1A5RA

Structure determination of the small ubiquitin-related modifier sumo-1, nmr, 10 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
103
structure length
103
Chain Sequence
b'GSMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-1
molecule tags Targeting protein
source organism Homo sapiens
publication title Structure determination of the small ubiquitin-related modifier SUMO-1.
pubmed doi rcsb
total genus 10
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1a5rA00
5LLIA 3WALA 3EHVA 4WJOA 1UBIA 1TBEA 3KW5B 3KUZA 4P7IA 4EEWA 2KC1A 1LQBA 1WMHB 1YX6B 4ICUA 2JT4B 4W9DA 2DENB 2MW5A 2V3SA 1WGHA 2LVPA 2ZVNA 2KX3A 1CMXB 2IO2B 3VUXA 4FJZA 2ZVOA 2V1YA 3WAPA 3DVGY 2MWSB 4F1SA 1WXSA 3OLMD 2Z0EB 3A9JB 2O6VA 4WWOA 1A5RA 2JUOA 2KDIA 4W9IA 3ZIMA 2RGFA 3VUWA 2LZ6A 1IP9A 1NBFC 2A4ZA 2CHZA 1YQBA 2KQ7A 2NPTB 2G45B 4PS7A 4DXAB 3ZDTA 3B0AA 2VRRB 3ZLZA 4MJSA 3VQIA 3LJ3A 2O6VB 3APFA 3R7RA 1I35A 1Z2MA 5IA7A 2JWZA 4WJNA 3W1YA 1L7YA 5KHQA 2ZCBA 3PV1A 3ALBA 2MRPA 3V6EB 2IBIB 1E5WA 3P2BA 1ZW7A 2IO3B 4DK5A 3L08A 2FUHB 1Q1OA 5DPWA 5CX3A 1E8WA 2GOWA 4EOYA 4G50A 3RULA 4BFRA 2GBNA 1LFDA 2AYOB 2D11A 3VDZA 4W9CA 3H7SA 1V2YA 2Z59B 2AWTA 2KFKB 2KWCA 1EF1A 3CSFA 3H7PA 3VFKA 1YX5B 4KV2A 2IZVB 4LDTB 2LD9A 2M1MA 3R3MA 3EECA 5C23A 4EZKA 1P1AA 4GIVA 4MGIE 4TV3A 5IAAC 5BO4B 1NI2A 4KSKC 2K25A 3CF6E 3TCAA 4ZRIA 5LXHA 3QQ8B 3QWZB 2DYMA 4IM3A 3W1SA 4IG7B 4DDGD 2IO0B 2KTRB 4A3OA 2JRHA 1WX8A 3V62A 2WX0A 2HTHA 2KJ6A 2GBRA 3Q3JA 1GNUA 2BKFA 2QHOA 2KFKA 2ZEQA 5KHOA 4HWIB 2KMCA 1X1MA 2KLGA 4EFOA 4BOZB 2RD0A 3H9DA 2MBOA 2DZJA 4HJKA 2LUEA 2KD0A 3HM6X 3DPDA 1IYFA 3DBSA 2BYFA 3UQBA 4K1RB 4EUTA 5E6OA 4HCNB 4WJQA 4MDKE 4W9FA 3TBLD 3VUYA 3KYCD 4TQ1A 4IM0A 2JRIB 1WR6E 1D3ZA 1H8CA 3AU4A 2JPHA 5J18A 2D3GA 2LXCA 3L0WB 3IBEA 3M3JA 2XEWA 3HHMA 3LDZE 5JZEB 3A9JA 4W9GA 1WX9A 3A4SC 4I6PA 4W9EA 1P3QU 4AJWA 4K81A 3PRPB 2ZPYA 5JHAA 2HD5B 4GOCA 5CHFA 1OQYA 4J6IA 4BKGA 2G4SA 3A33B 3DVNV 4ZRKA 2NS5A 2REXA 2MSED 2JVCA 2JY6A 3IVFA 4W9LA 4K7SA 1GJZA 2G3QB 2KTRA 4KZ0A 1E7UA 2L0TA 3AU5A 1KLVA 3VXWA 4K7WA 4ZRJA 3R7QA 3B1LX 3A1QA 4MEMA 5D94A 3QAQA 3HK0A 1UD7A 1ZGUB 4JGHB 4ZYNA 4EZJA 3M95A 2KOXA 2MX2A 1M94A 1C1YB 2DAJA 5G2NA 4ICVA 2MBEA 3PZDA 3TMPB 1Z5SB 1T0YA 1WGDA 2CHXA 2K8CA 2OJRA 3KUDB 2KJRA 3QHTA 3SD5A 4E3CA 5AEKB 4FULA 2KDFB 3DCGA 4W9HA 3H6NA 2L8JA 4IUMB 4BOSC 4MM3A 2L7RA 4ANUA 1V9JA 2FCSA 3NOBA 3H1UA 4E71A 2W9NA 3NZSA 2OOBB 2N1VA 5D6JB 2N9XA 2LGDA 3UINB 3ZO5B 1FXTB 4MGYE 1ZKHA 4MH0E 4M8NA 2L05A 2MLBA 4KIKB 1Q5WB 2ASQA 4DHJD 2LVQA 1TZ1A 2KHWB 4IC7B 1WE6A 1LM8B 4NQLB 2DHZA 4CYEA 3ZRFA 2HE7A 4GGQA 4TKNA 1V80A 1E8ZA 2G4DB 1UH6A 1WGYA 4IWQA 4W9JA 3DQVA 3OAWA 3ZW3A 2NCNA 4BKTA 2ZJDA 4PYZA 1WY8A 3DOWA 4KZCA 2IO1B 2BKRB 2EMSA 2GBMA 2XK5B 2FAZA 1RFAA 2XBBC 2M0XA 4FHJA 3JSVB 4URKA 3AULA 3CSTA 3VH4B 1KOTA 3UIOB 1I42A 1C3TA 2HJ8A 2JF5A 3KUCB 1WGGA 4A3PA 4B9KA 4BBNC 4NJ7A 4B6WA 3QARA 3GOEA 3ENEA 2CS4A 3SHQA 2DX5B 4HPLB 1LXDA 4WWPA 3DVGX 1TTNA 3BINA 4JL9A 3RT3B 1V6EA 1ISNA 1V49A 4LJOB 3BY4B 2C7NB 3TL5A 1P98A 4DBGA 1WF9A 3UIPB 4HXDA 2CU1A 2UWQA 4GMVA 5D7GA 1R4MI 3H7PB 1VCBA 2AL6A 2FIDA 2KO3A 4IW0A 4XX5A 1E90A 2KNBA 3DBRI 3MTNB 2KTFA 1XT9B 4HDQA 1TGZB 4NQKE 5DPTA 2KXJA 3PS6A 2AL3A 4BBNF 1F9JA 3V60A 1V86A 2ZCCA 2LVOA 2CR5A 3T9LA 2N1WA 3APDA 1YJ1A 1OEYJ 3ML8A 4LJPB 1WM2A 4HVBA 1MG8A 2KFJA 3NZUA 3PLUA 3QIJA 1XD3B 3WAMA 3M63B 2PPHA 3PVLA 1WFYA 3VTWA 3ZTCA 3MHSD 2Y5BB 4GDLB 4NAWA 3UQAA 3ZDMC 2BYEA 3RCZA 1WXMA 4KIKA 2LGYA 2EKEC 2C5LC 1UELA 3GZNI 3Q3FA 2R2QA 3AXCA 2N7DA 3PRMB 2WWZA 4FJYA 1E8YA 1GG3A 5CHWA 4DHZB 3T8MA 5JHBA 1WJ4A 2KC2A 2MP2B 4DHZE 2WYQA 3C0RB 4TUUA 2NBWB 1OGWA 1WJ6A 1V81A 2FCQA 3ZKJC 4M8MA 1P9DU 4RM8A 3X0WA 4II2B 5J2RA 3L10B 4I6LB 4GDKA 1UGMA 2I1JA 3QC8B 3W1SC 2XK5A 2BYVE 3NS8A 4OVVA 3HIZA 4PS3A 1GC7A 3L16A 1OEYA 2FCMA 3PRZA 4FLHA 1WGRA 1EF5A 3VTVA 3V6CB 2RPQA 4JIOU 3ONSA 3PTFC 2K8BA 4LCDE 1WRDB 4PS8A 3SDLC 2GBKA 2LWPA 4AWJA 1UZXB 1RRBA 2DZKA 2V4LA 2ZNVB 1S1QB 3OJ3A 4NNJB 2UYZB 4B95A 1PQSA 1WJNA 4HLEA 1QZEA 2MQJA 2PEAA 3CMMB 1JRUA 2L0FA 3K9OB 4LDTD 2NBUA 4JLCA 2FCNA 2K8HA 1SGHA 3TIXA 2EMTA 3KYDD 3RZFA 4KVGB 1E7VA 1WIAA 4IWPA 5GMVA 3APCA 4G0NB 2N9EB 4MJSB 1GUAB 4FHKA 2KKCA 4GU2A 2NBVB 2O2VB 4ANXA 4CHKA 1AARA 2PE9A 2FIFA 4PYUA 3A4RA 3JSVA 2YLMA 4NJ6A 2IYDB 3UF8A 5TR5A 3ML9A 2IY1B 5C1ZA 3ZNHB 3A1QB 1WR1A 1UBQA 4I6NB 3RUIB 4F7ZA 1H4RA 3B08A 2O2VA 2RSUA 5FR6A 2KK8A 3MJWA 1GC6A 5E6NA 3PGEA 2KWVB 5L95C 4G3XB 3DBHI 2BGFA 1WMHA 4YL8A 1XQQA 1KJTA 4X57B 3JVZX 4GDLA 3NY5A 2LI5A 4RMAA 4W9KA 3QCAA 2FNJB 2BPSA 3RD2A 3IHPC 3X23A 4AJYB 3EC8A 3L17A 2JZZA 3PLVA 4WJPA 1VD2A 5CTRC 4DWFA 5D2MB 4TQ0A 4E74A 3L54A 2CHWA 3ZVVA 1YIWA 2DYOA 5G55A 3ECIA 3JW0X 5AZHA 2K39A 3QA8A 3D32A 4FJVB 4G11A 2J0KA 4FA6A 4XZ4A 2BWES 4KDLB 2D07B 2N4FA 1WX7A 1J8CA 1RLFA 1RAXA 1V5TA 2KJHB 4GDKB 2WX1A 4EKUA 1WI0A 2J0MA 2L00B 1EUVB 2LASA 4WAAA 2D10A 3PREA 5CHVC 4II3B 3VAWA 3RYTA 4HK2A 2N7EA 4MELA 4ANWA 3S2AA 2LRUA 3ZNGC 1WZ0A 4XC2A 3IFWB 4GN1A 2C7MB 1WM3A 3PT2B 1IPGA 4DHJB 5DCNA 1WH3A 2KLCA 2B3AA 1J0GA 3VHTC 1U4AA 3O65B 4AOFA 3PHXB 2LJ5A 5E6PA 4HDOA 3WANA 2YVCA 5AZFA 2I1KA 4MSQB 3ZNID 2M17A 4DDID 5DPSA 3V61A 1E8XA 2K6DB 4M0WB 1NDDA 2ZNVC 3N32A 4ANVA 1P0RA 3ZUNA 4MSMB 3A9KB 2KDEB 3QJZA 4EZLA 3PSEB 3U8ZA 4AP4C 1J19A 2AEHA 2C9WB 4OVUA 2KMAA 3K9PB 3ZRCA 2NVUI 5LXIB 2RR9A 2KZRA 2PJHA 3A9KA 4N9F4 4ZDVA 2ZPNA 4JQWC 2NPTA 3RZWC 4GB9A 2BF8B 2K6QA 1WJUA 2J0JA 3M62B 4NY0A 3ZTDA 2K1FA 4GSWA 2MBHA 1EO6A 2JXXA 2O6VD 4CO7A 5DPRA 2KANA 3QX1A 3PHWB 2R2OA 1G6JA 2C7HA 4MGZE 3U30A 1Q0WB 1OTRB 1WXVA 2GBJA 2WDTB 2N9PC 2DZIA 2PE6B 4K7UA 4NAWB 1WE7A 5J17A 2JZ3B 3PPAA 2KWUB 4NPNA 5HKHA 3KH0A 4KDIC 4KSLC 2L76A 4MGKE 3JYUA 4HCPB 3U7DA 4WWNA 4WQOB 1V5OA 2J7QB 3R66C 2D2QA 3DVNU 3SU8X 4FBJB 2MBBB 4ASWC 3DDCB 1R4NI 2M4NA 5AZGA 2IY0B 4BVUC 2KQSA 3VH3B 2GMIC 4A20A 1YD8U 3IG3A 4FADA 1BT0A 2L3ZA 2LRWA 4IWOA 3DBLI 1SIFA 1HE8A 3L13A 1SE9A 1WZ3A 4IM2A 1KM7A 4AUQC 4F8CB 3WIMA 2A5UA 3NHEB 2DZMA 3EFUA 4FN2A 2KX0A 1WXAA 3WAOA 3QK0A 5L83A 3VTUA 3OJ4B 3TJPA 2KVRA 2DYBA 1K8RB 2LXAA 2MA9B 2MCNB 3WA0A 4BKSD 5EDSA 3KVFB 2KDBA 3UGBB 3N3KB 1L2NA 1S3SG 2C60A 2DAFA 2BWFA 4HPMB 1Y8RC 2NR2A 3N30A 2KN5A 4GXBA 1WYWB 2CKHB 2Z0DB 3HM3A 5JH5C 2MP2A 2ZZPB 4BKSA 3I3TB 2MBQA 3AI5A 4RM9A 3ZNZB 2LGXA 3VVWB 2M8SA
chains in the Genus database with same CATH superfamily
