1A5RA

Structure determination of the small ubiquitin-related modifier sumo-1, nmr, 10 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
103
structure length
103
Chain Sequence
GSMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Targeting protein
molecule keywords SUMO-1
publication title Structure determination of the small ubiquitin-related modifier SUMO-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1a5rA00
3VTWA 1WJ6A 4F8CB 1C3TA 4EZKA 4GDKA 4JLCA 4F7ZA 2K8BA 4I6NB 3WA0A 4B6WA 1WXVA 1PQSA 2GBMA 2CHXA 3ECIA 3RD2A 1WRDB 3U7DA 4DXAB 5DPWA 3AI5A 2MBQA 1LFDA 1WIAA 2CHZA 3VFKA 2IO2B 3V6EB 1UH6A 2D11A 2ZVNA 5JZEB 2M8SA 3A9JA 2XK5A 3NS8A 4JL9A 4W9DA 4YL8A 1Y8RC 1XT9B 4JIOU 2Z0EB 1WJUA 1AARA 1TGZB 3A9KB 3JSVA 4HJKA 3H1UA 3VUYA 2VRRB 2N9PC 1WZ3A 2BYFA 4IWQA 4MELA 2NS5A 4LDTB 1Q5WB 1E8ZA 2KWUB 3ONSA 4BOSC 1WX8A 2PE9A 1OEYA 1Z2MA 3VHTC 1VD2A 4MSQB 1RRBA 3KH0A 4WWOA 4BKTA 1V81A 3DCGA 3DBLI 1WE7A 4MGYE 4GGQA 4EEWA 3GZNI 1E5WA 1E8YA 4MGKE 2MX2A 3UF8A 4G3XB 3PLVA 4CYEA 4GSWA 4RMAA 2LXCA 1UELA 1WR1A 2NPTA 3PHWB 3MTNB 3QARA 4JGHB 1R4NI 2IO1B 2L0FA 2LRWA 3M62B 2IYDB 3HM3A 4NQLB 3N3KB 5E6OA 4EFOA 2BF8B 2C7MB 4DBGA 3NOBA 1WMHA 2KDIA 2DAFA 1WI0A 2MBHA 4FJVB 5J2RA 2FCQA 2N7DA 3A4SC 2MBEA 2AL3A 4MJSB 4PYZA 2LZ6A 3AU4A 4HWIB 3A33B 3LDZE 3N32A 5L95C 3V61A 3AU5A 3CF6E 2IBIB 3WAOA 2WX1A 4ZDVA 1E8WA 3IG3A 4NQKE 1WGRA 2C7NB 2FCNA 1P0RA 1YIWA 1SGHA 2A4ZA 3A1QA 5CHFA 3T9LA 2KTFA 4GU2A 2BWFA 4FHJA 1D3ZA 3TCAA 2N1VA 1RAXA 2DX5B 2RD0A 4GB9A 3PVLA 4G50A 3R3MA 1KOTA 2KX3A 1KLVA 4HPLB 3ZNID 4DHZB 1WE6A 3ZUNA 3DDCB 4TUUA 2GOWA 2W9NA 2JF5A 2HD5B 3U30A 1WXMA 5LLIA 4NY0A 3VH4B 2KFKB 4ANXA 2Z0DB 2M1MA 5AZFA 2FIFA 1OTRB 2KWVB 2R2QA 1XD3B 4RM8A 4BKGA 3ZDMC 1P1AA 4II3B 4GDKB 5JHAA 1WYWB 2AWTA 4XZ4A 2AL6A 3IFWB 5DPSA 3APDA 1ZGUB 2L00B 4IG7B 2L3ZA 2LUEA 5AEKB 1P98A 3UIPB 3EECA 5KHQA 2CS4A 3OJ4B 5DPTA 2LGYA 2M0XA 4FN2A 4EKUA 4FLHA 2C9WB 3VAWA 3DBRI 2ZEQA 3PLUA 4KVGB 4MGZE 2ZPNA 5C1ZA 3A9JB 2XK5B 3JYUA 3HHMA 3DVNV 5CX3A 3M63B 4ASWC 2FIDA 3VVWB 5LXHA 1IYFA 2FUHB 2KHWB 3DQVA 3JSVB 3ENEA 3QC8B 3BINA 2KTRA 2JWZA 5DPRA 2KJ6A 2O6VA 3MJWA 4AJYB 2K6DB 2KC1A 3Q3FA 1S3SG 2L7RA 2JRHA 2KLGA 4AOFA 4IM2A 2N7EA 4MSMB 4WWPA 3RZFA 3SHQA 3ZRFA 3ZNZB 2NR2A 1J0GA 2J0JA 3SDLC 2CKHB 4FULA 3RUIB 5IA7A 3QA8A 1EF1A 1WF9A 2MBBB 2NPTB 2KVRA 3PZDA 2MCNB 3RT3B 2IO0B 3QCAA 1OEYJ 2MLBA 4AUQC 4W9FA 1J8CA 3UINB 1J19A 1R4MI 3OAWA 1WMHB 2GBJA 1LXDA 1YX6B 1WM2A 1TTNA 4W9GA 2LGDA 2CR5A 1H4RA 1GJZA 3MHSD 4A20A 3V6CB 1QZEA 3KW5B 2CHWA 3RCZA 1F9JA 2ZZPB 2LVPA 4BBNF 1ZW7A 2IO3B 4I6PA 3K9OB 4LJPB 3P2BA 4PS3A 4W9EA 2GBKA 2NBWB 2BKRB 1IPGA 3A1QB 3L17A 3QJZA 4J6IA 2JZZA 2KFJA 3HK0A 2OJRA 4LJOB 4E71A 2KWCA 4WQOB 2C5LC 4IWOA 2KLCA 1WGYA 2RR9A 2M4NA 3SD5A 2KO3A 1P9DU 3VUXA 2D10A 1WGDA 1SE9A 1L7YA 2RGFA 3OLMD 3DBSA 2PJHA 2MA9B 3TBLD 3TJPA 4BBNC 4BKSD 4W9HA 4GXBA 3UGBB 2MSED 2BGFA 2DAJA 3B08A 2IZVB 2L0TA 5G55A 3R66C 2KANA 3CSTA 2G3QB 5AZHA 3ZIMA 4NJ7A 3B0AA 5L83A 2EKEC 5CTRC 1WM3A 4PS8A 4ICVA 2GBRA 4DHJB 2EMSA 3CSFA 2GMIC 4F1SA 1E90A 2ZNVC 2KMAA 3VUWA 1BT0A 2D07B 4GDLA 2EMTA 2LVQA 3W1SA 5EDSA 4FJYA 3WIMA 2DZJA 3T8MA 3NHEB 5JHBA 4MH0E 4KZ0A 1FXTB 2K6QA 2KKCA 3KYCD 1V5OA 1KJTA 1XQQA 2UWQA 2D2QA 5J18A 1V6EA 2LI5A 3V60A 4BVUC 2HTHA 2KTRB 3L54A 1TZ1A 3PHXB 2O6VB 1E7VA 3WALA 4M0WB 1UBIA 2ZCBA 1ZKHA 2AYOB 2DZIA 2N1WA 5E6NA 3AXCA 4FHKA 1EO6A 2NBVB 2JZ3B 4BKSA 4HDQA 1C1YB 2JVCA 2KDFB 2NVUI 4P7IA 5D7GA 4II2B 3ZRCA 4IUMB 3H7PA 4W9LA 4WJOA 4AP4C 4IM0A 4IW0A 2RPQA 4KV2A 2V3SA 3IBEA 2L05A 2O2VA 3RYTA 1U4AA 4A3OA 2R2OA 3ZDTA 3B1LX 4TQ0A 5HKHA 3QQ8B 4EUTA 1V86A 2J0KA 3W1YA 3PPAA 3D32A 2PPHA 3ML8A 1GNUA 3TIXA 3ZLZA 4HCNB 4AWJA 4FBJB 4URKA 5C23A 4HXDA 4N9F4 4KDIC 3IVFA 5D2MB 4RM9A 1YJ1A 2DENB 2K1FA 5AZGA 4JQWC 4FJZA 1WGGA 2BYEA 3N30A 2M17A 2ZPYA 2OOBB 4KIKA 2J0MA 5CHVC 3KYDD 4NJ6A 3KUCB 3VQIA 2FCMA 1V80A 4G11A 4FADA 1WFYA 2JPHA 2QHOA 2UYZB 4PYUA 4M8NA 4WJPA 2K8HA 2J7QB 4NPNA 2G4SA 4BFRA 3M3JA 3ZNHB 4DHZE 3LJ3A 5D6JB 5TR5A 3AULA 4WJNA 1ISNA 2ZCCA 3I3TB 4HDOA 2G45B 3DPDA 1TBEA 3X23A 2BYVE 3H9DA 1EF5A 4WWNA 3H6NA 4HCPB 2ZVOA 3PRPB 1NBFC 4K7WA 4LCDE 2K8CA 2V4LA 1VCBA 1V5TA 4ANVA 4DK5A 3PRZA 3KUZA 3M95A 2DYMA 2HE7A 2KJHB 3QIJA 4W9CA 3ML9A 2I1KA 3X0WA 2I1JA 4EZLA 2L8JA 1V9JA 1JRUA 2KJRA 3L08A 2MW5A 5GMVA 4GN1A 4ZYNA 4GDLB 4KZCA 4DWFA 1WR6E 2DZMA 2KD0A 2LXAA 4AJWA 1M94A 3APCA 2MQJA 3ZW3A 3DBHI 4NNJB 2XBBC 3L16A 4DDGD 3EFUA 4TQ1A 5J17A 3R7QA 3PREA 2IY0B 2WYQA 5IAAC 2LD9A 2ZJDA 3DVNU 3PSEB 2BPSA 2G4DB 2NBUA 2ZNVB 3BY4B 4G0NB 2KNBA 1I42A 2BKFA 1WX9A 2DYBA 3GOEA 3CMMB 2RSUA 2KDBA 3HM6X 3ZNGC 2LJ5A 1Q1OA 3ZKJC 2FAZA 3EC8A 3RZWC 2N9EB 3A4RA 4ANUA 3QK0A 2KK8A 3UIOB 2LASA 1G6JA 4KSKC 4ZRJA 2ASQA 4TKNA 3W1SC 3ALBA 4NAWA 1GG3A 2CU1A 4K1RB 2BWES 4OVUA 2N4FA 2DHZA 3H7PB 5D94A 2MRPA 4W9JA 4M8MA 1YX5B 2K39A 5DCNA 3ZTDA 4MDKE 1T0YA 2O2VB 3ZVVA 1SIFA 4PS7A 2KQ7A 4LDTD 1WJNA 3HIZA 2K25A 2KOXA 2C60A 4I6LB 3KVFB 4IC7B 1E7UA 1WZ0A 4B95A 3L10B 2D3GA 3JW0X 2V1YA 4KDLB 1UBQA 3NY5A 2MP2A 1V49A 5CHWA 4MEMA 4HK2A 1E8XA 5KHOA 4KIKB 3R7RA 1HE8A 3QHTA 2LRUA 3QX1A 2YLMA 3SU8X 3UQAA 2Y5BB 2IY1B 3VTVA 1A5RA 2HJ8A 4ANWA 2KMCA 3NZUA 3VTUA 3WAPA 1S1QB 2JUOA 1CMXB 3DOWA 4GMVA 1GUAB 4WJQA 4DHJD 2KXJA 1LM8B 1OGWA 3V62A 5LXIB 1EUVB 1Z5SB 1UZXB 5G2NA 4XX5A 3L13A 1WXAA 5BO4B 2AEHA 1GC7A 4ICUA 2WX0A 1NI2A 3C0RB 4OVVA 3TL5A 4HVBA 3OJ3A 3H7SA 3O65B 4A3PA 2A5UA 1P3QU 4HPMB 3A9KA 4CHKA 2C7HA 5E6PA 1WJ4A 2YVCA 2O6VD 4K7SA 3JVZX 4E3CA 3PTFC 3UQBA 1WH3A 4FA6A 3RULA 2KDEB 3VDZA 2JT4B 3WAMA 1IP9A 1MG8A 3DVGX 4W9IA 3EHVA 2GBNA 2MBOA 2KZRA 3PRMB 3WANA 2DYOA 3DVGY 1YD8U 4GOCA 1LQBA 2KX0A 4EOYA 1RFAA 1H8CA 2PE6B 1K8RB 3Q3JA 2KC2A 4GIVA 2LWPA 3VXWA 4BOZB 1X1MA 2B3AA 2N9XA 1RLFA 4MM3A 4XC2A 4K81A 2PEAA 1YQBA 2JRIB 1WXSA 2DZKA 3VH3B 1OQYA 3QAQA 4DDID 4HLEA 3S2AA 3QWZB 3ZTCA 4E74A 1Q0WB 3PV1A 4IWPA 4MJSA 3PGEA 1UGMA 4TV3A 3L0WB 4X57B 4ZRKA 2MWSB 4NAWB 3TMPB 1WGHA 2FCSA 3K9PB 2Z59B 4MGIE 3U8ZA 3IHPC 1WX7A 2NCNA 1L2NA 2FNJB 5FR6A 1NDDA 2WDTB 3PT2B 1WY8A 4ZRIA 4KSLC 2L76A 4CO7A 4EZJA 5JH5C 1GC6A 2LVOA 4WAAA 4K7UA 3APFA 3ZO5B 1I35A 2MP2B 4IM3A 2JXXA 2JY6A 2KN5A 3NZSA 3KUDB 2XEWA 3PS6A 2LGXA 4W9KA 2REXA 1KM7A 2KFKA 2WWZA 1V2YA 4B9KA 1UD7A 2KQSA
chains in the Genus database with same CATH superfamily
