1A5RA

Structure determination of the small ubiquitin-related modifier sumo-1, nmr, 10 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
103
structure length
103
Chain Sequence
GSMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of the small ubiquitin-related modifier SUMO-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Targeting protein
molecule keywords SUMO-1
total genus 10
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1a5rA00
3KYDD 2KZRA 3QCAA 2V1YA 3DQVA 4B6WA 1J0GA 1LM8B 2FCMA 2AWTA 3RCZA 1YIWA 4KV2A 4F7ZA 4W9CA 3NOBA 3DCGA 5DPTA 3K9PB 3RZFA 1L2NA 3PT2B 1ZW7A 3EC8A 3ZTCA 2GBNA 5JHBA 1WJ4A 1E5WA 2DZJA 2KMCA 3QAQA 2D11A 4WAAA 3U30A 3ENEA 3ZDTA 1UBIA 4FBJB 2KQ7A 2R2QA 3QHTA 2KWUB 2D3GA 3HK0A 3ZNGC 1WFYA 1WZ3A 3RT3B 1WX8A 2C7NB 5E6NA 3PS6A 3VH4B 2R2OA 2C7HA 4ANVA 2K8BA 4WQOB 3A9JB 4GOCA 4TQ0A 1EUVB 3A4RA 4ICVA 3PSEB 2KOXA 5AZHA 2NCNA 4ZRIA 2UYZB 4KSLC 2MBHA 1WXVA 3IBEA 3L10B 2XEWA 3PHWB 4G0NB 2JRIB 4ICUA 4JIOU 4PYZA 4TQ1A 4BKTA 2KC2A 3GOEA 2M4NA 4XZ4A 4FLHA 4BVUC 2N1VA 3R7RA 2ZVNA 3VUXA 2AL6A 1PQSA 4ANWA 4NQKE 2ASQA 4JGHB 1WGDA 4HPMB 3PTFC 2KFKB 2NPTA 3SHQA 2MSED 3WA0A 2ZPNA 3M62B 4DDID 2KWVB 1GUAB 3DBSA 1C3TA 2V3SA 2KD0A 3BY4B 2HTHA 1LXDA 3T8MA 2WX0A 4WWOA 4GDKB 5G55A 4W9JA 4X57B 3VDZA 4HJKA 2KQSA 1YX6B 1WYWB 2PPHA 2YLMA 1WX7A 4IG7B 1GJZA 3DBHI 3RULA 2KTFA 1OTRB 2KKCA 2L05A 4KIKB 4HCPB 2MBBB 2LJ5A 3V62A 3NS8A 3JVZX 3O65B 2JXXA 4IM0A 5IAAC 3V61A 2EMSA 2IZVB 4W9IA 3PGEA 1UELA 3PPAA 3N32A 1A5RA 1H4RA 3L54A 2JT4B 3AU5A 3AXCA 3QJZA 4NQLB 4FADA 4BKGA 3KW5B 4DK5A 1G6JA 3H7SA 1V5TA 4B95A 1TZ1A 3DVNV 2RGFA 3QK0A 2C9WB 3X23A 3OAWA 2JRHA 4A20A 4MEMA 2FCNA 3M95A 3OJ3A 4EZKA 4M8NA 2LZ6A 4ZYNA 2MA9B 3L17A 4KZCA 2D07B 3OLMD 5TR5A 1P1AA 1TBEA 1UZXB 1GNUA 3RD2A 3UIOB 2K6DB 4BKSD 2NPTB 4GDLB 2JUOA 5JHAA 3A33B 2L00B 2M0XA 2KN5A 3ZW3A 4GU2A 3VAWA 2NVUI 4W9LA 1WJNA 2QHOA 3CMMB 4FHKA 4K1RB 1Q5WB 4LDTB 3NZUA 4NAWB 3HM6X 3WANA 3A9KA 1AARA 2KC1A 3DOWA 4K81A 2ZNVB 2ZCCA 3H7PA 4II2B 4WWNA 3PVLA 2CR5A 4TV3A 5CHWA 5FR6A 3WAOA 4TKNA 4GB9A 3K9OB 1NDDA 4MGYE 4J6IA 1IPGA 2WDTB 5LLIA 4G50A 1V9JA 3IVFA 1WGHA 4G11A 4MGIE 2N9EB 3T9LA 1ZGUB 3GZNI 4KZ0A 4DHZB 4KIKA 2LUEA 2D2QA 1WGRA 4HPLB 1V86A 2MX2A 1V6EA 1WJUA 4HK2A 1YQBA 3DBRI 4FHJA 3WAPA 1WXAA 3B1LX 3QC8B 2CU1A 4HLEA 1P3QU 1WMHA 4N9F4 2GBMA 1J19A 2AEHA 3AU4A 3N30A 1WF9A 3IG3A 1ZKHA 4LCDE 2CHXA 4EZLA 1XQQA 3X0WA 1X1MA 1WE7A 4RM9A 4E3CA 3APCA 2FUHB 3UQBA 3PLVA 1GC6A 1NI2A 2M8SA 3APFA 4HWIB 2DZKA 2GBRA 4I6LB 3LJ3A 4II3B 2KO3A 2NBVB 2M17A 3BINA 3DVGX 3DPDA 3ZVVA 1WY8A 3ZRCA 2J0JA 4GIVA 4IC7B 3VTUA 4AUQC 4NAWA 1YJ1A 2NBUA 2L0TA 2N7EA 2FCQA 4NNJB 1S1QB 3PRPB 1OQYA 4W9FA 3C0RB 2N4FA 4NJ6A 5J17A 1RRBA 4WJOA 3EECA 3DDCB 2MCNB 3JYUA 4HDQA 1SIFA 1WMHB 4F8CB 4OVUA 2EMTA 5DPWA 1IYFA 2G4SA 3R66C 1E8WA 2DYBA 2LWPA 3RYTA 2NS5A 3EHVA 1V2YA 1WM3A 3PRMB 2A4ZA 2WYQA 2LXAA 4I6PA 5AEKB 1OEYJ 5D2MB 3DVNU 4BKSA 4PS3A 1J8CA 2KDFB 3NZSA 1LFDA 2KX3A 1UD7A 2BPSA 3D32A 1OEYA 2LVQA 3V6EB 3PHXB 5AZFA 1KOTA 3W1SA 2KDBA 1Q0WB 4BFRA 3DVGY 1WIAA 5AZGA 4AOFA 1S3SG 2LI5A 3QIJA 2HJ8A 2MQJA 1WJ6A 2Z0EB 3ZUNA 1F9JA 4BBNF 1E7UA 2Z0DB 5J2RA 2OJRA 4ASWC 2XK5A 3VHTC 2MRPA 4MJSB 2BKRB 2BYVE 1U4AA 1WE6A 3CF6E 3U8ZA 4IM3A 2CS4A 2GBJA 2PE6B 4PS8A 4WJQA 3KYCD 3QX1A 4FJZA 2JWZA 1ISNA 4GDKA 4LDTD 4I6NB 2JF5A 3L0WB 1WI0A 4B9KA 4EEWA 1WZ0A 3OJ4B 3VFKA 2N1WA 1RLFA 2IYDB 2KFJA 2LGXA 5D6JB 3TJPA 4GN1A 2A5UA 4IWQA 3UQAA 2LASA 2HE7A 5CX3A 4GXBA 2UWQA 1KJTA 4W9GA 4NPNA 2AL3A 1WH3A 2K1FA 1R4NI 2EKEC 2N9PC 3I3TB 5E6PA 5GMVA 2V4LA 3VH3B 2MW5A 3R7QA 1L7YA 4HDOA 1OGWA 2ZEQA 1IP9A 1R4MI 1Z5SB 2MLBA 3ZRFA 2IO1B 4RM8A 1E8ZA 2KTRB 2BWFA 2L76A 3MJWA 2KHWB 2FIDA 4MSQB 5KHOA 2NBWB 4DHZE 3DBLI 2CHWA 3JW0X 1SE9A 4FULA 3NHEB 4WJNA 2LRUA 2JZZA 3JSVA 4LJPB 2KK8A 1MG8A 5KHQA 4LJOB 1UH6A 2PEAA 1E90A 4DDGD 4A3OA 4MELA 2O2VB 4EZJA 2J0MA 3H9DA 4M8MA 3WALA 2HD5B 2G3QB 2KDIA 3P2BA 2JVCA 2ZZPB 4KDLB 4CYEA 4ZRKA 4GDLA 1EO6A 3ECIA 2OOBB 3TIXA 4HVBA 1P9DU 2N9XA 2Y5BB 4W9EA 5C23A 1YX5B 2C5LC 2GMIC 3ZO5B 1RFAA 4WJPA 4OVVA 3ZNID 1C1YB 3KUCB 5J18A 2O6VB 3KUDB 3UF8A 2MP2B 2FAZA 3EFUA 5JH5C 1WX9A 1Z2MA 3W1YA 1T0YA 3SD5A 4IWPA 2WWZA 1Q1OA 4EOYA 4ZRJA 4CHKA 3ZKJC 2BKFA 3M3JA 2DYMA 1WXSA 2ZNVC 5G2NA 1I35A 3W1SC 2RPQA 1EF1A 5DPSA 3VQIA 1LQBA 2PE9A 5JZEB 2LD9A 4KVGB 3MTNB 4FA6A 2DAJA 2JPHA 2GBKA 4K7SA 2L8JA 3VTWA 2DX5B 1WR1A 4MM3A 3PREA 3KVFB 1YD8U 3QQ8B 4MGZE 4HCNB 4YL8A 2YVCA 3A1QA 4RMAA 4TUUA 3VVWB 4MGKE 1H8CA 4MSMB 2ZCBA 1P98A 2O6VD 5LXIB 4FN2A 3WIMA 5DCNA 2IO3B 1UBQA 4AJYB 4F1SA 4GGQA 2LGYA 2JZ3B 2KXJA 1WXMA 2KJHB 2KTRA 3ML9A 3M63B 4ANUA 3HIZA 1WRDB 3APDA 5IA7A 2KVRA 2KJRA 4PYUA 4IUMB 3A4SC 4NJ7A 3ML8A 2NR2A 4M0WB 1P0RA 1HE8A 2DZIA 1VCBA 2LRWA 4ANXA 2I1KA 3L16A 2D10A 4PS7A 4DBGA 1WGGA 1E8XA 3KUZA 4W9KA 3TL5A 2K25A 3CSTA 2MBOA 4DXAB 2KJ6A 3B08A 3UGBB 3ZLZA 4BOZB 1E8YA 4P7IA 3RUIB 1QZEA 2IY1B 5E6OA 2IO2B 3CSFA 2DAFA 3TBLD 2KDEB 2KANA 2KWCA 4KDIC 1TTNA 3PLUA 1V80A 5D7GA 2BYFA 4W9HA 5LXHA 3V6CB 3WAMA 4IM2A 2MP2A 2XK5B 4IW0A 1V5OA 2CKHB 3HHMA 3TMPB 3ZDMC 3SDLC 3L13A 1I42A 2IY0B 4FJVB 2FIFA 4XC2A 1CMXB 1NBFC 2WX1A 1FXTB 2J7QB 3ALBA 3NY5A 3UINB 4DHJB 2MBQA 4EFOA 3A9KB 4K7UA 5CHFA 2K8HA 2FCSA 3UIPB 3ZNHB 4JQWC 4HXDA 4G3XB 2L7RA 3VTVA 1TGZB 2BGFA 2DENB 1KM7A 3H6NA 2KX0A 5BO4B 3L08A 2IO0B 1V81A 5CTRC 4AP4C 2AYOB 5L83A 3HM3A 2ZVOA 3MHSD 3PRZA 2G45B 4EKUA 2MWSB 3AI5A 2RD0A 2RSUA 4A3PA 2ZJDA 3ZTDA 3A1QB 4MH0E 4AJWA 1VD2A 1XD3B 2KMAA 2DYOA 2C7MB 2DZMA 2DHZA 3V60A 4MJSA 2B3AA 4K7WA 1SGHA 2REXA 3RZWC 4JLCA 4GSWA 4BOSC 4WWPA 4EUTA 5L95C 1UGMA 3B0AA 4KSKC 4URKA 3S2AA 2LGDA 2W9NA 2N7DA 4JL9A 1D3ZA 5CHVC 3LDZE 3KH0A 2KNBA 1M94A 2MBEA 3IFWB 4GMVA 3AULA 2L3ZA 3H7PB 3N3KB 2LVPA 4NY0A 2LVOA 1WM2A 3A9JA 3Q3JA 1GC7A 1EF5A 2IBIB 3ZIMA 2KLGA 5HKHA 2CHZA 3IHPC 3ZNZB 4MDKE 2VRRB 1V49A 4E71A 3VXWA 4CO7A 3PZDA 3TCAA 2J0KA 1Y8RC 5EDSA 4IWOA 1K8RB 2G4DB 2LXCA 2FNJB 4BBNC 3QARA 1BT0A 3SU8X 3ONSA 2JY6A 4FJYA 5D94A 2KLCA 2I1JA 3R3MA 1WGYA 4XX5A 2GOWA 3U7DA 1KLVA 1E7VA 1JRUA 1WR6E 4E74A 3QA8A 2XBBC 3H1UA 2O2VA 2BF8B 5DPRA 2C60A 1GG3A 2BWES 3VUWA 1RAXA 2M1MA 2O6VA 4DHJD 2RR9A 3JSVB 2K8CA 2BYEA 2L0FA 1XT9B 3QWZB 2K6QA 2PJHA 2ZPYA 3PV1A 2K39A 4ZDVA 3Q3FA 2Z59B 3VUYA 5C1ZA 4AWJA 2KFKA 4DWFA 4W9DA
chains in the Genus database with same CATH superfamily