1SSNA 1I4GA 1TBEA 4P7IA 1YX6B 1XF5L 3ZJUA 2BW2A 2DENB 2BVCA 1WGHA 2ZVNA 2K5PA 3FC4A 4P1BC 1WXSA 1PUTA 2O6VA 1A5RA 1YMHE 2NPTB 1UF0A 2OEDA 1VR9A 3ZDTA 4MJSA 2IGHA 3AE9B 3APFA 1I4PA 1GAQB 1I35A 3W1YA 2ZCBA 2J42A 2FUHB 5DPWA 2GOWA 3P63A 4W9CA 3FILA 2LHDA 2Z59B 2KWCA 2K9XA 1RM6C 3H7PA 2K22A 5C2TB 3Q8AA 1UUPA 3VR8B 5HFYA 3SR6A 5BO4B 1NI2A 2WXNA 4JX1C 3TCAA 1HTQA 1XEEA 4IM3A 4IG7B 1Y56A 1TS5A 2KTRB 4TMAB 5C3JB 2WX0A 3Q8FA 2Q5WD 2R61A 3Q3JA 3GE8C 1FXIA 2ZW0A 1PGAA 4LK0M 4A8XC 1ZOYB 3H9DA 2DZJA 3HM6X 2BYFA 2N0SB 5E6OA 4WJQA 1RYJA 3TBLD 3UI3A 4IM0A 3IAS1 2JRIB 5E6JA 3NS1A 1JWUD 3AU4A 2QCZA 5J18A 3RFZB 3IBEA 3M3JA 2PLPA 3N9YC 4W9GA 1WX9A 1ZP0B 4AJWA 4K81A 2XNAC 5CHFA 4J6IA 3A33B 4ZRKA 2AQ3B 2NS5A 2JY6A 1GJZA 4K7SA 2G3QB 3BWUD 2HJ1A 4XDCA 4MEMA 3HK0A 3BVZA 4WH4A 3ZGZA 2FUG1 1T0YA 2K8CA 2CHXA 2KJRA 4E3CA 4FULA 4RCOA 3DHIC 1PYWD 2KDFB 4P1CC 3BYTB 4UDUC 3BIID 4W9HA 3H6NA 4BOSC 2KAJA 4ANUA 4LNNA 3NOBA 3RNBC 3GE3C 2WHIA 2OOBB 4JWUC 3ZO5B 1DGJA 1Q5WB 1KFYB 2WXFA 4DHJD 1TZ1A 1E10A 4NQLB 1TY0A 4TKNA 1V80A 1HQRD 3I63C 4C7ZA 4W9JA 4BKTA 2BS3B 3OAWA 3AMZA 2BKRB 4URKA 1M4VA 5EE3A 3AULA 1ENFA 2L83A 1C4AA 3UIOB 1I4HA 3KUCB 4A3PA 2D3BA 3WCQA 4B6WA 3B2GA 2CS4A 2D3CA 4HPLB 1TTNA 3BINA 3BY4B 1QOBA 1WF9A 2LUMA 4HXDA 4GMVA 2AL6A 2KO3A 1XT9B 1SBBB 5DPTA 1CZPA 3E9SA 1KTKA 3P42A 2LVOA 3NUHB 1ACCA 1YJ1A 3DHHC 1MG8A 1XD3B 2BS4B 3M63B 3Q3OC 3MHSD 4D2KA 3RCZA 1WXMA 3LYYA 3GZNI 3Q3FA 4LNFA 5EE1A 2R2QA 2N7DA 1TT5B 2MP2B 2KC2A 2WYQA 3C0RB 1HEZE 1WJ6A 2INCC 3X0WA 4II2B 3L10B 1NYRA 2BYVE 1J7BA 2PKOA 3L16A 1OEYA 3PRZA 1FNUA 1WGRA 4CQNA 1FD6A 3NG0A 3ONSA 3PTFC 1WRDB 1D3ZA 3OJ3A 2WXMA 3URYA 3KYDD 2JX5A 2N9EB 1UGJA 2O2VB 4ANXA 2WP9B 4CHKA 4RGOS 4ARIA 1JROA 2WNMA 3ML9A 3A1QB 1FMAD 5H8YE 1SIJA 1GC6A 5E6NA 5L95C 3N20C 3DBHI 1MG4A 1MPEA 4Q2JA 2BS2B 3ABVB 2BBCA 1AWDA 3NVYA 4RMAA 4W9KA 5HHDG 3X23A 2MJEA 4DWFA 5D3DA 1VD2A 3W9CB 1N5WA 1JCKB 4IKGA 2WGSA 3ZVVA 1ZE3D 5AZHA 3RNEC 4G11A 4FA6A 4KDLB 4AS1A 1ZXIA 2KJHB 2KYWA 4YTNB 4KGTA 2D10A 1L4ZB 2L52A 4NJCA 2K3UA 4HK2A 2M56B 2N7EA 4KKIA 3S2AA 3ZNGC 2WXJA 4GN1A 4NAMA 3PT2B 1XLNA 4DHJB 1WH3A 3EA6A 1U4AA 2MH7A 2H88B 3P4RB 3Q3MC 3WANA 2YVCA 4DDID 3V61A 1FNWA 4RGMA 1UNSA 2WQYB 1FNVA 1FRRA 2GI9A 4EZLA 1J7AA 2WXLA 3K9PB 4HEA1 2RR9A 2ZPNA 2INPE 3E56A 2K1FA 3ZYYX 1EO6A 3KLSX 3H8HA 2OJWA 1QILA 2TSSA 3AB5A 1FCCC 4K3BA 5IO9A 1D4BA 2W3SA 2GLSA 2JWUA 5J17A 2JZ3B 3PPAA 4NPNA 3VR9B 3KH0A 2L76A 1R7SA 2LJIA 3JYUA 2DBYA 3R66C 4MM3B 2VH1A 4FBJB 2MBBB 1IUEA 3DDCB 4JWSC 2GMIC 1E7PB 1YD8U 2E6XA 3V05A 1BT0A 1R4MB 2L3ZA 2J53A 1KM7A 4HRSA 1T3QA 3OWEB 5FK9C 3TJPA 2DYBA 2MCNB 2UU7A 5EDSA 5LNK1 4WWMA 2BWFA 4HPMB 1Y8RC 4C80A 3V3XA 1WYWB 4MT5A 2KQ4X 3HM3A 4US8A 4OW0A 1HXYD 3ZNZB 2M8SA 1JWSD 3RNCC 4WJOA 1UBIA 4YSXB 3C19A 1C77A 2SEBD 3KUZA 2PTLA 3I5JC 4EEWA 1LQBA 2JT4B 4W9DA 4M02A 2V3SA 3HVZA 3VUXA 4FJZA 4F1SA 3OLMD 2Z0EB 3A9JB 2JUOA 2RGFA 2LZ6A 1IP9A 1MFWA 2A4ZA 2RDHA 2KQ7A 4XYCA 3B0AA 3ZLZA 3LJ3A 3R7RA 2JWZA 3P4PB 4PT5A 1EU3A 3AE5B 3U52E 3PV1A 3V6EB 3ALBA 2MRPA 1E5WA 1ZW7A 3L08A 1OQQA 3I9V1 2KT7A 4G50A 4BFRA 2AYOB 2KFKB 4L23A 3CSFA 1KRHA 3VFKA 2IZVB 3J9CA 1MVKA 2LD9A 3EECA 5C23A 4GIVA 2GRIA 4YTMB 1B9RA 2K25A 2BT6A 3QQ8B 3QWZB 3W1SA 2QDFA 2JRHA 3V62A 4C7YA 2HTHA 2KJ6A 3LB8C 2QHOA 2ZEQA 2IPKD 2KLGA 4EFOA 2JYTA 2WXOA 3KQ4A 4HJKA 2KD0A 1IYFA 3DPDA 1AN8A 1I4XA 4K1RB 4WIPA 2WU5B 3VUYA 4TQ1A 1IBXB 1D5XC 3GS2A 2J4XA 4ZHPA 2B76B 1H8CA 2JPHA 4ITKA 1K53A 1FEHA 4ZRQA 2WXRA 2XEWA 3LDZE 4BAXA 1A70A 3A9JA 1PDXA 5JZEB 1P7EA 3R8BA 4I6PA 4W9EA 4YT0B 2ZPYA 1NYQA 5JHAA 4WQMA 2N9KA 4KKJA 4BKGA 4QAYA 2JVCA 2AX5A 2KTRA 1XLQA 3VXWA 3R7QA 4EZJA 2MX2A 1M94A 1YNTE 2DAJA 4ICVA 3TMPB 2OJRA 3KUDB 5AEKB 3ZJTA 4HPPA 3DCGA 1ZDXA 1V97A 4M01A 3ZJVA 2L7RA 1JMLA 1V9JA 2WXGA 3VRBB 4E71A 1KLGD 1L0XB 1FXTB 4KGRA 2L05A 2ON8A 3AE4B 2LVQA 3ZRFA 2VZKB 3NVVA 2NCNA 4PYZA 3AECB 1WY8A 3NVZA 3DOWA 2IO1B 2EMSA 1RFAA 1STEA 4WAFA 2INNE 1C3TA 2HJ8A 1WGGA 1IBXA 2QC8A 1ET9A 1LXDA 1WRIA 4LJOB 2MHJA 3RN9C 5FR3A 1P98A 2V3NA 2UWQA 4XX5A 3BYYB 4RGTA 4HDQA 1TGZB 2ACZB 2DNFA 2KXJA 1CQVA 2IJ0A 1QKZA 3V60A 1N60A 1V86A 2ZCCA 4ARCA 2KFJA 2KWDA 2PPHA 1WFYA 1SE2A 3MC8A 4GDLB 4NAWA 3B2FA 4LLGM 4GLSC 1YQ3B 2VH2A 1C79A 2HTME 4FJYA 1E8YA 1GG3A 2N9LA 5JHBA 1WJ4A 1SB3C 3AEBB 4M8MA 1P9DU 3TSSA 4RM8A 5J2RA 2KMMA 4GDKA 1UGMA 1ROEA 4OVVA 1N62A 2FCMA 3V6CB 2RPQA 4LCDE 4PS8A 3SDLC 1F77A 2ZNVB 1S1QB 2UYZB 4HLEA 3CMMB 4LDTD 2NBUA 4JLCA 1DOYA 2FCNA 2K8HA 3I57A 2EMTA 1WIAA 4IWPA 2Y5PA 3BK1A 3B9JA 3R2IA 4FHKA 1AYFA 2KKCA 4GU2A 3NVWA 2JXTA 2FIFA 3UF8A 3RNAC 2IYDB 5TR5A 1UBQA 2HDEA 1H4RA 2KDMA 2WDRB 3PGEA 1TKGA 2WXPA 1YN4A 4JPSA 4X57B 4GDLA 3NY5A 2LI5A 3QCAA 2G9HD 3IHPC 4AJYB 1XLOA 3L17A 3PLVA 4TQ0A 5CTRC 1TY2A 4E74A 3L54A 2E3TA 4MACA 2K39A 3QA8A 4FJVB 1JALA 3BZDB 4YSYB 1VLBA 4GDKB 2J0MA 4C4VB 4RNAA 3NRZA 1N5XA 2SAKA 4ANWA 4C00A 1WZ0A 3Q69A 2C7MB 1WM3A 1JRPA 1XO3A 2WXQA 3VHTC 2D3AA 2LJ5A 4HDOA 3AEEB 5AZFA 4MSQB 1UWMA 1E8XA 2CJOA 4M0WB 3TUOA 1P0RA 1SXTA 2BB6A 3ZUNA 3RPFC 2RDGA 3AEFB 3A9KB 5G5GA 4AP4C 4HKZE 3AE8B 1YJIA 3ZRCA 5LXIB 2JYEA 3DWMA 1VZ6A 1SE3A 2K6QA 4NY0A 4GSWA 2MBHA 2O6VD 2JXXA 2R2OA 5AUKA 4A9AA 1Q0WB 1OTRB 2GBJA 2WDTB 4K7UA 2BYTA 4KX6B 2EELA 5HKHA 3AE2B 4KSLC 3IT6B 1HTOA 3U7DA 2LGIA 3MFGA 3DVNU 3SU8X 4DQOC 4ASWC 1R4NI 3VH3B 1GB4A 4LTUA 1HA5A 3IG3A 4FADA 1K51A 2LRWA 1KF6B 2QILA 1SIFA 3NHEB 3WAOA 3QK0A 2INDC 3OJ4B 2LXAA 2KVZA 2MA9B 3T3OA 1JQ4A 3KVFB 1S3SG 2DAFA 4ACFA 2NR2A 3N30A 2KN5A 5BYRA 2XN9C 4OZBA 2RMMA 2Z0DB 2MP2A 2ZZPB 3I3TB 4RM9A 2DLBA 3VVWB 1L6VA 1F1HA 5LLIA 1MHHE 1T0SC 2K0PA 4RF0A 1J7CA 1WMHB 4ICUA 2MW5A 2LVPA 2JSVX 2IO2B 2MWSB 2KDIA 4W9IA 3ZIMA 1YQBA 2G45B 1UWXA 1SJED 1WWTA 4N6EB 1E9MA 2O6VB 1RWSA 1GOZA 5IA7A 2MEKA 2CJNA 1YOVB 1NENB 2IO3B 1D6EC 1D5ZC 1Q1OA 1WSPA 5CX3A 2IDYA 4EOYA 3RULA 1FCLA 2GBNA 3CWIA 2D11A 3H7SA 1T0RC 2AWTA 2WXIA 1EF1A 1YX5B 4KV2A 5HI1A 2QEJC 2M1MA 3R3MA 4EZKA 1P1AA 4MGIE 5IAAC 4B0EA 4KSKC 2EKIA 5LXHA 3GP7A 4XWTA 1WX8A 1MJDA 3EUB2 2GBRA 2BKFA 2KFKA 4B0MA 4HWIB 1LO5D 2PVOD 5BYQA 2LUEA 1ZDVA 1MI0A 3UQBA 4HCNB 4MDKE 4W9FA 3KYCD 1TS4A 2D3GA 2LXCA 3DWGC 2JU6X 2WDVB 3EGRA 3HHMA 3FAHA 4R3DA 3A4SC 3NZ3A 4HJGE 3IT4B 2HD5B 1KLUD 4GOCA 1OQYA 1JWMD 1L0YB 3HUIA 1N61A 3IVFA 1C4CA 4XGAB 4KZ0A 3AU5A 2L0TA 1KLVA 3KWVA 4ZRJA 3B1LX 3A1QA 5D94A 3QAQA 4JGHB 1UD7A 1ZGUB 4YTPB 4ZYNA 2ZW1A 3M95A 2WLBA 2QMTA 1BMLC 5G2NA 1WGDA 1N63A 3CIRB 4ZOHC 4IUMB 4MM3A 3H1UA 1F0ZA 3NZSA 2N1VA 5D6JB 2LGDA 3UINB 4MGYE 1ZKHA 4MH0E 4S0RA 4M8NA 3VRAB 2ASQA 4IC7B 1WE6A 1LM8B 2DHZA 3DBRB 2G4DB 1UH6A 1WGYA 2W54A 3C8YA 3P4SB 4KZCA 2GBMA 1ZPSA 2XBBC 4RFBA 4DXGA 3JSVB 3CSTA 4XDDA 1I42A 2WXKA 1XCTL 4PK1A 4B9KA 3OG5A 4BBNC 2IGGA 3GOEA 3ENEA 1V1PA 2DX5B 4WWPA 1L5PA 1ISNA 1V49A 1VZ7A 1QT9A 2LGSA 3UIPB 5D7GA 1SF0A 3H7PB 3AEAB 2FIDA 2WXHA 3DBRI 4M00A 3MTNB 2KTFA 4XE0A 1GPXA 4BBNF 2BB5A 2CR5A 1L6UA 4ZYSA 3ML8A 2LHEA 3Q3NC 4HKQA 3QIJA 3WAMA 1OQRA 3PVLA 3ZXVA 2Y5BB 1YQ4B 3ZDMC 4A55A 2BYEA 5GXGB 2LGYA 2EKEC 1GB1A 3L4PA 1BXTA 4DHZB 5IN7A 3N1YC 1NVID 1OGWA 2FCQA 1V81A 2NBWB 3Q14C 4N59A 3QC8B 1VRAB 4P16A 3NS8A 2MJ3A 4PS3A 3VTVA 1EF5A 4BZAA 2GBKA 1SJHD 2LWPA 4NNJB 1RRBA 2V4LA 2Y3AA 1WJNA 5BMGA 1JRUA 1V1PB 2L0FA 1SGHA 2Y5CA 4H2AA 2KN4A 1R4NB 3RZFA 4KVGB 1E7VA 3MC9A 2QSDA 5GMVA 3P4QB 4MJSB 2NMQA 1AARA 1K50A 4PYUA 3JSVA 2YLMA 4NJ6A 1V8CA 5C1ZA 1JWBD 2N7JA 1ZXHA 3TEWA 1WR1A 4I6NB 3RUIB 2O2VA 1N6ZA 2RSUA 5FR6A 1I4RA 2KK8A 1QLBB 3BVGA 2KWVB 2BGFA 1DYQA 3FILB 4YL8A 1HZ5A 1XQQA 1KJTA 1SE4A 3PO0A 1F52A 5D3IB 2BPSA 3EC8A 2JZZA 2Z8LA 3DHGC 1PGXA 4O1NA 2AQ2B 4HROA 5G55A 3D32A 2J0KA 2BWES 2D07B 1VZ8A 2N4FA 1WX7A 1J8CA 1XXGA 2WX1A 1C4PA 4EKUA 1EUVB 3VAWA 4REZA 4OZAA 4MH8A 3IFWB 2WS3B 1TKYA 1FO4A 3GB1A 2PVGC 2B3AA 1J0GA 3O65B 3PHXB 5E6PA 4RF1A 2I1KA 3GZNB 1PFDA 2ZNVC 3N32A 1Q10A 3QJZA 1FM0D 3PSEB 1XCQL 1BUIC 1J19A 3R2TA 4OVUA 3IXSA 2KMAA 2PJHA 4N9F4 4ZDVA 4JQWC 3RZWC 4GB9A 1DOXA 2BF8B 3M62B 3ZTDA 4CO7A 5DPRA 3PHWB 3EFCA 1E6EB 4LNOA 1WXVA 4US9A 1WE7A 1QOAA 1RFKA 4KDIC 4HCPB 1WGKA 4WQOB 2J7QB 2D2QA 1LGRA 3BVMA 2VZKD 2CU3A 