;  1BCC G;  1ZXG A;  3N0Q A;  3H32 B;  2XV5 A;  3EFF K;  1KB9 E;  1R5L A;  1KIL A;  2E74 C;  3M9Q A;  1OVV A;  3EWK A;  1JY3 N;  3WUT A;  2CPS A;  1DH3 A;  1KN7 A;  3H1K G;  1NTM G;  2RH0 A;  3B71 A;  1D7M A;  4DZO A;  1ZV8 A;  1NTZ G;  2ZT9 B;  4HB1 A;  2E5Y A;  1M57 D;  2FFD B;  1L0N D;  1VQ6 P;  4GIF A;  2E5T A;  3KHU A;  3PJS K;  1BE3 D;  1DIP A;  1EZV G;  4W80 A;  3BCC D;  1FDI A;  1K05 A;  1JEK A;  5B5E H;  1K9M Q;  3MUD C;  5KLI C;  1N73 A;  1BGY G;  3AE3 C;  1UII A;  1L0N K;  3D6Y A;  4UB6 H;  1J1D C;  3H1I J;  1K73 Q;  3H1H E;  3R2P A;  3L36 A;  2XSO A;  3GZY A;  1MZ9 A;  3G6E P;  2KIK A;  3C9I A;  3G3Z A;  2JWA A;  3PH0 A;  5KLV K;  2IFM A;  3P7K A;  2LKM A;  1O7M A;  3RK3 E;  1OZH A;  3S1K A;  1GMJ A;  2A06 E;  2Q7C A;  4WY4 C;  4NBB D;  1FZA A;  4PD4 I;  1JOC A;  1M1K Q;  3Q5R A;  1S5L H;  1LT9 C;  1KIL B;  2LR2 A;  3TK1 A;  3HUS A;  4Y99 B;  1L0N G;  1H0T A;  4H0L D;  1GK6 A;  3HE5 A;  4N78 D;  4D6T J;  1SQB D;  1ZRT D;  1X79 B;  1YYC A;  1JM0 A;  2W90 A;  1H89 A;  3Q3D A;  1PFI A;  1X9V A;  1NH4 A;  1OFC X;  1N2D C;  1NTK G;  1L4A B;  2IBZ E;  3CX5 I;  3SFE C;  2J59 M;  1H88 A;  4HM8 A;  1YQ4 C;  3CCL P;  4BRY A;  3II6 A;  5BU5 A;  5KTB A;  2XR8 A;  4RJT A;  1HUC A;  2QJY B;  2AXT E;  1H8A A;  1FQT A;  2A06 G;  3A0H H;  2AEF A;  4C46 A;  3AE6 C;  3M06 A;  4OGQ D;  2N1T B;  4JYB A;  2H7H A;  1VQO P;  4PJ0 H;  1NO4 A;  3OJA B;  1N73 B;  4I7Z C;  5APW A;  3VCP A;  3HD7 D;  1SQX G;  5CMZ A;  1HGZ A;  1KQL A;  3GLM A;  2W8Z A;  1VQ7 P;  2YMY A;  1EXJ A;  1IJD B;  3CC7 P;  2WZ7 A;  1VQ5 P;  2AEM A;  2A45 G;  1EG9 A;  1NTM J;  4JQ0 D;  3H1K J;  1T6A A;  1VQ9 P;  2NPS D;  2E74 B;  1IC2 A;  4JBZ A;  1RF1 A;  3H1J G;  5AVZ B;  3AE9 C;  3NMD A;  3CME P;  3WMM 0;  2ZVN B;  1P84 H;  5AVR B;  4GOE A;  4XE5 B;  1KYO H;  2ZT9 C;  1CZQ A;  3PTZ A;  2AXC A;  2QSI A;  5TIS E;  1NU1 D;  2KS1 B;  2D2C C;  1OVU A;  3CCU P;  4RES B;  3U1A A;  3SWY A;  3FXE A;  3B8E B;  1IK9 A;  2O1K A;  1GL2 A;  1LTS C;  4N6J A;  1GTW A;  2H8P D;  5KLI B;  1FOS F;  2XND H;  3IF4 A; 
#chains in the Genus database with same CATH homology
 2BCC E;  4QCK A;  1NDO A;  1NYK A;  1FQT A;  2FYN C;  2YFI A;  2YVJ B;  2BMO A;  3H1K E;  2BMR A;  2B24 A;  2GBW A;  1SQX E;  2D2C D;  4AIV A;  4OGQ D;  2YFL A;  4NBA D;  4HM0 A;  2HMN A;  2FYU E;  4NBD D;  4NB9 D;  4NBH D;  4QDD A;  2HMO A;  1G8J B;  4HKV A;  1PPJ E;  1BCC E;  3VCP A;  4QUR A;  5KLI C;  3L70 E;  2Q3W A;  3CWB E;  4EMJ B;  2E76 D;  3VMI D;  4HM2 A;  3H1I E;  4NBE D;  2XSO A;  3H1H E;  3GZY A;  3H1J E;  3GKE A;  2JO6 A;  4QDC A;  1P84 E;  1PP9 E;  1O7N A;  2I7F A;  3CX5 E;  2NUM A;  1SQB E;  1ZRT E;  2NVG A;  2B1X A;  3GL0 A;  3GCE A;  2JZA A;  3C0D A;  3FOU A;  5HL4 A;  4P1C H;  1WQL A;  1O7M A;  2E4P A;  4AAY B;  1SQV E;  2A06 E;  4HM1 A;  1NTM E;  4HM5 A;  1L0L E;  4PD4 E;  3VCA A;  2HMM A;  3EQQ A;  1EG9 A;  1BE3 E;  3L73 E;  3GZX A;  3VMH D;  3TGU E;  4NBB D;  4QDF A;  3GB4 A;  1VF5 D;  2CKF A;  4H13 D;  2NVE A;  4QUQ A;  4HM7 A;  1ULJ A;  4QDF B;  2E75 D;  3DQY A;  2XSH A;  4NBC D;  1SQQ E;  3GTE A;  3L74 E;  1RIE A;  4NBF D;  1NU1 E;  3H1L E;  2NVF A;  3GL2 A;  4HJL A;  3AZC A;  5AEW A;  4H0L D;  5CXM A;  5BOK A;  4U3F E;  3VMG D;  1VM9 A;  3EN1 A;  4NB8 D;  1L0N E;  2QPZ A;  2QJK C;  1O7W A;  2XRX A;  4HM4 A;  1O7G A;  4QUP A;  2QJY C;  2YIU C;  1O7P A;  3N0Q A;  3L75 E;  3D89 A;  2GBX A;  3GOB A;  1G8K B;  5KLV E;  2HML A;  2NWF A;  1JM1 A;  1O7H A;  4HM6 A;  5AEU A;  1KB9 E;  3GTS A;  2BMQ A;  1BGY E;  4H44 D;  1UUV A;  2DE7 D;  2ZYL A;  1UUW A;  2HMK A;  1ULI A;  5KKZ C;  4P1B H;  2HMJ A;  4D6T E;  1NTZ E;  2DE5 D;  2IBZ E;  2ZT9 D;  1Q90 C;  4HM3 A;  4PV1 D;  3L72 E;  3L71 E;  2NUK A;  3CXH E;  1VCK A;  4HM8 A;  2DE6 D;  2YFJ A;  1EZV E;  4NBG D;  1NTK E;  2E4Q A;  1RFS A;  2QJP C;  1KYO E;  2E74 D;  2XR8 A;  1SQP E;  3BCC E;  1SJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...