1FO4A 1DYQA 1WJ6A 4GDKA 5TSSA 1GB1A 2BS2B 4IDIA 1LO5D 3ECIA 4XDDA 2MEKA 2J4XA 3AI5A 1WIAA 1KLGD 2IO2B 4XGAB 2AQ2B 2M8SA 2XK5A 3ZYYX 3T3OA 1XT9B 2LHDA 1PUTA 2Z0EB 4RGNA 1TGZB 4HJKA 3H1UA 2N9PC 3AH7A 1E8ZA 1Z2MA 4IOIE 3KH0A 4WWOA 3DHHC 4GGQA 2JYEA 3GZNI 1PGBA 1Q10A 3PLVA 4CYEA 4GSWA 2LXCA 1WR1A 3QARA 2IO1B 1AWDA 2X38A 4K3CA 2C7MB 3CIRB 2KDIA 2DAFA 4HWIB 1MPEA 3N32A 2GI9A 1L5PA 2WX1A 3FAHA 2I38A 1AYFA 2FCNA 2A4ZA 3GP7A 3DBLB 4FHJA 3SFDB 2G9HD 2RD0A 2W3RA 2WXFA 2KX3A 4DHZB 1NYRA 3DDCB 2HTME 1JMLA 2HD5B 3MC9A 4NY0A 1KF6B 3VH4B 3NVYA 2KFKB 2M1MA 1OTRB 4ITKA 4M01A 1DOXA 2AL6A 3IFWB 4HKQA 2L00B 4IG7B 2L3ZA 5AEKB 3UIPB 4ARIA 3OJ4B 5DPTA 4EKUA 4FLHA 1QF6A 4MGZE 3PLUA 2ZPNA 3JYUA 3P42A 3HHMA 5CX3A 1NI3A 3M63B 3VVWB 4LTUA 2KHWB 3JSVB 3ENEA 4OZAA 2KTRA 2JWZA 5DPRA 2KJ6A 4B0EA 2O6VA 2WXKA 3AE1B 1CZPA 1S3SG 2L7RA 1HTQA 2JRHA 4IM2A 3RZFA 2PLPA 2VH2A 2NR2A 1C77A 2NMQA 2CKHB 3RUIB 2MBBB 3IT6B 3PZDA 2MCNB 1C76A 3RT3B 4W9FA 2W3SA 4HRSA 4HJGE 1YX6B 4XDCA 4WAFA 2BTEA 1TTNA 3ZJTA 2SAKA 2WLBA 3Q2AC 2MJDA 1QZEA 2D3AA 1Y56A 4I6PA 4PS3A 4W9EA 2GBKA 2NBWB 1IPGA 3IAS1 4HPPA 3HK0A 2OJRA 4A6QA 1ZDXA 3OG5A 2RR9A 3SD5A 3WCQA 1P9DU 1TKYA 1DOYA 4P16A 3AN1A 3TBLD 1E6EB 3UGBB 4YSZB 2BGFA 2DAJA 3B08A 1CK1A 4NZLB 3GS2A 1F0ZA 4NJ7A 5L83A 5IA7A 4DHJB 2GMIC 1EU3A 4FJYA 2DZJA 2NTTA 4TSSA 1GPXA 1FXTB 4MH8A 5H92C 3PO0A 2PTLA 3Q8FA 1JW9D 4RFBA 4C80A 5J18A 3ZXVA 1XF5L 1E7VA 1ZDVA 1N5XA 1N63A 2GB1A 3I9V1 3KWLA 1JWUD 2AYOB 2BS4B 2OHFA 1TKEA 1C1YB 5EE0A 2NVUI 4M00A 4WJOA 2JU6X 2V3SA 4MT5A 2L05A 4KX6B 3BK2A 3ZDTA 4TQ0A 5HKHA 1QT9A 4D2KA 3AE9B 3D32A 2ZW0A 3LB8C 4URKA 1F2RI 5D2MB 2DENB 2K1FA 4KIKA 4CQNA 5CHVC 1IUEA 3RPFC 1ZXHA 1VZ7A 2JPHA 2X8XX 2QHOA 3KQ4A 4M8NA 2WQYB 5I4DA 2WXGA 5IKCM 2ZCCA 2G45B 1TY2A 2TSSA 2QEJC 3H6NA 4LCDE 2K8CA 1VCBA 1V5TA 1TT5B 4ZHOA 2HE7A 1C4AA 3ML9A 2JQRB 4EZLA 2I1JA 3L08A 1P7FA 4DWFA 2N7JA 3UI3A 1M94A 5BYRA 2MQJA 1FFUA 2WDVB 3EFUA 1JWSD 3N9YC 4TQ1A 5HHDG 3PREA 2IY0B 5IAAC 3PSEB 3BY4B 1I42A 4AQ7A 4KKJA 1PFDA 3GOEA 1JCKB 2WXNA 1Q1OA 1TIFA 2ASQA 2AQ3B 3W1SC 2FUG1 3E56A 4K1RB 3W2DA 2MRPA 3W5UB 3I63C 4S17A 1ESFA 2O2VB 1SIFA 2KQ7A 3HIZA 3Q8CA 3ABVB 2L1AA 3L10B 2V1YA 2RPVA 3U4EG 1I4XA 1HE8A 2JX5A 2J52A 3UQAA 2Y5BB 2DWQA 3VTVA 3EUB2 5AUIA 2MJ3A 2KXJA 2ON8A 3P4SB 1OGWA 1JWAD 1UZXB 5G2NA 2DBYA 1RFKA 1GC7A 4OVVA 1IGCA 3R2IA 4HVBA 3OJ3A 4A3PA 4WIPA 1WJ4A 2O6VD 4Q2JA 4E3CA 1SIJA 1WH3A 4H2AA 2JT4B 2WNMA 3WAMA 2KZRA 3WANA 2DYOA 3DVGY 1YD8U 2KN4A 2LEKA 3MC0B 3Q3JA 3N1YC 1X1MA 2QDFA 4XC2A 4K81A 2JRIB 3V3XA 1OQYA 3QWZB 1L6VA 5IOIA 1QLBB 1KH0A 4P1CC 1UGMA 4NAWB 3U2SC 3IHPC 4IKGA 3Q3MC 5FR6A 2WDTB 4CO7A 1WY8A 4ZRIA 4KSLC 4OZBA 3TSSA 1I4QA 1GC6A 2WU2B 3NUHB 2MP2B 1T0RC 3NZSA 2Y5PA 3ZJVA 2KFKA 4B9KA 1UD7A 4DXFA 1ZXIA 4EZKA 3WA0A 1WXVA 4ZRQA 2GBMA 4N6EB 3U7DA 2M19A 5DPWA 2WGSA 1LFDA 2CHZA 2JXTA 3NS8A 4JL9A 1QILA 3MP9A 1WJUA 3A9KB 3JSVA 1WZ3A 2NS5A 1Q5WB 2KWUB 3ONSA 4BOSC 1WX8A 2PE9A 1GB4A 1VD2A 1RRBA 2BYTA 4EEWA 1XCQL 1E8YA 4MGKE 2N9KA 2WXMA 2MX2A 4G3XB 2XN9C 4RMAA 1UELA 4NQLB 2IYDB 3HM3A 5E6OA 3N3KB 4EFOA 4YXDB 4ZOHC 5J2RA 4MJSB 4PYZA 2V4IB 1N5WA 5FKAC 3A33B 1VDVA 4K3BA 1E8WA 5BYSA 1WGRA 2C7NB 1P0RA 3T9LA 1E10A 3GZNB 5FR3A 3RN9C 4AS1A 1SJED 5BMIA 2XNAC 4FXCA 3ZUNA 4TUUA 2JF5A 1FRRA 4ANXA 2Z0DB 2KMMA 3BK1A 1D5ZC 1DOIA 1P1AA 4II3B 4XZ4A 4JE3B 4WWMA 1ZGUB 1VZ6A 3EECA 1C78A 2LGYA 2M0XA 2C9WB 3DBRI 3Q8EA 5C1ZA 1GAQB 2K5PA 2QMTA 3U7ZA 1WRIA 1E9MA 1PGXA 1P7EA 3AE6B 3DQVA 1EWCA 1RYJA 2K6DB 1FPYA 4MSMB 1JALA 1NENB 3SDLC 3QA8A 1EF1A 1WF9A 2NPTB 3BVMA 3N1ZC 2IO0B 4YWGG 1J19A 1R4MI 2VH1A 1WM2A 1OQQA 2RDGA 2EKIA 2CR5A 1SE2A 1D5XC 4HKZE 3IT4B 4US8A 2LVPA 3Q3OC 4LJPB 3A1QB 3EFCA 2ACZB 2MJEA 3QJZA 2KFJA 2KLCA 2M4NA 2KO3A 1WGDA 1TS5A 3OLMD 2MA9B 3TJPA 4BBNC 4BKSD 3RNEC 2IZVB 5AZHA 2KANA 2K9XA 3ZIMA 3B0AA 3MJ5A 2GLSA 4PS8A 4ICVA 3TUOA 4F1SA 1E90A 1N62A 2KMAA 3VUWA 1ZE3D 5EDSA 3H8HA 4LNNA 5FK9C 3T8MA 5JHBA 4KZ0A 2K6QA 3KYCD 1V5OA 1KJTA 3MC8A 4YSYB 2D2QA 1V6EA 2LI5A 2D3CA 3URYA 2PMVA 3PHXB 4C56C 3B2FA 1C4CA 1UBIA 1R4NB 2ZCBA 4OW0A 5D3DA 2DZIA 3NRZA 4FHKA 1EO6A 1FCLA 2JZ3B 4HDQA 2Q5WD 5D7GA 2KDMA 4IUMB 2E3TA 4IM0A 2EELA 3NS1A 2BQQA 3IBEA 2O2VA 3RYTA 1U4AA 4A3OA 1MHXA 5D3IB 3DHIC 4EUTA 1V86A 1CQVA 4N59A 4FBJB 1FXAA 1YJ1A 4JQWC 4B0MA 4FJZA 3N30A 2CJNA 2M17A 2ZPYA 2RDBC 3KUCB 1WFYA 1FIQA 2R61A 1SJHD 2J7QB 3C19A 3M3JA 3LJ3A 5D6JB 5TR5A 3AULA 2Y5CA 3Q6BA 3I3TB 4HDOA 1J7BA 2IJ0A 3X23A 2QSDA 3H9DA 1EF5A 2ZVOA 3PRPB 1NBFC 3AEDB 1FEHA 1UUPA 1YNTE 3N1XC 1YN5A 2DYMA 3QIJA 2KJHB 4W9CA 2I1KA 1V9JA 1JRUA 3BIID 5GMVA 4GN1A 4OZCA 2KD0A 4AJWA 3APCA 3DBHI 4NNJB 2XBBC 5G5HA 3L16A 4XE0A 2N9LA 4YTNB 1TS3A 2VZKD 5C3JB 2LD9A 1XLQA 2G4DB 2NBUA 2V3NA 1WX9A 2DYBA 2IGHA 3CMMB 2Z8LA 2KDBA 1MFWA 2LJ5A 3ZKJC 2N9EB 4ANUA 1T0QC 3QK0A 2KK8A 2BT6A 4C00A 5BMHA 4KSKC 3ALBA 4NAWA 2W54A 3H7PB 2RDHA 3Q3NC 5D94A 3TEWA 2K39A 4MDKE 1NVID 1T0YA 1I4HA 4LDTD 1UF0A 1WJNA 1V1PB 2KOXA 2C60A 4IC7B 4RGOS 1E7UA 1WZ0A 1RWSA 2MP2A 1E8XA 3QHTA 3AM9A 1T3QA 2G1EA 2IY1B 2V9HA 3NZUA 1QKZA 3VTUA 4GMVA 1CMXB 2KT7A 1ACCA 1GUAB 2AX5A 4WJQA 4DHJD 1HXYD 4NAMA 5C2TB 2LGIA 2WP9B 1D6EC 3MHZA 4ICUA 1NI2A 3C0RB 3H7SA 4BZAA 5HFYA 1P3QU 3A9KA 4CHKA 2C7HA 1XLPA 3PZ8A 3UQBA 3VDZA 1IP9A 3KWVA 1MG8A 3DVGX 4W9IA 3ZGZA 1KLUD 4LNOA 3PRMB 1UWXA 1LQBA 4GOCA 1RFAA 5HG2A 2LWPA 3RI7C 3GE3C 3VXWA 1RLFA 2JZPA 2PEAA 1WXSA 1UNSA 3QAQA 1DGJA 3ZTCA 1TS2A 1Q0WB 4MJSA 3B9JA 1FFVA 1LGRA 4A8XC 1JWMD 4LNFA 3TMPB 1F77A 2FCSA 2Z59B 3VR9B 3U8ZA 1WX7A 2L83A 1ENFA 4LK0M 2BS3B 1HZ5A 3PT2B 4LNIA 3ZO5B 4IM3A 1IBXB 2JY6A 3KUDB 1OQRA 2XEWA 3SEBA 1V1OA 1KM7A 4RF0A 5MPOA 3LYYA 2UU7A 2LUMA 1C3TA 2M0AA 3HVDA 1ZUD2 2K8BA 4R3DA 4B6WA 1PQSA 3RD2A 3OWEB 1QQRA 1VZ8A 2MBQA 3VFKA 3V6EB 1UH6A 2D11A 5JXVA 3AV8A 2WXRA 3CWIA 1L6UA 2YEPF 4ZHPA 4IWQA 4MELA 1AW7A 3R8BA 1OFFA 4YTMB 3VHTC 4MSQB 4BKTA 1V81A 3DCGA 4MGYE 4L23A 3UF8A 4REZA 2NPTA 1YN4A 2LRWA 3M62B 4MM3B 2BF8B 4FJVB 1WI0A 2MBHA 2FCQA 3A4SC 2MBEA 2AL3A 3AU4A 3LDZE 2PVGC 3EA6A 3TEZA 1I7HA 4EE2A 3AU5A 3CF6E 2IBIB 3WAOA 3IG3A 4NQKE 4L2YA 1FNVA 3A1QA 2KTFA 2BWFA 1D3ZA 2DX5B 3P63A 4L1BA 1TS4A 4RCOA 4G50A 3AE7B 1KLVA 3ZNID 1WE6A 1XEEA 2QJLA 3U30A 4A9AA 1WXMA 5LLIA 2SEBD 1FCCC 4RF1A 3P4QB 2R2QA 4BKGA 3ZDMC 1FMAD 1WYWB 5DPSA 3BYTB 1E0ZA 5KHQA 1VJKA 3VAWA 2BB5A 1EM7A 1YN3A 2ZEQA 3A9JB 1CJEA 3DVNV 3VRBB 4ASWC 1KTKA 2FIDA 3QC8B 2WDRB 3SR6A 1YOVB 4AJYB 2KC1A 2KLGA 4ARCA 2N7EA 3ZRFA 4WWPA 2V3PA 3RNFC 1J0GA 3IAM1 2MLBA 3OAWA 1FRDA 1WMHB 2GBJA 2DLBA 4W9GA 4RGTA 2LGDA 4UDUC 1GJZA 3MHSD 4A20A 2W82A 3KW5B 3RCZA 1N61A 2IO3B 3K9OB 2D5GA 3L17A 4US9A 2JZZA 1QOFA 1QOBA 4LJOB 4E71A 2C5LC 1HZ6A 1F2RC 1WGYA 3DHGC 3VUXA 2L32A 1SE9A 2RGFA 1R4MB 2PJHA 3FILB 4W9HA 2MSED 5BYQA 2L0TA 2BBCA 2G3QB 1L4DB 1FXIA 1WM3A 4YSXB 3CSFA 1QOGA 1PGAA 1BT0A 1T6BX 2D07B 2LHEA 1L0YB 4KGSA 4MH0E 2IDYA 3AECB 2KKCA 4DXGA 3IXSA 4LNKA 1JWBD 3L54A 1TZ1A 4M0WB 3W9CB 2N1WA 1UWMA 1D5MC 3FC4A 2NBVB 2KDFB 4P7IA 2Y3AA 3ZRCA 3H7PA 4AP4C 3NG0A 4IW0A 4KV2A 3V05A 3LXFA 2R2OA 2ICIA 4A90A 1C4PA 1V1PA 3AE4B 1ZPSA 2QCZA 3W1YA 3PPAA 2PPHA 4HCNB 3RNAC 3HVZA 4N9F4 4KDIC 3IVFA 3O13A 4RM9A 2D3BA 2OOBB 1XLNA 1V80A 2FCMA 2K0PA 2INDC 2UYZB 4PYUA 3N20C 2K8HA 4NPNA 2G4SA 1ET6A 1STEA 1YQ4B 4DHZE 2AQ1B 2WDQB 1EWYC 1ISNA 1L4ZB 2OJWA 3DWMA 2IGGA 2WXJA 2BYVE 4WWNA 1J7CA 4HCPB 2INPE 1V8CA 4K7WA 4S0RA 2V4LA 4ANVA 4DK5A 3PRZA 3M95A 1JQ4A 3X0WA 1B9RA 3TEYA 4DQOC 2MW5A 4GDLB 4KZCA 1WR6E 2DZMA 2LXAA 3NVWA 1D4BA 4C7ZA 3Q8AA 3W5VB 3R7QA 3AE3B 1TZOA 1XO3A 3DVNU 4G0NB 2ZNVB 1HA5A 1WYGA 2QC8A 2RSUA 3HM6X 1ROEA 1N60A 2FAZA 4M02A 3EC8A 3A4RA 3UIOB 2LASA 1G6JA 4TKNA 5IN7A 5IO9A 4YT0B 5BMGA 2CU1A 2DHZA 5DCNA 1WXQA 3ZTDA 4OVZA 1TY0A 3DBHB 3ZVVA 4PS7A 3ZJUA 3I57A 3KVFB 1XCTL 3HUIA 4KDLB 3JW0X 1I4PA 1T5XD 3NY5A 1V49A 1IBXA 4MEMA 1B1ZA 4HK2A 2BW2A 3ZQ4A 1RM6C 1FM0D 1A5RA 2HJ8A 4ANWA 4QAYA 2KMCA 1S1QB 3DOWA 2WU5B 1LM8B 5LXIB 1EUVB 1Z5SB 1SSNA 4XX5A 1WXAA 4JWUC 1JRPA 2WX0A 3TL5A 2IPKD 4O1NA 1EU4A 4HPMB 5E6PA 4K7SA 3JVZX 3AEBB 4FA6A 1BUIC 2KDEB 1XXGA 3EHVA 2GBNA 2MBOA 1WWTA 3P4RB 1A70A 2PE6B 1K8RB 1TKGA 1FNWA 2KVZA 4BOZB 3P1MA 4MM3A 