3KYDD 1NVID 4YSZB 2JWUA 2KT7A 1YIWA 4KV2A 4F7ZA 4W9CA 2KYWA 3NOBA 2WXFA 3DCGA 5DPTA 3K9PB 2IJ0A 3PT2B 2HTME 3EC8A 2GBNA 1YN5A 5JHBA 2BTEA 3QAQA 2D11A 4WAAA 2MJ3A 3I5JC 3KWVA 2N9LA 1NEKB 3RT3B 1QOFA 2C7NB 2KVZA 3W5UB 1V8CA 4TQ0A 1EUVB 3Q8AA 3AEFB 3PSEB 2NCNA 4ZRIA 2UYZB 4KSLC 2N9KA 3NS1A 2KC2A 4M0WA 4XGAB 4XZ4A 2N1VA 3MP9A 4HPMB 2KFKB 2NPTA 3SEBA 3SHQA 3WA0A 3AE4B 3N20C 3M62B 4DDID 2KWVB 2V3SA 1LXDA 3T8MA 3N1YC 4WWOA 4W9JA 2QILA 1PGBA 2PPHA 4ARCA 1GJZA 3C19A 1OTRB 2KKCA 3NRZA 2MBBB 4L1BA 3JVZX 1R4MB 3O65B 4KGSA 5IAAC 2IZVB 2M0AA 3PPAA 2UU7A 4FADA 4BKGA 4DK5A 1G6JA 1UNSA 1TZ1A 3AE5B 4IDIA 1C4AA 1MHHE 3OAWA 2JRHA 3R2TA 2K5PA 2FCNA 3OJ3A 3PZ7A 3L17A 2D07B 3OLMD 1P1AA 3UIOB 2BS3B 1XF5L 2AQ3B 5JHAA 2V9HA 1KTKA 2XN9C 1YQ3B 3FILB 3IAS1 1AARA 1E10A 2ZNVB 4II2B 2CR5A 3NVZA 5CHWA 4GB9A 1IPGA 1V9JA 2WDQB 2JX5A 4G11A 5BMIA 1ZGUB 2LUEA 1PGAA 4HPLB 1WGRA 2D2QA 2MX2A 1WJUA 2FE8A 3B1LX 3QC8B 1P3QU 1J19A 3RNAC 1XLNA 3IG3A 3Q3NC 4LCDE 4P1CC 3AEBB 2OEDA 3PLVA 2M8SA 1YQ4B 3LJ3A 2M17A 3BINA 2H89B 3HRDD 1AN8A 1C4PA 2FUG1 2J0JA 3AB5A 3B2GA 4GIVA 3L4PA 1FIQA 1TYGB 2L0TA 1S1QB 3PRPB 1VLBA 1A70A 2N4FA 3E9SA 4REZA 4JWSC 4OVUA 1NENB 5TSSA 2G4SA 3U7ZA 2DYBA 1I4QA 1WM3A 5AEKB 1OEYJ 5BMHA 5D2MB 3DVNU 4ZHPA 3DWMA 3NZSA 1UD7A 2BPSA 3D32A 4JPSA 3PHXB 5AZFA 4LNFA 2KQ4X 3W1SA 4C4VB 5AZGA 4AOFA 2RDHA 2HJ8A 1V1PA 1D4BA 1OQQA 2XK5A 3VHTC 2BKRB 1WE6A 1FMAD 1L6UA 3CF6E 4IM3A 2GBJA 4YSXB 2PE6B 4JX1C 3KYCD 2JWZA 1ISNA 2KN4A 4LDTD 3P63A 4EEWA 2IYDB 5HHDG 3Q8EA 3UQAA 4GXBA 2L32A 2AL3A 1BUIC 5GMVA 1L7YA 1OGWA 1R4MI 1Z5SB 4MSQB 2FIDA 2V4IB 2K9XA 1SE9A 3NHEB 1MG8A 1E90A 4EZJA 2O2VB 2J0MA 2BBCA 1P7EA 2K3UA 1VDVA 1EWYC 2HD5B 4ZRKA 3TIXA 1EO6A 1XEEA 1B1ZA 2AQ2B 4HKQA 3ZO5B 4WJPA 2WNMA 4XE0A 2O6VB 4A6QA 2FBWB 1Z2MA 1V97A 3MJ5A 2BKFA 1J7AA 4XDDA 2DYMA 1WXSA 4JE3B 3AE6B 2WXPA 2RPQA 2NMQA 2PE9A 3IAM1 2PW9A 4M01A 1OQRA 3MTNB 4FA6A 2DAJA 4K7SA 2L8JA 2DX5B 3PREA 3A1QA 4TUUA 3TEYA 2LEKA 4MGKE 1H8CA 4MSMB 2ZCBA 1P98A 4P6VF 3WIMA 2IPKD 2QCZA 2IO3B 4AQ7A 3AEAB 4AJYB 1OFFA 4F1SA 1FNUA 1WXMA 1JWAD 3ML9A 1WRDB 1M4VA 3APDA 4PYUA 4IUMB 4NJ7A 1I4PA 3R8BA 5FR3A 1HE8A 5BYRA 4OZCA 2I1KA 4DBGA 3CSTA 1VZ6A 3B08A 2WXKA 3RUIB 3MC8A 2IY1B 2J4XA 3ZGZA 1LO5D 4KDIC 1QT9A 5LXHA 4IM2A 2MP2A 2Z8LA 3KWLA 2Y5PA 3Q14C 1FCCC 2J7QB 1ESFA 3V3XA 4EFOA 1UUPA 4ITKA 3UIPB 4HXDA 4G3XB 4NZLB 3VTVA 1T3QA 2BGFA 5BO4B 3L08A 1V81A 4AP4C 1KLUD 2QC8A 3MHSD 3LYYA 3ZTDA 3KLSX 1I7HA 1XD3B 2KMAA 3V60A 2B3AA 4K7WA 3RZWC 2OHFA 4JLCA 4BOSC 1N5XA 4URKA 2BS4B 3S2AA 1D3ZA 2PTLA 1DOYA 1FO4A 1M94A 2VZKD 3RNFC 4GMVA 4PK1A 3H7PB 2IBIB 3GE3C 3ZIMA 2KLGA 3IHPC 5H8YE 4YWGG 2VRRB 1WYGA 2GRIA 2GB1A 2G4DB 1PFDA 2INDC 2FNJB 3RNEC 3MFGA 3SU8X 4FJYA 4KKJA 5D94A 2KLCA 1WGYA 3BVZA 1FFVA 3P42A 2WGSA 3H1UA 2O2VA 2C60A 1GG3A 3VUWA 2O6VA 1E0ZA 2BYEA 1XT9B 3QWZB 2KACA 2K6QA 2PJHA 2WDRB 3LXFA 3PV1A 3URYA 2Z59B 1SB3C 2KFKA 2KZRA 4B6WA 2V1YA 2AWTA 1EWCA 3RZFA 1ZW7A 1JWBD 1TT5B 4FBJB 3J9CA 1SIJA 3QHTA 2D3GA 2KWUB 1RFKA 1WFYA 1WZ3A 4RGNA 3V05A 2JYTA 5E6NA 2X8XX 2WXHA 4ANVA 4WQOB 5AZHA 3AECB 2N0SB 1YJIA 3W2DA 1KLGD 3IBEA 1Q10A 2XEWA 3PHWB 4TQ1A 1QILA 2SEBD 3VUXA 2ZVNA 4MACA 2AL6A 4ANWA 2ASQA 2WDVB 4BZAA 3PTFC 2ZPNA 3U2SC 3MC0B 3BY4B 1GB1A 1XLOA 1GB4A 1ZE3D 4X57B 4HJKA 1YX6B 1SEBD 2YLMA 2AX5A 4TSSA 4KIKB 4HCPB 4IOIE 1FRDA 3HVDA 4USAA 4RGOS 2JXXA 4IM0A 3BYTB 2EMSA 3PGEA 1FNWA 3U52E 1H4RA 3BK2A 4NQLB 3ZJVA 1V5TA 3DHHC 3P4RB 2RGFA 1RWSA 1HTQA 3QK0A 1SBBB 4MEMA 3M95A 5E6JA 2MA9B 5FKAC 1GNUA 3RD2A 1R4NB 2W55A 4BKSD 2NPTB 4GDLB 2L00B 2KN5A 3ZW3A 4GU2A 2QHOA 3CMMB 4FHKA 4K1RB 4LDTB 3NZUA 1KH0A 4NAWB 5D3IB 5HFYA 2VH1A 1CJEA 3H7PA 3PVLA 4TV3A 3WAOA 2PIAA 1NDDA 4J6IA 2WDTB 1DYQA 3T3OA 4G50A 1WGHA 3T9LA 1VRAB 1QOAA 5FK9C 1TKYA 5JXVA 4FHJA 1K53A 2CU1A 3PZ8A 1WMHA 5G5HA 2GBMA 4BAXA 3AU4A 1NI3A 1WF9A 1YNTE 1ZKHA 1F2RI 4N59A 4EZLA 1XQQA 1X1MA 3APCA 3AE1B 1YN4A 2EKIA 1UGJA 3BZDB 4I6LB 2QEJC 2NBVB 5EE0A 3DVGX 3DPDA 2WXNA 1WY8A 3ZRCA 1JALA 2AQ1B 2BYTA 4P1BC 1YJ1A 2MHJA 4YTPB 4NNJB 1FXAA 4W9FA 1QF6A 1QOBA 1AYFA 1AWDA 1ACCA 1K50A 3Q8CA 4HDQA 1SIFA 1WMHB 2KDMA 4A8XC 2MH7A 1N63A 2LWPA 1N61A 2NS5A 5EE9A 2DNFA 1E9MA 4BKSA 4LNIA 1FFUA 3AMZA 2IGDA 1OEYA 2LVQA 1SXTA 4YT0B 1FD6A 2KDBA 2QSDA 1WIAA 1WJ6A 3UI3A 1MG4A 2Z0DB 4XYCA 1UWMA 4P16A 2INNE 2CS4A 3GB1A 4WJQA 1ZXIA 1ZDVA 2JF5A 5H92C 1WZ0A 2KFJA 2LGXA 2BVCA 5D6JB 2JQRB 4EE2A 2HE7A 1ZPSA 1WH3A 2K1FA 2EKEC 5E6PA 1UF0A 2V4LA 2MW5A 3R7QA 4H2AA 1NYRA 1CZPA 2IO1B 1L5PA 2NBWB 3AH7A 2W3RA 2CHWA 2D5GA 4WJNA 3RNCC 1ZP0B 5KHQA 2PEAA 4GLSC 4DDGD 3AE2B 4C56C 1SJHD 1MHXA 2WXGA 4M8MA 1GOZA 2KDIA 2JVCA 2ZZPB 2YEPF 4GDLA 4C00A 4HVBA 1P9DU 2LGSA 4W9EA 2WS3B 1F52A 2W54A 2RPVA 1R7SA 4OVVA 3ZNID 3UF8A 2BQQA 2FAZA 1YN3A 2MP2B 3OG5A 5EE1A 5AUKA 4R3DA 1T0YA 1YMHE 4CHKA 3M3JA 2ZNVC 3W1SC 1I4XA 5JZEB 1MVKA 2WXQA 3VRBB 1K51A 4KVGB 2QJLA 1KF6B 2CJNA 2GBKA 2JPHA 3VTWA 4MM3A 3KVFB 4HCNB 3TEZA 2O6VD 2JYEA 5I4DA 2PMVA 5DCNA 1VR9A 2LGYA 2JZ3B 3DBHB 2KJHB 2RMMA 5IA7A 5HI1A 3ML8A 2NR2A 1P0RA 2G9HD 1V1OA 1F2RC 1L4DB 4IKGA 4ANXA 3BWUD 1E8XA 3KUZA 4KGTA 1T0SC 4AS1A 2KJ6A 2BS2B 1E8YA 4P7IA 3Q69A 3RN9C 4US8A 4J3OD 1QZEA 4OZBA 3CSFA 4HJGE 4YXDB 2KWCA 3PLUA 4RCOA 1NYQA 2BYFA 4W9HA 1XCTL 2V0GA 3WAMA 4UDUC 2XK5B 4IW0A 3FAHA 2CJOA 3HHMA 3Q2AC 3TMPB 3ETRA 3ZDMC 5BMGA 3L13A 2KAJA 2IY0B 4FJVB 3I9V1 1ET6A 4L2YA 1FXTB 3DWGC 3NY5A 1VZ8A 4C80A 1J7BA 5CHFA 2K8HA 1YJJA 1TGZB 4KX6B 3Q3MC 1IBXA 1I4RA 2MWSB 3FC4A 4A3PA 1FNVA 3A1QB 4WH4A 2J53A 1VD2A 4AJWA 4YTNB 1WGKA 1J7CA 3TSSA 2REXA 3U4EG 4WWPA 5L95C 3BVMA 3RNGC 4KSKC 4KKIA 3AN1A 4A90A 3LDZE 3KH0A 2KNBA 2WXIA 3IFWB 3P4SB 2LVPA 2L1AA 1EF5A 3LB8C 2QIEB 2CHZA 1I4GA 1L0VB 3ZNZB 4C7YA 1V49A 1VJKA 4E71A 3AEGB 4CO7A 3FKYA 4WWMA 2LXCA 2DBYA 3ONSA 4PT5A 4XX5A 2IGHA 1KLVA 1SSNA 1JRUA 1WR6E 4WAFA 3EGRA 1D5XC 1RAXA 4HEA1 3JSVB 2QDFA 2K8CA 2ZPYA 5C1ZA 3VUYA 3I57A 3QCAA 1EM7A 1J0GA 2FCMA 5BYQA 1L2NA 1PYWD 2YEPB 1WJ4A 1E5WA 3U30A 3ENEA 3ZDTA 3SFDB 2KQ7A 2R2QA 4YSYB 3ZNGC 3TEWA 1BMLC 1SJED 4D2KA 2K8BA 4LNOA 3A9JB 4ICVA 2KOXA 1V1PB 2JSVX 2MBHA 2V3NA 4RFBA 4G0NB 3L10B 4BKTA 4JIOU 4C4VA 2M4NA 4BVUC 4FLHA 3R7RA 4NJCA 3ZJUA 4JGHB 1WGDA 3IT6B 4CQNA 1QLBB 2MSED 1JW9D 2Y3AA 1GUAB 3DBSA 3W5VB 2KD0A 2HTHA 4GDKB 2INCC 4K3CA 2KQSA 4IG7B 2WQYB 1HQRD 2L05A 3VR9B 2LJ5A 3V62A 3V61A 1XO3A 1UELA 1A5RA 3AU5A 3AXCA 3KW5B 3AEEB 2LUMA 3BYYB 3N1ZC 3DVNV 1TS3A 2INPE 2C9WB 3X23A 3RI7C 1MI0A 4M8NA 4ZYNA 2M56B 5TR5A 2K6DB 1ZOYB 2ZW1A 2RDBC 3VAWA 1Q5WB 2IDYA 3HM6X 1C77A 3SR6A 3WANA 4M00A 2KC1A 3DOWA 1IBXB 2ZCCA 4WWNA 3P1MA 2ZW0A 4MGYE 4M02A 5LLIA 4OHJA 4MGIE 2GI9A 2R61A 3GZNI 4DHZB 4KIKA 3GE8C 5IP4D 4HK2A 3MHZA 3WAPA 1YQBA 3B2FA 2MJEA 1F77A 3N30A 1DOXA 3X0WA 1RM6C 2Q5WD 4RM9A 3UQBA 1QQRA 1GC6A 1NI2A 2GBRA 3BVGA 2KO3A 1Y56A 4IC7B 4AUQC 1T5XD 3O13A 2N7EA 3NUHB 2FCQA 1YOVB 1OQYA 1B9RA 3C0RB 1TJEA 4NJ6A 1TS4A 3DDCB 1TS5A 2DLBA 4K3BA 4F8CB 2EMTA 1STEA 5DPWA 4OW0A 3NG0A 4FXCA 2NTSA 3EHVA 1V2YA 1WRIA 2A4ZA 1TS2A 1JMLA 2WYQA 4I6PA 2LHDA 1JROA 1AW7A 2BB5A 3DBLB 1ZDXA 1Q0WB 3DVGY 2MQJA 3ZUNA 1F9JA 4BBNF 5J2RA 2OJRA 3C8YA 4ASWC 4WIPA 4MJSB 3T3NA 2BYVE 1U4AA 1QOGA 3WCQA 4PS8A 3QX1A 1TZOA 4FJZA 4GDKA 3L0WB 2XNAC 1WI0A 4B9KA 3VFKA 3AE8B 2SAKA 4N6EB 2A5UA 4IWQA 1N60A 1HXYD 4W9GA 1FCLA 3I3TB 4ZRQA 2N9PC 1E6EB 3VH3B 4HDOA 2ZEQA 1IP9A 2RDGA 3ZRFA 2L76A 4RF1A 2CU3A 3DBLI 4FULA 3IXSA 2LRUA 2JZZA 4LJPB 2KK8A 2X38A 4LJOB 1PGXA 1UH6A 4MELA 3RMKC 3H9DA 5BYSA 3WALA 2TSSA 2G3QB 4KDLB 4CYEA 1DOIA 2JXTA 2Y5BB 2N9XA 2PLPA 5C23A 1FEHA 2MEKA 1RFAA 1C1YB 3KUCB 5J18A 5JH5C 4IWPA 2WWZA 1Q1OA 4EOYA 1D5ZC 3H8HA 5DPSA 1N62A 3VQIA 1LQBA 3IT4B 4WURA 5HG2A 2EELA 4B0MA 1MJDA 1WR1A 3Q8FA 1ET9A 1YD8U 4MGZE 4YL8A 2YVCA 1P7FA 3GS2A 3EUB2 4YTMB 3DHGC 1EU3A 4B0EA 2KXJA 2KTRA 2N7JA 3HIZA 2KVRA 2KJRA 3DBRB 3ABVB 2K22A 2LHEA 3A4SC 4OZAA 2D3BA 4DXGA 2HDEA 1KFYB 2D10A 4W9KA 3TL5A 2MBOA 4DXAB 3UGBB 2PVOD 3ZLZA 4BOZB 5E6OA 2ON8A 2DAFA 3TBLD 1V80A 3I63C 1FM0D 3V6CB 3OWEB 1V5OA 3HVZA 3SDLC 4XC2A 2L52A 1CMXB 1NBFC 2WX1A 3B9JA 4DHJB 1JWUD 2MBQA 5IKCM 2FCSA 3CIRB 2L7RA 1C78A 3H6NA 4HRSA 2KX0A 1JQ4A 