2LWPA

The nmr solution structure of the the ubiquitin homology domain of mouse bag-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG family molecular chaperone regulator 1
publication title The NMR solution structure of the ubiquitin homology domain of Bcl-2-associated athanogene 1 (BAG-1-UBH) from Mus musculus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lwpA00
3KUDB 1WXMA 2LGYA 3VUWA 2YLMA 4NNJB 4E3CA 2NCNA 3KW5B 3L17A 4BKSA 2G4DB 2NR2A 3HK0A 3R66C 3IFWB 3VTVA 4NPNA 1A5RA 1UD7A 5CHVC 2C7NB 1Z2MA 1IP9A 3IHPC 4K7UA 3PV1A 2NBWB 1WJUA 2KLGA 4F8CB 3AULA 2PPHA 2KN5A 3QHTA 1FXTB 1WXVA 3L08A 1XQQA 1X1MA 3KYDD 3RZWC 2PEAA 1S3SG 4EZKA 3JSVA 1SE9A 1WMHB 3MJWA 3TJPA 2KJRA 4KVGB 2BYVE 2MX2A 2MRPA 4I6NB 2RPQA 3ZKJC 4GOCA 2K8CA 3QARA 4DDID 4ZRIA 4XX5A 3QAQA 4PS8A 1GC7A 1WZ3A 2LZ6A 2QHOA 3R3MA 2N9EB 3RULA 2LUEA 4HPLB 2L3ZA 3QJZA 2K39A 3H7SA 3OAWA 2K1FA 4ZDVA 3A9JB 4DDGD 1GC6A 4DXAB 3RUIB 3UINB 4G3XB 4FJVB 3VTWA 3X23A 2KTRB 4A3PA 4ANUA 2OOBB 3V6CB 3H9DA 1ISNA 2NPTA 3JVZX 3PLVA 4WWPA 1JRUA 1OGWA 2JPHA 4IM2A 4HVBA 1WJNA 3QX1A 2J0JA 2L0TA 3APDA 3UGBB 3PTFC 5LXHA 4FJYA 5G2NA 4NAWA 1VCBA 1WE7A 2ZVOA 3X0WA 3HIZA 5E6PA 3DDCB 1V5TA 2MBQA 2JF5A 5LXIB 5J18A 1D3ZA 2CU1A 1UH6A 3UQBA 4B95A 2JVCA 2ZZPB 2O6VA 5AZFA 2L8JA 1RAXA 2WWZA 4K7SA 4M0WB 3VXWA 1ZKHA 2LVOA 3KH0A 5DPTA 4IM0A 4LDTB 1UBIA 2A5UA 4MGZE 2CR5A 5CHFA 1EO6A 2G4SA 2BGFA 2KD0A 3Q3JA 2YVCA 3RT3B 3ECIA 4HDOA 4GN1A 3QQ8B 4DHJD 4BKSD 3WAPA 5JH5C 2KDFB 2KVRA 4ICVA 3U8ZA 3RCZA 4XZ4A 4GDKB 1P1AA 3PPAA 2ZJDA 4BKGA 1Q5WB 3H1UA 3M63B 4G11A 4II3B 5J17A 1WYWB 2BKRB 4MH0E 4ANXA 2LVQA 4ZYNA 3QA8A 1EUVB 1UGMA 2IY1B 4HCPB 2C9WB 2LJ5A 4M8NA 5C23A 4II2B 1IPGA 3GZNI 3QWZB 3SDLC 5TR5A 1WM2A 3M62B 4W9JA 2Z0DB 3KYCD 4W9LA 2LRUA 3VQIA 3RZFA 2KJ6A 2JZ3B 4IC7B 2KZRA 3A4SC 2ZCBA 3PGEA 1NBFC 5KHOA 1TBEA 1OTRB 1WGDA 3PVLA 2Y5BB 4B6WA 3B08A 4HPMB 2L0FA 4HK2A 