2N0SB 5LNK1 2DZKA 3VH3B 4ZRPA 4DDID 5EE9A 2K22A 1V97A 1XLOA 3PV1A 4IWPA 4TV3A 3L0WB 3AEFB 2WXHA 2HDEA 3K9PB 2NCNA 1L2NA 4C4VB 2FNJB 1NDDA 4K7UA 1VLBA 4B95A 3BZDB 2E6XA 4W9KA 3PS6A 1F1HA 2LGXA 2LFIA 1YJJA 3BWUD 1HQRD 2VZKB 4AUQC 3PZ7A 2KQSA 3P4PB 3VTWA 4F8CB 4KKIA 4JLCA 4F7ZA 4I6NB 1K53A 4KGRA 2CHXA 3NZ3A 1WRDB 4PT5A 4DXAB 1R7SA 2V0GA 4XWWA 5AUKA 2ZW1A 3AB5A 5JZEB 2ZVNA 5EE1A 4JPSA 3ETRA 3A9JA 4W9DA 4YL8A 3T3NA 1Y8RC 4JIOU 1AARA 3VUYA 1FD6A 1SB3C 2VRRB 1YMHE 2BYFA 4BAXA 1KRHA 4LDTB 2LJIA 1SXTA 2H89B 1OEYA 2QIEB 3DBLI 1WE7A 3HRDD 1K50A 1E5WA 3EGRA 3PHWB 4JGHB 3MTNB 2FBWB 1R4NI 2L0FA 4DBGA 3NOBA 1WMHA 5HI1A 2KAJA 2N7DA 2PIAA 2LZ6A 4YTPB 1MI0A 1SBBB 5L95C 3SFEB 2KWDA 3V61A 4ZDVA 1YIWA 2WXIA 1SGHA 2J42A 5CHFA 4GU2A 3TCAA 2N1VA 1RAXA 2IGDA 1PYWD 4GB9A 3PVLA 1K52A 1KOTA 3R3MA 4HPLB 2GOWA 4RH6A 2W9NA 3FILA 5AZFA 2FIFA 2KWVB 4MACA 1XD3B 4RM8A 2WXQA 4C7YA 4GDKB 5JHAA 2AWTA 3APDA 3RNCC 1YQ3B 2LUEA 1P98A 4NJCA 4WURA 2CS4A 1C79A 4FN2A 1J7AA 4KVGB 4LLGM 2BVCA 2XK5B 3Q14C 5LXHA 2INCC 1IYFA 1QOAA 2FUHB 4GLSC 3BINA 2K3UA 2BB6A 4A55A 3MJWA 4M0WA 3Q3FA 3U52E 4AOFA 1MVKA 3SHQA 3ZNZB 2J0JA 4FULA 2W55A 2KVRA 1HEZE 3QCAA 1OEYJ 1J8CA 1NYQA 3UINB 1K51A 1M4VA 2CJOA 2PVOD 1LXDA 3ZXRA 1SE4A 1VR9A 1H4RA 1SEBD 3V6CB 1VRAB 2CHWA 1F9JA 2ZZPB 2J53A 1TJEA 4BBNF 1ZW7A 3B2GA 2INNE 2B76B 3P2BA 2YEPB 2HJ1A 3L4PA 2BKRB 4J6IA 2KWCA 4WQMA 4WQOB 3GE8C 4IWOA 2JSVX 3RFZB 1ZP0B 2KYWA 2D10A 4RGMA 3DWGC 1L7YA 3KLSX 3DBSA 1I4RA 2WHIA 1AN8A 4GXBA 1MG4A 1GOZA 5G55A 3R66C 3AE5B 3CSTA 1I4GA 2EKEC 5CTRC 4J3OD 2GBRA 2EMSA 2ZNVC 4ZYSA 3W1SA 4GDLA 2EMTA 2LVQA 2WXLA 3WIMA 3NHEB 3Q69A 2ONQA 1XQQA 4P1BC 2UWQA 3Q8BA 3V60A 2HTHA 4BVUC 2KTRB 3BYYB 1N6ZA 2O6VB 3WALA 2KQ4X 3BVZA 1ET9A 1L0XB 1ZKHA 5E6NA 3RNBC 1MJDA 3AXCA 4BKSA 4JX1C 2PKOA 2JVCA 4II2B 1BMLC 1KFYB 4W9LA 2JYTA 2RPQA 5IP4D 2RMMA 5G5GA 3B1LX 3QQ8B 1HTOA 1F52A 2J0KA 3TIXA 3ML8A 1GNUA 3ZLZA 4AWJA 3MFGA 5C23A 1E7PB 4HXDA 4P6VF 5AZGA 2MHJA 1WGGA 2BYEA 3RMKC 3FKYA 2J0MA 3KYDD 2WXPA 4NJ6A 3VQIA 2NTSA 4G11A 4ACFA 4FADA 2DNFA 2LGSA 3VRAB 1YJIA 4WJPA 1ZOYB 4BFRA 2WXOA 3ZNHB 1SF0A 4WJNA 1NEKB 2I2YA 3DPDA 1TBEA 1UGJA 4RNAA 5GXGB 2PW9A 2KACA 3DBRB 3KUZA 4HROA 2L8JA 1WSPA 2KJRA 4ZYNA 2GRIA 2MH7A 3ZW3A 3AEGB 4DDGD 5J17A 4KGTA 2WYQA 2ZJDA 2BPSA 2KNBA 2BKFA 2LMCA 1FNUA 3ZNGC 2CU3A 3VR8B 3RZWC 4XWTA 4ZRJA 1GG3A 2BWES 4OVUA 2N4FA 3J9CA 4W9JA 4M8MA 1YX5B 4XYCA 4C4VA 2FE8A 2K25A 4I6LB 2D3GA 4JWSC 1UBQA 3NJTA 5CHWA 2QILA 5KHOA 4KIKB 3R7RA 2LRUA 3QX1A 2YLMA 3SU8X 2H88B 4PK1A 1SE3A 3WAPA 2JUOA 2OEDA 1BXTA 3V62A 1MHHE 3L13A 5BO4B 2AEHA 3AMZA 3O65B 1PDXA 3E9SA 2A5UA 3NVZA 1IGDA 5E6JA 1C9FA 2YVCA 3AE8B 4WH4A 3TEXA 3PTFC 3RULA 1L0VB 3GB1A 2KX0A 4EOYA 4TMAB 1H8CA 2KC2A 4GIVA 3RNGC 2B3AA 2N9XA 3I5JC 1WGKA 1YQBA 5H8YE 2L52A 2WS3B 4HLEA 3S2AA 3NVVA 3BVGA 1TYGB 4E74A 3AEAB 3AEEB 3C8YA 5EE3A 4HEA1 3PGEA 2M56B 4X57B 4ZRKA 2MWSB 4N58A 1WGHA 3R2TA 4OHJA 4MGIE 4USAA 2JWUA 4EZJA 2L76A 5JH5C 5T8IA 2LVOA 4WAAA 3APFA 1I35A 1T0SC 2JXXA 2KN5A 1JROA 2REXA 3AE2B 2WWZA 1V2YA
chains in the Genus database with same CATH topology
3VTWA 1WJ6A 4F8CB 1C3TA 4EZKA 4GDKA 4JLCA 4F7ZA 2K8BA 4I6NB 3WA0A 4B6WA 1WXVA 1PQSA 2GBMA 2CHXA 3ECIA 3RD2A 1WRDB 3U7DA 4DXAB 5DPWA 3AI5A 2MBQA 1LFDA 1WIAA 2CHZA 3VFKA 2IO2B 3V6EB 1UH6A 2D11A 2ZVNA 5JZEB 2M8SA 3A9JA 2XK5A 3NS8A 4JL9A 4W9DA 4YL8A 1Y8RC 1XT9B 4JIOU 2Z0EB 1WJUA 1AARA 1TGZB 3A9KB 3JSVA 4HJKA 3H1UA 3VUYA 2VRRB 2N9PC 1WZ3A 2BYFA 4IWQA 4MELA 2NS5A 4LDTB 1Q5WB 1E8ZA 2KWUB 3ONSA 4BOSC 1WX8A 2PE9A 1OEYA 1Z2MA 3VHTC 1VD2A 4MSQB 1RRBA 3KH0A 4WWOA 4BKTA 1V81A 3DCGA 3DBLI 1WE7A 4MGYE 4GGQA 4EEWA 3GZNI 1E5WA 1E8YA 4MGKE 2MX2A 3UF8A 4G3XB 3PLVA 4CYEA 4GSWA 4RMAA 2LXCA 1UELA 1WR1A 2NPTA 3PHWB 3MTNB 3QARA 4JGHB 1R4NI 2IO1B 2L0FA 2LRWA 3M62B 2IYDB 3HM3A 4NQLB 3N3KB 5E6OA 4EFOA 2BF8B 2C7MB 4DBGA 3NOBA 1WMHA 2KDIA 2DAFA 1WI0A 2MBHA 4FJVB 5J2RA 2FCQA 2N7DA 3A4SC 2MBEA 2AL3A 4MJSB 4PYZA 2LZ6A 3AU4A 4HWIB 3A33B 3LDZE 3N32A 5L95C 3V61A 3AU5A 3CF6E 2IBIB 3WAOA 2WX1A 4ZDVA 1E8WA 3IG3A 4NQKE 1WGRA 2C7NB 2FCNA 1P0RA 1YIWA 1SGHA 2A4ZA 3A1QA 5CHFA 3T9LA 2KTFA 4GU2A 2BWFA 4FHJA 1D3ZA 3TCAA 2N1VA 1RAXA 2DX5B 2RD0A 4GB9A 3PVLA 4G50A 3R3MA 1KOTA 2KX3A 1KLVA 4HPLB 3ZNID 4DHZB 1WE6A 3ZUNA 3DDCB 4TUUA 2GOWA 2W9NA 2JF5A 2HD5B 3U30A 1WXMA 5LLIA 4NY0A 3VH4B 2KFKB 4ANXA 2Z0DB 2M1MA 5AZFA 2FIFA 1OTRB 2KWVB 2R2QA 1XD3B 4RM8A 4BKGA 3ZDMC 1P1AA 4II3B 4GDKB 5JHAA 1WYWB 2AWTA 4XZ4A 2AL6A 3IFWB 5DPSA 3APDA 1ZGUB 2L00B 4IG7B 2L3ZA 2LUEA 5AEKB 1P98A 3UIPB 3EECA 5KHQA 2CS4A 3OJ4B 5DPTA 2LGYA 2M0XA 4FN2A 4EKUA 4FLHA 2C9WB 3VAWA 3DBRI 2ZEQA 3PLUA 4KVGB 4MGZE 2ZPNA 5C1ZA 3A9JB 2XK5B 3JYUA 3HHMA 3DVNV 5CX3A 3M63B 4ASWC 2FIDA 3VVWB 5LXHA 1IYFA 2FUHB 2KHWB 3DQVA 3JSVB 3ENEA 3QC8B 3BINA 2KTRA 2JWZA 5DPRA 2KJ6A 2O6VA 3MJWA 4AJYB 2K6DB 2KC1A 3Q3FA 1S3SG 2L7RA 2JRHA 2KLGA 4AOFA 4IM2A 2N7EA 4MSMB 4WWPA 3RZFA 3SHQA 3ZRFA 3ZNZB 2NR2A 1J0GA 2J0JA 3SDLC 2CKHB 4FULA 3RUIB 5IA7A 3QA8A 1EF1A 1WF9A 2MBBB 2NPTB 2KVRA 3PZDA 2MCNB 3RT3B 2IO0B 3QCAA 1OEYJ 2MLBA 4AUQC 4W9FA 1J8CA 3UINB 1J19A 1R4MI 3OAWA 1WMHB 2GBJA 1LXDA 1YX6B 1WM2A 1TTNA 4W9GA 2LGDA 2CR5A 1H4RA 1GJZA 3MHSD 4A20A 3V6CB 1QZEA 3KW5B 2CHWA 3RCZA 1F9JA 2ZZPB 2LVPA 4BBNF 1ZW7A 2IO3B 4I6PA 3K9OB 4LJPB 3P2BA 4PS3A 4W9EA 2GBKA 2NBWB 2BKRB 1IPGA 3A1QB 3L17A 3QJZA 4J6IA 2JZZA 2KFJA 3HK0A 2OJRA 4LJOB 4E71A 2KWCA 4WQOB 2C5LC 4IWOA 2KLCA 1WGYA 2RR9A 2M4NA 3SD5A 2KO3A 1P9DU 3VUXA 2D10A 1WGDA 1SE9A 1L7YA 2RGFA 3OLMD 3DBSA 2PJHA 2MA9B 3TBLD 3TJPA 4BBNC 4BKSD 4W9HA 4GXBA 3UGBB 2MSED 2BGFA 2DAJA 3B08A 2IZVB 2L0TA 5G55A 3R66C 2KANA 3CSTA 2G3QB 5AZHA 3ZIMA 4NJ7A 3B0AA 5L83A 2EKEC 5CTRC 1WM3A 4PS8A 4ICVA 2GBRA 4DHJB 2EMSA 3CSFA 2GMIC 4F1SA 1E90A 2ZNVC 2KMAA 3VUWA 1BT0A 2D07B 4GDLA 2EMTA 2LVQA 3W1SA 5EDSA 4FJYA 3WIMA 2DZJA 3T8MA 3NHEB 5JHBA 4MH0E 4KZ0A 1FXTB 2K6QA 2KKCA 3KYCD 1V5OA 1KJTA 1XQQA 2UWQA 2D2QA 5J18A 1V6EA 2LI5A 3V60A 4BVUC 2HTHA 2KTRB 3L54A 1TZ1A 3PHXB 2O6VB 1E7VA 3WALA 4M0WB 1UBIA 2ZCBA 1ZKHA 2AYOB 2DZIA 2N1WA 5E6NA 3AXCA 4FHKA 1EO6A 2NBVB 2JZ3B 4BKSA 4HDQA 1C1YB 2JVCA 2KDFB 2NVUI 4P7IA 5D7GA 4II2B 3ZRCA 4IUMB 3H7PA 4W9LA 4WJOA 4AP4C 4IM0A 4IW0A 2RPQA 4KV2A 2V3SA 3IBEA 2L05A 2O2VA 3RYTA 1U4AA 4A3OA 2R2OA 3ZDTA 3B1LX 4TQ0A 5HKHA 3QQ8B 4EUTA 1V86A 2J0KA 3W1YA 3PPAA 3D32A 2PPHA 3ML8A 1GNUA 3TIXA 3ZLZA 4HCNB 4AWJA 4FBJB 4URKA 5C23A 4HXDA 4N9F4 4KDIC 3IVFA 5D2MB 4RM9A 1YJ1A 2DENB 2K1FA 5AZGA 4JQWC 4FJZA 1WGGA 2BYEA 3N30A 2M17A 2ZPYA 2OOBB 4KIKA 2J0MA 5CHVC 3KYDD 4NJ6A 3KUCB 3VQIA 2FCMA 1V80A 4G11A 4FADA 1WFYA 2JPHA 2QHOA 2UYZB 4PYUA 4M8NA 4WJPA 2K8HA 2J7QB 4NPNA 2G4SA 4BFRA 3M3JA 3ZNHB 4DHZE 3LJ3A 5D6JB 5TR5A 3AULA 4WJNA 1ISNA 2ZCCA 3I3TB 4HDOA 2G45B 3DPDA 1TBEA 3X23A 2BYVE 3H9DA 1EF5A 4WWNA 3H6NA 4HCPB 2ZVOA 3PRPB 1NBFC 4K7WA 4LCDE 2K8CA 2V4LA 1VCBA 1V5TA 4ANVA 4DK5A 3PRZA 3KUZA 3M95A 2DYMA 2HE7A 2KJHB 3QIJA 4W9CA 3ML9A 2I1KA 3X0WA 2I1JA 4EZLA 2L8JA 1V9JA 1JRUA 2KJRA 3L08A 2MW5A 5GMVA 4GN1A 4ZYNA 4GDLB 4KZCA 4DWFA 1WR6E 2DZMA 2KD0A 2LXAA 4AJWA 1M94A 3APCA 2MQJA 3ZW3A 3DBHI 4NNJB 2XBBC 3L16A 4DDGD 3EFUA 4TQ1A 5J17A 3R7QA 3PREA 2IY0B 2WYQA 5IAAC 2LD9A 2ZJDA 3DVNU 3PSEB 2BPSA 2G4DB 2NBUA 2ZNVB 