2G1EA 5L83A 3HM3A 2ZVOA 3PRZA 2G45B 4EKUA 2BB6A 1TKGA 2ZJDA 5AUIA 1D6EC 2DYOA 2DHZA 4MJSA 1FXIA 1F0ZA 1SGHA 2J42A 3AM9A 4GSWA 4EUTA 2WXLA 1UGMA 2E6XA 1CQVA 4JL9A 2HJ1A 1L0XB 5CHVC 1C9FA 2L3ZA 5D3DA 4NY0A 2LVOA 1WM2A 3A9JA 1GC7A 1GAQB 3VXWA 3TCAA 3N9YC 5EDSA 1XLPA 4IWOA 1VZ7A 1HZ5A 2BT6A 1BT0A 1D5MC 2JY6A 4E74A 1C76A 2B76B 2BF8B 5LNK1 2BWES 1IGDA 1MPEA 3AE7B 4MM3B 4DHJD 2M1MA 4A55A 2RR9A 3P4QB 4ZDVA 4AWJA 4W9DA 1JWMD 3DQVA 1LM8B 3RCZA 4C7ZA 1LGRA 4LTUA 3ZTCA 4WQMA 3AEDB 2DZJA 2KMCA 2WXOA 3DHIC 3SFEB 1UBIA 2WP9B 3HK0A 1ENFA 5EE3A 4HPPA 1WX8A 2NTTA 3PS6A 3VH4B 2R2OA 3ZQ4A 3FILA 2C7HA 4LK0M 3EFCA 2J52A 4LNKA 1FRRA 3VR8B 4GOCA 3A4RA 4A9AA 3VRAB 1WXVA 4PYZA 3RNBC 2JRIB 4ICUA 3GOEA 1I4HA 1PQSA 1WSPA 4NQKE 1C3TA 3ZXRA 2I2YA 2WX0A 5G55A 3VDZA 2PVGC 2WXRA 1WYWB 1WX7A 1F1HA 3DBHI 3RULA 2KTFA 4JWUC 3RFZB 1L0YB 1ROEA 3NS8A 4DQOC 1GPXA 4W9IA 1SE2A 3AE3B 3N32A 2H88B 3L54A 2JT4B 3QJZA 1JCKB 3H7SA 4B95A 5GXGB 1MFWA 1HZ6A 1ZUD2 1T6BX 4EZKA 2LZ6A 4KZCA 1TBEA 1UZXB 3MC9A 3BIID 3NVVA 2JUOA 3A33B 3ZXVA 2M0XA 2NVUI 4W9LA 1WJNA 2E3TA 5C3JB 3A9KA 2DWQA 4K81A 1JWSD 5FR6A 4TKNA 2WXJA 3K9OB 4ACFA 4KGRA 4S17A 3IVFA 4HKZE 2N9EB 4KZ0A 1CK1A 1V86A 1V6EA 2V3PA 3DBRI 1WXAA 2JZPA 4HLEA 4N9F4 2AEHA 3Q8BA 4HROA 2KMMA 2CHXA 4OVZA 1WE7A 4E3CA 4DXFA 1XCQL 2FUHB 3W9CB 3APFA 4HWIB 2DZKA 3TEXA 4II3B 3AV8A 1ZXHA 2BW2A 2W3SA 3ZVVA 4QAYA 4ZYSA 3VTUA 1N6ZA 4NAWA 2NBUA 1KRHA 1HTOA 3Q3OC 4XDCA 5J17A 1RRBA 4WJOA 3EECA 2MCNB 4O1NA 3JYUA 2ACZB 1IYFA 3R66C 1E8WA 1L6VA 4RGMA 4XWTA 3RYTA 1PDXA 3PRMB 2LGIA 2LXAA 1L4ZB 4PS3A 1J8CA 2KDFB 1T0RC 1LFDA 2KX3A 1TIFA 2D3CA 3V6EB 1KOTA 3Q6BA 4RNAA 1SE3A 3BK1A 4XWWA 4BFRA 1S3SG 2LI5A 3QIJA 3NVWA 2Z0EB 1E7UA 4US9A 4MH8A 2Y5CA 2MRPA 2M19A 3NJTA 3KQ4A 3U8ZA 4TMAB 2GLSA 3EA6A 3PO0A 4I6NB 4ARIA 3OJ4B 2N1WA 1RLFA 3TJPA 1IGCA 2LJIA 4GN1A 2LASA 2L83A 5CX3A 2UWQA 1KJTA 4NPNA 1R4NI 5T8IA 1TKEA 1C79A 2MLBA 4RM8A 1E8ZA 2KTRB 2BWFA 3MJWA 4MT5A 2KHWB 2WXMA 5KHOA 4A20A 3NZ3A 4DHZE 3P4PB 3JW0X 1RYJA 1BXTA 3JSVA 1PUTA 4A3OA 3GP7A 3P2BA 2D3AA 3ECIA 1N5WA 2OOBB 2QMTA 1IUEA 3ZYYX 1YX5B 2C5LC 2GMIC 5G5GA 3CWIA 3KUDB 3EFUA 1WX9A 3W1YA 3SD5A 2I38A 4ZRJA 3ZKJC 5G2NA 1I35A 1EF1A 4N58A 1T0QC 2LD9A 1TY0A 2LFIA 3QQ8B 5IO9A 4RMAA 1SF0A 1XXGA 2W82A 3VVWB 1K52A 1HA5A 5LXIB 1WWTA 4S0RA 4FN2A 1WXQA 1HEZE 1UBQA 4GGQA 3R2IA 2WLBA 2VH2A 3M63B 4ANUA 1XLQA 3AE9B 4M0WB 3GZNB 2DZIA 2WHIA 1VCBA 2ICIA 2LRWA 4L23A 3L16A 4PS7A 1WGGA 3N1XC 4ZHOA 2K25A 5C2TB 4ZOHC 2K0PA 4LNNA 4ZRPA 2IO2B 2IGGA 2KDEB 2KANA 5D7GA 1TTNA 3RPFC 2CKHB 1I42A 2FIFA 2PKOA 4RGTA 2JU6X 3ALBA 3UINB 5IOIA 2LMCA 3A9KB 4K7UA 3NVYA 3ZNHB 4JQWC 2WU5B 1E7PB 2VZKB 2DENB 1KM7A 5MPOA 2IO0B 1JRPA 5CTRC 2AYOB 3AI5A 2RD0A 2RSUA 2WU2B 3ZJTA 4MH0E 2DZMA 2C7MB 4LLGM 4RF0A 3E56A 4RH6A 1C4CA 3B0AA 1QKZA 2MJDA 2ONQA 2LGDA 2W9NA 2N7DA 3TUOA 2MBEA 3AULA 3N3KB 3Q3JA 5IN7A 5HKHA 4NAMA 4MDKE 2OJWA 3PZDA 2J0KA 1Y8RC 1K8RB 4BBNC 3QARA 3HUIA 1UWXA 1DGJA 2I1JA 3R3MA 1SE4A 2GOWA 3U7DA 1E7VA 2KWDA 3QA8A 1TY2A 2XBBC 5DPRA 1EU4A 2L0FA 1FPYA 2K39A 3Q3FA 4Q2JA 4DWFA
chains in the Genus database with same CATH topology
3KYDD 2KZRA 3QCAA 2V1YA 3DQVA 4B6WA 1J0GA 1LM8B 2FCMA 2AWTA 3RCZA 1YIWA 4KV2A 4F7ZA 4W9CA 3NOBA 3DCGA 5DPTA 3K9PB 3RZFA 1L2NA 3PT2B 1ZW7A 3EC8A 3ZTCA 2GBNA 5JHBA 1WJ4A 1E5WA 2DZJA 2KMCA 3QAQA 2D11A 4WAAA 3U30A 3ENEA 3ZDTA 1UBIA 4FBJB 2KQ7A 2R2QA 3QHTA 2KWUB 2D3GA 3HK0A 3ZNGC 1WFYA 1WZ3A 3RT3B 1WX8A 2C7NB 5E6NA 3PS6A 3VH4B 2R2OA 2C7HA 4ANVA 2K8BA 4WQOB 3A9JB 4GOCA 4TQ0A 1EUVB 3A4RA 4ICVA 3PSEB 2KOXA 5AZHA 2NCNA 4ZRIA 2UYZB 4KSLC 2MBHA 1WXVA 3IBEA 3L10B 2XEWA 3PHWB 4G0NB 2JRIB 4ICUA 4JIOU 4PYZA 4TQ1A 4BKTA 2KC2A 3GOEA 2M4NA 4XZ4A 4FLHA 4BVUC 2N1VA 3R7RA 2ZVNA 3VUXA 2AL6A 1PQSA 4ANWA 4NQKE 2ASQA 4JGHB 1WGDA 4HPMB 3PTFC 2KFKB 2NPTA 3SHQA 2MSED 3WA0A 2ZPNA 3M62B 4DDID 2KWVB 1GUAB 3DBSA 1C3TA 2V3SA 2KD0A 3BY4B 2HTHA 1LXDA 3T8MA 2WX0A 4WWOA 4GDKB 5G55A 4W9JA 4X57B 3VDZA 4HJKA 2KQSA 1YX6B 1WYWB 2PPHA 2YLMA 1WX7A 4IG7B 1GJZA 3DBHI 3RULA 2KTFA 1OTRB 2KKCA 2L05A 4KIKB 4HCPB 2MBBB 2LJ5A 3V62A 3NS8A 3JVZX 3O65B 2JXXA 4IM0A 5IAAC 3V61A 2EMSA 2IZVB 4W9IA 3PGEA 1UELA 3PPAA 3N32A 1A5RA 1H4RA 3L54A 2JT4B 3AU5A 3AXCA 3QJZA 4NQLB 4FADA 4BKGA 3KW5B 4DK5A 1G6JA 3H7SA 1V5TA 4B95A 1TZ1A 3DVNV 2RGFA 3QK0A 2C9WB 3X23A 3OAWA 2JRHA 4A20A 4MEMA 2FCNA 3M95A 3OJ3A 4EZKA 4M8NA 2LZ6A 4ZYNA 2MA9B 3L17A 4KZCA 2D07B 3OLMD 5TR5A 1P1AA 1TBEA 1UZXB 1GNUA 3RD2A 3UIOB 2K6DB 4BKSD 2NPTB 4GDLB 2JUOA 5JHAA 3A33B 2L00B 2M0XA 2KN5A 3ZW3A 4GU2A 3VAWA 2NVUI 4W9LA 1WJNA 2QHOA 3CMMB 4FHKA 4K1RB 1Q5WB 4LDTB 3NZUA 4NAWB 3HM6X 3WANA 3A9KA 1AARA 2KC1A 3DOWA 4K81A 2ZNVB 2ZCCA 3H7PA 4II2B 4WWNA 3PVLA 2CR5A 4TV3A 5CHWA 5FR6A 3WAOA 4TKNA 4GB9A 3K9OB 1NDDA 4MGYE 4J6IA 1IPGA 2WDTB 5LLIA 4G50A 1V9JA 3IVFA 1WGHA 4G11A 4MGIE 2N9EB 3T9LA 1ZGUB 3GZNI 4KZ0A 4DHZB 4KIKA 2LUEA 2D2QA 1WGRA 4HPLB 1V86A 2MX2A 1V6EA 1WJUA 4HK2A 1YQBA 3DBRI 4FHJA 3WAPA 1WXAA 3B1LX 3QC8B 2CU1A 4HLEA 1P3QU 1WMHA 4N9F4 2GBMA 1J19A 2AEHA 3AU4A 3N30A 1WF9A 3IG3A 1ZKHA 4LCDE 2CHXA 4EZLA 1XQQA 3X0WA 1X1MA 1WE7A 4RM9A 4E3CA 3APCA 2FUHB 3UQBA 3PLVA 1GC6A 1NI2A 2M8SA 3APFA 4HWIB 2DZKA 2GBRA 4I6LB 3LJ3A 4II3B 2KO3A 2NBVB 2M17A 3BINA 3DVGX 3DPDA 3ZVVA 1WY8A 3ZRCA 2J0JA 4GIVA 4IC7B 3VTUA 4AUQC 4NAWA 1YJ1A 2NBUA 2L0TA 2N7EA 2FCQA 4NNJB 1S1QB 3PRPB 1OQYA 4W9FA 3C0RB 2N4FA 4NJ6A 5J17A 1RRBA 4WJOA 3EECA 3DDCB 2MCNB 3JYUA 4HDQA 1SIFA 1WMHB 4F8CB 4OVUA 2EMTA 5DPWA 1IYFA 2G4SA 3R66C 1E8WA 2DYBA 2LWPA 3RYTA 2NS5A 3EHVA 1V2YA 1WM3A 3PRMB 2A4ZA 2WYQA 2LXAA 4I6PA 5AEKB 1OEYJ 5D2MB 3DVNU 4BKSA 4PS3A 1J8CA 2KDFB 3NZSA 1LFDA 2KX3A 1UD7A 2BPSA 3D32A 1OEYA 2LVQA 3V6EB 3PHXB 5AZFA 1KOTA 3W1SA 2KDBA 1Q0WB 4BFRA 3DVGY 1WIAA 5AZGA 4AOFA 1S3SG 2LI5A 3QIJA 2HJ8A 2MQJA 1WJ6A 2Z0EB 3ZUNA 1F9JA 4BBNF 1E7UA 2Z0DB 5J2RA 2OJRA 4ASWC 2XK5A 3VHTC 2MRPA 4MJSB 2BKRB 2BYVE 1U4AA 1WE6A 3CF6E 3U8ZA 4IM3A 2CS4A 2GBJA 2PE6B 4PS8A 4WJQA 3KYCD 3QX1A 4FJZA 2JWZA 1ISNA 4GDKA 4LDTD 4I6NB 2JF5A 3L0WB 1WI0A 4B9KA 4EEWA 1WZ0A 3OJ4B 3VFKA 2N1WA 1RLFA 2IYDB 2KFJA 2LGXA 5D6JB 3TJPA 4GN1A 2A5UA 4IWQA 3UQAA 2LASA 2HE7A 5CX3A 4GXBA 2UWQA 1KJTA 4W9GA 4NPNA 2AL3A 1WH3A 2K1FA 1R4NI 2EKEC 2N9PC 3I3TB 5E6PA 5GMVA 2V4LA 3VH3B 2MW5A 3R7QA 1L7YA 4HDOA 1OGWA 2ZEQA 1IP9A 1R4MI 1Z5SB 2MLBA 3ZRFA 2IO1B 4RM8A 1E8ZA 2KTRB 2BWFA 2L76A 3MJWA 2KHWB 2FIDA 4MSQB 5KHOA 2NBWB 4DHZE 3DBLI 2CHWA 3JW0X 1SE9A 4FULA 3NHEB 4WJNA 2LRUA 2JZZA 3JSVA 4LJPB 2KK8A 1MG8A 5KHQA 4LJOB 1UH6A 2PEAA 1E90A 4DDGD 4A3OA 4MELA 2O2VB 4EZJA 2J0MA 3H9DA 4M8MA 3WALA 2HD5B 2G3QB 2KDIA 3P2BA 2JVCA 2ZZPB 4KDLB 4CYEA 4ZRKA 4GDLA 1EO6A 3ECIA 2OOBB 3TIXA 4HVBA 1P9DU 2N9XA 2Y5BB 4W9EA 5C23A 1YX5B 2C5LC 2GMIC 3ZO5B 1RFAA 4WJPA 4OVVA 3ZNID 1C1YB 3KUCB 5J18A 2O6VB 3KUDB 3UF8A 2MP2B 2FAZA 3EFUA 5JH5C 1WX9A 1Z2MA 3W1YA 1T0YA 3SD5A 4IWPA 2WWZA 1Q1OA 4EOYA 4ZRJA 4CHKA 3ZKJC 2BKFA 3M3JA 2DYMA 1WXSA 2ZNVC 5G2NA 1I35A 3W1SC 2RPQA 1EF1A 5DPSA 3VQIA 1LQBA 2PE9A 5JZEB 2LD9A 4KVGB 3MTNB 4FA6A 2DAJA 2JPHA 2GBKA 4K7SA 2L8JA 3VTWA 2DX5B 1WR1A 4MM3A 3PREA 3KVFB 1YD8U 3QQ8B 4MGZE 4HCNB 4YL8A 2YVCA 3A1QA 4RMAA 4TUUA 3VVWB 4MGKE 1H8CA 4MSMB 2ZCBA 1P98A 2O6VD 5LXIB 4FN2A 3WIMA 5DCNA 2IO3B 1UBQA 4AJYB 