2M4NA 5AZGA 2IY0B 2KQSA 4L2YA 2V4IB 3AN1A 3Q2AC 1FFUA 3AM9A 1HE8A 1I7HA 3DBLB 3L13A 4IM2A 2IGDA 4AUQC 4F8CB 3WIMA 2A5UA 3EFUA 1WXAA 1EWYC 4A6QA 2I38A 2G1EA 5AUIA 3VTUA 2KVRA 1K8RB 3WA0A 4BKSD 3N3KB 5HG2A 2C60A 5EE9A 4GXBA 2ONQA 4BKSA 3AI5A 2LGXA 3WALA 5TSSA 3EHVA 3KW5B 2KC1A 1CK1A 2KX3A 1CMXB 2YEPF 3MP9A 3WAPA 2ZVOA 2V1YA 3DVGY 3AEDB 3MHZA 5IP4D 1NI3A 4WWOA 1PGBA 1YN3A 5EE0A 3VUWA 1NBFC 2CHZA 4PS7A 4DXAB 2NTTA 3MJ5A 2VRRB 3VQIA 1FRDA 2M19A 1Z2MA 2H89B 4WJNA 1E0ZA 1L7YA 5KHQA 2X8XX 2IBIB 3P2BA 4DK5A 3N1XC 1E8WA 1LFDA 3VDZA 1V2YA 3TEYA 4YXDB 2GB1A 1T6BX 4C56C 4LDTB 5MPOA 5IOIA 2FBWB 1ESFA 1K52A 4TV3A 1KH0A 2BQQA 1QOFA 3CF6E 4ZRIA 2DYMA 3TEXA 3SFDB 4DDGD 2IO0B 4A3OA 3ETRA 1GNUA 3AE3B 5KHOA 3AE1B 2KMCA 3W5UB 1X1MA 4BOZB 2RD0A 4XWWA 1AW7A 2MBOA 1C76A 4IDIA 3DBSA 1MHXA 4EUTA 4N58A 2ICIA 4K3CA 1WYGA 4RH6A 1WR6E 3FKYA 4EE2A 3L0WB 4M0WA 3N1ZC 1NEKB 4J3OD 1P3QU 3PRPB 2QJLA 2G4SA 3DVNV 4W9LA 2REXA 2MSED 2M0AA 1E7UA 2D5GA 4K7WA 3NJTA 2V3PA 1L4DB 2KOXA 1TKEA 3RNGC 2RPVA 1C1YB 4ZHOA 2MBEA 3PZDA 1Z5SB 1XLPA 3QHTA 3SD5A 1QOGA 2LFIA 3HVDA 4NZLB 3Q8CA 2L8JA 3LXFA 2FCSA 2W9NA 1F2RI 2N9XA 4LNIA 2MLBA 3U7ZA 4KIKB 3SEBA 2KHWB 4S17A 2RDBC 3PZ7A 4CYEA 2HE7A 4GGQA 3W5VB 1E8ZA 4IWQA 3DQVA 3ZW3A 2ZJDA 4WURA 5H92C 3T3NA 1C9FA 2XK5B 2FAZA 1FFVA 2M0XA 3U2SC 1EU4A 4FHJA 3VH4B 1KOTA 2LEKA 3Q6BA 2JF5A 2PW9A 4NJ7A 3QARA 1FIQA 3SHQA 3DVGX 3Q8BA 4JL9A 3RT3B 1FPYA 1V6EA 3IAM1 5G5HA 2C7NB 3TL5A 4DBGA 2CU1A 3U4EG 3ZXRA 1TS2A 2LMCA 1R4MI 1VCBA 4IW0A 1E90A 2KNBA 3MC0B 4NQKE 4JE3B 3AE7B 3PS6A 1JWAD 2AL3A 3TEZA 1F9JA 3T9LA 2N1WA 3APDA 2V9HA 1OEYJ 4LJPB 1WM2A 4HVBA 3HRDD 1I4QA 3NZUA 3PLUA 3VTWA 3ZTCA 4ZRPA 3UQAA 1QQRA 4KIKA 2C5LC 1EM7A 1UELA 3AXCA 3PRMB 2WWZA 2DWQA 5CHWA 2FE8A 3RMKC 4IOIE 3T8MA 4DHZE 3KWLA 4TUUA 3ZKJC 4I6LB 1D5MC 2I1JA 3W1SC 2XK5A 1VJKA 3AE6B 3HIZA 1GC7A 3PZ8A 4FXCA 1VDVA 4FLHA 4JIOU 2J52A 2K8BA 4AWJA 1P7FA 1UZXB 2DZKA 4B95A 1PQSA 1QZEA 2MQJA 2PEAA 3K9OB 3TIXA 4OZCA 5BMIA 1CJEA 3APCA 4G0NB 1TJEA 1GUAB 4AQ7A 1YN5A 2NBVB 2PE9A 2KACA 3A4RA 2I2YA 2IY1B 2X38A 3ZNHB 1DOIA 2JQRB 4F7ZA 4TSSA 2L1AA 3RNFC 3B08A 3MJWA 1TIFA 1YJJA 4G3XB 2OHFA 1WMHA 1T0QC 1QF6A 3JVZX 2NTSA 3RD2A 2FNJB 4WJPA 5D2MB 2CHWA 1YIWA 2DYOA 3ECIA 4C4VA 1C78A 3JW0X 3Q8EA 2MJDA 2AQ1B 4XZ4A 3W2DA 4KGSA 4YWGG 1RLFA 1RAXA 1V5TA 1WI0A 2L00B 3ZQ4A 4A90A 2BTEA 3BK2A 2LASA 4WAAA 1EWCA 3PREA 5CHVC 4II3B 1T5XD 3RYTA 3SFEB 2QIEB 5I4DA 4YSZB 4MELA 1ET6A 2LRUA 4XC2A 1IPGA 3AV8A 5DCNA 2KLCA 1ZUD2 4OHJA 2L32A 4AOFA 5FKAC 1HZ6A 2WDQB 3ZNID 2M17A 5DPSA 2K6DB 1NDDA 4ANVA 4MSMB 4L1BA 2KDEB 3U8ZA 4P6VF 2AEHA 2C9WB 5IKCM 2NVUI 3AH7A 1L0VB 2KZRA 3A9KA 3AEGB 1FXAA 2NPTA 1JW9D 2J0JA 1WJUA 2KANA 3QX1A 1G6JA 2C7HA 5T8IA 4MGZE 1TYGB 3U30A 1TS3A 4USAA 3RI7C 2N9PC 2DZIA 2PE6B 4NAWB 1IGCA 2KWUB 1TZOA 2W55A 4MGKE 2WU2B 2JZPA 4OVZA 4WWNA 1V5OA 1WXQA 3O13A 2W82A 5BMHA 4LNKA 4BVUC 1V1OA 4A20A 2PMVA 5JXVA 1B1ZA 4IWOA 3DBLI 1SE9A 1WZ3A 3P1MA 2DZMA 4FN2A 2KX0A 1F2RC 5L83A 2V0GA 2W3RA 2YEPB 3DBHB 2KDBA 3UGBB 1SEBD 1L2NA 4DXFA 4RGNA 2CKHB 5BYSA 5JH5C 2PIAA 1OFFA 2MBQA 1IGDA
chains in the Genus database with same CATH topology
5LLIA 3WALA 3EHVA 4WJOA 1UBIA 1TBEA 3KW5B 3KUZA 4P7IA 4EEWA 2KC1A 1LQBA 1WMHB 1YX6B 4ICUA 2JT4B 4W9DA 2DENB 2MW5A 2V3SA 1WGHA 2LVPA 2ZVNA 2KX3A 1CMXB 2IO2B 3VUXA 4FJZA 2ZVOA 2V1YA 3WAPA 3DVGY 2MWSB 4F1SA 1WXSA 3OLMD 2Z0EB 3A9JB 2O6VA 4WWOA 1A5RA 2JUOA 2KDIA 4W9IA 3ZIMA 2RGFA 3VUWA 2LZ6A 1IP9A 1NBFC 2A4ZA 2CHZA 1YQBA 2KQ7A 2NPTB 2G45B 4PS7A 4DXAB 3ZDTA 3B0AA 2VRRB 3ZLZA 4MJSA 3VQIA 3LJ3A 2O6VB 3APFA 3R7RA 1I35A 1Z2MA 5IA7A 2JWZA 4WJNA 3W1YA 1L7YA 5KHQA 2ZCBA 3PV1A 3ALBA 2MRPA 3V6EB 2IBIB 1E5WA 3P2BA 1ZW7A 2IO3B 4DK5A 3L08A 2FUHB 1Q1OA 5DPWA 5CX3A 1E8WA 2GOWA 4EOYA 4G50A 3RULA 4BFRA 2GBNA 1LFDA 2AYOB 2D11A 3VDZA 4W9CA 3H7SA 1V2YA 2Z59B 2AWTA 2KFKB 2KWCA 1EF1A 3CSFA 3H7PA 3VFKA 1YX5B 4KV2A 2IZVB 4LDTB 2LD9A 2M1MA 3R3MA 3EECA 5C23A 4EZKA 1P1AA 4GIVA 4MGIE 4TV3A 5IAAC 5BO4B 1NI2A 4KSKC 2K25A 3CF6E 3TCAA 4ZRIA 5LXHA 3QQ8B 3QWZB 2DYMA 4IM3A 3W1SA 4IG7B 4DDGD 2IO0B 2KTRB 4A3OA 2JRHA 1WX8A 3V62A 2WX0A 2HTHA 2KJ6A 2GBRA 3Q3JA 1GNUA 2BKFA 2QHOA 2KFKA 2ZEQA 5KHOA 4HWIB 2KMCA 1X1MA 2KLGA 4EFOA 4BOZB 2RD0A 3H9DA 2MBOA 2DZJA 4HJKA 2LUEA 2KD0A 3HM6X 3DPDA 1IYFA 3DBSA 2BYFA 3UQBA 4K1RB 4EUTA 5E6OA 4HCNB 4WJQA 4MDKE 4W9FA 3TBLD 3VUYA 3KYCD 4TQ1A 4IM0A 2JRIB 1WR6E 1D3ZA 1H8CA 3AU4A 2JPHA 5J18A 2D3GA 2LXCA 3L0WB 3IBEA 3M3JA 2XEWA 3HHMA 3LDZE 5JZEB 3A9JA 4W9GA 1WX9A 3A4SC 4I6PA 4W9EA 1P3QU 4AJWA 4K81A 3PRPB 2ZPYA 5JHAA 2HD5B 4GOCA 5CHFA 1OQYA 4J6IA 4BKGA 2G4SA 3A33B 3DVNV 4ZRKA 2NS5A 2REXA 2MSED 2JVCA 2JY6A 3IVFA 4W9LA 4K7SA 1GJZA 2G3QB 2KTRA 4KZ0A 1E7UA 2L0TA 3AU5A 1KLVA 3VXWA 4K7WA 4ZRJA 3R7QA 3B1LX 3A1QA 4MEMA 5D94A 3QAQA 3HK0A 1UD7A 1ZGUB 4JGHB 4ZYNA 4EZJA 3M95A 2KOXA 2MX2A 1M94A 1C1YB 2DAJA 5G2NA 4ICVA 2MBEA 3PZDA 3TMPB 1Z5SB 1T0YA 1WGDA 2CHXA 2K8CA 2OJRA 3KUDB 2KJRA 3QHTA 3SD5A 4E3CA 5AEKB 4FULA 2KDFB 3DCGA 4W9HA 3H6NA 2L8JA 4IUMB 4BOSC 4MM3A 2L7RA 4ANUA 1V9JA 2FCSA 3NOBA 3H1UA 4E71A 2W9NA 3NZSA 2OOBB 2N1VA 5D6JB 2N9XA 2LGDA 3UINB 3ZO5B 1FXTB 4MGYE 1ZKHA 4MH0E 4M8NA 2L05A 2MLBA 4KIKB 1Q5WB 2ASQA 4DHJD 2LVQA 1TZ1A 2KHWB 4IC7B 1WE6A 1LM8B 4NQLB 2DHZA 4CYEA 3ZRFA 2HE7A 4GGQA 4TKNA 1V80A 1E8ZA 2G4DB 1UH6A 1WGYA 4IWQA 4W9JA 3DQVA 3OAWA 3ZW3A 2NCNA 4BKTA 2ZJDA 4PYZA 1WY8A 3DOWA 4KZCA 2IO1B 2BKRB 2EMSA 2GBMA 2XK5B 2FAZA 1RFAA 2XBBC 2M0XA 4FHJA 3JSVB 4URKA 3AULA 3CSTA 3VH4B 1KOTA 3UIOB 1I42A 1C3TA 2HJ8A 2JF5A 3KUCB 1WGGA 4A3PA 4B9KA 4BBNC 4NJ7A 4B6WA 3QARA 3GOEA 3ENEA 2CS4A 3SHQA 2DX5B 4HPLB 1LXDA 4WWPA 3DVGX 1TTNA 3BINA 4JL9A 3RT3B 1V6EA 1ISNA 1V49A 4LJOB 3BY4B 2C7NB 3TL5A 1P98A 4DBGA 1WF9A 3UIPB 4HXDA 2CU1A 2UWQA 4GMVA 5D7GA 1R4MI 3H7PB 1VCBA 2AL6A 2FIDA 2KO3A 4IW0A 4XX5A 1E90A 2KNBA 3DBRI 3MTNB 2KTFA 1XT9B 4HDQA 1TGZB 4NQKE 5DPTA 2KXJA 3PS6A 2AL3A 4BBNF 1F9JA 3V60A 1V86A 2ZCCA 2LVOA 2CR5A 3T9LA 2N1WA 3APDA 1YJ1A 1OEYJ 3ML8A 4LJPB 1WM2A 4HVBA 1MG8A 2KFJA 3NZUA 3PLUA 3QIJA 1XD3B 3WAMA 3M63B 2PPHA 3PVLA 1WFYA 3VTWA 3ZTCA 3MHSD 2Y5BB 4GDLB 4NAWA 3UQAA 3ZDMC 2BYEA 3RCZA 1WXMA 4KIKA 2LGYA 2EKEC 2C5LC 1UELA 3GZNI 3Q3FA 2R2QA 3AXCA 2N7DA 3PRMB 2WWZA 4FJYA 1E8YA 1GG3A 5CHWA 4DHZB 3T8MA 5JHBA 1WJ4A 2KC2A 2MP2B 4DHZE 2WYQA 3C0RB 4TUUA 2NBWB 1OGWA 1WJ6A 1V81A 2FCQA 3ZKJC 4M8MA 1P9DU 4RM8A 3X0WA 4II2B 5J2RA 3L10B 4I6LB 4GDKA 1UGMA 2I1JA 3QC8B 3W1SC 2XK5A 2BYVE 3NS8A 4OVVA 3HIZA 4PS3A 1GC7A 3L16A 1OEYA 2FCMA 3PRZA 4FLHA 1WGRA 1EF5A 3VTVA 3V6CB 2RPQA 4JIOU 3ONSA 3PTFC 2K8BA 4LCDE 1WRDB 4PS8A 3SDLC 2GBKA 2LWPA 4AWJA 1UZXB 1RRBA 2DZKA 2V4LA 2ZNVB 1S1QB 3OJ3A 4NNJB 2UYZB 4B95A 1PQSA 1WJNA 4HLEA 1QZEA 2MQJA 2PEAA 3CMMB 1JRUA 2L0FA 3K9OB 4LDTD 2NBUA 4JLCA 2FCNA 2K8HA 1SGHA 3TIXA 2EMTA 3KYDD 3RZFA 4KVGB 1E7VA 1WIAA 4IWPA 5GMVA 3APCA 4G0NB 2N9EB 4MJSB 1GUAB 4FHKA 2KKCA 4GU2A 2NBVB 2O2VB 4ANXA 4CHKA 1AARA 2PE9A 2FIFA 4PYUA 3A4RA 3JSVA 2YLMA 4NJ6A 2IYDB 3UF8A 5TR5A 3ML9A 2IY1B 5C1ZA 3ZNHB 3A1QB 1WR1A 1UBQA 4I6NB 3RUIB 4F7ZA 1H4RA 3B08A 2O2VA 2RSUA 5FR6A 2KK8A 3MJWA 1GC6A 5E6NA 3PGEA 2KWVB 5L95C 4G3XB 3DBHI 2BGFA 1WMHA 4YL8A 1XQQA 1KJTA 4X57B 3JVZX 4GDLA 3NY5A 2LI5A 4RMAA 4W9KA 3QCAA 2FNJB 2BPSA 3RD2A 