3BY4B 4G0NB 2KNBA 1I42A 2BKFA 1WX9A 2DYBA 3GOEA 3CMMB 2RSUA 2KDBA 3HM6X 3ZNGC 2LJ5A 1Q1OA 3ZKJC 2FAZA 3EC8A 3RZWC 2N9EB 3A4RA 4ANUA 3QK0A 2KK8A 3UIOB 2LASA 1G6JA 4KSKC 4ZRJA 2ASQA 4TKNA 3W1SC 3ALBA 4NAWA 1GG3A 2CU1A 4K1RB 2BWES 4OVUA 2N4FA 2DHZA 3H7PB 5D94A 2MRPA 4W9JA 4M8MA 1YX5B 2K39A 5DCNA 3ZTDA 4MDKE 1T0YA 2O2VB 3ZVVA 1SIFA 4PS7A 2KQ7A 4LDTD 1WJNA 3HIZA 2K25A 2KOXA 2C60A 4I6LB 3KVFB 4IC7B 1E7UA 1WZ0A 4B95A 3L10B 2D3GA 3JW0X 2V1YA 4KDLB 1UBQA 3NY5A 2MP2A 1V49A 5CHWA 4MEMA 4HK2A 1E8XA 5KHOA 4KIKB 3R7RA 1HE8A 3QHTA 2LRUA 3QX1A 2YLMA 3SU8X 3UQAA 2Y5BB 2IY1B 3VTVA 1A5RA 2HJ8A 4ANWA 2KMCA 3NZUA 3VTUA 3WAPA 1S1QB 2JUOA 1CMXB 3DOWA 4GMVA 1GUAB 4WJQA 4DHJD 2KXJA 1LM8B 1OGWA 3V62A 5LXIB 1EUVB 1Z5SB 1UZXB 5G2NA 4XX5A 3L13A 1WXAA 5BO4B 2AEHA 1GC7A 4ICUA 2WX0A 1NI2A 3C0RB 4OVVA 3TL5A 4HVBA 3OJ3A 3H7SA 3O65B 4A3PA 2A5UA 1P3QU 4HPMB 3A9KA 4CHKA 2C7HA 5E6PA 1WJ4A 2YVCA 2O6VD 4K7SA 3JVZX 4E3CA 3PTFC 3UQBA 1WH3A 4FA6A 3RULA 2KDEB 3VDZA 2JT4B 3WAMA 1IP9A 1MG8A 3DVGX 4W9IA 3EHVA 2GBNA 2MBOA 2KZRA 3PRMB 3WANA 2DYOA 3DVGY 1YD8U 4GOCA 1LQBA 2KX0A 4EOYA 1RFAA 1H8CA 2PE6B 1K8RB 3Q3JA 2KC2A 4GIVA 2LWPA 3VXWA 4BOZB 1X1MA 2B3AA 2N9XA 1RLFA 4MM3A 4XC2A 4K81A 2PEAA 1YQBA 2JRIB 1WXSA 2DZKA 3VH3B 1OQYA 3QAQA 4DDID 4HLEA 3S2AA 3QWZB 3ZTCA 4E74A 1Q0WB 3PV1A 4IWPA 4MJSA 3PGEA 1UGMA 4TV3A 3L0WB 4X57B 4ZRKA 2MWSB 4NAWB 3TMPB 1WGHA 2FCSA 3K9PB 2Z59B 4MGIE 3U8ZA 3IHPC 1WX7A 2NCNA 1L2NA 2FNJB 5FR6A 1NDDA 2WDTB 3PT2B 1WY8A 4ZRIA 4KSLC 2L76A 4CO7A 4EZJA 5JH5C 1GC6A 2LVOA 4WAAA 4K7UA 3APFA 3ZO5B 1I35A 2MP2B 4IM3A 2JXXA 2JY6A 2KN5A 3NZSA 3KUDB 2XEWA 3PS6A 2LGXA 4W9KA 2REXA 1KM7A 2KFKA 2WWZA 1V2YA 4B9KA 1UD7A 2KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTW A;  1WJ6 A;  4F8C B;  1C3T A;  4EZK A;  4GDK A;  4JLC A;  4F7Z A;  2K8B A;  4I6N B;  3WA0 A;  4B6W A;  1WXV A;  1PQS A;  2GBM A;  2CHX A;  3ECI A;  3RD2 A;  1WRD B;  3U7D A;  4DXA B;  5DPW A;  3AI5 A;  2MBQ A;  1LFD A;  1WIA A;  2CHZ A;  3VFK A;  2IO2 B;  3V6E B;  1UH6 A;  2D11 A;  2ZVN A;  5JZE B;  2M8S A;  3A9J A;  2XK5 A;  3NS8 A;  4JL9 A;  4W9D A;  4YL8 A;  1Y8R C;  1XT9 B;  4JIO U;  2Z0E B;  1WJU A;  1AAR A;  1TGZ B;  3A9K B;  3JSV A;  4HJK A;  3H1U A;  3VUY A;  2VRR B;  2N9P C;  1WZ3 A;  2BYF A;  4IWQ A;  4MEL A;  2NS5 A;  4LDT B;  1Q5W B;  1E8Z A;  2KWU B;  3ONS A;  4BOS C;  1WX8 A;  2PE9 A;  1OEY A;  1Z2M A;  3VHT C;  1VD2 A;  4MSQ B;  1RRB A;  3KH0 A;  4WWO A;  4BKT A;  1V81 A;  3DCG A;  3DBL I;  1WE7 A;  4MGY E;  4GGQ A;  4EEW A;  3GZN I;  1E5W A;  1E8Y A;  4MGK E;  2MX2 A;  3UF8 A;  4G3X B;  3PLV A;  4CYE A;  4GSW A;  4RMA A;  2LXC A;  1UEL A;  1WR1 A;  2NPT A;  3PHW B;  3MTN B;  3QAR A;  4JGH B;  1R4N I;  2IO1 B;  2L0F A;  2LRW A;  3M62 B;  2IYD B;  3HM3 A;  4NQL B;  3N3K B;  5E6O A;  4EFO A;  2BF8 B;  2C7M B;  4DBG A;  3NOB A;  1WMH A;  2KDI A;  2DAF A;  1WI0 A;  2MBH A;  4FJV B;  5J2R A;  2FCQ A;  2N7D A;  3A4S C;  2MBE A;  2AL3 A;  4MJS B;  4PYZ A;  2LZ6 A;  3AU4 A;  4HWI B;  3A33 B;  3LDZ E;  3N32 A;  5L95 C;  3V61 A;  3AU5 A;  3CF6 E;  2IBI B;  3WAO A;  2WX1 A;  4ZDV A;  1E8W A;  3IG3 A;  4NQK E;  1WGR A;  2C7N B;  2FCN A;  1P0R A;  1YIW A;  1SGH A;  2A4Z A;  3A1Q A;  5CHF A;  3T9L A;  2KTF A;  4GU2 A;  2BWF A;  4FHJ A;  1D3Z A;  3TCA A;  2N1V A;  1RAX A;  2DX5 B;  2RD0 A;  4GB9 A;  3PVL A;  4G50 A;  3R3M A;  1KOT A;  2KX3 A;  1KLV A;  4HPL B;  3ZNI D;  4DHZ B;  1WE6 A;  3ZUN A;  3DDC B;  4TUU A;  2GOW A;  2W9N A;  2JF5 A;  2HD5 B;  3U30 A;  1WXM A;  5LLI A;  4NY0 A;  3VH4 B;  2KFK B;  4ANX A;  2Z0D B;  2M1M A;  5AZF A;  2FIF A;  1OTR B;  2KWV B;  2R2Q A;  1XD3 B;  4RM8 A;  4BKG A;  3ZDM C;  1P1A A;  4II3 B;  4GDK B;  5JHA A;  1WYW B;  2AWT A;  4XZ4 A;  2AL6 A;  3IFW B;  5DPS A;  3APD A;  1ZGU B;  2L00 B;  4IG7 B;  2L3Z A;  2LUE A;  5AEK B;  1P98 A;  3UIP B;  3EEC A;  5KHQ A;  2CS4 A;  3OJ4 B;  5DPT A;  2LGY A;  2M0X A;  4FN2 A;  4EKU A;  4FLH A;  2C9W B;  3VAW A;  3DBR I;  2ZEQ A;  3PLU A;  4KVG B;  4MGZ E;  2ZPN A;  5C1Z A;  3A9J B;  2XK5 B;  3JYU A;  3HHM A;  3DVN V;  5CX3 A;  3M63 B;  4ASW C;  2FID A;  3VVW B;  5LXH A;  1IYF A;  2FUH B;  2KHW B;  3DQV A;  3JSV B;  3ENE A;  3QC8 B;  3BIN A;  2KTR A;  2JWZ A;  5DPR A;  2KJ6 A;  2O6V A;  3MJW A;  4AJY B;  2K6D B;  2KC1 A;  3Q3F A;  1S3S G;  2L7R A;  2JRH A;  2KLG A;  4AOF A;  4IM2 A;  2N7E A;  4MSM B;  4WWP A;  3RZF A;  3SHQ A;  3ZRF A;  3ZNZ B;  2NR2 A;  1J0G A;  2J0J A;  3SDL C;  2CKH B;  4FUL A;  3RUI B;  5IA7 A;  3QA8 A;  1EF1 A;  1WF9 A;  2MBB B;  2NPT B;  2KVR A;  3PZD A;  2MCN B;  3RT3 B;  2IO0 B;  3QCA A;  1OEY J;  2MLB A;  4AUQ C;  4W9F A;  1J8C A;  3UIN B;  1J19 A;  1R4M I;  3OAW A;  1WMH B;  2GBJ A;  1LXD A;  1YX6 B;  1WM2 A;  1TTN A;  4W9G A;  2LGD A;  2CR5 A;  1H4R A;  1GJZ A;  3MHS D;  4A20 A;  3V6C B;  1QZE A;  3KW5 B;  2CHW A;  3RCZ A;  1F9J A;  2ZZP B;  2LVP A;  4BBN F;  1ZW7 A;  2IO3 B;  4I6P A;  3K9O B;  4LJP B;  3P2B A;  4PS3 A;  4W9E A;  2GBK A;  2NBW B;  2BKR B;  1IPG A;  3A1Q B;  3L17 A;  3QJZ A;  4J6I A;  2JZZ A;  2KFJ A;  3HK0 A;  2OJR A;  4LJO B;  4E71 A;  2KWC A;  4WQO B;  2C5L C;  4IWO A;  2KLC A;  1WGY A;  2RR9 A;  2M4N A;  3SD5 A;  2KO3 A;  1P9D U;  3VUX A;  2D10 A;  1WGD A;  1SE9 A;  1L7Y A;  2RGF A;  3OLM D;  3DBS A;  2PJH A;  2MA9 B;  3TBL D;  3TJP A;  4BBN C;  4BKS D;  4W9H A;  4GXB A;  3UGB B;  2MSE D;  2BGF A;  2DAJ A;  3B08 A;  2IZV B;  2L0T A;  5G55 A;  3R66 C;  2KAN A;  3CST A;  2G3Q B;  5AZH A;  3ZIM A;  4NJ7 A;  3B0A A;  5L83 A;  2EKE C;  5CTR C;  1WM3 A;  4PS8 A;  4ICV A;  2GBR A;  4DHJ B;  2EMS A;  3CSF A;  2GMI C;  4F1S A;  1E90 A;  2ZNV C;  2KMA A;  3VUW A;  1BT0 A;  2D07 B;  4GDL A;  2EMT A;  2LVQ A;  3W1S A;  5EDS A;  4FJY A;  3WIM A;  2DZJ A;  3T8M A;  3NHE B;  5JHB A;  4MH0 E;  4KZ0 A;  1FXT B;  2K6Q A;  2KKC A;  3KYC D;  1V5O A;  1KJT A;  1XQQ A;  2UWQ A;  2D2Q A;  5J18 A;  1V6E A;  2LI5 A;  3V60 A;  4BVU C;  2HTH A;  2KTR B;  3L54 A;  1TZ1 A;  3PHX B;  2O6V B;  1E7V A;  3WAL A;  4M0W B;  1UBI A;  2ZCB A;  1ZKH A;  2AYO B;  2DZI A;  2N1W A;  5E6N A;  3AXC A;  4FHK A;  1EO6 A;  2NBV B;  2JZ3 B;  4BKS A;  4HDQ A;  1C1Y B;  2JVC A;  2KDF B;  2NVU I;  4P7I A;  5D7G A;  4II2 B;  3ZRC A;  4IUM B;  3H7P A;  4W9L A;  4WJO A;  4AP4 C;  4IM0 A;  4IW0 A;  2RPQ A;  4KV2 A;  2V3S A;  3IBE A;  2L05 A;  2O2V A;  3RYT A;  1U4A A;  4A3O A;  2R2O A;  3ZDT A;  3B1L X;  4TQ0 A;  5HKH A;  3QQ8 B;  4EUT A;  1V86 A;  2J0K A;  3W1Y A;  3PPA A;  3D32 A;  2PPH A;  3ML8 A;  1GNU A;  3TIX A;  3ZLZ A;  4HCN B;  4AWJ A;  4FBJ B;  4URK A;  5C23 A;  4HXD A;  4N9F 4;  4KDI C;  3IVF A;  5D2M B;  4RM9 A;  1YJ1 A;  2DEN B;  2K1F A;  5AZG A;  4JQW C;  4FJZ A;  1WGG A;  2BYE A;  3N30 A;  2M17 A;  2ZPY A;  2OOB B;  4KIK A;  2J0M A;  5CHV C;  3KYD D;  4NJ6 A;  3KUC B;  3VQI A;  2FCM A;  1V80 A;  4G11 A;  4FAD A;  1WFY A;  2JPH A;  2QHO A;  2UYZ B;  4PYU A;  4M8N A;  4WJP A;  2K8H A;  2J7Q B;  4NPN A;  2G4S A;  4BFR A;  3M3J A;  3ZNH B;  4DHZ E;  3LJ3 A;  5D6J B;  5TR5 A;  3AUL A;  4WJN A;  1ISN A;  2ZCC A;  3I3T B;  4HDO A;  2G45 B;  3DPD A;  1TBE A;  3X23 A;  2BYV