4F1SA 4GGQA 2LGYA 2JZ3B 2KXJA 1WXMA 2KJHB 2KTRA 3ML9A 3M63B 4ANUA 3HIZA 1WRDB 3APDA 5IA7A 2KVRA 2KJRA 4PYUA 4IUMB 3A4SC 4NJ7A 3ML8A 2NR2A 4M0WB 1P0RA 1HE8A 2DZIA 1VCBA 2LRWA 4ANXA 2I1KA 3L16A 2D10A 4PS7A 4DBGA 1WGGA 1E8XA 3KUZA 4W9KA 3TL5A 2K25A 3CSTA 2MBOA 4DXAB 2KJ6A 3B08A 3UGBB 3ZLZA 4BOZB 1E8YA 4P7IA 3RUIB 1QZEA 2IY1B 5E6OA 2IO2B 3CSFA 2DAFA 3TBLD 2KDEB 2KANA 2KWCA 4KDIC 1TTNA 3PLUA 1V80A 5D7GA 2BYFA 4W9HA 5LXHA 3V6CB 3WAMA 4IM2A 2MP2A 2XK5B 4IW0A 1V5OA 2CKHB 3HHMA 3TMPB 3ZDMC 3SDLC 3L13A 1I42A 2IY0B 4FJVB 2FIFA 4XC2A 1CMXB 1NBFC 2WX1A 1FXTB 2J7QB 3ALBA 3NY5A 3UINB 4DHJB 2MBQA 4EFOA 3A9KB 4K7UA 5CHFA 2K8HA 2FCSA 3UIPB 3ZNHB 4JQWC 4HXDA 4G3XB 2L7RA 3VTVA 1TGZB 2BGFA 2DENB 1KM7A 3H6NA 2KX0A 5BO4B 3L08A 2IO0B 1V81A 5CTRC 4AP4C 2AYOB 5L83A 3HM3A 2ZVOA 3MHSD 3PRZA 2G45B 4EKUA 2MWSB 3AI5A 2RD0A 2RSUA 4A3PA 2ZJDA 3ZTDA 3A1QB 4MH0E 4AJWA 1VD2A 1XD3B 2KMAA 2DYOA 2C7MB 2DZMA 2DHZA 3V60A 4MJSA 2B3AA 4K7WA 1SGHA 2REXA 3RZWC 4JLCA 4GSWA 4BOSC 4WWPA 4EUTA 5L95C 1UGMA 3B0AA 4KSKC 4URKA 3S2AA 2LGDA 2W9NA 2N7DA 4JL9A 1D3ZA 5CHVC 3LDZE 3KH0A 2KNBA 1M94A 2MBEA 3IFWB 4GMVA 3AULA 2L3ZA 3H7PB 3N3KB 2LVPA 4NY0A 2LVOA 1WM2A 3A9JA 3Q3JA 1GC7A 1EF5A 2IBIB 3ZIMA 2KLGA 5HKHA 2CHZA 3IHPC 3ZNZB 4MDKE 2VRRB 1V49A 4E71A 3VXWA 4CO7A 3PZDA 3TCAA 2J0KA 1Y8RC 5EDSA 4IWOA 1K8RB 2G4DB 2LXCA 2FNJB 4BBNC 3QARA 1BT0A 3SU8X 3ONSA 2JY6A 4FJYA 5D94A 2KLCA 2I1JA 3R3MA 1WGYA 4XX5A 2GOWA 3U7DA 1KLVA 1E7VA 1JRUA 1WR6E 4E74A 3QA8A 2XBBC 3H1UA 2O2VA 2BF8B 5DPRA 2C60A 1GG3A 2BWES 3VUWA 1RAXA 2M1MA 2O6VA 4DHJD 2RR9A 3JSVB 2K8CA 2BYEA 2L0FA 1XT9B 3QWZB 2K6QA 2PJHA 2ZPYA 3PV1A 2K39A 4ZDVA 3Q3FA 2Z59B 3VUYA 5C1ZA 4AWJA 2KFKA 4DWFA 4W9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYD D;  2KZR A;  3QCA A;  2V1Y A;  3DQV A;  4B6W A;  1J0G A;  1LM8 B;  2FCM A;  2AWT A;  3RCZ A;  1YIW A;  4KV2 A;  4F7Z A;  4W9C A;  3NOB A;  3DCG A;  5DPT A;  3K9P B;  3RZF A;  1L2N A;  3PT2 B;  1ZW7 A;  3EC8 A;  3ZTC A;  2GBN A;  5JHB A;  1WJ4 A;  1E5W A;  2DZJ A;  2KMC A;  3QAQ A;  2D11 A;  4WAA A;  3U30 A;  3ENE A;  3ZDT A;  1UBI A;  4FBJ B;  2KQ7 A;  2R2Q A;  3QHT A;  2KWU B;  2D3G A;  3HK0 A;  3ZNG C;  1WFY A;  1WZ3 A;  3RT3 B;  1WX8 A;  2C7N B;  5E6N A;  3PS6 A;  3VH4 B;  2R2O A;  2C7H A;  4ANV A;  2K8B A;  4WQO B;  3A9J B;  4GOC A;  4TQ0 A;  1EUV B;  3A4R A;  4ICV A;  3PSE B;  2KOX A;  5AZH A;  2NCN A;  4ZRI A;  2UYZ B;  4KSL C;  2MBH A;  1WXV A;  3IBE A;  3L10 B;  2XEW A;  3PHW B;  4G0N B;  2JRI B;  4ICU A;  4JIO U;  4PYZ A;  4TQ1 A;  4BKT A;  2KC2 A;  3GOE A;  2M4N A;  4XZ4 A;  4FLH A;  4BVU C;  2N1V A;  3R7R A;  2ZVN A;  3VUX A;  2AL6 A;  1PQS A;  4ANW A;  4NQK E;  2ASQ A;  4JGH B;  1WGD A;  4HPM B;  3PTF C;  2KFK B;  2NPT A;  3SHQ A;  2MSE D;  3WA0 A;  2ZPN A;  3M62 B;  4DDI D;  2KWV B;  1GUA B;  3DBS A;  1C3T A;  2V3S A;  2KD0 A;  3BY4 B;  2HTH A;  1LXD A;  3T8M A;  2WX0 A;  4WWO A;  4GDK B;  5G55 A;  4W9J A;  4X57 B;  3VDZ A;  4HJK A;  2KQS A;  1YX6 B;  1WYW B;  2PPH A;  2YLM A;  1WX7 A;  4IG7 B;  1GJZ A;  3DBH I;  3RUL A;  2KTF A;  1OTR B;  2KKC A;  2L05 A;  4KIK B;  4HCP B;  2MBB B;  2LJ5 A;  3V62 A;  3NS8 A;  3JVZ X;  3O65 B;  2JXX A;  4IM0 A;  5IAA C;  3V61 A;  2EMS A;  2IZV B;  4W9I A;  3PGE A;  1UEL A;  3PPA A;  3N32 A;  1A5R A;  1H4R A;  3L54 A;  2JT4 B;  3AU5 A;  3AXC A;  3QJZ A;  4NQL B;  4FAD A;  4BKG A;  3KW5 B;  4DK5 A;  1G6J A;  3H7S A;  1V5T A;  4B95 A;  1TZ1 A;  3DVN V;  2RGF A;  3QK0 A;  2C9W B;  3X23 A;  3OAW A;  2JRH A;  4A20 A;  4MEM A;  2FCN A;  3M95 A;  3OJ3 A;  4EZK A;  4M8N A;  2LZ6 A;  4ZYN A;  2MA9 B;  3L17 A;  4KZC A;  2D07 B;  3OLM D;  5TR5 A;  1P1A A;  1TBE A;  1UZX B;  1GNU A;  3RD2 A;  3UIO B;  2K6D B;  4BKS D;  2NPT B;  4GDL B;  2JUO A;  5JHA A;  3A33 B;  2L00 B;  2M0X A;  2KN5 A;  3ZW3 A;  4GU2 A;  3VAW A;  2NVU I;  4W9L A;  1WJN A;  2QHO A;  3CMM B;  4FHK A;  4K1R B;  1Q5W B;  4LDT B;  3NZU A;  4NAW B;  3HM6 X;  3WAN A;  3A9K A;  1AAR A;  2KC1 A;  3DOW A;  4K81 A;  2ZNV B;  2ZCC A;  3H7P A;  4II2 B;  4WWN A;  3PVL A;  2CR5 A;  4TV3 A;  5CHW A;  5FR6 A;  3WAO A;  4TKN A;  4GB9 A;  3K9O B;  1NDD A;  4MGY E;  4J6I A;  1IPG A;  2WDT B;  5LLI A;  4G50 A;  1V9J A;  3IVF A;  1WGH A;  4G11 A;  4MGI E;  2N9E B;  3T9L A;  1ZGU B;  3GZN I;  4KZ0 A;  4DHZ B;  4KIK A;  2LUE A;  2D2Q A;  1WGR A;  4HPL B;  1V86 A;  2MX2 A;  1V6E A;  1WJU A;  4HK2 A;  1YQB A;  3DBR I;  4FHJ A;  3WAP A;  1WXA A;  3B1L X;  3QC8 B;  2CU1 A;  4HLE A;  1P3Q U;  1WMH A;  4N9F 4;  2GBM A;  1J19 A;  2AEH A;  3AU4 A;  3N30 A;  1WF9 A;  3IG3 A;  1ZKH A;  4LCD E;  2CHX A;  4EZL A;  1XQQ A;  3X0W A;  1X1M A;  1WE7 A;  4RM9 A;  4E3C A;  3APC A;  2FUH B;  3UQB A;  3PLV A;  1GC6 A;  1NI2 A;  2M8S A;  3APF A;  4HWI B;  2DZK A;  2GBR A;  4I6L B;  3LJ3 A;  4II3 B;  2KO3 A;  2NBV B;  2M17 A;  3BIN A;  3DVG X;  3DPD A;  3ZVV A;  1WY8 A;  3ZRC A;  2J0J A;  4GIV A;  4IC7 B;  3VTU A;  4AUQ C;  4NAW A;  1YJ1 A;  2NBU A;  2L0T A;  2N7E A;  2FCQ A;  4NNJ B;  1S1Q B;  3PRP B;  1OQY A;  4W9F A;  3C0R B;  2N4F A;  4NJ6 A;  5J17 A;  1RRB A;  4WJO A;  3EEC A;  3DDC B;  2MCN B;  3JYU A;  4HDQ A;  1SIF A;  1WMH B;  4F8C B;  4OVU A;  2EMT A;  5DPW A;  1IYF A;  2G4S A;  3R66 C;  1E8W A;  2DYB A;  2LWP A;  3RYT A;  2NS5 A;  3EHV A;  1V2Y A;  1WM3 A;  3PRM B;  2A4Z A;  2WYQ A;  2LXA A;  4I6P A;  5AEK B;  1OEY J;  5D2M B;  3DVN U;  4BKS A;  4PS3 A;  1J8C A;  2KDF B;  3NZS A;  1LFD A;  2KX3 A;  1UD7 A;  2BPS A;  3D32 A;  1OEY A;  2LVQ A;  3V6E B;  3PHX B;  5AZF A;  1KOT A;  3W1S A;  2KDB A;  1Q0W B;  4BFR A;  3DVG Y;  1WIA A;  5AZG A;  4AOF A;  1S3S G;  2LI5 A;  3QIJ A;  2HJ8 A;  2MQJ A;  1WJ6 A;  2Z0E B;  3ZUN A;  1F9J A;  4BBN F;  1E7U A;  2Z0D B;  5J2R A;  2OJR A;  4ASW C;  2XK5 A;  3VHT C;  2MRP A;  4MJS B;  2BKR B;  2BYV E;  1U4A A;  1WE6 A;  3CF6 E;  3U8Z A;  4IM3 A;  2CS4 A;  2GBJ A;  2PE6 B;  4PS8 A;  4WJQ A;  3KYC D;  3QX1 A;  4FJZ A;  2JWZ A;  1ISN A;  4GDK A;  4LDT D;  4I6N B;  2JF5 A;  3L0W B;  1WI0 A;  4B9K A;  4EEW A;  1WZ0 A;  3OJ4 B;  3VFK A;  2N1W A;  1RLF A;  2IYD B;  2KFJ A;  2LGX A;  5D6J B;  3TJP A;  4GN1 A;  2A5U A;  4IWQ A;  3UQA A;  2LAS A;  2HE7 A;  5CX3 A;  4GXB A;  2UWQ A;  1KJT A;  4W9G A;  4NPN A;  2AL3 A;  1WH3 A;  2K1F A;  1R4N I;  2EKE C;  2N9P C;  3I3T B;  5E6P A;  5GMV A;  2V4L A;  3VH3 B;  2MW5 A;  3R7Q A;  1L7Y A;  4HDO A;  1OGW A;  2ZEQ A;  1IP9 A;  1R4M I;  1Z5S B;  2MLB A;  3ZRF A;  2IO1 B;  4RM8 A;  1E8Z A;  2KTR B;  2BWF A;  2L76 A;  3MJW A;  2KHW B;  2FID A;  4MSQ B;  5KHO A;  2NBW B;  4DHZ E;  3DBL I;  2CHW A;  3JW0 X;  1SE9 A;  4FUL A;  3NHE B;  4WJN A;  2LRU A;  2JZZ A;  3JSV A;  4LJP B;  2KK8 A;  1MG8 A;  5KHQ A;  4LJO B;  1UH6 A;  2PEA A;  1E90 A;  4DDG D;  4A3O A;  4MEL A;  2O2V B;  4EZJ A;  2J0M A;  3H9D A;  4M8M A;  3WAL A;  2HD5 B;  2G3Q B;  2KDI A;  3P2B A;  2JVC A;  2ZZP B;  4KDL B;  4CYE A;  4ZRK A;  4GDL A;  1EO6 A;  3ECI A;  2OOB B;  3TIX A;  4HVB A;  1P9D U;  2N9X A;  2Y5B B;  4W9E A;  5C23 A;  1YX5 B;  2C5L C;  2GMI C;  3ZO5 B;  1RFA A;  4WJP A;  4OVV A;  3ZNI D;  1C1Y B;  3KUC B;  5J18 A;  2O6V B;  3KUD