3IHPC 3X23A 4AJYB 3EC8A 3L17A 2JZZA 3PLVA 4WJPA 1VD2A 5CTRC 4DWFA 5D2MB 4TQ0A 4E74A 3L54A 2CHWA 3ZVVA 1YIWA 2DYOA 5G55A 3ECIA 3JW0X 5AZHA 2K39A 3QA8A 3D32A 4FJVB 4G11A 2J0KA 4FA6A 4XZ4A 2BWES 4KDLB 2D07B 2N4FA 1WX7A 1J8CA 1RLFA 1RAXA 1V5TA 2KJHB 4GDKB 2WX1A 4EKUA 1WI0A 2J0MA 2L00B 1EUVB 2LASA 4WAAA 2D10A 3PREA 5CHVC 4II3B 3VAWA 3RYTA 4HK2A 2N7EA 4MELA 4ANWA 3S2AA 2LRUA 3ZNGC 1WZ0A 4XC2A 3IFWB 4GN1A 2C7MB 1WM3A 3PT2B 1IPGA 4DHJB 5DCNA 1WH3A 2KLCA 2B3AA 1J0GA 3VHTC 1U4AA 3O65B 4AOFA 3PHXB 2LJ5A 5E6PA 4HDOA 3WANA 2YVCA 5AZFA 2I1KA 4MSQB 3ZNID 2M17A 4DDID 5DPSA 3V61A 1E8XA 2K6DB 4M0WB 1NDDA 2ZNVC 3N32A 4ANVA 1P0RA 3ZUNA 4MSMB 3A9KB 2KDEB 3QJZA 4EZLA 3PSEB 3U8ZA 4AP4C 1J19A 2AEHA 2C9WB 4OVUA 2KMAA 3K9PB 3ZRCA 2NVUI 5LXIB 2RR9A 2KZRA 2PJHA 3A9KA 4N9F4 4ZDVA 2ZPNA 4JQWC 2NPTA 3RZWC 4GB9A 2BF8B 2K6QA 1WJUA 2J0JA 3M62B 4NY0A 3ZTDA 2K1FA 4GSWA 2MBHA 1EO6A 2JXXA 2O6VD 4CO7A 5DPRA 2KANA 3QX1A 3PHWB 2R2OA 1G6JA 2C7HA 4MGZE 3U30A 1Q0WB 1OTRB 1WXVA 2GBJA 2WDTB 2N9PC 2DZIA 2PE6B 4K7UA 4NAWB 1WE7A 5J17A 2JZ3B 3PPAA 2KWUB 4NPNA 5HKHA 3KH0A 4KDIC 4KSLC 2L76A 4MGKE 3JYUA 4HCPB 3U7DA 4WWNA 4WQOB 1V5OA 2J7QB 3R66C 2D2QA 3DVNU 3SU8X 4FBJB 2MBBB 4ASWC 3DDCB 1R4NI 2M4NA 5AZGA 2IY0B 4BVUC 2KQSA 3VH3B 2GMIC 4A20A 1YD8U 3IG3A 4FADA 1BT0A 2L3ZA 2LRWA 4IWOA 3DBLI 1SIFA 1HE8A 3L13A 1SE9A 1WZ3A 4IM2A 1KM7A 4AUQC 4F8CB 3WIMA 2A5UA 3NHEB 2DZMA 3EFUA 4FN2A 2KX0A 1WXAA 3WAOA 3QK0A 5L83A 3VTUA 3OJ4B 3TJPA 2KVRA 2DYBA 1K8RB 2LXAA 2MA9B 2MCNB 3WA0A 4BKSD 5EDSA 3KVFB 2KDBA 3UGBB 3N3KB 1L2NA 1S3SG 2C60A 2DAFA 2BWFA 4HPMB 1Y8RC 2NR2A 3N30A 2KN5A 4GXBA 1WYWB 2CKHB 2Z0DB 3HM3A 5JH5C 2MP2A 2ZZPB 4BKSA 3I3TB 2MBQA 3AI5A 4RM9A 3ZNZB 2LGXA 3VVWB 2M8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LLI A;  3WAL A;  3EHV A;  4WJO A;  1UBI A;  1TBE A;  3KW5 B;  3KUZ A;  4P7I A;  4EEW A;  2KC1 A;  1LQB A;  1WMH B;  1YX6 B;  4ICU A;  2JT4 B;  4W9D A;  2DEN B;  2MW5 A;  2V3S A;  1WGH A;  2LVP A;  2ZVN A;  2KX3 A;  1CMX B;  2IO2 B;  3VUX A;  4FJZ A;  2ZVO A;  2V1Y A;  3WAP A;  3DVG Y;  2MWS B;  4F1S A;  1WXS A;  3OLM D;  2Z0E B;  3A9J B;  2O6V A;  4WWO A;  1A5R A;  2JUO A;  2KDI A;  4W9I A;  3ZIM A;  2RGF A;  3VUW A;  2LZ6 A;  1IP9 A;  1NBF C;  2A4Z A;  2CHZ A;  1YQB A;  2KQ7 A;  2NPT B;  2G45 B;  4PS7 A;  4DXA B;  3ZDT A;  3B0A A;  2VRR B;  3ZLZ A;  4MJS A;  3VQI A;  3LJ3 A;  2O6V B;  3APF A;  3R7R A;  1I35 A;  1Z2M A;  5IA7 A;  2JWZ A;  4WJN A;  3W1Y A;  1L7Y A;  5KHQ A;  2ZCB A;  3PV1 A;  3ALB A;  2MRP A;  3V6E B;  2IBI B;  1E5W A;  3P2B A;  1ZW7 A;  2IO3 B;  4DK5 A;  3L08 A;  2FUH B;  1Q1O A;  5DPW A;  5CX3 A;  1E8W A;  2GOW A;  4EOY A;  4G50 A;  3RUL A;  4BFR A;  2GBN A;  1LFD A;  2AYO B;  2D11 A;  3VDZ A;  4W9C A;  3H7S A;  1V2Y A;  2Z59 B;  2AWT A;  2KFK B;  2KWC A;  1EF1 A;  3CSF A;  3H7P A;  3VFK A;  1YX5 B;  4KV2 A;  2IZV B;  4LDT B;  2LD9 A;  2M1M A;  3R3M A;  3EEC A;  5C23 A;  4EZK A;  1P1A A;  4GIV A;  4MGI E;  4TV3 A;  5IAA C;  5BO4 B;  1NI2 A;  4KSK C;  2K25 A;  3CF6 E;  3TCA A;  4ZRI A;  5LXH A;  3QQ8 B;  3QWZ B;  2DYM A;  4IM3 A;  3W1S A;  4IG7 B;  4DDG D;  2IO0 B;  2KTR B;  4A3O A;  2JRH A;  1WX8 A;  3V62 A;  2WX0 A;  2HTH A;  2KJ6 A;  2GBR A;  3Q3J A;  1GNU A;  2BKF A;  2QHO A;  2KFK A;  2ZEQ A;  5KHO A;  4HWI B;  2KMC A;  1X1M A;  2KLG A;  4EFO A;  4BOZ B;  2RD0 A;  3H9D A;  2MBO A;  2DZJ A;  4HJK A;  2LUE A;  2KD0 A;  3HM6 X;  3DPD A;  1IYF A;  3DBS A;  2BYF A;  3UQB A;  4K1R B;  4EUT A;  5E6O A;  4HCN B;  4WJQ A;  4MDK E;  4W9F A;  3TBL D;  3VUY A;  3KYC D;  4TQ1 A;  4IM0 A;  2JRI B;  1WR6 E;  1D3Z A;  1H8C A;  3AU4 A;  2JPH A;  5J18 A;  2D3G A;  2LXC A;  3L0W B;  3IBE A;  3M3J A;  2XEW A;  3HHM A;  3LDZ E;  5JZE B;  3A9J A;  4W9G A;  1WX9 A;  3A4S C;  4I6P A;  4W9E A;  1P3Q U;  4AJW A;  4K81 A;  3PRP B;  2ZPY A;  5JHA A;  2HD5 B;  4GOC A;  5CHF A;  1OQY A;  4J6I A;  4BKG A;  2G4S A;  3A33 B;  3DVN V;  4ZRK A;  2NS5 A;  2REX A;  2MSE D;  2JVC A;  2JY6 A;  3IVF A;  4W9L A;  4K7S A;  1GJZ A;  2G3Q B;  2KTR A;  4KZ0 A;  1E7U A;  2L0T A;  3AU5 A;  1KLV A;  3VXW A;  4K7W A;  4ZRJ A;  3R7Q A;  3B1L X;  3A1Q A;  4MEM A;  5D94 A;  3QAQ A;  3HK0 A;  1UD7 A;  1ZGU B;  4JGH B;  4ZYN A;  4EZJ A;  3M95 A;  2KOX A;  2MX2 A;  1M94 A;  1C1Y B;  2DAJ A;  5G2N A;  4ICV A;  2MBE A;  3PZD A;  3TMP B;  1Z5S B;  1T0Y A;  1WGD A;  2CHX A;  2K8C A;  2OJR A;  3KUD B;  2KJR A;  3QHT A;  3SD5 A;  4E3C A;  5AEK B;  4FUL A;  2KDF B;  3DCG A;  4W9H A;  3H6N A;  2L8J A;  4IUM B;  4BOS C;  4MM3 A;  2L7R A;  4ANU A;  1V9J A;  2FCS A;  3NOB A;  3H1U A;  4E71 A;  2W9N A;  3NZS A;  2OOB B;  2N1V A;  5D6J B;  2N9X A;  2LGD A;  3UIN B;  3ZO5 B;  1FXT B;  4MGY E;  1ZKH A;  4MH0 E;  4M8N A;  2L05 A;  2MLB A;  4KIK B;  1Q5W B;  2ASQ A;  4DHJ D;  2LVQ A;  1TZ1 A;  2KHW B;  4IC7 B;  1WE6 A;  1LM8 B;  4NQL B;  2DHZ A;  4CYE A;  3ZRF A;  2HE7 A;  4GGQ A;  4TKN A;  1V80 A;  1E8Z A;  2G4D B;  1UH6 A;  1WGY A;  4IWQ A;  4W9J A;  3DQV A;  3OAW A;  3ZW3 A;  2NCN A;  4BKT A;  2ZJD A;  4PYZ A;  1WY8 A;  3DOW A;  4KZC A;  2IO1 B;  2BKR B;  2EMS A;  2GBM A;  2XK5 B;  2FAZ A;  1RFA A;  2XBB C;  2M0X A;  4FHJ A;  3JSV B;  4URK A;  3AUL A;  3CST A;  3VH4 B;  1KOT A;  3UIO B;  1I42 A;  1C3T A;  2HJ8 A;  2JF5 A;  3KUC B;  1WGG A;  4A3P A;  4B9K A;  4BBN C;  4NJ7 A;  4B6W A;  3QAR A;  3GOE A;  3ENE A;  2CS4 A;  3SHQ A;  2DX5 B;  4HPL B;  1LXD A;  4WWP A;  3DVG X;  1TTN A;  3BIN A;  4JL9 A;  3RT3 B;  1V6E A;  1ISN A;  1V49 A;  4LJO B;  3BY4 B;  2C7N B;  3TL5 A;  1P98 A;  4DBG A;  1WF9 A;  3UIP B;  4HXD A;  2CU1 A;  2UWQ A;  4GMV A;  5D7G A;  1R4M I;  3H7P B;  1VCB A;  2AL6 A;  2FID A;  2KO3 A;  4IW0 A;  4XX5 A;  1E90 A;  2KNB A;  3DBR I;  3MTN B;  2KTF A;  1XT9 B;  4HDQ A;  1TGZ B;  4NQK E;  5DPT A;  2KXJ A;  3PS6 A;  2AL3 A;  4BBN F;  1F9J A;  3V60 A;  1V86 A;  2ZCC A;  2LVO A;  2CR5 A;  3T9L A;  2N1W A;  3APD A;  1YJ1 A;  1OEY J;  3ML8 A;  4LJP B;  1WM2 A;  4HVB A;  1MG8 A;  2KFJ A;  3NZU A;  3PLU A;  3QIJ A;  1XD3 B;  3WAM A;  3M63 B;  2PPH A;  3PVL A;  1WFY A;  3VTW A;  3ZTC A;  3MHS D;  2Y5B B;  4GDL B;  4NAW A;  3UQA A;  3ZDM C;  2BYE A;  3RCZ A;  1WXM A;  4KIK A;  2LGY A;  2EKE C;  2C5L C;  1UEL A;  3GZN I;  3Q3F A;  2R2Q A;  3AXC A;  2N7D A;  3PRM B;  2WWZ A;  4FJY A;  1E8Y A;  1GG3 A;  5CHW A;  4DHZ B;  3T8M A;  5JHB A;  1WJ4 A;  2KC2 A;  2MP2 B;  4DHZ E;  2WYQ A;  3C0R B;  4TUU A;  2NBW B;  1OGW A;  1WJ6 A;  1V81 A;  2FCQ A;  3ZKJ C;  4M8M A;  1P9D U;  4RM8 A;  3X0W A;  4II2 B;  5J2R A;  3L10 B;  4I6L B;  4GDK A;  1UGM A;  2I1J A;  3QC8 B;  3W1S C;  2XK5 A;  2BYV E;  3NS8 A;  4OVV A;  3HIZ A;  4PS3 A;  1GC7 A;  3L16 A;  1OEY A;  2FCM A;  3PRZ A;  4FLH A;  1WGR A;  1EF5 A;  3VTV A;  3V6C B;  2RPQ A;  4JIO U;  3ONS A;  3PTF C;  2K8B A;  4LCD E;  1WRD B;  4PS8 A;  3SDL C;  2GBK A;  2LWP A;  4AWJ A;  1UZX B;  1RRB A;  2DZK A;  2V4L A;  2ZNV B;  1S1Q B;  3OJ3 A;  4NNJ B;  2UYZ B;  4B95 A;  1PQS A;  1WJN A;  4HLE A;  1QZE A;  2MQJ A;  2PEA A;  3CMM B;  1JRU A;  2L0F A;  3K9O B;  4LDT D;  2NBU A;  4JLC A;  2FCN A;  2K8H A;  1SGH A;  3TIX A;  2EMT A;  3KYD D;  