E;  3H9D A;  1EF5 A;  4WWN A;  3H6N A;  4HCP B;  2ZVO A;  3PRP B;  1NBF C;  4K7W A;  4LCD E;  2K8C A;  2V4L A;  1VCB A;  1V5T A;  4ANV A;  4DK5 A;  3PRZ A;  3KUZ A;  3M95 A;  2DYM A;  2HE7 A;  2KJH B;  3QIJ A;  4W9C A;  3ML9 A;  2I1K A;  3X0W A;  2I1J A;  4EZL A;  2L8J A;  1V9J A;  1JRU A;  2KJR A;  3L08 A;  2MW5 A;  5GMV A;  4GN1 A;  4ZYN A;  4GDL B;  4KZC A;  4DWF A;  1WR6 E;  2DZM A;  2KD0 A;  2LXA A;  4AJW A;  1M94 A;  3APC A;  2MQJ A;  3ZW3 A;  3DBH I;  4NNJ B;  2XBB C;  3L16 A;  4DDG D;  3EFU A;  4TQ1 A;  5J17 A;  3R7Q A;  3PRE A;  2IY0 B;  2WYQ A;  5IAA C;  2LD9 A;  2ZJD A;  3DVN U;  3PSE B;  2BPS A;  2G4D B;  2NBU A;  2ZNV B;  3BY4 B;  4G0N B;  2KNB A;  1I42 A;  2BKF A;  1WX9 A;  2DYB A;  3GOE A;  3CMM B;  2RSU A;  2KDB A;  3HM6 X;  3ZNG C;  2LJ5 A;  1Q1O A;  3ZKJ C;  2FAZ A;  3EC8 A;  3RZW C;  2N9E B;  3A4R A;  4ANU A;  3QK0 A;  2KK8 A;  3UIO B;  2LAS A;  1G6J A;  4KSK C;  4ZRJ A;  2ASQ A;  4TKN A;  3W1S C;  3ALB A;  4NAW A;  1GG3 A;  2CU1 A;  4K1R B;  2BWE S;  4OVU A;  2N4F A;  2DHZ A;  3H7P B;  5D94 A;  2MRP A;  4W9J A;  4M8M A;  1YX5 B;  2K39 A;  5DCN A;  3ZTD A;  4MDK E;  1T0Y A;  2O2V B;  3ZVV A;  1SIF A;  4PS7 A;  2KQ7 A;  4LDT D;  1WJN A;  3HIZ A;  2K25 A;  2KOX A;  2C60 A;  4I6L B;  3KVF B;  4IC7 B;  1E7U A;  1WZ0 A;  4B95 A;  3L10 B;  2D3G A;  3JW0 X;  2V1Y A;  4KDL B;  1UBQ A;  3NY5 A;  2MP2 A;  1V49 A;  5CHW A;  4MEM A;  4HK2 A;  1E8X A;  5KHO A;  4KIK B;  3R7R A;  1HE8 A;  3QHT A;  2LRU A;  3QX1 A;  2YLM A;  3SU8 X;  3UQA A;  2Y5B B;  2IY1 B;  3VTV A;  1A5R A;  2HJ8 A;  4ANW A;  2KMC A;  3NZU A;  3VTU A;  3WAP A;  1S1Q B;  2JUO A;  1CMX B;  3DOW A;  4GMV A;  1GUA B;  4WJQ A;  4DHJ D;  2KXJ A;  1LM8 B;  1OGW A;  3V62 A;  5LXI B;  1EUV B;  1Z5S B;  1UZX B;  5G2N A;  4XX5 A;  3L13 A;  1WXA A;  5BO4 B;  2AEH A;  1GC7 A;  4ICU A;  2WX0 A;  1NI2 A;  3C0R B;  4OVV A;  3TL5 A;  4HVB A;  3OJ3 A;  3H7S A;  3O65 B;  4A3P A;  2A5U A;  1P3Q U;  4HPM B;  3A9K A;  4CHK A;  2C7H A;  5E6P A;  1WJ4 A;  2YVC A;  2O6V D;  4K7S A;  3JVZ X;  4E3C A;  3PTF C;  3UQB A;  1WH3 A;  4FA6 A;  3RUL A;  2KDE B;  3VDZ A;  2JT4 B;  3WAM A;  1IP9 A;  1MG8 A;  3DVG X;  4W9I A;  3EHV A;  2GBN A;  2MBO A;  2KZR A;  3PRM B;  3WAN A;  2DYO A;  3DVG Y;  1YD8 U;  4GOC A;  1LQB A;  2KX0 A;  4EOY A;  1RFA A;  1H8C A;  2PE6 B;  1K8R B;  3Q3J A;  2KC2 A;  4GIV A;  2LWP A;  3VXW A;  4BOZ B;  1X1M A;  2B3A A;  2N9X A;  1RLF A;  4MM3 A;  4XC2 A;  4K81 A;  2PEA A;  1YQB A;  2JRI B;  1WXS A;  2DZK A;  3VH3 B;  1OQY A;  3QAQ A;  4DDI D;  4HLE A;  3S2A A;  3QWZ B;  3ZTC A;  4E74 A;  1Q0W B;  3PV1 A;  4IWP A;  4MJS A;  3PGE A;  1UGM A;  4TV3 A;  3L0W B;  4X57 B;  4ZRK A;  2MWS B;  4NAW B;  3TMP B;  1WGH A;  2FCS A;  3K9P B;  2Z59 B;  4MGI E;  3U8Z A;  3IHP C;  1WX7 A;  2NCN A;  1L2N A;  2FNJ B;  5FR6 A;  1NDD A;  2WDT B;  3PT2 B;  1WY8 A;  4ZRI A;  4KSL C;  2L76 A;  4CO7 A;  4EZJ A;  5JH5 C;  1GC6 A;  2LVO A;  4WAA A;  4K7U A;  3APF A;  3ZO5 B;  1I35 A;  2MP2 B;  4IM3 A;  2JXX A;  2JY6 A;  2KN5 A;  3NZS A;  3KUD B;  2XEW A;  3PS6 A;  2LGX A;  4W9K A;  2REX A;  1KM7 A;  2KFK A;  2WWZ A;  1V2Y A;  4B9K A;  1UD7 A;  2KQS A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  1DYQ A;  1WJ6 A;  4GDK A;  5TSS A;  1GB1 A;  2BS2 B;  4IDI A;  1LO5 D;  3ECI A;  4XDD A;  2MEK A;  2J4X A;  3AI5 A;  1WIA A;  1KLG D;  2IO2 B;  4XGA B;  2AQ2 B;  2M8S A;  2XK5 A;  3ZYY X;  3T3O A;  1XT9 B;  2LHD A;  1PUT A;  2Z0E B;  4RGN A;  1TGZ B;  4HJK A;  3H1U A;  2N9P C;  3AH7 A;  1E8Z A;  1Z2M A;  4IOI E;  3KH0 A;  4WWO A;  3DHH C;  4GGQ A;  2JYE A;  3GZN I;  1PGB A;  1Q10 A;  3PLV A;  4CYE A;  4GSW A;  2LXC A;  1WR1 A;  3QAR A;  2IO1 B;  1AWD A;  2X38 A;  4K3C A;  2C7M B;  3CIR B;  2KDI A;  2DAF A;  4HWI B;  1MPE A;  3N32 A;  2GI9 A;  1L5P A;  2WX1 A;  3FAH A;  2I38 A;  1AYF A;  2FCN A;  2A4Z A;  3GP7 A;  3DBL B;  4FHJ A;  3SFD B;  2G9H D;  2RD0 A;  2W3R A;  2WXF A;  2KX3 A;  4DHZ B;  1NYR A;  3DDC B;  2HTM E;  1JML A;  2HD5 B;  3MC9 A;  4NY0 A;  1KF6 B;  3VH4 B;  3NVY A;  2KFK B;  2M1M A;  1OTR B;  4ITK A;  4M01 A;  1DOX A;  2AL6 A;  3IFW B;  4HKQ A;  2L00 B;  4IG7 B;  2L3Z A;  5AEK B;  3UIP B;  4ARI A;  3OJ4 B;  5DPT A;  4EKU A;  4FLH A;  1QF6 A;  4MGZ E;  3PLU A;  2ZPN A;  3JYU A;  3P42 A;  3HHM A;  5CX3 A;  1NI3 A;  3M63 B;  3VVW B;  4LTU A;  2KHW B;  3JSV B;  3ENE A;  4OZA A;  2KTR A;  2JWZ A;  5DPR A;  2KJ6 A;  4B0E A;  2O6V A;  2WXK A;  3AE1 B;  1CZP A;  1S3S G;  2L7R A;  1HTQ A;  2JRH A;  4IM2 A;  3RZF A;  2PLP A;  2VH2 A;  2NR2 A;  1C77 A;  2NMQ A;  2CKH B;  3RUI B;  2MBB B;  3IT6 B;  3PZD A;  2MCN B;  1C76 A;  3RT3 B;  4W9F A;  2W3S A;  4HRS A;  4HJG E;  1YX6 B;  4XDC A;  4WAF A;  2BTE A;  1TTN A;  3ZJT A;  2SAK A;  2WLB A;  3Q2A C;  2MJD A;  1QZE A;  2D3A A;  1Y56 A;  4I6P A;  4PS3 A;  4W9E A;  2GBK A;  2NBW B;  1IPG A;  3IAS 1;  4HPP A;  3HK0 A;  2OJR A;  4A6Q A;  1ZDX A;  3OG5 A;  2RR9 A;  3SD5 A;  3WCQ A;  1P9D U;  1TKY A;  1DOY A;  4P16 A;  3AN1 A;  3TBL D;  1E6E B;  3UGB B;  4YSZ B;  2BGF A;  2DAJ A;  3B08 A;  1CK1 A;  4NZL B;  3GS2 A;  1F0Z A;  4NJ7 A;  5L83 A;  5IA7 A;  4DHJ B;  2GMI C;  1EU3 A;  4FJY A;  2DZJ A;  2NTT A;  4TSS A;  1GPX A;  1FXT B;  4MH8 A;  5H92 C;  3PO0 A;  2PTL A;  3Q8F A;  1JW9 D;  4RFB A;  4C80 A;  5J18 A;  3ZXV A;  1XF5 L;  1E7V A;  1ZDV A;  1N5X A;  1N63 A;  2GB1 A;  3I9V 1;  3KWL A;  1JWU D;  2AYO B;  2BS4 B;  2OHF A;  1TKE A;  1C1Y B;  5EE0 A;  2NVU I;  4M00 A;  4WJO A;  2JU6 X;  2V3S A;  4MT5 A;  2L05 A;  4KX6 B;  3BK2 A;  3ZDT A;  4TQ0 A;  5HKH A;  1QT9 A;  4D2K A;  3AE9 B;  3D32 A;  2ZW0 A;  3LB8 C;  4URK A;  1F2R I;  5D2M B;  2DEN B;  2K1F A;  4KIK A;  4CQN A;  5CHV C;  1IUE A;  3RPF C;  1ZXH A;  1VZ7 A;  2JPH A;  2X8X X;  2QHO A;  3KQ4 A;  4M8N A;  2WQY B;  5I4D A;  2WXG A;  5IKC M;  2ZCC A;  2G45 B;  1TY2 A;  2TSS A;  2QEJ C;  3H6N A;  4LCD E;  2K8C A;  1VCB A;  1V5T A;  1TT5 B;  4ZHO A;  2HE7 A;  1C4A A;  3ML9 A;  2JQR B;  4EZL A;  2I1J A;  3L08 A;  1P7F A;  4DWF A;  2N7J A;  3UI3 A;  1M94 A;  5BYR A;  2MQJ A;  1FFU A;  2WDV B;  3EFU A;  1JWS D;  3N9Y C;  4TQ1 A;  5HHD G;  3PRE A;  2IY0 B;  5IAA C;  3PSE B;  3BY4 B;  1I42 A;  4AQ7 A;  4KKJ A;  1PFD A;  3GOE A;  1JCK B;  2WXN A;  1Q1O A;  1TIF A;  2ASQ A;  2AQ3 B;  3W1S C;  2FUG 1;  3E56 A;  4K1R B;  3W2D A;  2MRP A;  3W5U B;  3I63 C;  4S17 A;  1ESF A;  2O2V B;  1SIF A;  2KQ7 A;  3HIZ A;  3Q8C A;  3ABV B;  2L1A A;  3L10 B;  2V1Y A;  2RPV A;  3U4E G;  1I4X A;  1HE8 A;  2JX5 A;  2J52 A;  3UQA A;  2Y5B B;  2DWQ A;  3VTV A;  3EUB 2;  5AUI A;  2MJ3 A;  2KXJ A;  2ON8 A;  3P4S B;  1OGW A;  1JWA D;  1UZX B;  5G2N A;  2DBY A;  1RFK A;  1GC7 A;  4OVV A;  1IGC A;  3R2I A;  4HVB A;  3OJ3 A;  4A3P A;  4WIP A;  1WJ4 A;  2O6V D;  4Q2J A;  4E3C A;  1SIJ A;  1WH3 A;  4H2A A;  2JT4 B;  2WNM A;  3WAM A;  2KZR A;  3WAN A;  2DYO A;  3DVG Y;  1YD8 U;  2KN4 A;  2LEK A;  3MC0 B;  3Q3J A;  3N1Y C;  1X1M A;  2QDF A;  4XC2 A;  4K81 A;  2JRI B;  3V3X A;  1OQY A;  3QWZ B;  1L6V A;  5IOI A;  1QLB B;  1KH0 A;  4P1C C;  1UGM A;  4NAW B;  3U2S C;  3IHP