B;  3UF8 A;  2MP2 B;  2FAZ A;  3EFU A;  5JH5 C;  1WX9 A;  1Z2M A;  3W1Y A;  1T0Y A;  3SD5 A;  4IWP A;  2WWZ A;  1Q1O A;  4EOY A;  4ZRJ A;  4CHK A;  3ZKJ C;  2BKF A;  3M3J A;  2DYM A;  1WXS A;  2ZNV C;  5G2N A;  1I35 A;  3W1S C;  2RPQ A;  1EF1 A;  5DPS A;  3VQI A;  1LQB A;  2PE9 A;  5JZE B;  2LD9 A;  4KVG B;  3MTN B;  4FA6 A;  2DAJ A;  2JPH A;  2GBK A;  4K7S A;  2L8J A;  3VTW A;  2DX5 B;  1WR1 A;  4MM3 A;  3PRE A;  3KVF B;  1YD8 U;  3QQ8 B;  4MGZ E;  4HCN B;  4YL8 A;  2YVC A;  3A1Q A;  4RMA A;  4TUU A;  3VVW B;  4MGK E;  1H8C A;  4MSM B;  2ZCB A;  1P98 A;  2O6V D;  5LXI B;  4FN2 A;  3WIM A;  5DCN A;  2IO3 B;  1UBQ A;  4AJY B;  4F1S A;  4GGQ A;  2LGY A;  2JZ3 B;  2KXJ A;  1WXM A;  2KJH B;  2KTR A;  3ML9 A;  3M63 B;  4ANU A;  3HIZ A;  1WRD B;  3APD A;  5IA7 A;  2KVR A;  2KJR A;  4PYU A;  4IUM B;  3A4S C;  4NJ7 A;  3ML8 A;  2NR2 A;  4M0W B;  1P0R A;  1HE8 A;  2DZI A;  1VCB A;  2LRW A;  4ANX A;  2I1K A;  3L16 A;  2D10 A;  4PS7 A;  4DBG A;  1WGG A;  1E8X A;  3KUZ A;  4W9K A;  3TL5 A;  2K25 A;  3CST A;  2MBO A;  4DXA B;  2KJ6 A;  3B08 A;  3UGB B;  3ZLZ A;  4BOZ B;  1E8Y A;  4P7I A;  3RUI B;  1QZE A;  2IY1 B;  5E6O A;  2IO2 B;  3CSF A;  2DAF A;  3TBL D;  2KDE B;  2KAN A;  2KWC A;  4KDI C;  1TTN A;  3PLU A;  1V80 A;  5D7G A;  2BYF A;  4W9H A;  5LXH A;  3V6C B;  3WAM A;  4IM2 A;  2MP2 A;  2XK5 B;  4IW0 A;  1V5O A;  2CKH B;  3HHM A;  3TMP B;  3ZDM C;  3SDL C;  3L13 A;  1I42 A;  2IY0 B;  4FJV B;  2FIF A;  4XC2 A;  1CMX B;  1NBF C;  2WX1 A;  1FXT B;  2J7Q B;  3ALB A;  3NY5 A;  3UIN B;  4DHJ B;  2MBQ A;  4EFO A;  3A9K B;  4K7U A;  5CHF A;  2K8H A;  2FCS A;  3UIP B;  3ZNH B;  4JQW C;  4HXD A;  4G3X B;  2L7R A;  3VTV A;  1TGZ B;  2BGF A;  2DEN B;  1KM7 A;  3H6N A;  2KX0 A;  5BO4 B;  3L08 A;  2IO0 B;  1V81 A;  5CTR C;  4AP4 C;  2AYO B;  5L83 A;  3HM3 A;  2ZVO A;  3MHS D;  3PRZ A;  2G45 B;  4EKU A;  2MWS B;  3AI5 A;  2RD0 A;  2RSU A;  4A3P A;  2ZJD A;  3ZTD A;  3A1Q B;  4MH0 E;  4AJW A;  1VD2 A;  1XD3 B;  2KMA A;  2DYO A;  2C7M B;  2DZM A;  2DHZ A;  3V60 A;  4MJS A;  2B3A A;  4K7W A;  1SGH A;  2REX A;  3RZW C;  4JLC A;  4GSW A;  4BOS C;  4WWP A;  4EUT A;  5L95 C;  1UGM A;  3B0A A;  4KSK C;  4URK A;  3S2A A;  2LGD A;  2W9N A;  2N7D A;  4JL9 A;  1D3Z A;  5CHV C;  3LDZ E;  3KH0 A;  2KNB A;  1M94 A;  2MBE A;  3IFW B;  4GMV A;  3AUL A;  2L3Z A;  3H7P B;  3N3K B;  2LVP A;  4NY0 A;  2LVO A;  1WM2 A;  3A9J A;  3Q3J A;  1GC7 A;  1EF5 A;  2IBI B;  3ZIM A;  2KLG A;  5HKH A;  2CHZ A;  3IHP C;  3ZNZ B;  4MDK E;  2VRR B;  1V49 A;  4E71 A;  3VXW A;  4CO7 A;  3PZD A;  3TCA A;  2J0K A;  1Y8R C;  5EDS A;  4IWO A;  1K8R B;  2G4D B;  2LXC A;  2FNJ B;  4BBN C;  3QAR A;  1BT0 A;  3SU8 X;  3ONS A;  2JY6 A;  4FJY A;  5D94 A;  2KLC A;  2I1J A;  3R3M A;  1WGY A;  4XX5 A;  2GOW A;  3U7D A;  1KLV A;  1E7V A;  1JRU A;  1WR6 E;  4E74 A;  3QA8 A;  2XBB C;  3H1U A;  2O2V A;  2BF8 B;  5DPR A;  2C60 A;  1GG3 A;  2BWE S;  3VUW A;  1RAX A;  2M1M A;  2O6V A;  4DHJ D;  2RR9 A;  3JSV B;  2K8C A;  2BYE A;  2L0F A;  1XT9 B;  3QWZ B;  2K6Q A;  2PJH A;  2ZPY A;  3PV1 A;  2K39 A;  4ZDV A;  3Q3F A;  2Z59 B;  3VUY A;  5C1Z A;  4AWJ A;  2KFK A;  4DWF A;  4W9D A; 
#chains in the Genus database with same CATH topology
 3KYD D;  1NVI D;  4YSZ B;  2JWU A;  2KT7 A;  1YIW A;  4KV2 A;  4F7Z A;  4W9C A;  2KYW A;  3NOB A;  2WXF A;  3DCG A;  5DPT A;  3K9P B;  2IJ0 A;  3PT2 B;  2HTM E;  3EC8 A;  2GBN A;  1YN5 A;  5JHB A;  2BTE A;  3QAQ A;  2D11 A;  4WAA A;  2MJ3 A;  3I5J C;  3KWV A;  2N9L A;  1NEK B;  3RT3 B;  1QOF A;  2C7N B;  2KVZ A;  3W5U B;  1V8C A;  4TQ0 A;  1EUV B;  3Q8A A;  3AEF B;  3PSE B;  2NCN A;  4ZRI A;  2UYZ B;  4KSL C;  2N9K A;  3NS1 A;  2KC2 A;  4M0W A;  4XGA B;  4XZ4 A;  2N1V A;  3MP9 A;  4HPM B;  2KFK B;  2NPT A;  3SEB A;  3SHQ A;  3WA0 A;  3AE4 B;  3N20 C;  3M62 B;  4DDI D;  2KWV B;  2V3S A;  1LXD A;  3T8M A;  3N1Y C;  4WWO A;  4W9J A;  2QIL A;  1PGB A;  2PPH A;  4ARC A;  1GJZ A;  3C19 A;  1OTR B;  2KKC A;  3NRZ A;  2MBB B;  4L1B A;  3JVZ X;  1R4M B;  3O65 B;  4KGS A;  5IAA C;  2IZV B;  2M0A A;  3PPA A;  2UU7 A;  4FAD A;  4BKG A;  4DK5 A;  1G6J A;  1UNS A;  1TZ1 A;  3AE5 B;  4IDI A;  1C4A A;  1MHH E;  3OAW A;  2JRH A;  3R2T A;  2K5P A;  2FCN A;  3OJ3 A;  3PZ7 A;  3L17 A;  2D07 B;  3OLM D;  1P1A A;  3UIO B;  2BS3 B;  1XF5 L;  2AQ3 B;  5JHA A;  2V9H A;  1KTK A;  2XN9 C;  1YQ3 B;  3FIL B;  3IAS 1;  1AAR A;  1E10 A;  2ZNV B;  4II2 B;  2CR5 A;  3NVZ A;  5CHW A;  4GB9 A;  1IPG A;  1V9J A;  2WDQ B;  2JX5 A;  4G11 A;  5BMI A;  1ZGU B;  2LUE A;  1PGA A;  4HPL B;  1WGR A;  2D2Q A;  2MX2 A;  1WJU A;  2FE8 A;  3B1L X;  3QC8 B;  1P3Q U;  1J19 A;  3RNA C;  1XLN A;  3IG3 A;  3Q3N C;  4LCD E;  4P1C C;  3AEB B;  2OED A;  3PLV A;  2M8S A;  1YQ4 B;  3LJ3 A;  2M17 A;  3BIN A;  2H89 B;  3HRD D;  1AN8 A;  1C4P A;  2FUG 1;  2J0J A;  3AB5 A;  3B2G A;  4GIV A;  3L4P A;  1FIQ A;  1TYG B;  2L0T A;  1S1Q B;  3PRP B;  1VLB A;  1A70 A;  2N4F A;  3E9S A;  4REZ A;  4JWS C;  4OVU A;  1NEN B;  5TSS A;  2G4S A;  3U7Z A;  2DYB A;  1I4Q A;  1WM3 A;  5AEK B;  1OEY J;  5BMH A;  5D2M B;  3DVN U;  4ZHP A;  3DWM A;  3NZS A;  1UD7 A;  2BPS A;  3D32 A;  4JPS A;  3PHX B;  5AZF A;  4LNF A;  2KQ4 X;  3W1S A;  4C4V B;  5AZG A;  4AOF A;  2RDH A;  2HJ8 A;  1V1P A;  1D4B A;  1OQQ A;  2XK5 A;  3VHT C;  2BKR B;  1WE6 A;  1FMA D;  1L6U A;  3CF6 E;  4IM3 A;  2GBJ A;  4YSX B;  2PE6 B;  4JX1 C;  3KYC D;  2JWZ A;  1ISN A;  2KN4 A;  4LDT D;  3P63 A;  4EEW A;  2IYD B;  5HHD G;  3Q8E A;  3UQA A;  4GXB A;  2L32 A;  2AL3 A;  1BUI C;  5GMV A;  1L7Y A;  1OGW A;  1R4M I;  1Z5S B;  4MSQ B;  2FID A;  2V4I B;  2K9X A;  1SE9 A;  3NHE B;  1MG8 A;  1E90 A;  4EZJ A;  2O2V B;  2J0M A;  2BBC A;  1P7E A;  2K3U A;  1VDV A;  1EWY C;  2HD5 B;  4ZRK A;  3TIX A;  1EO6 A;  1XEE A;  1B1Z A;  2AQ2 B;  4HKQ A;  3ZO5 B;  4WJP A;  2WNM A;  4XE0 A;  2O6V B;  4A6Q A;  2FBW B;  1Z2M A;  1V97 A;  3MJ5 A;  2BKF A;  1J7A A;  4XDD A;  2DYM A;  1WXS A;  4JE3 B;  3AE6 B;  2WXP A;  2RPQ A;  2NMQ A;  2PE9 A;  3IAM 1;  2PW9 A;  4M01 A;  1OQR A;  3MTN B;  4FA6 A;  2DAJ A;  4K7S A;  2L8J A;  2DX5 B;  3PRE A;  3A1Q A;  4TUU A;  3TEY A;  2LEK A;  4MGK E;  1H8C A;  4MSM B;  2ZCB A;  1P98 A;  4P6V F;  3WIM A;  2IPK D;  2QCZ A;  2IO3 B;  4AQ7 A;  3AEA B;  4AJY B;  1OFF A;  4F1S A;  1FNU A;  1WXM A;  1JWA D;  3ML9 A;  1WRD B;  1M4V A;  3APD A;  4PYU A;  4IUM B;  4NJ7 A;  1I4P A;  3R8B A;  5FR3 A;  1HE8 A;  5BYR A;  4OZC A;  2I1K A;  4DBG A;  3CST A;  1VZ6 A;  3B08 A;  2WXK A;  3RUI B;  3MC8 A;  2IY1 B;  2J4X A;  3ZGZ A;  1LO5 D;  4KDI C;  1QT9 A;  5LXH A;  4IM2 A;  2MP2 A;  2Z8L A;  3KWL A;  2Y5P A;  3Q14 C;  1FCC C;  2J7Q B;  1ESF A;  3V3X A;  4EFO A;  1UUP A;  4ITK A;  3UIP B;  4HXD A;  4G3X B;  4NZL B;  3VTV A;  1T3Q A;  2BGF A;  5BO4 B;  3L08 A;  1V81 A;  4AP4 C;  1KLU D;  2QC8 A;  3MHS D;  3LYY A;  3ZTD A;  3KLS X;  1I7H A;  1XD3 B;  2KMA A;  3V60 A;  2B3A A;  4K7W A;  3RZW C;  2OHF A;  4JLC A;  4BOS C;  1N5X A;  4URK A;  2BS4 B;  3S2A A;  1D3Z A;  2PTL A;  1DOY A;  1FO4 A;  1M94 A;  2VZK D;  3RNF C;  4GMV A;  4PK1 A;  3H7P B;  