3RZF A;  4KVG B;  1E7V A;  1WIA A;  4IWP A;  5GMV A;  3APC A;  4G0N B;  2N9E B;  4MJS B;  1GUA B;  4FHK A;  2KKC A;  4GU2 A;  2NBV B;  2O2V B;  4ANX A;  4CHK A;  1AAR A;  2PE9 A;  2FIF A;  4PYU A;  3A4R A;  3JSV A;  2YLM A;  4NJ6 A;  2IYD B;  3UF8 A;  5TR5 A;  3ML9 A;  2IY1 B;  5C1Z A;  3ZNH B;  3A1Q B;  1WR1 A;  1UBQ A;  4I6N B;  3RUI B;  4F7Z A;  1H4R A;  3B08 A;  2O2V A;  2RSU A;  5FR6 A;  2KK8 A;  3MJW A;  1GC6 A;  5E6N A;  3PGE A;  2KWV B;  5L95 C;  4G3X B;  3DBH I;  2BGF A;  1WMH A;  4YL8 A;  1XQQ A;  1KJT A;  4X57 B;  3JVZ X;  4GDL A;  3NY5 A;  2LI5 A;  4RMA A;  4W9K A;  3QCA A;  2FNJ B;  2BPS A;  3RD2 A;  3IHP C;  3X23 A;  4AJY B;  3EC8 A;  3L17 A;  2JZZ A;  3PLV A;  4WJP A;  1VD2 A;  5CTR C;  4DWF A;  5D2M B;  4TQ0 A;  4E74 A;  3L54 A;  2CHW A;  3ZVV A;  1YIW A;  2DYO A;  5G55 A;  3ECI A;  3JW0 X;  5AZH A;  2K39 A;  3QA8 A;  3D32 A;  4FJV B;  4G11 A;  2J0K A;  4FA6 A;  4XZ4 A;  2BWE S;  4KDL B;  2D07 B;  2N4F A;  1WX7 A;  1J8C A;  1RLF A;  1RAX A;  1V5T A;  2KJH B;  4GDK B;  2WX1 A;  4EKU A;  1WI0 A;  2J0M A;  2L00 B;  1EUV B;  2LAS A;  4WAA A;  2D10 A;  3PRE A;  5CHV C;  4II3 B;  3VAW A;  3RYT A;  4HK2 A;  2N7E A;  4MEL A;  4ANW A;  3S2A A;  2LRU A;  3ZNG C;  1WZ0 A;  4XC2 A;  3IFW B;  4GN1 A;  2C7M B;  1WM3 A;  3PT2 B;  1IPG A;  4DHJ B;  5DCN A;  1WH3 A;  2KLC A;  2B3A A;  1J0G A;  3VHT C;  1U4A A;  3O65 B;  4AOF A;  3PHX B;  2LJ5 A;  5E6P A;  4HDO A;  3WAN A;  2YVC A;  5AZF A;  2I1K A;  4MSQ B;  3ZNI D;  2M17 A;  4DDI D;  5DPS A;  3V61 A;  1E8X A;  2K6D B;  4M0W B;  1NDD A;  2ZNV C;  3N32 A;  4ANV A;  1P0R A;  3ZUN A;  4MSM B;  3A9K B;  2KDE B;  3QJZ A;  4EZL A;  3PSE B;  3U8Z A;  4AP4 C;  1J19 A;  2AEH A;  2C9W B;  4OVU A;  2KMA A;  3K9P B;  3ZRC A;  2NVU I;  5LXI B;  2RR9 A;  2KZR A;  2PJH A;  3A9K A;  4N9F 4;  4ZDV A;  2ZPN A;  4JQW C;  2NPT A;  3RZW C;  4GB9 A;  2BF8 B;  2K6Q A;  1WJU A;  2J0J A;  3M62 B;  4NY0 A;  3ZTD A;  2K1F A;  4GSW A;  2MBH A;  1EO6 A;  2JXX A;  2O6V D;  4CO7 A;  5DPR A;  2KAN A;  3QX1 A;  3PHW B;  2R2O A;  1G6J A;  2C7H A;  4MGZ E;  3U30 A;  1Q0W B;  1OTR B;  1WXV A;  2GBJ A;  2WDT B;  2N9P C;  2DZI A;  2PE6 B;  4K7U A;  4NAW B;  1WE7 A;  5J17 A;  2JZ3 B;  3PPA A;  2KWU B;  4NPN A;  5HKH A;  3KH0 A;  4KDI C;  4KSL C;  2L76 A;  4MGK E;  3JYU A;  4HCP B;  3U7D A;  4WWN A;  4WQO B;  1V5O A;  2J7Q B;  3R66 C;  2D2Q A;  3DVN U;  3SU8 X;  4FBJ B;  2MBB B;  4ASW C;  3DDC B;  1R4N I;  2M4N A;  5AZG A;  2IY0 B;  4BVU C;  2KQS A;  3VH3 B;  2GMI C;  4A20 A;  1YD8 U;  3IG3 A;  4FAD A;  1BT0 A;  2L3Z A;  2LRW A;  4IWO A;  3DBL I;  1SIF A;  1HE8 A;  3L13 A;  1SE9 A;  1WZ3 A;  4IM2 A;  1KM7 A;  4AUQ C;  4F8C B;  3WIM A;  2A5U A;  3NHE B;  2DZM A;  3EFU A;  4FN2 A;  2KX0 A;  1WXA A;  3WAO A;  3QK0 A;  5L83 A;  3VTU A;  3OJ4 B;  3TJP A;  2KVR A;  2DYB A;  1K8R B;  2LXA A;  2MA9 B;  2MCN B;  3WA0 A;  4BKS D;  5EDS A;  3KVF B;  2KDB A;  3UGB B;  3N3K B;  1L2N A;  1S3S G;  2C60 A;  2DAF A;  2BWF A;  4HPM B;  1Y8R C;  2NR2 A;  3N30 A;  2KN5 A;  4GXB A;  1WYW B;  2CKH B;  2Z0D B;  3HM3 A;  5JH5 C;  2MP2 A;  2ZZP B;  4BKS A;  3I3T B;  2MBQ A;  3AI5 A;  4RM9 A;  3ZNZ B;  2LGX A;  3VVW B;  2M8S A; 
#chains in the Genus database with same CATH topology
 1SSN A;  1I4G A;  1TBE A;  4P7I A;  1YX6 B;  1XF5 L;  3ZJU A;  2BW2 A;  2DEN B;  2BVC A;  1WGH A;  2ZVN A;  2K5P A;  3FC4 A;  4P1B C;  1WXS A;  1PUT A;  2O6V A;  1A5R A;  1YMH E;  2NPT B;  1UF0 A;  2OED A;  1VR9 A;  3ZDT A;  4MJS A;  2IGH A;  3AE9 B;  3APF A;  1I4P A;  1GAQ B;  1I35 A;  3W1Y A;  2ZCB A;  2J42 A;  2FUH B;  5DPW A;  2GOW A;  3P63 A;  4W9C A;  3FIL A;  2LHD A;  2Z59 B;  2KWC A;  2K9X A;  1RM6 C;  3H7P A;  2K22 A;  5C2T B;  3Q8A A;  1UUP A;  3VR8 B;  5HFY A;  3SR6 A;  5BO4 B;  1NI2 A;  2WXN A;  4JX1 C;  3TCA A;  1HTQ A;  1XEE A;  4IM3 A;  4IG7 B;  1Y56 A;  1TS5 A;  2KTR B;  4TMA B;  5C3J B;  2WX0 A;  3Q8F A;  2Q5W D;  2R61 A;  3Q3J A;  3GE8 C;  1FXI A;  2ZW0 A;  1PGA A;  4LK0 M;  4A8X C;  1ZOY B;  3H9D A;  2DZJ A;  3HM6 X;  2BYF A;  2N0S B;  5E6O A;  4WJQ A;  1RYJ A;  3TBL D;  3UI3 A;  4IM0 A;  3IAS 1;  2JRI B;  5E6J A;  3NS1 A;  1JWU D;  3AU4 A;  2QCZ A;  5J18 A;  3RFZ B;  3IBE A;  3M3J A;  2PLP A;  3N9Y C;  4W9G A;  1WX9 A;  1ZP0 B;  4AJW A;  4K81 A;  2XNA C;  5CHF A;  4J6I A;  3A33 B;  4ZRK A;  2AQ3 B;  2NS5 A;  2JY6 A;  1GJZ A;  4K7S A;  2G3Q B;  3BWU D;  2HJ1 A;  4XDC A;  4MEM A;  3HK0 A;  3BVZ A;  4WH4 A;  3ZGZ A;  2FUG 1;  1T0Y A;  2K8C A;  2CHX A;  2KJR A;  4E3C A;  4FUL A;  4RCO A;  3DHI C;  1PYW D;  2KDF B;  4P1C C;  3BYT B;  4UDU C;  3BII D;  4W9H A;  3H6N A;  4BOS C;  2KAJ A;  4ANU A;  4LNN A;  3NOB A;  3RNB C;  3GE3 C;  2WHI A;  2OOB B;  4JWU C;  3ZO5 B;  1DGJ A;  1Q5W B;  1KFY B;  2WXF A;  4DHJ D;  1TZ1 A;  1E10 A;  4NQL B;  1TY0 A;  4TKN A;  1V80 A;  1HQR D;  3I63 C;  4C7Z A;  4W9J A;  4BKT A;  2BS3 B;  3OAW A;  3AMZ A;  2BKR B;  4URK A;  1M4V A;  5EE3 A;  3AUL A;  1ENF A;  2L83 A;  1C4A A;  3UIO B;  1I4H A;  3KUC B;  4A3P A;  2D3B A;  3WCQ A;  4B6W A;  3B2G A;  2CS4 A;  2D3C A;  4HPL B;  1TTN A;  3BIN A;  3BY4 B;  1QOB A;  1WF9 A;  2LUM A;  4HXD A;  4GMV A;  2AL6 A;  2KO3 A;  1XT9 B;  1SBB B;  5DPT A;  1CZP A;  3E9S A;  1KTK A;  3P42 A;  2LVO A;  3NUH B;  1ACC A;  1YJ1 A;  3DHH C;  1MG8 A;  1XD3 B;  2BS4 B;  3M63 B;  3Q3O C;  3MHS D;  4D2K A;  3RCZ A;  1WXM A;  3LYY A;  3GZN I;  3Q3F A;  4LNF A;  5EE1 A;  2R2Q A;  2N7D A;  1TT5 B;  2MP2 B;  2KC2 A;  2WYQ A;  3C0R B;  1HEZ E;  1WJ6 A;  2INC C;  3X0W A;  4II2 B;  3L10 B;  1NYR A;  2BYV E;  1J7B A;  2PKO A;  3L16 A;  1OEY A;  3PRZ A;  1FNU A;  1WGR A;  4CQN A;  1FD6 A;  3NG0 A;  3ONS A;  3PTF C;  1WRD B;  1D3Z A;  3OJ3 A;  2WXM A;  3URY A;  3KYD D;  2JX5 A;  2N9E B;  1UGJ A;  2O2V B;  4ANX A;  2WP9 B;  4CHK A;  4RGO S;  4ARI A;  1JRO A;  2WNM A;  3ML9 A;  3A1Q B;  1FMA D;  5H8Y E;  1SIJ A;  1GC6 A;  5E6N A;  5L95 C;  3N20 C;  3DBH I;  1MG4 A;  1MPE A;  4Q2J A;  2BS2 B;  3ABV B;  2BBC A;  1AWD A;  3NVY A;  4RMA A;  4W9K A;  5HHD G;  3X23 A;  2MJE A;  4DWF A;  5D3D A;  1VD2 A;  3W9C B;  1N5W A;  1JCK B;  4IKG A;  2WGS A;  3ZVV A;  1ZE3 D;  5AZH A;  3RNE C;  4G11 A;  4FA6 A;  4KDL B;  4AS1 A;  1ZXI A;  2KJH B;  2KYW A;  4YTN B;  4KGT A;  2D10 A;  1L4Z B;  2L52 A;  4NJC A;  2K3U A;  4HK2 A;  2M56 B;  2N7E A;  4KKI A;  3S2A A;  3ZNG C;  2WXJ A;  4GN1 A;  4NAM A;  3PT2 B;  1XLN A;  4DHJ B;  1WH3 A;  3EA6 A;  1U4A A;  2MH7 A;  2H88 B;  3P4R B;  3Q3M C;  3WAN A;  2YVC A;  4DDI D;  3V61 A;  1FNW A;  4RGM A;  1UNS A;  2WQY B;  1FNV A;  1FRR A;  2GI9 A;  4EZL A;  1J7A A;  2WXL A;  3K9P B;  4HEA 1;  2RR9 A;  2ZPN A;  2INP E;  3E56 A;  2K1F A;  3ZYY X;  1EO6 A;  3KLS X;  3H8H A;  2OJW A;  1QIL A;  2TSS A;  3AB5 A;  1FCC C;  4K3B A;  5IO9 A;  1D4B A;  2W3S A;  2GLS A;  2JWU A;  5J17 A;  2JZ3 B;  3PPA A;  4NPN A;  3VR9 B;  3KH0 A;  2L76 A;  1R7S A;  2LJI A;  3JYU A;  2DBY A;  3R66 C;  4MM3 B;  2VH1 A;  4FBJ B;  2MBB B;  1IUE A;  3DDC B;  4JWS C;  2GMI C;  1E7P B;  1YD8 U;  2E6X A;  3V05 A;  1BT0 A;  1R4M B;  2L3Z A;  2J53 A;  1KM7 A;  4HRS A;  1T3Q