C;  4IKG A;  3Q3M C;  5FR6 A;  2WDT B;  4CO7 A;  1WY8 A;  4ZRI A;  4KSL C;  4OZB A;  3TSS A;  1I4Q A;  1GC6 A;  2WU2 B;  3NUH B;  2MP2 B;  1T0R C;  3NZS A;  2Y5P A;  3ZJV A;  2KFK A;  4B9K A;  1UD7 A;  4DXF A;  1ZXI A;  4EZK A;  3WA0 A;  1WXV A;  4ZRQ A;  2GBM A;  4N6E B;  3U7D A;  2M19 A;  5DPW A;  2WGS A;  1LFD A;  2CHZ A;  2JXT A;  3NS8 A;  4JL9 A;  1QIL A;  3MP9 A;  1WJU A;  3A9K B;  3JSV A;  1WZ3 A;  2NS5 A;  1Q5W B;  2KWU B;  3ONS A;  4BOS C;  1WX8 A;  2PE9 A;  1GB4 A;  1VD2 A;  1RRB A;  2BYT A;  4EEW A;  1XCQ L;  1E8Y A;  4MGK E;  2N9K A;  2WXM A;  2MX2 A;  4G3X B;  2XN9 C;  4RMA A;  1UEL A;  4NQL B;  2IYD B;  3HM3 A;  5E6O A;  3N3K B;  4EFO A;  4YXD B;  4ZOH C;  5J2R A;  4MJS B;  4PYZ A;  2V4I B;  1N5W A;  5FKA C;  3A33 B;  1VDV A;  4K3B A;  1E8W A;  5BYS A;  1WGR A;  2C7N B;  1P0R A;  3T9L A;  1E10 A;  3GZN B;  5FR3 A;  3RN9 C;  4AS1 A;  1SJE D;  5BMI A;  2XNA C;  4FXC A;  3ZUN A;  4TUU A;  2JF5 A;  1FRR A;  4ANX A;  2Z0D B;  2KMM A;  3BK1 A;  1D5Z C;  1DOI A;  1P1A A;  4II3 B;  4XZ4 A;  4JE3 B;  4WWM A;  1ZGU B;  1VZ6 A;  3EEC A;  1C78 A;  2LGY A;  2M0X A;  2C9W B;  3DBR I;  3Q8E A;  5C1Z A;  1GAQ B;  2K5P A;  2QMT A;  3U7Z A;  1WRI A;  1E9M A;  1PGX A;  1P7E A;  3AE6 B;  3DQV A;  1EWC A;  1RYJ A;  2K6D B;  1FPY A;  4MSM B;  1JAL A;  1NEN B;  3SDL C;  3QA8 A;  1EF1 A;  1WF9 A;  2NPT B;  3BVM A;  3N1Z C;  2IO0 B;  4YWG G;  1J19 A;  1R4M I;  2VH1 A;  1WM2 A;  1OQQ A;  2RDG A;  2EKI A;  2CR5 A;  1SE2 A;  1D5X C;  4HKZ E;  3IT4 B;  4US8 A;  2LVP A;  3Q3O C;  4LJP B;  3A1Q B;  3EFC A;  2ACZ B;  2MJE A;  3QJZ A;  2KFJ A;  2KLC A;  2M4N A;  2KO3 A;  1WGD A;  1TS5 A;  3OLM D;  2MA9 B;  3TJP A;  4BBN C;  4BKS D;  3RNE C;  2IZV B;  5AZH A;  2KAN A;  2K9X A;  3ZIM A;  3B0A A;  3MJ5 A;  2GLS A;  4PS8 A;  4ICV A;  3TUO A;  4F1S A;  1E90 A;  1N62 A;  2KMA A;  3VUW A;  1ZE3 D;  5EDS A;  3H8H A;  4LNN A;  5FK9 C;  3T8M A;  5JHB A;  4KZ0 A;  2K6Q A;  3KYC D;  1V5O A;  1KJT A;  3MC8 A;  4YSY B;  2D2Q A;  1V6E A;  2LI5 A;  2D3C A;  3URY A;  2PMV A;  3PHX B;  4C56 C;  3B2F A;  1C4C A;  1UBI A;  1R4N B;  2ZCB A;  4OW0 A;  5D3D A;  2DZI A;  3NRZ A;  4FHK A;  1EO6 A;  1FCL A;  2JZ3 B;  4HDQ A;  2Q5W D;  5D7G A;  2KDM A;  4IUM B;  2E3T A;  4IM0 A;  2EEL A;  3NS1 A;  2BQQ A;  3IBE A;  2O2V A;  3RYT A;  1U4A A;  4A3O A;  1MHX A;  5D3I B;  3DHI C;  4EUT A;  1V86 A;  1CQV A;  4N59 A;  4FBJ B;  1FXA A;  1YJ1 A;  4JQW C;  4B0M A;  4FJZ A;  3N30 A;  2CJN A;  2M17 A;  2ZPY A;  2RDB C;  3KUC B;  1WFY A;  1FIQ A;  2R61 A;  1SJH D;  2J7Q B;  3C19 A;  3M3J A;  3LJ3 A;  5D6J B;  5TR5 A;  3AUL A;  2Y5C A;  3Q6B A;  3I3T B;  4HDO A;  1J7B A;  2IJ0 A;  3X23 A;  2QSD A;  3H9D A;  1EF5 A;  2ZVO A;  3PRP B;  1NBF C;  3AED B;  1FEH A;  1UUP A;  1YNT E;  3N1X C;  1YN5 A;  2DYM A;  3QIJ A;  2KJH B;  4W9C A;  2I1K A;  1V9J A;  1JRU A;  3BII D;  5GMV A;  4GN1 A;  4OZC A;  2KD0 A;  4AJW A;  3APC A;  3DBH I;  4NNJ B;  2XBB C;  5G5H A;  3L16 A;  4XE0 A;  2N9L A;  4YTN B;  1TS3 A;  2VZK D;  5C3J B;  2LD9 A;  1XLQ A;  2G4D B;  2NBU A;  2V3N A;  1WX9 A;  2DYB A;  2IGH A;  3CMM B;  2Z8L A;  2KDB A;  1MFW A;  2LJ5 A;  3ZKJ C;  2N9E B;  4ANU A;  1T0Q C;  3QK0 A;  2KK8 A;  2BT6 A;  4C00 A;  5BMH A;  4KSK C;  3ALB A;  4NAW A;  2W54 A;  3H7P B;  2RDH A;  3Q3N C;  5D94 A;  3TEW A;  2K39 A;  4MDK E;  1NVI D;  1T0Y A;  1I4H A;  4LDT D;  1UF0 A;  1WJN A;  1V1P B;  2KOX A;  2C60 A;  4IC7 B;  4RGO S;  1E7U A;  1WZ0 A;  1RWS A;  2MP2 A;  1E8X A;  3QHT A;  3AM9 A;  1T3Q A;  2G1E A;  2IY1 B;  2V9H A;  3NZU A;  1QKZ A;  3VTU A;  4GMV A;  1CMX B;  2KT7 A;  1ACC A;  1GUA B;  2AX5 A;  4WJQ A;  4DHJ D;  1HXY D;  4NAM A;  5C2T B;  2LGI A;  2WP9 B;  1D6E C;  3MHZ A;  4ICU A;  1NI2 A;  3C0R B;  3H7S A;  4BZA A;  5HFY A;  1P3Q U;  3A9K A;  4CHK A;  2C7H A;  1XLP A;  3PZ8 A;  3UQB A;  3VDZ A;  1IP9 A;  3KWV A;  1MG8 A;  3DVG X;  4W9I A;  3ZGZ A;  1KLU D;  4LNO A;  3PRM B;  1UWX A;  1LQB A;  4GOC A;  1RFA A;  5HG2 A;  2LWP A;  3RI7 C;  3GE3 C;  3VXW A;  1RLF A;  2JZP A;  2PEA A;  1WXS A;  1UNS A;  3QAQ A;  1DGJ A;  3ZTC A;  1TS2 A;  1Q0W B;  4MJS A;  3B9J A;  1FFV A;  1LGR A;  4A8X C;  1JWM D;  4LNF A;  3TMP B;  1F77 A;  2FCS A;  2Z59 B;  3VR9 B;  3U8Z A;  1WX7 A;  2L83 A;  1ENF A;  4LK0 M;  2BS3 B;  1HZ5 A;  3PT2 B;  4LNI A;  3ZO5 B;  4IM3 A;  1IBX B;  2JY6 A;  3KUD B;  1OQR A;  2XEW A;  3SEB A;  1V1O A;  1KM7 A;  4RF0 A;  5MPO A;  3LYY A;  2UU7 A;  2LUM A;  1C3T A;  2M0A A;  3HVD A;  1ZUD 2;  2K8B A;  4R3D A;  4B6W A;  1PQS A;  3RD2 A;  3OWE B;  1QQR A;  1VZ8 A;  2MBQ A;  3VFK A;  3V6E B;  1UH6 A;  2D11 A;  5JXV A;  3AV8 A;  2WXR A;  3CWI A;  1L6U A;  2YEP F;  4ZHP A;  4IWQ A;  4MEL A;  1AW7 A;  3R8B A;  1OFF A;  4YTM B;  3VHT C;  4MSQ B;  4BKT A;  1V81 A;  3DCG A;  4MGY E;  4L23 A;  3UF8 A;  4REZ A;  2NPT A;  1YN4 A;  2LRW A;  3M62 B;  4MM3 B;  2BF8 B;  4FJV B;  1WI0 A;  2MBH A;  2FCQ A;  3A4S C;  2MBE A;  2AL3 A;  3AU4 A;  3LDZ E;  2PVG C;  3EA6 A;  3TEZ A;  1I7H A;  4EE2 A;  3AU5 A;  3CF6 E;  2IBI B;  3WAO A;  3IG3 A;  4NQK E;  4L2Y A;  1FNV A;  3A1Q A;  2KTF A;  2BWF A;  1D3Z A;  2DX5 B;  3P63 A;  4L1B A;  1TS4 A;  4RCO A;  4G50 A;  3AE7 B;  1KLV A;  3ZNI D;  1WE6 A;  1XEE A;  2QJL A;  3U30 A;  4A9A A;  1WXM A;  5LLI A;  2SEB D;  1FCC C;  4RF1 A;  3P4Q B;  2R2Q A;  4BKG A;  3ZDM C;  1FMA D;  1WYW B;  5DPS A;  3BYT B;  1E0Z A;  5KHQ A;  1VJK A;  3VAW A;  2BB5 A;  1EM7 A;  1YN3 A;  2ZEQ A;  3A9J B;  1CJE A;  3DVN V;  3VRB B;  4ASW C;  1KTK A;  2FID A;  3QC8 B;  2WDR B;  3SR6 A;  1YOV B;  4AJY B;  2KC1 A;  2KLG A;  4ARC A;  2N7E A;  3ZRF A;  4WWP A;  2V3P A;  3RNF C;  1J0G A;  3IAM 1;  2MLB A;  3OAW A;  1FRD A;  1WMH B;  2GBJ A;  2DLB A;  4W9G A;  4RGT A;  2LGD A;  4UDU C;  1GJZ A;  3MHS D;  4A20 A;  2W82 A;  3KW5 B;  3RCZ A;  1N61 A;  2IO3 B;  3K9O B;  2D5G A;  3L17 A;  4US9 A;  2JZZ A;  1QOF A;  1QOB A;  4LJO B;  4E71 A;  2C5L C;  1HZ6 A;  1F2R C;  1WGY A;  3DHG C;  3VUX A;  2L32 A;  1SE9 A;  2RGF A;  1R4M B;  2PJH A;  3FIL B;  4W9H A;  2MSE D;  5BYQ A;  2L0T A;  2BBC A;  2G3Q B;  1L4D B;  1FXI A;  1WM3 A;  4YSX B;  3CSF A;  1QOG A;  1PGA A;  1BT0 A;  1T6B X;  2D07 B;  2LHE A;  1L0Y B;  4KGS A;  4MH0 E;  2IDY A;  3AEC B;  2KKC A;  4DXG A;  3IXS A;  4LNK A;  1JWB D;  3L54 A;  1TZ1 A;  4M0W B;  3W9C B;  2N1W A;  1UWM A;  1D5M C;  3FC4 A;  2NBV B;  2KDF B;  4P7I A;  2Y3A A;  3ZRC A;  3H7P A;  4AP4 C;  3NG0 A;  4IW0 A;  4KV2 A;  3V05 A;  3LXF A;  2R2O A;  2ICI A;  4A90 A;  1C4P A;  1V1P A;  3AE4 B;  1ZPS A;  2QCZ A;  3W1Y A;  3PPA A;  2PPH A;  4HCN B;  3RNA C;  3HVZ A;  4N9F 4;  4KDI C;  3IVF A;  3O13 A;  4RM9 A;  2D3B A;  2OOB B;  1XLN A;  1V80 A;  2FCM A;  2K0P A;  2IND C;  2UYZ B;  4PYU A;  3N20 C;  2K8H A;  4NPN A;  2G4S A;  1ET6 A;  1STE A;  1YQ4 B;  4DHZ E;  2AQ1 B;  2WDQ B;  1EWY C;  1ISN A;  1L4Z B;  2OJW A;  3DWM A;  2IGG A;  2WXJ A;  2BYV E;  4WWN A;  1J7C A;  4HCP B;  2INP E;  1V8C A;  4K7W A;  4S0R A;  2V4L A;  4ANV A;  4DK5 A;  3PRZ A;  3M95 A;  1JQ4 A;  3X0W A;  1B9R A;  3TEY A;  4DQO C;  2MW5 A;  4GDL B;  4KZC A;  