2IBI B;  3GE3 C;  3ZIM A;  2KLG A;  3IHP C;  5H8Y E;  4YWG G;  2VRR B;  1WYG A;  2GRI A;  2GB1 A;  2G4D B;  1PFD A;  2IND C;  2FNJ B;  3RNE C;  3MFG A;  3SU8 X;  4FJY A;  4KKJ A;  5D94 A;  2KLC A;  1WGY A;  3BVZ A;  1FFV A;  3P42 A;  2WGS A;  3H1U A;  2O2V A;  2C60 A;  1GG3 A;  3VUW A;  2O6V A;  1E0Z A;  2BYE A;  1XT9 B;  3QWZ B;  2KAC A;  2K6Q A;  2PJH A;  2WDR B;  3LXF A;  3PV1 A;  3URY A;  2Z59 B;  1SB3 C;  2KFK A;  2KZR A;  4B6W A;  2V1Y A;  2AWT A;  1EWC A;  3RZF A;  1ZW7 A;  1JWB D;  1TT5 B;  4FBJ B;  3J9C A;  1SIJ A;  3QHT A;  2D3G A;  2KWU B;  1RFK A;  1WFY A;  1WZ3 A;  4RGN A;  3V05 A;  2JYT A;  5E6N A;  2X8X X;  2WXH A;  4ANV A;  4WQO B;  5AZH A;  3AEC B;  2N0S B;  1YJI A;  3W2D A;  1KLG D;  3IBE A;  1Q10 A;  2XEW A;  3PHW B;  4TQ1 A;  1QIL A;  2SEB D;  3VUX A;  2ZVN A;  4MAC A;  2AL6 A;  4ANW A;  2ASQ A;  2WDV B;  4BZA A;  3PTF C;  2ZPN A;  3U2S C;  3MC0 B;  3BY4 B;  1GB1 A;  1XLO A;  1GB4 A;  1ZE3 D;  4X57 B;  4HJK A;  1YX6 B;  1SEB D;  2YLM A;  2AX5 A;  4TSS A;  4KIK B;  4HCP B;  4IOI E;  1FRD A;  3HVD A;  4USA A;  4RGO S;  2JXX A;  4IM0 A;  3BYT B;  2EMS A;  3PGE A;  1FNW A;  3U52 E;  1H4R A;  3BK2 A;  4NQL B;  3ZJV A;  1V5T A;  3DHH C;  3P4R B;  2RGF A;  1RWS A;  1HTQ A;  3QK0 A;  1SBB B;  4MEM A;  3M95 A;  5E6J A;  2MA9 B;  5FKA C;  1GNU A;  3RD2 A;  1R4N B;  2W55 A;  4BKS D;  2NPT B;  4GDL B;  2L00 B;  2KN5 A;  3ZW3 A;  4GU2 A;  2QHO A;  3CMM B;  4FHK A;  4K1R B;  4LDT B;  3NZU A;  1KH0 A;  4NAW B;  5D3I B;  5HFY A;  2VH1 A;  1CJE A;  3H7P A;  3PVL A;  4TV3 A;  3WAO A;  2PIA A;  1NDD A;  4J6I A;  2WDT B;  1DYQ A;  3T3O A;  4G50 A;  1WGH A;  3T9L A;  1VRA B;  1QOA A;  5FK9 C;  1TKY A;  5JXV A;  4FHJ A;  1K53 A;  2CU1 A;  3PZ8 A;  1WMH A;  5G5H A;  2GBM A;  4BAX A;  3AU4 A;  1NI3 A;  1WF9 A;  1YNT E;  1ZKH A;  1F2R I;  4N59 A;  4EZL A;  1XQQ A;  1X1M A;  3APC A;  3AE1 B;  1YN4 A;  2EKI A;  1UGJ A;  3BZD B;  4I6L B;  2QEJ C;  2NBV B;  5EE0 A;  3DVG X;  3DPD A;  2WXN A;  1WY8 A;  3ZRC A;  1JAL A;  2AQ1 B;  2BYT A;  4P1B C;  1YJ1 A;  2MHJ A;  4YTP B;  4NNJ B;  1FXA A;  4W9F A;  1QF6 A;  1QOB A;  1AYF A;  1AWD A;  1ACC A;  1K50 A;  3Q8C A;  4HDQ A;  1SIF A;  1WMH B;  2KDM A;  4A8X C;  2MH7 A;  1N63 A;  2LWP A;  1N61 A;  2NS5 A;  5EE9 A;  2DNF A;  1E9M A;  4BKS A;  4LNI A;  1FFU A;  3AMZ A;  2IGD A;  1OEY A;  2LVQ A;  1SXT A;  4YT0 B;  1FD6 A;  2KDB A;  2QSD A;  1WIA A;  1WJ6 A;  3UI3 A;  1MG4 A;  2Z0D B;  4XYC A;  1UWM A;  4P16 A;  2INN E;  2CS4 A;  3GB1 A;  4WJQ A;  1ZXI A;  1ZDV A;  2JF5 A;  5H92 C;  1WZ0 A;  2KFJ A;  2LGX A;  2BVC A;  5D6J B;  2JQR B;  4EE2 A;  2HE7 A;  1ZPS A;  1WH3 A;  2K1F A;  2EKE C;  5E6P A;  1UF0 A;  2V4L A;  2MW5 A;  3R7Q A;  4H2A A;  1NYR A;  1CZP A;  2IO1 B;  1L5P A;  2NBW B;  3AH7 A;  2W3R A;  2CHW A;  2D5G A;  4WJN A;  3RNC C;  1ZP0 B;  5KHQ A;  2PEA A;  4GLS C;  4DDG D;  3AE2 B;  4C56 C;  1SJH D;  1MHX A;  2WXG A;  4M8M A;  1GOZ A;  2KDI A;  2JVC A;  2ZZP B;  2YEP F;  4GDL A;  4C00 A;  4HVB A;  1P9D U;  2LGS A;  4W9E A;  2WS3 B;  1F52 A;  2W54 A;  2RPV A;  1R7S A;  4OVV A;  3ZNI D;  3UF8 A;  2BQQ A;  2FAZ A;  1YN3 A;  2MP2 B;  3OG5 A;  5EE1 A;  5AUK A;  4R3D A;  1T0Y A;  1YMH E;  4CHK A;  3M3J A;  2ZNV C;  3W1S C;  1I4X A;  5JZE B;  1MVK A;  2WXQ A;  3VRB B;  1K51 A;  4KVG B;  2QJL A;  1KF6 B;  2CJN A;  2GBK A;  2JPH A;  3VTW A;  4MM3 A;  3KVF B;  4HCN B;  3TEZ A;  2O6V D;  2JYE A;  5I4D A;  2PMV A;  5DCN A;  1VR9 A;  2LGY A;  2JZ3 B;  3DBH B;  2KJH B;  2RMM A;  5IA7 A;  5HI1 A;  3ML8 A;  2NR2 A;  1P0R A;  2G9H D;  1V1O A;  1F2R C;  1L4D B;  4IKG A;  4ANX A;  3BWU D;  1E8X A;  3KUZ A;  4KGT A;  1T0S C;  4AS1 A;  2KJ6 A;  2BS2 B;  1E8Y A;  4P7I A;  3Q69 A;  3RN9 C;  4US8 A;  4J3O D;  1QZE A;  4OZB A;  3CSF A;  4HJG E;  4YXD B;  2KWC A;  3PLU A;  4RCO A;  1NYQ A;  2BYF A;  4W9H A;  1XCT L;  2V0G A;  3WAM A;  4UDU C;  2XK5 B;  4IW0 A;  3FAH A;  2CJO A;  3HHM A;  3Q2A C;  3TMP B;  3ETR A;  3ZDM C;  5BMG A;  3L13 A;  2KAJ A;  2IY0 B;  4FJV B;  3I9V 1;  1ET6 A;  4L2Y A;  1FXT B;  3DWG C;  3NY5 A;  1VZ8 A;  4C80 A;  1J7B A;  5CHF A;  2K8H A;  1YJJ A;  1TGZ B;  4KX6 B;  3Q3M C;  1IBX A;  1I4R A;  2MWS B;  3FC4 A;  4A3P A;  1FNV A;  3A1Q B;  4WH4 A;  2J53 A;  1VD2 A;  4AJW A;  4YTN B;  1WGK A;  1J7C A;  3TSS A;  2REX A;  3U4E G;  4WWP A;  5L95 C;  3BVM A;  3RNG C;  4KSK C;  4KKI A;  3AN1 A;  4A90 A;  3LDZ E;  3KH0 A;  2KNB A;  2WXI A;  3IFW B;  3P4S B;  2LVP A;  2L1A A;  1EF5 A;  3LB8 C;  2QIE B;  2CHZ A;  1I4G A;  1L0V B;  3ZNZ B;  4C7Y A;  1V49 A;  1VJK A;  4E71 A;  3AEG B;  4CO7 A;  3FKY A;  4WWM A;  2LXC A;  2DBY A;  3ONS A;  4PT5 A;  4XX5 A;  2IGH A;  1KLV A;  1SSN A;  1JRU A;  1WR6 E;  4WAF A;  3EGR A;  1D5X C;  1RAX A;  4HEA 1;  3JSV B;  2QDF A;  2K8C A;  2ZPY A;  5C1Z A;  3VUY A;  3I57 A;  3QCA A;  1EM7 A;  1J0G A;  2FCM A;  5BYQ A;  1L2N A;  1PYW D;  2YEP B;  1WJ4 A;  1E5W A;  3U30 A;  3ENE A;  3ZDT A;  3SFD B;  2KQ7 A;  2R2Q A;  4YSY B;  3ZNG C;  3TEW A;  1BML C;  1SJE D;  4D2K A;  2K8B A;  4LNO A;  3A9J B;  4ICV A;  2KOX A;  1V1P B;  2JSV X;  2MBH A;  2V3N A;  4RFB A;  4G0N B;  3L10 B;  4BKT A;  4JIO U;  4C4V A;  2M4N A;  4BVU C;  4FLH A;  3R7R A;  4NJC A;  3ZJU A;  4JGH B;  1WGD A;  3IT6 B;  4CQN A;  1QLB B;  2MSE D;  1JW9 D;  2Y3A A;  1GUA B;  3DBS A;  3W5V B;  2KD0 A;  2HTH A;  4GDK B;  2INC C;  4K3C A;  2KQS A;  4IG7 B;  2WQY B;  1HQR D;  2L05 A;  3VR9 B;  2LJ5 A;  3V62 A;  3V61 A;  1XO3 A;  1UEL A;  1A5R A;  3AU5 A;  3AXC A;  3KW5 B;  3AEE B;  2LUM A;  3BYY B;  3N1Z C;  3DVN V;  1TS3 A;  2INP E;  2C9W B;  3X23 A;  3RI7 C;  1MI0 A;  4M8N A;  4ZYN A;  2M56 B;  5TR5 A;  2K6D B;  1ZOY B;  2ZW1 A;  2RDB C;  3VAW A;  1Q5W B;  2IDY A;  3HM6 X;  1C77 A;  3SR6 A;  3WAN A;  4M00 A;  2KC1 A;  3DOW A;  1IBX B;  2ZCC A;  4WWN A;  3P1M A;  2ZW0 A;  4MGY E;  4M02 A;  5LLI A;  4OHJ A;  4MGI E;  2GI9 A;  2R61 A;  3GZN I;  4DHZ B;  4KIK A;  3GE8 C;  5IP4 D;  4HK2 A;  3MHZ A;  3WAP A;  1YQB A;  3B2F A;  2MJE A;  1F77 A;  3N30 A;  1DOX A;  3X0W A;  1RM6 C;  2Q5W D;  4RM9 A;  3UQB A;  1QQR A;  1GC6 A;  1NI2 A;  2GBR A;  3BVG A;  2KO3 A;  1Y56 A;  4IC7 B;  4AUQ C;  1T5X D;  3O13 A;  2N7E A;  3NUH B;  2FCQ A;  1YOV B;  1OQY A;  1B9R A;  3C0R B;  1TJE A;  4NJ6 A;  1TS4 A;  3DDC B;  1TS5 A;  2DLB A;  4K3B A;  4F8C B;  2EMT A;  1STE A;  5DPW A;  4OW0 A;  3NG0 A;  4FXC A;  2NTS A;  3EHV A;  1V2Y A;  1WRI A;  2A4Z A;  1TS2 A;  1JML A;  2WYQ A;  4I6P A;  2LHD A;  1JRO A;  1AW7 A;  2BB5 A;  3DBL B;  1ZDX A;  1Q0W B;  3DVG Y;  2MQJ A;  3ZUN A;  1F9J A;  4BBN F;  5J2R A;  2OJR A;  3C8Y A;  4ASW C;  4WIP A;  4MJS B;  3T3N A;  2BYV E;  1U4A A;  1QOG A;  3WCQ A;  4PS8 A;  3QX1 A;  1TZO A;  4FJZ A;  4GDK A;  3L0W B;  2XNA C;  1WI0 A;  4B9K A;  3VFK A;  3AE8 B;  2SAK A;  4N6E B;  2A5U A;  4IWQ A;  1N60 A;  1HXY D;  4W9G A;  1FCL A;  3I3T B;  4ZRQ A;  2N9P C;  1E6E B;  3VH3 B;  4HDO A;  2ZEQ A;  1IP9 A;  2RDG A;  3ZRF A;  2L76 A;  4RF1 A;  2CU3 A;  3DBL I;  4FUL A;  3IXS A;  2LRU A;  2JZZ A;  4LJP B;  2KK8 A;  2X38 A;  4LJO B;  1PGX A;  1UH6 A;  4MEL A;  