A;  3OWE B;  5FK9 C;  3TJP A;  2DYB A;  2MCN B;  2UU7 A;  5EDS A;  5LNK 1;  4WWM A;  2BWF A;  4HPM B;  1Y8R C;  4C80 A;  3V3X A;  1WYW B;  4MT5 A;  2KQ4 X;  3HM3 A;  4US8 A;  4OW0 A;  1HXY D;  3ZNZ B;  2M8S A;  1JWS D;  3RNC C;  4WJO A;  1UBI A;  4YSX B;  3C19 A;  1C77 A;  2SEB D;  3KUZ A;  2PTL A;  3I5J C;  4EEW A;  1LQB A;  2JT4 B;  4W9D A;  4M02 A;  2V3S A;  3HVZ A;  3VUX A;  4FJZ A;  4F1S A;  3OLM D;  2Z0E B;  3A9J B;  2JUO A;  2RGF A;  2LZ6 A;  1IP9 A;  1MFW A;  2A4Z A;  2RDH A;  2KQ7 A;  4XYC A;  3B0A A;  3ZLZ A;  3LJ3 A;  3R7R A;  2JWZ A;  3P4P B;  4PT5 A;  1EU3 A;  3AE5 B;  3U52 E;  3PV1 A;  3V6E B;  3ALB A;  2MRP A;  1E5W A;  1ZW7 A;  3L08 A;  1OQQ A;  3I9V 1;  2KT7 A;  4G50 A;  4BFR A;  2AYO B;  2KFK B;  4L23 A;  3CSF A;  1KRH A;  3VFK A;  2IZV B;  3J9C A;  1MVK A;  2LD9 A;  3EEC A;  5C23 A;  4GIV A;  2GRI A;  4YTM B;  1B9R A;  2K25 A;  2BT6 A;  3QQ8 B;  3QWZ B;  3W1S A;  2QDF A;  2JRH A;  3V62 A;  4C7Y A;  2HTH A;  2KJ6 A;  3LB8 C;  2QHO A;  2ZEQ A;  2IPK D;  2KLG A;  4EFO A;  2JYT A;  2WXO A;  3KQ4 A;  4HJK A;  2KD0 A;  1IYF A;  3DPD A;  1AN8 A;  1I4X A;  4K1R B;  4WIP A;  2WU5 B;  3VUY A;  4TQ1 A;  1IBX B;  1D5X C;  3GS2 A;  2J4X A;  4ZHP A;  2B76 B;  1H8C A;  2JPH A;  4ITK A;  1K53 A;  1FEH A;  4ZRQ A;  2WXR A;  2XEW A;  3LDZ E;  4BAX A;  1A70 A;  3A9J A;  1PDX A;  5JZE B;  1P7E A;  3R8B A;  4I6P A;  4W9E A;  4YT0 B;  2ZPY A;  1NYQ A;  5JHA A;  4WQM A;  2N9K A;  4KKJ A;  4BKG A;  4QAY A;  2JVC A;  2AX5 A;  2KTR A;  1XLQ A;  3VXW A;  3R7Q A;  4EZJ A;  2MX2 A;  1M94 A;  1YNT E;  2DAJ A;  4ICV A;  3TMP B;  2OJR A;  3KUD B;  5AEK B;  3ZJT A;  4HPP A;  3DCG A;  1ZDX A;  1V97 A;  4M01 A;  3ZJV A;  2L7R A;  1JML A;  1V9J A;  2WXG A;  3VRB B;  4E71 A;  1KLG D;  1L0X B;  1FXT B;  4KGR A;  2L05 A;  2ON8 A;  3AE4 B;  2LVQ A;  3ZRF A;  2VZK B;  3NVV A;  2NCN A;  4PYZ A;  3AEC B;  1WY8 A;  3NVZ A;  3DOW A;  2IO1 B;  2EMS A;  1RFA A;  1STE A;  4WAF A;  2INN E;  1C3T A;  2HJ8 A;  1WGG A;  1IBX A;  2QC8 A;  1ET9 A;  1LXD A;  1WRI A;  4LJO B;  2MHJ A;  3RN9 C;  5FR3 A;  1P98 A;  2V3N A;  2UWQ A;  4XX5 A;  3BYY B;  4RGT A;  4HDQ A;  1TGZ B;  2ACZ B;  2DNF A;  2KXJ A;  1CQV A;  2IJ0 A;  1QKZ A;  3V60 A;  1N60 A;  1V86 A;  2ZCC A;  4ARC A;  2KFJ A;  2KWD A;  2PPH A;  1WFY A;  1SE2 A;  3MC8 A;  4GDL B;  4NAW A;  3B2F A;  4LLG M;  4GLS C;  1YQ3 B;  2VH2 A;  1C79 A;  2HTM E;  4FJY A;  1E8Y A;  1GG3 A;  2N9L A;  5JHB A;  1WJ4 A;  1SB3 C;  3AEB B;  4M8M A;  1P9D U;  3TSS A;  4RM8 A;  5J2R A;  2KMM A;  4GDK A;  1UGM A;  1ROE A;  4OVV A;  1N62 A;  2FCM A;  3V6C B;  2RPQ A;  4LCD E;  4PS8 A;  3SDL C;  1F77 A;  2ZNV B;  1S1Q B;  2UYZ B;  4HLE A;  3CMM B;  4LDT D;  2NBU A;  4JLC A;  1DOY A;  2FCN A;  2K8H A;  3I57 A;  2EMT A;  1WIA A;  4IWP A;  2Y5P A;  3BK1 A;  3B9J A;  3R2I A;  4FHK A;  1AYF A;  2KKC A;  4GU2 A;  3NVW A;  2JXT A;  2FIF A;  3UF8 A;  3RNA C;  2IYD B;  5TR5 A;  1UBQ A;  2HDE A;  1H4R A;  2KDM A;  2WDR B;  3PGE A;  1TKG A;  2WXP A;  1YN4 A;  4JPS A;  4X57 B;  4GDL A;  3NY5 A;  2LI5 A;  3QCA A;  2G9H D;  3IHP C;  4AJY B;  1XLO A;  3L17 A;  3PLV A;  4TQ0 A;  5CTR C;  1TY2 A;  4E74 A;  3L54 A;  2E3T A;  4MAC A;  2K39 A;  3QA8 A;  4FJV B;  1JAL A;  3BZD B;  4YSY B;  1VLB A;  4GDK B;  2J0M A;  4C4V B;  4RNA A;  3NRZ A;  1N5X A;  2SAK A;  4ANW A;  4C00 A;  1WZ0 A;  3Q69 A;  2C7M B;  1WM3 A;  1JRP A;  1XO3 A;  2WXQ A;  3VHT C;  2D3A A;  2LJ5 A;  4HDO A;  3AEE B;  5AZF A;  4MSQ B;  1UWM A;  1E8X A;  2CJO A;  4M0W B;  3TUO A;  1P0R A;  1SXT A;  2BB6 A;  3ZUN A;  3RPF C;  2RDG A;  3AEF B;  3A9K B;  5G5G A;  4AP4 C;  4HKZ E;  3AE8 B;  1YJI A;  3ZRC A;  5LXI B;  2JYE A;  3DWM A;  1VZ6 A;  1SE3 A;  2K6Q A;  4NY0 A;  4GSW A;  2MBH A;  2O6V D;  2JXX A;  2R2O A;  5AUK A;  4A9A A;  1Q0W B;  1OTR B;  2GBJ A;  2WDT B;  4K7U A;  2BYT A;  4KX6 B;  2EEL A;  5HKH A;  3AE2 B;  4KSL C;  3IT6 B;  1HTO A;  3U7D A;  2LGI A;  3MFG A;  3DVN U;  3SU8 X;  4DQO C;  4ASW C;  1R4N I;  3VH3 B;  1GB4 A;  4LTU A;  1HA5 A;  3IG3 A;  4FAD A;  1K51 A;  2LRW A;  1KF6 B;  2QIL A;  1SIF A;  3NHE B;  3WAO A;  3QK0 A;  2IND C;  3OJ4 B;  2LXA A;  2KVZ A;  2MA9 B;  3T3O A;  1JQ4 A;  3KVF B;  1S3S G;  2DAF A;  4ACF A;  2NR2 A;  3N30 A;  2KN5 A;  5BYR A;  2XN9 C;  4OZB A;  2RMM A;  2Z0D B;  2MP2 A;  2ZZP B;  3I3T B;  4RM9 A;  2DLB A;  3VVW B;  1L6V A;  1F1H A;  5LLI A;  1MHH E;  1T0S C;  2K0P A;  4RF0 A;  1J7C A;  1WMH B;  4ICU A;  2MW5 A;  2LVP A;  2JSV X;  2IO2 B;  2MWS B;  2KDI A;  4W9I A;  3ZIM A;  1YQB A;  2G45 B;  1UWX A;  1SJE D;  1WWT A;  4N6E B;  1E9M A;  2O6V B;  1RWS A;  1GOZ A;  5IA7 A;  2MEK A;  2CJN A;  1YOV B;  1NEN B;  2IO3 B;  1D6E C;  1D5Z C;  1Q1O A;  1WSP A;  5CX3 A;  2IDY A;  4EOY A;  3RUL A;  1FCL A;  2GBN A;  3CWI A;  2D11 A;  3H7S A;  1T0R C;  2AWT A;  2WXI A;  1EF1 A;  1YX5 B;  4KV2 A;  5HI1 A;  2QEJ C;  2M1M A;  3R3M A;  4EZK A;  1P1A A;  4MGI E;  5IAA C;  4B0E A;  4KSK C;  2EKI A;  5LXH A;  3GP7 A;  4XWT A;  1WX8 A;  1MJD A;  3EUB 2;  2GBR A;  2BKF A;  2KFK A;  4B0M A;  4HWI B;  1LO5 D;  2PVO D;  5BYQ A;  2LUE A;  1ZDV A;  1MI0 A;  3UQB A;  4HCN B;  4MDK E;  4W9F A;  3KYC D;  1TS4 A;  2D3G A;  2LXC A;  3DWG C;  2JU6 X;  2WDV B;  3EGR A;  3HHM A;  3FAH A;  4R3D A;  3A4S C;  3NZ3 A;  4HJG E;  3IT4 B;  2HD5 B;  1KLU D;  4GOC A;  1OQY A;  1JWM D;  1L0Y B;  3HUI A;  1N61 A;  3IVF A;  1C4C A;  4XGA B;  4KZ0 A;  3AU5 A;  2L0T A;  1KLV A;  3KWV A;  4ZRJ A;  3B1L X;  3A1Q A;  5D94 A;  3QAQ A;  4JGH B;  1UD7 A;  1ZGU B;  4YTP B;  4ZYN A;  2ZW1 A;  3M95 A;  2WLB A;  2QMT A;  1BML C;  5G2N A;  1WGD A;  1N63 A;  3CIR B;  4ZOH C;  4IUM B;  4MM3 A;  3H1U A;  1F0Z A;  3NZS A;  2N1V A;  5D6J B;  2LGD A;  3UIN B;  4MGY E;  1ZKH A;  4MH0 E;  4S0R A;  4M8N A;  3VRA B;  2ASQ A;  4IC7 B;  1WE6 A;  1LM8 B;  2DHZ A;  3DBR B;  2G4D B;  1UH6 A;  1WGY A;  2W54 A;  3C8Y A;  3P4S B;  4KZC A;  2GBM A;  1ZPS A;  2XBB C;  4RFB A;  4DXG A;  3JSV B;  3CST A;  4XDD A;  1I42 A;  2WXK A;  1XCT L;  4PK1 A;  4B9K A;  3OG5 A;  4BBN C;  2IGG A;  3GOE A;  3ENE A;  1V1P A;  2DX5 B;  4WWP A;  1L5P A;  1ISN A;  1V49 A;  1VZ7 A;  1QT9 A;  2LGS A;  3UIP B;  5D7G A;  1SF0 A;  3H7P B;  3AEA B;  2FID A;  2WXH A;  3DBR I;  4M00 A;  3MTN B;  2KTF A;  4XE0 A;  1GPX A;  4BBN F;  2BB5 A;  2CR5 A;  1L6U A;  4ZYS A;  3ML8 A;  2LHE A;  3Q3N C;  4HKQ A;  3QIJ A;  3WAM A;  1OQR A;  3PVL A;  3ZXV A;  2Y5B B;  1YQ4 B;  3ZDM C;  4A55 A;  2BYE A;  5GXG B;  2LGY A;  2EKE C;  1GB1 A;  3L4P A;  1BXT A;  4DHZ B;  5IN7 A;  3N1Y C;  1NVI D;  1OGW A;  2FCQ A;  1V81 A;  2NBW B;  3Q14 C;  4N59 A;  3QC8 B;  1VRA B;  4P16 A;  3NS8 A;  2MJ3 A;  4PS3 A;  3VTV A;  1EF5 A;  4BZA A;  2GBK A;  1SJH D;  2LWP A;  4NNJ B;  1RRB A;  2V4L A;  2Y3A A;  1WJN A;  5BMG A;  1JRU A;  1V1P B;  2L0F A;  1SGH A;  2Y5C A;  4H2A A;  2KN4 A;  1R4N B;  3RZF A;  4KVG B;  1E7V A;  3MC9 A;  2QSD A;  5GMV A;  3P4Q B;  4MJS B;  2NMQ A;  1AAR A;  1K50 A;  4PYU A;  3JSV A;  2YLM A;  4NJ6 A;  1V8C A;  5C1Z A;  1JWB D;  2N7J A;  1ZXH A;  3TEW A;  1WR1 A;  4I6N B;  3RUI B;  2O2V A;  1N6Z A;  2RSU A;  