1WR6 E;  2DZM A;  2LXA A;  3NVW A;  1D4B A;  4C7Z A;  3Q8A A;  3W5V B;  3R7Q A;  3AE3 B;  1TZO A;  1XO3 A;  3DVN U;  4G0N B;  2ZNV B;  1HA5 A;  1WYG A;  2QC8 A;  2RSU A;  3HM6 X;  1ROE A;  1N60 A;  2FAZ A;  4M02 A;  3EC8 A;  3A4R A;  3UIO B;  2LAS A;  1G6J A;  4TKN A;  5IN7 A;  5IO9 A;  4YT0 B;  5BMG A;  2CU1 A;  2DHZ A;  5DCN A;  1WXQ A;  3ZTD A;  4OVZ A;  1TY0 A;  3DBH B;  3ZVV A;  4PS7 A;  3ZJU A;  3I57 A;  3KVF B;  1XCT L;  3HUI A;  4KDL B;  3JW0 X;  1I4P A;  1T5X D;  3NY5 A;  1V49 A;  1IBX A;  4MEM A;  1B1Z A;  4HK2 A;  2BW2 A;  3ZQ4 A;  1RM6 C;  1FM0 D;  1A5R A;  2HJ8 A;  4ANW A;  4QAY A;  2KMC A;  1S1Q B;  3DOW A;  2WU5 B;  1LM8 B;  5LXI B;  1EUV B;  1Z5S B;  1SSN A;  4XX5 A;  1WXA A;  4JWU C;  1JRP A;  2WX0 A;  3TL5 A;  2IPK D;  4O1N A;  1EU4 A;  4HPM B;  5E6P A;  4K7S A;  3JVZ X;  3AEB B;  4FA6 A;  1BUI C;  2KDE B;  1XXG A;  3EHV A;  2GBN A;  2MBO A;  1WWT A;  3P4R B;  1A70 A;  2PE6 B;  1K8R B;  1TKG A;  1FNW A;  2KVZ A;  4BOZ B;  3P1M A;  4MM3 A;  2N0S B;  5LNK 1;  2DZK A;  3VH3 B;  4ZRP A;  4DDI D;  5EE9 A;  2K22 A;  1V97 A;  1XLO A;  3PV1 A;  4IWP A;  4TV3 A;  3L0W B;  3AEF B;  2WXH A;  2HDE A;  3K9P B;  2NCN A;  1L2N A;  4C4V B;  2FNJ B;  1NDD A;  4K7U A;  1VLB A;  4B95 A;  3BZD B;  2E6X A;  4W9K A;  3PS6 A;  1F1H A;  2LGX A;  2LFI A;  1YJJ A;  3BWU D;  1HQR D;  2VZK B;  4AUQ C;  3PZ7 A;  2KQS A;  3P4P B;  3VTW A;  4F8C B;  4KKI A;  4JLC A;  4F7Z A;  4I6N B;  1K53 A;  4KGR A;  2CHX A;  3NZ3 A;  1WRD B;  4PT5 A;  4DXA B;  1R7S A;  2V0G A;  4XWW A;  5AUK A;  2ZW1 A;  3AB5 A;  5JZE B;  2ZVN A;  5EE1 A;  4JPS A;  3ETR A;  3A9J A;  4W9D A;  4YL8 A;  3T3N A;  1Y8R C;  4JIO U;  1AAR A;  3VUY A;  1FD6 A;  1SB3 C;  2VRR B;  1YMH E;  2BYF A;  4BAX A;  1KRH A;  4LDT B;  2LJI A;  1SXT A;  2H89 B;  1OEY A;  2QIE B;  3DBL I;  1WE7 A;  3HRD D;  1K50 A;  1E5W A;  3EGR A;  3PHW B;  4JGH B;  3MTN B;  2FBW B;  1R4N I;  2L0F A;  4DBG A;  3NOB A;  1WMH A;  5HI1 A;  2KAJ A;  2N7D A;  2PIA A;  2LZ6 A;  4YTP B;  1MI0 A;  1SBB B;  5L95 C;  3SFE B;  2KWD A;  3V61 A;  4ZDV A;  1YIW A;  2WXI A;  1SGH A;  2J42 A;  5CHF A;  4GU2 A;  3TCA A;  2N1V A;  1RAX A;  2IGD A;  1PYW D;  4GB9 A;  3PVL A;  1K52 A;  1KOT A;  3R3M A;  4HPL B;  2GOW A;  4RH6 A;  2W9N A;  3FIL A;  5AZF A;  2FIF A;  2KWV B;  4MAC A;  1XD3 B;  4RM8 A;  2WXQ A;  4C7Y A;  4GDK B;  5JHA A;  2AWT A;  3APD A;  3RNC C;  1YQ3 B;  2LUE A;  1P98 A;  4NJC A;  4WUR A;  2CS4 A;  1C79 A;  4FN2 A;  1J7A A;  4KVG B;  4LLG M;  2BVC A;  2XK5 B;  3Q14 C;  5LXH A;  2INC C;  1IYF A;  1QOA A;  2FUH B;  4GLS C;  3BIN A;  2K3U A;  2BB6 A;  4A55 A;  3MJW A;  4M0W A;  3Q3F A;  3U52 E;  4AOF A;  1MVK A;  3SHQ A;  3ZNZ B;  2J0J A;  4FUL A;  2W55 A;  2KVR A;  1HEZ E;  3QCA A;  1OEY J;  1J8C A;  1NYQ A;  3UIN B;  1K51 A;  1M4V A;  2CJO A;  2PVO D;  1LXD A;  3ZXR A;  1SE4 A;  1VR9 A;  1H4R A;  1SEB D;  3V6C B;  1VRA B;  2CHW A;  1F9J A;  2ZZP B;  2J53 A;  1TJE A;  4BBN F;  1ZW7 A;  3B2G A;  2INN E;  2B76 B;  3P2B A;  2YEP B;  2HJ1 A;  3L4P A;  2BKR B;  4J6I A;  2KWC A;  4WQM A;  4WQO B;  3GE8 C;  4IWO A;  2JSV X;  3RFZ B;  1ZP0 B;  2KYW A;  2D10 A;  4RGM A;  3DWG C;  1L7Y A;  3KLS X;  3DBS A;  1I4R A;  2WHI A;  1AN8 A;  4GXB A;  1MG4 A;  1GOZ A;  5G55 A;  3R66 C;  3AE5 B;  3CST A;  1I4G A;  2EKE C;  5CTR C;  4J3O D;  2GBR A;  2EMS A;  2ZNV C;  4ZYS A;  3W1S A;  4GDL A;  2EMT A;  2LVQ A;  2WXL A;  3WIM A;  3NHE B;  3Q69 A;  2ONQ A;  1XQQ A;  4P1B C;  2UWQ A;  3Q8B A;  3V60 A;  2HTH A;  4BVU C;  2KTR B;  3BYY B;  1N6Z A;  2O6V B;  3WAL A;  2KQ4 X;  3BVZ A;  1ET9 A;  1L0X B;  1ZKH A;  5E6N A;  3RNB C;  1MJD A;  3AXC A;  4BKS A;  4JX1 C;  2PKO A;  2JVC A;  4II2 B;  1BML C;  1KFY B;  4W9L A;  2JYT A;  2RPQ A;  5IP4 D;  2RMM A;  5G5G A;  3B1L X;  3QQ8 B;  1HTO A;  1F52 A;  2J0K A;  3TIX A;  3ML8 A;  1GNU A;  3ZLZ A;  4AWJ A;  3MFG A;  5C23 A;  1E7P B;  4HXD A;  4P6V F;  5AZG A;  2MHJ A;  1WGG A;  2BYE A;  3RMK C;  3FKY A;  2J0M A;  3KYD D;  2WXP A;  4NJ6 A;  3VQI A;  2NTS A;  4G11 A;  4ACF A;  4FAD A;  2DNF A;  2LGS A;  3VRA B;  1YJI A;  4WJP A;  1ZOY B;  4BFR A;  2WXO A;  3ZNH B;  1SF0 A;  4WJN A;  1NEK B;  2I2Y A;  3DPD A;  1TBE A;  1UGJ A;  4RNA A;  5GXG B;  2PW9 A;  2KAC A;  3DBR B;  3KUZ A;  4HRO A;  2L8J A;  1WSP A;  2KJR A;  4ZYN A;  2GRI A;  2MH7 A;  3ZW3 A;  3AEG B;  4DDG D;  5J17 A;  4KGT A;  2WYQ A;  2ZJD A;  2BPS A;  2KNB A;  2BKF A;  2LMC A;  1FNU A;  3ZNG C;  2CU3 A;  3VR8 B;  3RZW C;  4XWT A;  4ZRJ A;  1GG3 A;  2BWE S;  4OVU A;  2N4F A;  3J9C A;  4W9J A;  4M8M A;  1YX5 B;  4XYC A;  4C4V A;  2FE8 A;  2K25 A;  4I6L B;  2D3G A;  4JWS C;  1UBQ A;  3NJT A;  5CHW A;  2QIL A;  5KHO A;  4KIK B;  3R7R A;  2LRU A;  3QX1 A;  2YLM A;  3SU8 X;  2H88 B;  4PK1 A;  1SE3 A;  3WAP A;  2JUO A;  2OED A;  1BXT A;  3V62 A;  1MHH E;  3L13 A;  5BO4 B;  2AEH A;  3AMZ A;  3O65 B;  1PDX A;  3E9S A;  2A5U A;  3NVZ A;  1IGD A;  5E6J A;  1C9F A;  2YVC A;  3AE8 B;  4WH4 A;  3TEX A;  3PTF C;  3RUL A;  1L0V B;  3GB1 A;  2KX0 A;  4EOY A;  4TMA B;  1H8C A;  2KC2 A;  4GIV A;  3RNG C;  2B3A A;  2N9X A;  3I5J C;  1WGK A;  1YQB A;  5H8Y E;  2L52 A;  2WS3 B;  4HLE A;  3S2A A;  3NVV A;  3BVG A;  1TYG B;  4E74 A;  3AEA B;  3AEE B;  3C8Y A;  5EE3 A;  4HEA 1;  3PGE A;  2M56 B;  4X57 B;  4ZRK A;  2MWS B;  4N58 A;  1WGH A;  3R2T A;  4OHJ A;  4MGI E;  4USA A;  2JWU A;  4EZJ A;  2L76 A;  5JH5 C;  5T8I A;  2LVO A;  4WAA A;  3APF A;  1I35 A;  1T0S C;  2JXX A;  2KN5 A;  1JRO A;  2REX A;  3AE2 B;  2WWZ A;  1V2Y A; 
#chains in the Genus database with same CATH homology
 3VTW A;  1WJ6 A;  4F8C B;  1C3T A;  4EZK A;  4GDK A;  4JLC A;  4F7Z A;  2K8B A;  4I6N B;  3WA0 A;  4B6W A;  1WXV A;  1PQS A;  2GBM A;  2CHX A;  3ECI A;  3RD2 A;  1WRD B;  3U7D A;  4DXA B;  5DPW A;  3AI5 A;  2MBQ A;  1LFD A;  1WIA A;  2CHZ A;  3VFK A;  2IO2 B;  3V6E B;  1UH6 A;  2D11 A;  2ZVN A;  5JZE B;  2M8S A;  3A9J A;  2XK5 A;  3NS8 A;  4JL9 A;  4W9D A;  4YL8 A;  1Y8R C;  1XT9 B;  4JIO U;  2Z0E B;  1WJU A;  1AAR A;  1TGZ B;  3A9K B;  3JSV A;  4HJK A;  3H1U A;  3VUY A;  2VRR B;  2N9P C;  1WZ3 A;  2BYF A;  4IWQ A;  4MEL A;  2NS5 A;  4LDT B;  1Q5W B;  1E8Z A;  2KWU B;  3ONS A;  4BOS C;  1WX8 A;  2PE9 A;  1OEY A;  1Z2M A;  3VHT C;  1VD2 A;  4MSQ B;  1RRB A;  3KH0 A;  4WWO A;  4BKT A;  1V81 A;  3DCG A;  3DBL I;  1WE7 A;  4MGY E;  4GGQ A;  4EEW A;  3GZN I;  1E5W A;  1E8Y A;  4MGK E;  2MX2 A;  3UF8 A;  4G3X B;  3PLV A;  4CYE A;  4GSW A;  4RMA A;  2LXC A;  1UEL A;  1WR1 A;  2NPT A;  3PHW B;  3MTN B;  3QAR A;  4JGH B;  1R4N I;  2IO1 B;  2L0F A;  2LRW A;  3M62 B;  2IYD B;  3HM3 A;  4NQL B;  3N3K B;  5E6O A;  4EFO A;  2BF8 B;  2C7M B;  4DBG A;  3NOB A;  1WMH A;  2KDI A;  2DAF A;  1WI0 A;  2MBH A;  4FJV B;  5J2R A;  2FCQ A;  2N7D A;  3A4S C;  2MBE A;  2AL3 A;  4MJS B;  4PYZ A;  2LZ6 A;  3AU4 A;  4HWI B;  3A33 B;  3LDZ E;  3N32 A;  5L95 C;  3V61 A;  3AU5 A;  3CF6 E;  2IBI B;  3WAO A;  2WX1 A;  4ZDV A;  1E8W A;  3IG3 A;  4NQK E;  1WGR A;  2C7N B;  2FCN A;  1P0R A;  1YIW A;  1SGH A;  2A4Z A;  3A1Q A;  5CHF A;  3T9L A;  2KTF A;  4GU2 