3RMK C;  3H9D A;  5BYS A;  3WAL A;  2TSS A;  2G3Q B;  4KDL B;  4CYE A;  1DOI A;  2JXT A;  2Y5B B;  2N9X A;  2PLP A;  5C23 A;  1FEH A;  2MEK A;  1RFA A;  1C1Y B;  3KUC B;  5J18 A;  5JH5 C;  4IWP A;  2WWZ A;  1Q1O A;  4EOY A;  1D5Z C;  3H8H A;  5DPS A;  1N62 A;  3VQI A;  1LQB A;  3IT4 B;  4WUR A;  5HG2 A;  2EEL A;  4B0M A;  1MJD A;  1WR1 A;  3Q8F A;  1ET9 A;  1YD8 U;  4MGZ E;  4YL8 A;  2YVC A;  1P7F A;  3GS2 A;  3EUB 2;  4YTM B;  3DHG C;  1EU3 A;  4B0E A;  2KXJ A;  2KTR A;  2N7J A;  3HIZ A;  2KVR A;  2KJR A;  3DBR B;  3ABV B;  2K22 A;  2LHE A;  3A4S C;  4OZA A;  2D3B A;  4DXG A;  2HDE A;  1KFY B;  2D10 A;  4W9K A;  3TL5 A;  2MBO A;  4DXA B;  3UGB B;  2PVO D;  3ZLZ A;  4BOZ B;  5E6O A;  2ON8 A;  2DAF A;  3TBL D;  1V80 A;  3I63 C;  1FM0 D;  3V6C B;  3OWE B;  1V5O A;  3HVZ A;  3SDL C;  4XC2 A;  2L52 A;  1CMX B;  1NBF C;  2WX1 A;  3B9J A;  4DHJ B;  1JWU D;  2MBQ A;  5IKC M;  2FCS A;  3CIR B;  2L7R A;  1C78 A;  3H6N A;  4HRS A;  2KX0 A;  1JQ4 A;  2G1E A;  5L83 A;  3HM3 A;  2ZVO A;  3PRZ A;  2G45 B;  4EKU A;  2BB6 A;  1TKG A;  2ZJD A;  5AUI A;  1D6E C;  2DYO A;  2DHZ A;  4MJS A;  1FXI A;  1F0Z A;  1SGH A;  2J42 A;  3AM9 A;  4GSW A;  4EUT A;  2WXL A;  1UGM A;  2E6X A;  1CQV A;  4JL9 A;  2HJ1 A;  1L0X B;  5CHV C;  1C9F A;  2L3Z A;  5D3D A;  4NY0 A;  2LVO A;  1WM2 A;  3A9J A;  1GC7 A;  1GAQ B;  3VXW A;  3TCA A;  3N9Y C;  5EDS A;  1XLP A;  4IWO A;  1VZ7 A;  1HZ5 A;  2BT6 A;  1BT0 A;  1D5M C;  2JY6 A;  4E74 A;  1C76 A;  2B76 B;  2BF8 B;  5LNK 1;  2BWE S;  1IGD A;  1MPE A;  3AE7 B;  4MM3 B;  4DHJ D;  2M1M A;  4A55 A;  2RR9 A;  3P4Q B;  4ZDV A;  4AWJ A;  4W9D A;  1JWM D;  3DQV A;  1LM8 B;  3RCZ A;  4C7Z A;  1LGR A;  4LTU A;  3ZTC A;  4WQM A;  3AED B;  2DZJ A;  2KMC A;  2WXO A;  3DHI C;  3SFE B;  1UBI A;  2WP9 B;  3HK0 A;  1ENF A;  5EE3 A;  4HPP A;  1WX8 A;  2NTT A;  3PS6 A;  3VH4 B;  2R2O A;  3ZQ4 A;  3FIL A;  2C7H A;  4LK0 M;  3EFC A;  2J52 A;  4LNK A;  1FRR A;  3VR8 B;  4GOC A;  3A4R A;  4A9A A;  3VRA B;  1WXV A;  4PYZ A;  3RNB C;  2JRI B;  4ICU A;  3GOE A;  1I4H A;  1PQS A;  1WSP A;  4NQK E;  1C3T A;  3ZXR A;  2I2Y A;  2WX0 A;  5G55 A;  3VDZ A;  2PVG C;  2WXR A;  1WYW B;  1WX7 A;  1F1H A;  3DBH I;  3RUL A;  2KTF A;  4JWU C;  3RFZ B;  1L0Y B;  1ROE A;  3NS8 A;  4DQO C;  1GPX A;  4W9I A;  1SE2 A;  3AE3 B;  3N32 A;  2H88 B;  3L54 A;  2JT4 B;  3QJZ A;  1JCK B;  3H7S A;  4B95 A;  5GXG B;  1MFW A;  1HZ6 A;  1ZUD 2;  1T6B X;  4EZK A;  2LZ6 A;  4KZC A;  1TBE A;  1UZX B;  3MC9 A;  3BII D;  3NVV A;  2JUO A;  3A33 B;  3ZXV A;  2M0X A;  2NVU I;  4W9L A;  1WJN A;  2E3T A;  5C3J B;  3A9K A;  2DWQ A;  4K81 A;  1JWS D;  5FR6 A;  4TKN A;  2WXJ A;  3K9O B;  4ACF A;  4KGR A;  4S17 A;  3IVF A;  4HKZ E;  2N9E B;  4KZ0 A;  1CK1 A;  1V86 A;  1V6E A;  2V3P A;  3DBR I;  1WXA A;  2JZP A;  4HLE A;  4N9F 4;  2AEH A;  3Q8B A;  4HRO A;  2KMM A;  2CHX A;  4OVZ A;  1WE7 A;  4E3C A;  4DXF A;  1XCQ L;  2FUH B;  3W9C B;  3APF A;  4HWI B;  2DZK A;  3TEX A;  4II3 B;  3AV8 A;  1ZXH A;  2BW2 A;  2W3S A;  3ZVV A;  4QAY A;  4ZYS A;  3VTU A;  1N6Z A;  4NAW A;  2NBU A;  1KRH A;  1HTO A;  3Q3O C;  4XDC A;  5J17 A;  1RRB A;  4WJO A;  3EEC A;  2MCN B;  4O1N A;  3JYU A;  2ACZ B;  1IYF A;  3R66 C;  1E8W A;  1L6V A;  4RGM A;  4XWT A;  3RYT A;  1PDX A;  3PRM B;  2LGI A;  2LXA A;  1L4Z B;  4PS3 A;  1J8C A;  2KDF B;  1T0R C;  1LFD A;  2KX3 A;  1TIF A;  2D3C A;  3V6E B;  1KOT A;  3Q6B A;  4RNA A;  1SE3 A;  3BK1 A;  4XWW A;  4BFR A;  1S3S G;  2LI5 A;  3QIJ A;  3NVW A;  2Z0E B;  1E7U A;  4US9 A;  4MH8 A;  2Y5C A;  2MRP A;  2M19 A;  3NJT A;  3KQ4 A;  3U8Z A;  4TMA B;  2GLS A;  3EA6 A;  3PO0 A;  4I6N B;  4ARI A;  3OJ4 B;  2N1W A;  1RLF A;  3TJP A;  1IGC A;  2LJI A;  4GN1 A;  2LAS A;  2L83 A;  5CX3 A;  2UWQ A;  1KJT A;  4NPN A;  1R4N I;  5T8I A;  1TKE A;  1C79 A;  2MLB A;  4RM8 A;  1E8Z A;  2KTR B;  2BWF A;  3MJW A;  4MT5 A;  2KHW B;  2WXM A;  5KHO A;  4A20 A;  3NZ3 A;  4DHZ E;  3P4P B;  3JW0 X;  1RYJ A;  1BXT A;  3JSV A;  1PUT A;  4A3O A;  3GP7 A;  3P2B A;  2D3A A;  3ECI A;  1N5W A;  2OOB B;  2QMT A;  1IUE A;  3ZYY X;  1YX5 B;  2C5L C;  2GMI C;  5G5G A;  3CWI A;  3KUD B;  3EFU A;  1WX9 A;  3W1Y A;  3SD5 A;  2I38 A;  4ZRJ A;  3ZKJ C;  5G2N A;  1I35 A;  1EF1 A;  4N58 A;  1T0Q C;  2LD9 A;  1TY0 A;  2LFI A;  3QQ8 B;  5IO9 A;  4RMA A;  1SF0 A;  1XXG A;  2W82 A;  3VVW B;  1K52 A;  1HA5 A;  5LXI B;  1WWT A;  4S0R A;  4FN2 A;  1WXQ A;  1HEZ E;  1UBQ A;  4GGQ A;  3R2I A;  2WLB A;  2VH2 A;  3M63 B;  4ANU A;  1XLQ A;  3AE9 B;  4M0W B;  3GZN B;  2DZI A;  2WHI A;  1VCB A;  2ICI A;  2LRW A;  4L23 A;  3L16 A;  4PS7 A;  1WGG A;  3N1X C;  4ZHO A;  2K25 A;  5C2T B;  4ZOH C;  2K0P A;  4LNN A;  4ZRP A;  2IO2 B;  2IGG A;  2KDE B;  2KAN A;  5D7G A;  1TTN A;  3RPF C;  2CKH B;  1I42 A;  2FIF A;  2PKO A;  4RGT A;  2JU6 X;  3ALB A;  3UIN B;  5IOI A;  2LMC A;  3A9K B;  4K7U A;  3NVY A;  3ZNH B;  4JQW C;  2WU5 B;  1E7P B;  2VZK B;  2DEN B;  1KM7 A;  5MPO A;  2IO0 B;  1JRP A;  5CTR C;  2AYO B;  3AI5 A;  2RD0 A;  2RSU A;  2WU2 B;  3ZJT A;  4MH0 E;  2DZM A;  2C7M B;  4LLG M;  4RF0 A;  3E56 A;  4RH6 A;  1C4C A;  3B0A A;  1QKZ A;  2MJD A;  2ONQ A;  2LGD A;  2W9N A;  2N7D A;  3TUO A;  2MBE A;  3AUL A;  3N3K B;  3Q3J A;  5IN7 A;  5HKH A;  4NAM A;  4MDK E;  2OJW A;  3PZD A;  2J0K A;  1Y8R C;  1K8R B;  4BBN C;  3QAR A;  3HUI A;  1UWX A;  1DGJ A;  2I1J A;  3R3M A;  1SE4 A;  2GOW A;  3U7D A;  1E7V A;  2KWD A;  3QA8 A;  1TY2 A;  2XBB C;  5DPR A;  1EU4 A;  2L0F A;  1FPY A;  2K39 A;  3Q3F A;  4Q2J A;  4DWF A; 
#chains in the Genus database with same CATH homology
 3KYD D;  2KZR A;  3QCA A;  2V1Y A;  3DQV A;  4B6W A;  1J0G A;  1LM8 B;  2FCM A;  2AWT A;  3RCZ A;  1YIW A;  4KV2 A;  4F7Z A;  4W9C A;  3NOB A;  3DCG A;  5DPT A;  3K9P B;  3RZF A;  1L2N A;  3PT2 B;  1ZW7 A;  3EC8 A;  3ZTC A;  2GBN A;  5JHB A;  1WJ4 A;  1E5W A;  2DZJ A;  2KMC A;  3QAQ A;  2D11 A;  4WAA A;  3U30 A;  3ENE A;  3ZDT A;  1UBI A;  4FBJ B;  2KQ7 A;  2R2Q A;  3QHT A;  2KWU B;  2D3G A;  3HK0 A;  3ZNG C;  1WFY A;  1WZ3 A;  3RT3 B;  1WX8 A;  2C7N B;  5E6N A;  3PS6 A;  3VH4 B;  2R2O A;  2C7H A;  4ANV A;  2K8B A;  4WQO B;  3A9J B;  4GOC A;  4TQ0 A;  1EUV B;  3A4R A;  4ICV A;  3PSE B;  2KOX A;  5AZH A;  2NCN A;  4ZRI A;  2UYZ B;  4KSL C;  2MBH A;  1WXV A;  3IBE A;  3L10 B;  2XEW A;  3PHW B;  4G0N B;  2JRI B;  4ICU A;  4JIO U;  4PYZ A;  4TQ1 A;  4BKT A;  2KC2 A;  3GOE A;  2M4N A;  4XZ4 A;  4FLH A;  4BVU C;  2N1V A;  3R7R A;  2ZVN A;  3VUX A;  2AL6 A;  1PQS A;  4ANW A;  4NQK E;  2ASQ A;  4JGH B;  1WGD A;  4HPM B;  3PTF C;  2KFK B;  2NPT A;  3SHQ A;  2MSE D;  3WA0 A;  2ZPN A;  3M62 B;  4DDI D;  2KWV B;  1GUA B;  3DBS A;  1C3T A;  2V3S A;  2KD0 A;  3BY4 B;  2HTH A;  1LXD A;  3T8M A;  2WX0 A;  4WWO A;  4GDK B;  5G55 A;  4W9J A;  4X57 B;  3VDZ A;  4HJK A;  2KQS A;  1YX6 B;  1WYW B;  2PPH A;  2YLM A;  1WX7 A;  4IG7 B;  1GJZ A;  3DBH I;  3RUL A;  2KTF A;  1OTR B;  2KKC A;  2L05 A;  4KIK B;  4HCP B;  2MBB B;  2LJ5 A;  3V62 A;  3NS8 A;  3JVZ X;  3O65 B;  2JXX A;  4IM0 A;  5IAA C;  3V61 A;  2EMS A;  2IZV B;  4W9I A;  3PGE A;  