5FR6 A;  1I4R A;  2KK8 A;  1QLB B;  3BVG A;  2KWV B;  2BGF A;  1DYQ A;  3FIL B;  4YL8 A;  1HZ5 A;  1XQQ A;  1KJT A;  1SE4 A;  3PO0 A;  1F52 A;  5D3I B;  2BPS A;  3EC8 A;  2JZZ A;  2Z8L A;  3DHG C;  1PGX A;  4O1N A;  2AQ2 B;  4HRO A;  5G55 A;  3D32 A;  2J0K A;  2BWE S;  2D07 B;  1VZ8 A;  2N4F A;  1WX7 A;  1J8C A;  1XXG A;  2WX1 A;  1C4P A;  4EKU A;  1EUV B;  3VAW A;  4REZ A;  4OZA A;  4MH8 A;  3IFW B;  2WS3 B;  1TKY A;  1FO4 A;  3GB1 A;  2PVG C;  2B3A A;  1J0G A;  3O65 B;  3PHX B;  5E6P A;  4RF1 A;  2I1K A;  3GZN B;  1PFD A;  2ZNV C;  3N32 A;  1Q10 A;  3QJZ A;  1FM0 D;  3PSE B;  1XCQ L;  1BUI C;  1J19 A;  3R2T A;  4OVU A;  3IXS A;  2KMA A;  2PJH A;  4N9F 4;  4ZDV A;  4JQW C;  3RZW C;  4GB9 A;  1DOX A;  2BF8 B;  3M62 B;  3ZTD A;  4CO7 A;  5DPR A;  3PHW B;  3EFC A;  1E6E B;  4LNO A;  1WXV A;  4US9 A;  1WE7 A;  1QOA A;  1RFK A;  4KDI C;  4HCP B;  1WGK A;  4WQO B;  2J7Q B;  2D2Q A;  1LGR A;  3BVM A;  2VZK D;  2CU3 A;  2M4N A;  5AZG A;  2IY0 B;  2KQS A;  4L2Y A;  2V4I B;  3AN1 A;  3Q2A C;  1FFU A;  3AM9 A;  1HE8 A;  1I7H A;  3DBL B;  3L13 A;  4IM2 A;  2IGD A;  4AUQ C;  4F8C B;  3WIM A;  2A5U A;  3EFU A;  1WXA A;  1EWY C;  4A6Q A;  2I38 A;  2G1E A;  5AUI A;  3VTU A;  2KVR A;  1K8R B;  3WA0 A;  4BKS D;  3N3K B;  5HG2 A;  2C60 A;  5EE9 A;  4GXB A;  2ONQ A;  4BKS A;  3AI5 A;  2LGX A;  3WAL A;  5TSS A;  3EHV A;  3KW5 B;  2KC1 A;  1CK1 A;  2KX3 A;  1CMX B;  2YEP F;  3MP9 A;  3WAP A;  2ZVO A;  2V1Y A;  3DVG Y;  3AED B;  3MHZ A;  5IP4 D;  1NI3 A;  4WWO A;  1PGB A;  1YN3 A;  5EE0 A;  3VUW A;  1NBF C;  2CHZ A;  4PS7 A;  4DXA B;  2NTT A;  3MJ5 A;  2VRR B;  3VQI A;  1FRD A;  2M19 A;  1Z2M A;  2H89 B;  4WJN A;  1E0Z A;  1L7Y A;  5KHQ A;  2X8X X;  2IBI B;  3P2B A;  4DK5 A;  3N1X C;  1E8W A;  1LFD A;  3VDZ A;  1V2Y A;  3TEY A;  4YXD B;  2GB1 A;  1T6B X;  4C56 C;  4LDT B;  5MPO A;  5IOI A;  2FBW B;  1ESF A;  1K52 A;  4TV3 A;  1KH0 A;  2BQQ A;  1QOF A;  3CF6 E;  4ZRI A;  2DYM A;  3TEX A;  3SFD B;  4DDG D;  2IO0 B;  4A3O A;  3ETR A;  1GNU A;  3AE3 B;  5KHO A;  3AE1 B;  2KMC A;  3W5U B;  1X1M A;  4BOZ B;  2RD0 A;  4XWW A;  1AW7 A;  2MBO A;  1C76 A;  4IDI A;  3DBS A;  1MHX A;  4EUT A;  4N58 A;  2ICI A;  4K3C A;  1WYG A;  4RH6 A;  1WR6 E;  3FKY A;  4EE2 A;  3L0W B;  4M0W A;  3N1Z C;  1NEK B;  4J3O D;  1P3Q U;  3PRP B;  2QJL A;  2G4S A;  3DVN V;  4W9L A;  2REX A;  2MSE D;  2M0A A;  1E7U A;  2D5G A;  4K7W A;  3NJT A;  2V3P A;  1L4D B;  2KOX A;  1TKE A;  3RNG C;  2RPV A;  1C1Y B;  4ZHO A;  2MBE A;  3PZD A;  1Z5S B;  1XLP A;  3QHT A;  3SD5 A;  1QOG A;  2LFI A;  3HVD A;  4NZL B;  3Q8C A;  2L8J A;  3LXF A;  2FCS A;  2W9N A;  1F2R I;  2N9X A;  4LNI A;  2MLB A;  3U7Z A;  4KIK B;  3SEB A;  2KHW B;  4S17 A;  2RDB C;  3PZ7 A;  4CYE A;  2HE7 A;  4GGQ A;  3W5V B;  1E8Z A;  4IWQ A;  3DQV A;  3ZW3 A;  2ZJD A;  4WUR A;  5H92 C;  3T3N A;  1C9F A;  2XK5 B;  2FAZ A;  1FFV A;  2M0X A;  3U2S C;  1EU4 A;  4FHJ A;  3VH4 B;  1KOT A;  2LEK A;  3Q6B A;  2JF5 A;  2PW9 A;  4NJ7 A;  3QAR A;  1FIQ A;  3SHQ A;  3DVG X;  3Q8B A;  4JL9 A;  3RT3 B;  1FPY A;  1V6E A;  3IAM 1;  5G5H A;  2C7N B;  3TL5 A;  4DBG A;  2CU1 A;  3U4E G;  3ZXR A;  1TS2 A;  2LMC A;  1R4M I;  1VCB A;  4IW0 A;  1E90 A;  2KNB A;  3MC0 B;  4NQK E;  4JE3 B;  3AE7 B;  3PS6 A;  1JWA D;  2AL3 A;  3TEZ A;  1F9J A;  3T9L A;  2N1W A;  3APD A;  2V9H A;  1OEY J;  4LJP B;  1WM2 A;  4HVB A;  3HRD D;  1I4Q A;  3NZU A;  3PLU A;  3VTW A;  3ZTC A;  4ZRP A;  3UQA A;  1QQR A;  4KIK A;  2C5L C;  1EM7 A;  1UEL A;  3AXC A;  3PRM B;  2WWZ A;  2DWQ A;  5CHW A;  2FE8 A;  3RMK C;  4IOI E;  3T8M A;  4DHZ E;  3KWL A;  4TUU A;  3ZKJ C;  4I6L B;  1D5M C;  2I1J A;  3W1S C;  2XK5 A;  1VJK A;  3AE6 B;  3HIZ A;  1GC7 A;  3PZ8 A;  4FXC A;  1VDV A;  4FLH A;  4JIO U;  2J52 A;  2K8B A;  4AWJ A;  1P7F A;  1UZX B;  2DZK A;  4B95 A;  1PQS A;  1QZE A;  2MQJ A;  2PEA A;  3K9O B;  3TIX A;  4OZC A;  5BMI A;  1CJE A;  3APC A;  4G0N B;  1TJE A;  1GUA B;  4AQ7 A;  1YN5 A;  2NBV B;  2PE9 A;  2KAC A;  3A4R A;  2I2Y A;  2IY1 B;  2X38 A;  3ZNH B;  1DOI A;  2JQR B;  4F7Z A;  4TSS A;  2L1A A;  3RNF C;  3B08 A;  3MJW A;  1TIF A;  1YJJ A;  4G3X B;  2OHF A;  1WMH A;  1T0Q C;  1QF6 A;  3JVZ X;  2NTS A;  3RD2 A;  2FNJ B;  4WJP A;  5D2M B;  2CHW A;  1YIW A;  2DYO A;  3ECI A;  4C4V A;  1C78 A;  3JW0 X;  3Q8E A;  2MJD A;  2AQ1 B;  4XZ4 A;  3W2D A;  4KGS A;  4YWG G;  1RLF A;  1RAX A;  1V5T A;  1WI0 A;  2L00 B;  3ZQ4 A;  4A90 A;  2BTE A;  3BK2 A;  2LAS A;  4WAA A;  1EWC A;  3PRE A;  5CHV C;  4II3 B;  1T5X D;  3RYT A;  3SFE B;  2QIE B;  5I4D A;  4YSZ B;  4MEL A;  1ET6 A;  2LRU A;  4XC2 A;  1IPG A;  3AV8 A;  5DCN A;  2KLC A;  1ZUD 2;  4OHJ A;  2L32 A;  4AOF A;  5FKA C;  1HZ6 A;  2WDQ B;  3ZNI D;  2M17 A;  5DPS A;  2K6D B;  1NDD A;  4ANV A;  4MSM B;  4L1B A;  2KDE B;  3U8Z A;  4P6V F;  2AEH A;  2C9W B;  5IKC M;  2NVU I;  3AH7 A;  1L0V B;  2KZR A;  3A9K A;  3AEG B;  1FXA A;  2NPT A;  1JW9 D;  2J0J A;  1WJU A;  2KAN A;  3QX1 A;  1G6J A;  2C7H A;  5T8I A;  4MGZ E;  1TYG B;  3U30 A;  1TS3 A;  4USA A;  3RI7 C;  2N9P C;  2DZI A;  2PE6 B;  4NAW B;  1IGC A;  2KWU B;  1TZO A;  2W55 A;  4MGK E;  2WU2 B;  2JZP A;  4OVZ A;  4WWN A;  1V5O A;  1WXQ A;  3O13 A;  2W82 A;  5BMH A;  4LNK A;  4BVU C;  1V1O A;  4A20 A;  2PMV A;  5JXV A;  1B1Z A;  4IWO A;  3DBL I;  1SE9 A;  1WZ3 A;  3P1M A;  2DZM A;  4FN2 A;  2KX0 A;  1F2R C;  5L83 A;  2V0G A;  2W3R A;  2YEP B;  3DBH B;  2KDB A;  3UGB B;  1SEB D;  1L2N A;  4DXF A;  4RGN A;  2CKH B;  5BYS A;  5JH5 C;  2PIA A;  1OFF A;  2MBQ A;  1IGD A; 
#chains in the Genus database with same CATH homology
 5LLI A;  3WAL A;  3EHV A;  4WJO A;  1UBI A;  1TBE A;  3KW5 B;  3KUZ A;  4P7I A;  4EEW A;  2KC1 A;  1LQB A;  1WMH B;  1YX6 B;  4ICU A;  2JT4 B;  4W9D A;  2DEN B;  2MW5 A;  2V3S A;  1WGH A;  2LVP A;  2ZVN A;  2KX3 A;  1CMX B;  2IO2 B;  3VUX A;  4FJZ A;  2ZVO A;  2V1Y A;  3WAP A;  3DVG Y;  2MWS B;  4F1S A;  1WXS A;  3OLM D;  2Z0E B;  3A9J B;  2O6V A;  4WWO A;  1A5R A;  2JUO A;  2KDI A;  4W9I A;  3ZIM A;  2RGF A;  3VUW A;  2LZ6 A;  1IP9 A;  1NBF C;  2A4Z A;  2CHZ A;  1YQB A;  2KQ7 A;  2NPT B;  2G45 B;  4PS7 A;  4DXA B;  3ZDT A;  3B0A A;  2VRR B;  3ZLZ A;  4MJS A;  3VQI A;  3LJ3 A;  2O6V B;  3APF A;  3R7R A;  1I35 A;  1Z2M A;  5IA7 A;  2JWZ A;  4WJN A;  3W1Y A;  1L7Y A;  5KHQ A;  2ZCB A;  3PV1 A;  3ALB A;  2MRP A;  3V6E B;  2IBI B;  1E5W A;  3P2B A;  1ZW7 A;  2IO3 B;  4DK5 A;  3L08 A;  2FUH B;  1Q1O A;  5DPW A;  5CX3 A;  1E8W A;  2GOW A;  4EOY A;  4G50 A;  3RUL A;  4BFR A;  2GBN A;  1LFD A;  2AYO B;  2D11 A;  3VDZ A;  4W9C A;  3H7S A;  1V2Y A;  2Z59 B;  2AWT A;  2KFK B;  2KWC A;  1EF1 A;  3CSF A;  3H7P A;  3VFK A;  1YX5 B;  4KV2 A;  2IZV B;  4LDT B;  2LD9 A;  2M1M A;  3R3M A;  3EEC A;  5C23 A;  4EZK A;  1P1A A;  4GIV A;  4MGI E;  4TV3 A;  5IAA C;  5BO4 B;  1NI2 A;  4KSK C;  2K25 A;  3CF6 E;  3TCA A;  4ZRI A;  5LXH A;  3QQ8 B;  3QWZ B;  2DYM A;  4IM3 A;  3W1S A;  4IG7 B;  4DDG D;  2IO0 B;  2KTR B;  4A3O A;  2JRH A;  1WX8 A;  3V62 A;  2WX0 A;  2HTH A;  2KJ6 A;  2GBR A;  3Q3J A;  1GNU A;  2BKF A;  2QHO A;  2KFK A;  2ZEQ A;  