A;  2BWF A;  4FHJ A;  1D3Z A;  3TCA A;  2N1V A;  1RAX A;  2DX5 B;  2RD0 A;  4GB9 A;  3PVL A;  4G50 A;  3R3M A;  1KOT A;  2KX3 A;  1KLV A;  4HPL B;  3ZNI D;  4DHZ B;  1WE6 A;  3ZUN A;  3DDC B;  4TUU A;  2GOW A;  2W9N A;  2JF5 A;  2HD5 B;  3U30 A;  1WXM A;  5LLI A;  4NY0 A;  3VH4 B;  2KFK B;  4ANX A;  2Z0D B;  2M1M A;  5AZF A;  2FIF A;  1OTR B;  2KWV B;  2R2Q A;  1XD3 B;  4RM8 A;  4BKG A;  3ZDM C;  1P1A A;  4II3 B;  4GDK B;  5JHA A;  1WYW B;  2AWT A;  4XZ4 A;  2AL6 A;  3IFW B;  5DPS A;  3APD A;  1ZGU B;  2L00 B;  4IG7 B;  2L3Z A;  2LUE A;  5AEK B;  1P98 A;  3UIP B;  3EEC A;  5KHQ A;  2CS4 A;  3OJ4 B;  5DPT A;  2LGY A;  2M0X A;  4FN2 A;  4EKU A;  4FLH A;  2C9W B;  3VAW A;  3DBR I;  2ZEQ A;  3PLU A;  4KVG B;  4MGZ E;  2ZPN A;  5C1Z A;  3A9J B;  2XK5 B;  3JYU A;  3HHM A;  3DVN V;  5CX3 A;  3M63 B;  4ASW C;  2FID A;  3VVW B;  5LXH A;  1IYF A;  2FUH B;  2KHW B;  3DQV A;  3JSV B;  3ENE A;  3QC8 B;  3BIN A;  2KTR A;  2JWZ A;  5DPR A;  2KJ6 A;  2O6V A;  3MJW A;  4AJY B;  2K6D B;  2KC1 A;  3Q3F A;  1S3S G;  2L7R A;  2JRH A;  2KLG A;  4AOF A;  4IM2 A;  2N7E A;  4MSM B;  4WWP A;  3RZF A;  3SHQ A;  3ZRF A;  3ZNZ B;  2NR2 A;  1J0G A;  2J0J A;  3SDL C;  2CKH B;  4FUL A;  3RUI B;  5IA7 A;  3QA8 A;  1EF1 A;  1WF9 A;  2MBB B;  2NPT B;  2KVR A;  3PZD A;  2MCN B;  3RT3 B;  2IO0 B;  3QCA A;  1OEY J;  2MLB A;  4AUQ C;  4W9F A;  1J8C A;  3UIN B;  1J19 A;  1R4M I;  3OAW A;  1WMH B;  2GBJ A;  1LXD A;  1YX6 B;  1WM2 A;  1TTN A;  4W9G A;  2LGD A;  2CR5 A;  1H4R A;  1GJZ A;  3MHS D;  4A20 A;  3V6C B;  1QZE A;  3KW5 B;  2CHW A;  3RCZ A;  1F9J A;  2ZZP B;  2LVP A;  4BBN F;  1ZW7 A;  2IO3 B;  4I6P A;  3K9O B;  4LJP B;  3P2B A;  4PS3 A;  4W9E A;  2GBK A;  2NBW B;  2BKR B;  1IPG A;  3A1Q B;  3L17 A;  3QJZ A;  4J6I A;  2JZZ A;  2KFJ A;  3HK0 A;  2OJR A;  4LJO B;  4E71 A;  2KWC A;  4WQO B;  2C5L C;  4IWO A;  2KLC A;  1WGY A;  2RR9 A;  2M4N A;  3SD5 A;  2KO3 A;  1P9D U;  3VUX A;  2D10 A;  1WGD A;  1SE9 A;  1L7Y A;  2RGF A;  3OLM D;  3DBS A;  2PJH A;  2MA9 B;  3TBL D;  3TJP A;  4BBN C;  4BKS D;  4W9H A;  4GXB A;  3UGB B;  2MSE D;  2BGF A;  2DAJ A;  3B08 A;  2IZV B;  2L0T A;  5G55 A;  3R66 C;  2KAN A;  3CST A;  2G3Q B;  5AZH A;  3ZIM A;  4NJ7 A;  3B0A A;  5L83 A;  2EKE C;  5CTR C;  1WM3 A;  4PS8 A;  4ICV A;  2GBR A;  4DHJ B;  2EMS A;  3CSF A;  2GMI C;  4F1S A;  1E90 A;  2ZNV C;  2KMA A;  3VUW A;  1BT0 A;  2D07 B;  4GDL A;  2EMT A;  2LVQ A;  3W1S A;  5EDS A;  4FJY A;  3WIM A;  2DZJ A;  3T8M A;  3NHE B;  5JHB A;  4MH0 E;  4KZ0 A;  1FXT B;  2K6Q A;  2KKC A;  3KYC D;  1V5O A;  1KJT A;  1XQQ A;  2UWQ A;  2D2Q A;  5J18 A;  1V6E A;  2LI5 A;  3V60 A;  4BVU C;  2HTH A;  2KTR B;  3L54 A;  1TZ1 A;  3PHX B;  2O6V B;  1E7V A;  3WAL A;  4M0W B;  1UBI A;  2ZCB A;  1ZKH A;  2AYO B;  2DZI A;  2N1W A;  5E6N A;  3AXC A;  4FHK A;  1EO6 A;  2NBV B;  2JZ3 B;  4BKS A;  4HDQ A;  1C1Y B;  2JVC A;  2KDF B;  2NVU I;  4P7I A;  5D7G A;  4II2 B;  3ZRC A;  4IUM B;  3H7P A;  4W9L A;  4WJO A;  4AP4 C;  4IM0 A;  4IW0 A;  2RPQ A;  4KV2 A;  2V3S A;  3IBE A;  2L05 A;  2O2V A;  3RYT A;  1U4A A;  4A3O A;  2R2O A;  3ZDT A;  3B1L X;  4TQ0 A;  5HKH A;  3QQ8 B;  4EUT A;  1V86 A;  2J0K A;  3W1Y A;  3PPA A;  3D32 A;  2PPH A;  3ML8 A;  1GNU A;  3TIX A;  3ZLZ A;  4HCN B;  4AWJ A;  4FBJ B;  4URK A;  5C23 A;  4HXD A;  4N9F 4;  4KDI C;  3IVF A;  5D2M B;  4RM9 A;  1YJ1 A;  2DEN B;  2K1F A;  5AZG A;  4JQW C;  4FJZ A;  1WGG A;  2BYE A;  3N30 A;  2M17 A;  2ZPY A;  2OOB B;  4KIK A;  2J0M A;  5CHV C;  3KYD D;  4NJ6 A;  3KUC B;  3VQI A;  2FCM A;  1V80 A;  4G11 A;  4FAD A;  1WFY A;  2JPH A;  2QHO A;  2UYZ B;  4PYU A;  4M8N A;  4WJP A;  2K8H A;  2J7Q B;  4NPN A;  2G4S A;  4BFR A;  3M3J A;  3ZNH B;  4DHZ E;  3LJ3 A;  5D6J B;  5TR5 A;  3AUL A;  4WJN A;  1ISN A;  2ZCC A;  3I3T B;  4HDO A;  2G45 B;  3DPD A;  1TBE A;  3X23 A;  2BYV E;  3H9D A;  1EF5 A;  4WWN A;  3H6N A;  4HCP B;  2ZVO A;  3PRP B;  1NBF C;  4K7W A;  4LCD E;  2K8C A;  2V4L A;  1VCB A;  1V5T A;  4ANV A;  4DK5 A;  3PRZ A;  3KUZ A;  3M95 A;  2DYM A;  2HE7 A;  2KJH B;  3QIJ A;  4W9C A;  3ML9 A;  2I1K A;  3X0W A;  2I1J A;  4EZL A;  2L8J A;  1V9J A;  1JRU A;  2KJR A;  3L08 A;  2MW5 A;  5GMV A;  4GN1 A;  4ZYN A;  4GDL B;  4KZC A;  4DWF A;  1WR6 E;  2DZM A;  2KD0 A;  2LXA A;  4AJW A;  1M94 A;  3APC A;  2MQJ A;  3ZW3 A;  3DBH I;  4NNJ B;  2XBB C;  3L16 A;  4DDG D;  3EFU A;  4TQ1 A;  5J17 A;  3R7Q A;  3PRE A;  2IY0 B;  2WYQ A;  5IAA C;  2LD9 A;  2ZJD A;  3DVN U;  3PSE B;  2BPS A;  2G4D B;  2NBU A;  2ZNV B;  3BY4 B;  4G0N B;  2KNB A;  1I42 A;  2BKF A;  1WX9 A;  2DYB A;  3GOE A;  3CMM B;  2RSU A;  2KDB A;  3HM6 X;  3ZNG C;  2LJ5 A;  1Q1O A;  3ZKJ C;  2FAZ A;  3EC8 A;  3RZW C;  2N9E B;  3A4R A;  4ANU A;  3QK0 A;  2KK8 A;  3UIO B;  2LAS A;  1G6J A;  4KSK C;  4ZRJ A;  2ASQ A;  4TKN A;  3W1S C;  3ALB A;  4NAW A;  1GG3 A;  2CU1 A;  4K1R B;  2BWE S;  4OVU A;  2N4F A;  2DHZ A;  3H7P B;  5D94 A;  2MRP A;  4W9J A;  4M8M A;  1YX5 B;  2K39 A;  5DCN A;  3ZTD A;  4MDK E;  1T0Y A;  2O2V B;  3ZVV A;  1SIF A;  4PS7 A;  2KQ7 A;  4LDT D;  1WJN A;  3HIZ A;  2K25 A;  2KOX A;  2C60 A;  4I6L B;  3KVF B;  4IC7 B;  1E7U A;  1WZ0 A;  4B95 A;  3L10 B;  2D3G A;  3JW0 X;  2V1Y A;  4KDL B;  1UBQ A;  3NY5 A;  2MP2 A;  1V49 A;  5CHW A;  4MEM A;  4HK2 A;  1E8X A;  5KHO A;  4KIK B;  3R7R A;  1HE8 A;  3QHT A;  2LRU A;  3QX1 A;  2YLM A;  3SU8 X;  3UQA A;  2Y5B B;  2IY1 B;  3VTV A;  1A5R A;  2HJ8 A;  4ANW A;  2KMC A;  3NZU A;  3VTU A;  3WAP A;  1S1Q B;  2JUO A;  1CMX B;  3DOW A;  4GMV A;  1GUA B;  4WJQ A;  4DHJ D;  2KXJ A;  1LM8 B;  1OGW A;  3V62 A;  5LXI B;  1EUV B;  1Z5S B;  1UZX B;  5G2N A;  4XX5 A;  3L13 A;  1WXA A;  5BO4 B;  2AEH A;  1GC7 A;  4ICU A;  2WX0 A;  1NI2 A;  3C0R B;  4OVV A;  3TL5 A;  4HVB A;  3OJ3 A;  3H7S A;  3O65 B;  4A3P A;  2A5U A;  1P3Q U;  4HPM B;  3A9K A;  4CHK A;  2C7H A;  5E6P A;  1WJ4 A;  2YVC A;  2O6V D;  4K7S A;  3JVZ X;  4E3C A;  3PTF C;  3UQB A;  1WH3 A;  4FA6 A;  3RUL A;  2KDE B;  3VDZ A;  2JT4 B;  3WAM A;  1IP9 A;  1MG8 A;  3DVG X;  4W9I A;  3EHV A;  2GBN A;  2MBO A;  2KZR A;  3PRM B;  3WAN A;  2DYO A;  3DVG Y;  1YD8 U;  4GOC A;  1LQB A;  2KX0 A;  4EOY A;  1RFA A;  1H8C A;  2PE6 B;  1K8R B;  3Q3J A;  2KC2 A;  4GIV A;  2LWP A;  3VXW A;  4BOZ B;  1X1M A;  2B3A A;  2N9X A;  1RLF A;  4MM3 A;  4XC2 A;  4K81 A;  2PEA A;  1YQB A;  2JRI B;  1WXS A;  2DZK A;  3VH3 B;  1OQY A;  3QAQ A;  4DDI D;  4HLE A;  3S2A A;  3QWZ B;  3ZTC A;  4E74 A;  1Q0W B;  3PV1 A;  4IWP A;  4MJS A;  3PGE A;  1UGM A;  4TV3 A;  3L0W B;  4X57 B;  4ZRK A;  2MWS B;  4NAW B;  3TMP B;  1WGH A;  2FCS A;  3K9P B;  2Z59 B;  4MGI E;  3U8Z A;  3IHP C;  1WX7 A;  2NCN A;  1L2N A;  2FNJ B;  5FR6 A;  1NDD A;  2WDT B;  3PT2 B;  1WY8 A;  4ZRI A;  4KSL C;  2L76 A;  4CO7 A;  4EZJ A;  5JH5 C;  1GC6 A;  2LVO A;  4WAA A;  4K7U A;  3APF A;  3ZO5 B;  1I35 A;  2MP2 B;  4IM3 A;  2JXX A;  2JY6 A;  2KN5 A;  3NZS A;  3KUD B;  2XEW A;  3PS6 A;  2LGX A;  4W9K A;  2REX A;  1KM7 A;  2KFK A;  2WWZ A;  1V2Y A;  4B9K A;  1UD7 A;  2KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...