1UEL A;  3PPA A;  3N32 A;  1A5R A;  1H4R A;  3L54 A;  2JT4 B;  3AU5 A;  3AXC A;  3QJZ A;  4NQL B;  4FAD A;  4BKG A;  3KW5 B;  4DK5 A;  1G6J A;  3H7S A;  1V5T A;  4B95 A;  1TZ1 A;  3DVN V;  2RGF A;  3QK0 A;  2C9W B;  3X23 A;  3OAW A;  2JRH A;  4A20 A;  4MEM A;  2FCN A;  3M95 A;  3OJ3 A;  4EZK A;  4M8N A;  2LZ6 A;  4ZYN A;  2MA9 B;  3L17 A;  4KZC A;  2D07 B;  3OLM D;  5TR5 A;  1P1A A;  1TBE A;  1UZX B;  1GNU A;  3RD2 A;  3UIO B;  2K6D B;  4BKS D;  2NPT B;  4GDL B;  2JUO A;  5JHA A;  3A33 B;  2L00 B;  2M0X A;  2KN5 A;  3ZW3 A;  4GU2 A;  3VAW A;  2NVU I;  4W9L A;  1WJN A;  2QHO A;  3CMM B;  4FHK A;  4K1R B;  1Q5W B;  4LDT B;  3NZU A;  4NAW B;  3HM6 X;  3WAN A;  3A9K A;  1AAR A;  2KC1 A;  3DOW A;  4K81 A;  2ZNV B;  2ZCC A;  3H7P A;  4II2 B;  4WWN A;  3PVL A;  2CR5 A;  4TV3 A;  5CHW A;  5FR6 A;  3WAO A;  4TKN A;  4GB9 A;  3K9O B;  1NDD A;  4MGY E;  4J6I A;  1IPG A;  2WDT B;  5LLI A;  4G50 A;  1V9J A;  3IVF A;  1WGH A;  4G11 A;  4MGI E;  2N9E B;  3T9L A;  1ZGU B;  3GZN I;  4KZ0 A;  4DHZ B;  4KIK A;  2LUE A;  2D2Q A;  1WGR A;  4HPL B;  1V86 A;  2MX2 A;  1V6E A;  1WJU A;  4HK2 A;  1YQB A;  3DBR I;  4FHJ A;  3WAP A;  1WXA A;  3B1L X;  3QC8 B;  2CU1 A;  4HLE A;  1P3Q U;  1WMH A;  4N9F 4;  2GBM A;  1J19 A;  2AEH A;  3AU4 A;  3N30 A;  1WF9 A;  3IG3 A;  1ZKH A;  4LCD E;  2CHX A;  4EZL A;  1XQQ A;  3X0W A;  1X1M A;  1WE7 A;  4RM9 A;  4E3C A;  3APC A;  2FUH B;  3UQB A;  3PLV A;  1GC6 A;  1NI2 A;  2M8S A;  3APF A;  4HWI B;  2DZK A;  2GBR A;  4I6L B;  3LJ3 A;  4II3 B;  2KO3 A;  2NBV B;  2M17 A;  3BIN A;  3DVG X;  3DPD A;  3ZVV A;  1WY8 A;  3ZRC A;  2J0J A;  4GIV A;  4IC7 B;  3VTU A;  4AUQ C;  4NAW A;  1YJ1 A;  2NBU A;  2L0T A;  2N7E A;  2FCQ A;  4NNJ B;  1S1Q B;  3PRP B;  1OQY A;  4W9F A;  3C0R B;  2N4F A;  4NJ6 A;  5J17 A;  1RRB A;  4WJO A;  3EEC A;  3DDC B;  2MCN B;  3JYU A;  4HDQ A;  1SIF A;  1WMH B;  4F8C B;  4OVU A;  2EMT A;  5DPW A;  1IYF A;  2G4S A;  3R66 C;  1E8W A;  2DYB A;  2LWP A;  3RYT A;  2NS5 A;  3EHV A;  1V2Y A;  1WM3 A;  3PRM B;  2A4Z A;  2WYQ A;  2LXA A;  4I6P A;  5AEK B;  1OEY J;  5D2M B;  3DVN U;  4BKS A;  4PS3 A;  1J8C A;  2KDF B;  3NZS A;  1LFD A;  2KX3 A;  1UD7 A;  2BPS A;  3D32 A;  1OEY A;  2LVQ A;  3V6E B;  3PHX B;  5AZF A;  1KOT A;  3W1S A;  2KDB A;  1Q0W B;  4BFR A;  3DVG Y;  1WIA A;  5AZG A;  4AOF A;  1S3S G;  2LI5 A;  3QIJ A;  2HJ8 A;  2MQJ A;  1WJ6 A;  2Z0E B;  3ZUN A;  1F9J A;  4BBN F;  1E7U A;  2Z0D B;  5J2R A;  2OJR A;  4ASW C;  2XK5 A;  3VHT C;  2MRP A;  4MJS B;  2BKR B;  2BYV E;  1U4A A;  1WE6 A;  3CF6 E;  3U8Z A;  4IM3 A;  2CS4 A;  2GBJ A;  2PE6 B;  4PS8 A;  4WJQ A;  3KYC D;  3QX1 A;  4FJZ A;  2JWZ A;  1ISN A;  4GDK A;  4LDT D;  4I6N B;  2JF5 A;  3L0W B;  1WI0 A;  4B9K A;  4EEW A;  1WZ0 A;  3OJ4 B;  3VFK A;  2N1W A;  1RLF A;  2IYD B;  2KFJ A;  2LGX A;  5D6J B;  3TJP A;  4GN1 A;  2A5U A;  4IWQ A;  3UQA A;  2LAS A;  2HE7 A;  5CX3 A;  4GXB A;  2UWQ A;  1KJT A;  4W9G A;  4NPN A;  2AL3 A;  1WH3 A;  2K1F A;  1R4N I;  2EKE C;  2N9P C;  3I3T B;  5E6P A;  5GMV A;  2V4L A;  3VH3 B;  2MW5 A;  3R7Q A;  1L7Y A;  4HDO A;  1OGW A;  2ZEQ A;  1IP9 A;  1R4M I;  1Z5S B;  2MLB A;  3ZRF A;  2IO1 B;  4RM8 A;  1E8Z A;  2KTR B;  2BWF A;  2L76 A;  3MJW A;  2KHW B;  2FID A;  4MSQ B;  5KHO A;  2NBW B;  4DHZ E;  3DBL I;  2CHW A;  3JW0 X;  1SE9 A;  4FUL A;  3NHE B;  4WJN A;  2LRU A;  2JZZ A;  3JSV A;  4LJP B;  2KK8 A;  1MG8 A;  5KHQ A;  4LJO B;  1UH6 A;  2PEA A;  1E90 A;  4DDG D;  4A3O A;  4MEL A;  2O2V B;  4EZJ A;  2J0M A;  3H9D A;  4M8M A;  3WAL A;  2HD5 B;  2G3Q B;  2KDI A;  3P2B A;  2JVC A;  2ZZP B;  4KDL B;  4CYE A;  4ZRK A;  4GDL A;  1EO6 A;  3ECI A;  2OOB B;  3TIX A;  4HVB A;  1P9D U;  2N9X A;  2Y5B B;  4W9E A;  5C23 A;  1YX5 B;  2C5L C;  2GMI C;  3ZO5 B;  1RFA A;  4WJP A;  4OVV A;  3ZNI D;  1C1Y B;  3KUC B;  5J18 A;  2O6V B;  3KUD B;  3UF8 A;  2MP2 B;  2FAZ A;  3EFU A;  5JH5 C;  1WX9 A;  1Z2M A;  3W1Y A;  1T0Y A;  3SD5 A;  4IWP A;  2WWZ A;  1Q1O A;  4EOY A;  4ZRJ A;  4CHK A;  3ZKJ C;  2BKF A;  3M3J A;  2DYM A;  1WXS A;  2ZNV C;  5G2N A;  1I35 A;  3W1S C;  2RPQ A;  1EF1 A;  5DPS A;  3VQI A;  1LQB A;  2PE9 A;  5JZE B;  2LD9 A;  4KVG B;  3MTN B;  4FA6 A;  2DAJ A;  2JPH A;  2GBK A;  4K7S A;  2L8J A;  3VTW A;  2DX5 B;  1WR1 A;  4MM3 A;  3PRE A;  3KVF B;  1YD8 U;  3QQ8 B;  4MGZ E;  4HCN B;  4YL8 A;  2YVC A;  3A1Q A;  4RMA A;  4TUU A;  3VVW B;  4MGK E;  1H8C A;  4MSM B;  2ZCB A;  1P98 A;  2O6V D;  5LXI B;  4FN2 A;  3WIM A;  5DCN A;  2IO3 B;  1UBQ A;  4AJY B;  4F1S A;  4GGQ A;  2LGY A;  2JZ3 B;  2KXJ A;  1WXM A;  2KJH B;  2KTR A;  3ML9 A;  3M63 B;  4ANU A;  3HIZ A;  1WRD B;  3APD A;  5IA7 A;  2KVR A;  2KJR A;  4PYU A;  4IUM B;  3A4S C;  4NJ7 A;  3ML8 A;  2NR2 A;  4M0W B;  1P0R A;  1HE8 A;  2DZI A;  1VCB A;  2LRW A;  4ANX A;  2I1K A;  3L16 A;  2D10 A;  4PS7 A;  4DBG A;  1WGG A;  1E8X A;  3KUZ A;  4W9K A;  3TL5 A;  2K25 A;  3CST A;  2MBO A;  4DXA B;  2KJ6 A;  3B08 A;  3UGB B;  3ZLZ A;  4BOZ B;  1E8Y A;  4P7I A;  3RUI B;  1QZE A;  2IY1 B;  5E6O A;  2IO2 B;  3CSF A;  2DAF A;  3TBL D;  2KDE B;  2KAN A;  2KWC A;  4KDI C;  1TTN A;  3PLU A;  1V80 A;  5D7G A;  2BYF A;  4W9H A;  5LXH A;  3V6C B;  3WAM A;  4IM2 A;  2MP2 A;  2XK5 B;  4IW0 A;  1V5O A;  2CKH B;  3HHM A;  3TMP B;  3ZDM C;  3SDL C;  3L13 A;  1I42 A;  2IY0 B;  4FJV B;  2FIF A;  4XC2 A;  1CMX B;  1NBF C;  2WX1 A;  1FXT B;  2J7Q B;  3ALB A;  3NY5 A;  3UIN B;  4DHJ B;  2MBQ A;  4EFO A;  3A9K B;  4K7U A;  5CHF A;  2K8H A;  2FCS A;  3UIP B;  3ZNH B;  4JQW C;  4HXD A;  4G3X B;  2L7R A;  3VTV A;  1TGZ B;  2BGF A;  2DEN B;  1KM7 A;  3H6N A;  2KX0 A;  5BO4 B;  3L08 A;  2IO0 B;  1V81 A;  5CTR C;  4AP4 C;  2AYO B;  5L83 A;  3HM3 A;  2ZVO A;  3MHS D;  3PRZ A;  2G45 B;  4EKU A;  2MWS B;  3AI5 A;  2RD0 A;  2RSU A;  4A3P A;  2ZJD A;  3ZTD A;  3A1Q B;  4MH0 E;  4AJW A;  1VD2 A;  1XD3 B;  2KMA A;  2DYO A;  2C7M B;  2DZM A;  2DHZ A;  3V60 A;  4MJS A;  2B3A A;  4K7W A;  1SGH A;  2REX A;  3RZW C;  4JLC A;  4GSW A;  4BOS C;  4WWP A;  4EUT A;  5L95 C;  1UGM A;  3B0A A;  4KSK C;  4URK A;  3S2A A;  2LGD A;  2W9N A;  2N7D A;  4JL9 A;  1D3Z A;  5CHV C;  3LDZ E;  3KH0 A;  2KNB A;  1M94 A;  2MBE A;  3IFW B;  4GMV A;  3AUL A;  2L3Z A;  3H7P B;  3N3K B;  2LVP A;  4NY0 A;  2LVO A;  1WM2 A;  3A9J A;  3Q3J A;  1GC7 A;  1EF5 A;  2IBI B;  3ZIM A;  2KLG A;  5HKH A;  2CHZ A;  3IHP C;  3ZNZ B;  4MDK E;  2VRR B;  1V49 A;  4E71 A;  3VXW A;  4CO7 A;  3PZD A;  3TCA A;  2J0K A;  1Y8R C;  5EDS A;  4IWO A;  1K8R B;  2G4D B;  2LXC A;  2FNJ B;  4BBN C;  3QAR A;  1BT0 A;  3SU8 X;  3ONS A;  2JY6 A;  4FJY A;  5D94 A;  2KLC A;  2I1J A;  3R3M A;  1WGY A;  4XX5 A;  2GOW A;  3U7D A;  1KLV A;  1E7V A;  1JRU A;  1WR6 E;  4E74 A;  3QA8 A;  2XBB C;  3H1U A;  2O2V A;  2BF8 B;  5DPR A;  2C60 A;  1GG3 A;  2BWE S;  3VUW A;  1RAX A;  2M1M A;  2O6V A;  4DHJ D;  2RR9 A;  3JSV B;  2K8C A;  2BYE A;  2L0F A;  1XT9 B;  3QWZ B;  2K6Q A;  2PJH A;  2ZPY A;  3PV1 A;  2K39 A;  4ZDV A;  3Q3F A;  2Z59 B;  3VUY A;  5C1Z A;  4AWJ A;  2KFK A;  4DWF A;  4W9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...