5KHO A;  4HWI B;  2KMC A;  1X1M A;  2KLG A;  4EFO A;  4BOZ B;  2RD0 A;  3H9D A;  2MBO A;  2DZJ A;  4HJK A;  2LUE A;  2KD0 A;  3HM6 X;  3DPD A;  1IYF A;  3DBS A;  2BYF A;  3UQB A;  4K1R B;  4EUT A;  5E6O A;  4HCN B;  4WJQ A;  4MDK E;  4W9F A;  3TBL D;  3VUY A;  3KYC D;  4TQ1 A;  4IM0 A;  2JRI B;  1WR6 E;  1D3Z A;  1H8C A;  3AU4 A;  2JPH A;  5J18 A;  2D3G A;  2LXC A;  3L0W B;  3IBE A;  3M3J A;  2XEW A;  3HHM A;  3LDZ E;  5JZE B;  3A9J A;  4W9G A;  1WX9 A;  3A4S C;  4I6P A;  4W9E A;  1P3Q U;  4AJW A;  4K81 A;  3PRP B;  2ZPY A;  5JHA A;  2HD5 B;  4GOC A;  5CHF A;  1OQY A;  4J6I A;  4BKG A;  2G4S A;  3A33 B;  3DVN V;  4ZRK A;  2NS5 A;  2REX A;  2MSE D;  2JVC A;  2JY6 A;  3IVF A;  4W9L A;  4K7S A;  1GJZ A;  2G3Q B;  2KTR A;  4KZ0 A;  1E7U A;  2L0T A;  3AU5 A;  1KLV A;  3VXW A;  4K7W A;  4ZRJ A;  3R7Q A;  3B1L X;  3A1Q A;  4MEM A;  5D94 A;  3QAQ A;  3HK0 A;  1UD7 A;  1ZGU B;  4JGH B;  4ZYN A;  4EZJ A;  3M95 A;  2KOX A;  2MX2 A;  1M94 A;  1C1Y B;  2DAJ A;  5G2N A;  4ICV A;  2MBE A;  3PZD A;  3TMP B;  1Z5S B;  1T0Y A;  1WGD A;  2CHX A;  2K8C A;  2OJR A;  3KUD B;  2KJR A;  3QHT A;  3SD5 A;  4E3C A;  5AEK B;  4FUL A;  2KDF B;  3DCG A;  4W9H A;  3H6N A;  2L8J A;  4IUM B;  4BOS C;  4MM3 A;  2L7R A;  4ANU A;  1V9J A;  2FCS A;  3NOB A;  3H1U A;  4E71 A;  2W9N A;  3NZS A;  2OOB B;  2N1V A;  5D6J B;  2N9X A;  2LGD A;  3UIN B;  3ZO5 B;  1FXT B;  4MGY E;  1ZKH A;  4MH0 E;  4M8N A;  2L05 A;  2MLB A;  4KIK B;  1Q5W B;  2ASQ A;  4DHJ D;  2LVQ A;  1TZ1 A;  2KHW B;  4IC7 B;  1WE6 A;  1LM8 B;  4NQL B;  2DHZ A;  4CYE A;  3ZRF A;  2HE7 A;  4GGQ A;  4TKN A;  1V80 A;  1E8Z A;  2G4D B;  1UH6 A;  1WGY A;  4IWQ A;  4W9J A;  3DQV A;  3OAW A;  3ZW3 A;  2NCN A;  4BKT A;  2ZJD A;  4PYZ A;  1WY8 A;  3DOW A;  4KZC A;  2IO1 B;  2BKR B;  2EMS A;  2GBM A;  2XK5 B;  2FAZ A;  1RFA A;  2XBB C;  2M0X A;  4FHJ A;  3JSV B;  4URK A;  3AUL A;  3CST A;  3VH4 B;  1KOT A;  3UIO B;  1I42 A;  1C3T A;  2HJ8 A;  2JF5 A;  3KUC B;  1WGG A;  4A3P A;  4B9K A;  4BBN C;  4NJ7 A;  4B6W A;  3QAR A;  3GOE A;  3ENE A;  2CS4 A;  3SHQ A;  2DX5 B;  4HPL B;  1LXD A;  4WWP A;  3DVG X;  1TTN A;  3BIN A;  4JL9 A;  3RT3 B;  1V6E A;  1ISN A;  1V49 A;  4LJO B;  3BY4 B;  2C7N B;  3TL5 A;  1P98 A;  4DBG A;  1WF9 A;  3UIP B;  4HXD A;  2CU1 A;  2UWQ A;  4GMV A;  5D7G A;  1R4M I;  3H7P B;  1VCB A;  2AL6 A;  2FID A;  2KO3 A;  4IW0 A;  4XX5 A;  1E90 A;  2KNB A;  3DBR I;  3MTN B;  2KTF A;  1XT9 B;  4HDQ A;  1TGZ B;  4NQK E;  5DPT A;  2KXJ A;  3PS6 A;  2AL3 A;  4BBN F;  1F9J A;  3V60 A;  1V86 A;  2ZCC A;  2LVO A;  2CR5 A;  3T9L A;  2N1W A;  3APD A;  1YJ1 A;  1OEY J;  3ML8 A;  4LJP B;  1WM2 A;  4HVB A;  1MG8 A;  2KFJ A;  3NZU A;  3PLU A;  3QIJ A;  1XD3 B;  3WAM A;  3M63 B;  2PPH A;  3PVL A;  1WFY A;  3VTW A;  3ZTC A;  3MHS D;  2Y5B B;  4GDL B;  4NAW A;  3UQA A;  3ZDM C;  2BYE A;  3RCZ A;  1WXM A;  4KIK A;  2LGY A;  2EKE C;  2C5L C;  1UEL A;  3GZN I;  3Q3F A;  2R2Q A;  3AXC A;  2N7D A;  3PRM B;  2WWZ A;  4FJY A;  1E8Y A;  1GG3 A;  5CHW A;  4DHZ B;  3T8M A;  5JHB A;  1WJ4 A;  2KC2 A;  2MP2 B;  4DHZ E;  2WYQ A;  3C0R B;  4TUU A;  2NBW B;  1OGW A;  1WJ6 A;  1V81 A;  2FCQ A;  3ZKJ C;  4M8M A;  1P9D U;  4RM8 A;  3X0W A;  4II2 B;  5J2R A;  3L10 B;  4I6L B;  4GDK A;  1UGM A;  2I1J A;  3QC8 B;  3W1S C;  2XK5 A;  2BYV E;  3NS8 A;  4OVV A;  3HIZ A;  4PS3 A;  1GC7 A;  3L16 A;  1OEY A;  2FCM A;  3PRZ A;  4FLH A;  1WGR A;  1EF5 A;  3VTV A;  3V6C B;  2RPQ A;  4JIO U;  3ONS A;  3PTF C;  2K8B A;  4LCD E;  1WRD B;  4PS8 A;  3SDL C;  2GBK A;  2LWP A;  4AWJ A;  1UZX B;  1RRB A;  2DZK A;  2V4L A;  2ZNV B;  1S1Q B;  3OJ3 A;  4NNJ B;  2UYZ B;  4B95 A;  1PQS A;  1WJN A;  4HLE A;  1QZE A;  2MQJ A;  2PEA A;  3CMM B;  1JRU A;  2L0F A;  3K9O B;  4LDT D;  2NBU A;  4JLC A;  2FCN A;  2K8H A;  1SGH A;  3TIX A;  2EMT A;  3KYD D;  3RZF A;  4KVG B;  1E7V A;  1WIA A;  4IWP A;  5GMV A;  3APC A;  4G0N B;  2N9E B;  4MJS B;  1GUA B;  4FHK A;  2KKC A;  4GU2 A;  2NBV B;  2O2V B;  4ANX A;  4CHK A;  1AAR A;  2PE9 A;  2FIF A;  4PYU A;  3A4R A;  3JSV A;  2YLM A;  4NJ6 A;  2IYD B;  3UF8 A;  5TR5 A;  3ML9 A;  2IY1 B;  5C1Z A;  3ZNH B;  3A1Q B;  1WR1 A;  1UBQ A;  4I6N B;  3RUI B;  4F7Z A;  1H4R A;  3B08 A;  2O2V A;  2RSU A;  5FR6 A;  2KK8 A;  3MJW A;  1GC6 A;  5E6N A;  3PGE A;  2KWV B;  5L95 C;  4G3X B;  3DBH I;  2BGF A;  1WMH A;  4YL8 A;  1XQQ A;  1KJT A;  4X57 B;  3JVZ X;  4GDL A;  3NY5 A;  2LI5 A;  4RMA A;  4W9K A;  3QCA A;  2FNJ B;  2BPS A;  3RD2 A;  3IHP C;  3X23 A;  4AJY B;  3EC8 A;  3L17 A;  2JZZ A;  3PLV A;  4WJP A;  1VD2 A;  5CTR C;  4DWF A;  5D2M B;  4TQ0 A;  4E74 A;  3L54 A;  2CHW A;  3ZVV A;  1YIW A;  2DYO A;  5G55 A;  3ECI A;  3JW0 X;  5AZH A;  2K39 A;  3QA8 A;  3D32 A;  4FJV B;  4G11 A;  2J0K A;  4FA6 A;  4XZ4 A;  2BWE S;  4KDL B;  2D07 B;  2N4F A;  1WX7 A;  1J8C A;  1RLF A;  1RAX A;  1V5T A;  2KJH B;  4GDK B;  2WX1 A;  4EKU A;  1WI0 A;  2J0M A;  2L00 B;  1EUV B;  2LAS A;  4WAA A;  2D10 A;  3PRE A;  5CHV C;  4II3 B;  3VAW A;  3RYT A;  4HK2 A;  2N7E A;  4MEL A;  4ANW A;  3S2A A;  2LRU A;  3ZNG C;  1WZ0 A;  4XC2 A;  3IFW B;  4GN1 A;  2C7M B;  1WM3 A;  3PT2 B;  1IPG A;  4DHJ B;  5DCN A;  1WH3 A;  2KLC A;  2B3A A;  1J0G A;  3VHT C;  1U4A A;  3O65 B;  4AOF A;  3PHX B;  2LJ5 A;  5E6P A;  4HDO A;  3WAN A;  2YVC A;  5AZF A;  2I1K A;  4MSQ B;  3ZNI D;  2M17 A;  4DDI D;  5DPS A;  3V61 A;  1E8X A;  2K6D B;  4M0W B;  1NDD A;  2ZNV C;  3N32 A;  4ANV A;  1P0R A;  3ZUN A;  4MSM B;  3A9K B;  2KDE B;  3QJZ A;  4EZL A;  3PSE B;  3U8Z A;  4AP4 C;  1J19 A;  2AEH A;  2C9W B;  4OVU A;  2KMA A;  3K9P B;  3ZRC A;  2NVU I;  5LXI B;  2RR9 A;  2KZR A;  2PJH A;  3A9K A;  4N9F 4;  4ZDV A;  2ZPN A;  4JQW C;  2NPT A;  3RZW C;  4GB9 A;  2BF8 B;  2K6Q A;  1WJU A;  2J0J A;  3M62 B;  4NY0 A;  3ZTD A;  2K1F A;  4GSW A;  2MBH A;  1EO6 A;  2JXX A;  2O6V D;  4CO7 A;  5DPR A;  2KAN A;  3QX1 A;  3PHW B;  2R2O A;  1G6J A;  2C7H A;  4MGZ E;  3U30 A;  1Q0W B;  1OTR B;  1WXV A;  2GBJ A;  2WDT B;  2N9P C;  2DZI A;  2PE6 B;  4K7U A;  4NAW B;  1WE7 A;  5J17 A;  2JZ3 B;  3PPA A;  2KWU B;  4NPN A;  5HKH A;  3KH0 A;  4KDI C;  4KSL C;  2L76 A;  4MGK E;  3JYU A;  4HCP B;  3U7D A;  4WWN A;  4WQO B;  1V5O A;  2J7Q B;  3R66 C;  2D2Q A;  3DVN U;  3SU8 X;  4FBJ B;  2MBB B;  4ASW C;  3DDC B;  1R4N I;  2M4N A;  5AZG A;  2IY0 B;  4BVU C;  2KQS A;  3VH3 B;  2GMI C;  4A20 A;  1YD8 U;  3IG3 A;  4FAD A;  1BT0 A;  2L3Z A;  2LRW A;  4IWO A;  3DBL I;  1SIF A;  1HE8 A;  3L13 A;  1SE9 A;  1WZ3 A;  4IM2 A;  1KM7 A;  4AUQ C;  4F8C B;  3WIM A;  2A5U A;  3NHE B;  2DZM A;  3EFU A;  4FN2 A;  2KX0 A;  1WXA A;  3WAO A;  3QK0 A;  5L83 A;  3VTU A;  3OJ4 B;  3TJP A;  2KVR A;  2DYB A;  1K8R B;  2LXA A;  2MA9 B;  2MCN B;  3WA0 A;  4BKS D;  5EDS A;  3KVF B;  2KDB A;  3UGB B;  3N3K B;  1L2N A;  1S3S G;  2C60 A;  2DAF A;  2BWF A;  4HPM B;  1Y8R C;  2NR2 A;  3N30 A;  2KN5 A;  4GXB A;  1WYW B;  2CKH B;  2Z0D B;  3HM3 A;  5JH5 C;  2MP2 A;  2ZZP B;  4BKS A;  3I3T B;  2MBQ A;  3AI5 A;  4RM9 A;  3ZNZ B;  2LGX A;  3VVW B;  2M8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...