4MJSB 2D07B 2MBBB 2G3QB 4ICUA 2KOXA 2DAJA 1AARA 3P2BA 2AEHA 2JT4B 3NY5A 1GJZA 2LXCA 3ALBA 4W9EA 2XK5B 2RD0A 2FUHB 4IUMB 1MG8A 3UQAA 1CMXB 3QK0A 1WGGA 2KFKB 4GDLA 2DX5B 3H6NA 2XBBC 1WX8A 1WR6E 4W9HA 5AEKB 4FULA 4JGHB 5AZGA 1UBQA 5BO4B 3U7DA 2IO1B 2CHZA 3TL5A 4J6IA 3ZO5B 1E8ZA 2NBUA 4K7WA 1WXAA 3WANA 5AZHA 4FA6A 2IO0B 3AU4A 4IWPA 4BFRA 1J19A 2O6VD 4IM3A 2DYMA 3QCAA 4MDKE 3LDZE 4WJNA 3VHTC 1WJ4A 2BF8B 2KDEB 2K6QA 2MP2A 1XD3B 3V60A 4MELA 1KOTA 4X57B 4DWFA 4W9GA 3T8MA 2K8BA 4OVUA 2N7EA 2XEWA 2FCMA 3QIJA 1XT9B 2PJHA 4MJSA 3PT2B 3RYTA 3VUXA 3V6EB 2MA9B 2GMIC 1YQBA 1L7YA 2J7QB 1E7UA 3B0AA 4TKNA 2M17A 3IBEA 3V61A 2O2VA 3DBHI 4JL9A 1P98A 1L2NA 1WFYA 3VH3B 3SD5A 4EUTA 3W1SA 1KLVA 1WGHA 4BOSC 2DYBA 4MEMA 3S2AA 3N3KB 2HTHA 3ZUNA 4KZCA 2V1YA 2KWVB 4TUUA 4ZRKA 1I35A 3OLMD 3IVFA 2KANA 3H7PB 3ML8A 2JRHA 5C1ZA 4AOFA 3D32A 2I1KA 4EKUA 2HJ8A 1LM8B 1OEYJ 1P3QU 2RSUA 5HKHA 4KDLB 2EMSA 4IWOA 4WJQA 3KVFB 3DPDA 2UWQA 3A4RA 1YJ1A 2IZVB 3CSFA 3Q3FA 3N30A 4NQKE 3WA0A 2BYFA 2J0KA 4W9DA 1YIWA 4AWJA 4F7ZA 1WMHA 3DVNV 2M8SA 5DCNA 3TIXA 3VVWB 2FAZA 3GOEA 3L0WB 4RM8A 4AJYB 3PHWB 5D2MB 4EZJA 2N9PC 1GG3A 2L76A 2AYOB 2KXJA 3ZDMC 2EKEC 3MTNB 2D11A 2D3GA 2DZIA 3A9JA 3AU5A 4KDIC 3ML9A 4M8MA 1WI0A 2C7HA 2L05A 2GBRA 2ZNVB 5JHAA 5DPWA 2AL3A 4E71A 5D94A 3ENEA 2KTRA 3R7RA 2L00B 2R2OA 2DHZA 2Z59B 3QC8B 1E90A 3PZDA 4EOYA 4BOZB 4W9CA 4ANVA 1V6EA 3VUYA 2VRRB 4NY0A 2KX3A 3IG3A 2IO3B 4HWIB 1KM7A 2GBJA 1WH3A 2N4FA 2B3AA 2DZJA 1WR1A 4GXBA 4W9FA 2N9XA 1V81A 3MHSD 1IYFA 3OJ3A 1E8WA 4I6LB 4IG7B 2IO2B 3N32A 2DYOA 2KQSA 2DAFA 3ZTDA 3ONSA 3JW0X 4TQ1A 2KO3A 2C5LC 3SHQA 2LWPA 4WWNA 1R4MI 3DOWA 1V49A 1LXDA 2LASA 1RLFA 2PE9A 1Y8RC 3R7QA 3SU8X 5IA7A 1J8CA 3A9KB 4KIKB 2LGXA 2KMAA 4P7IA 2LI5A 3A1QB 3CMMB 1H8CA 5GMVA 5FR6A 4B9KA 4GDKA 3ZVVA 1K8RB 1RFAA 2KMCA 3HM3A 4DHJB 3ZRFA 4BKTA 2LGDA 1WM3A 4RMAA 1GUAB 1LFDA 2NBVB 1H4RA 4MSMB 3TBLD 2LXAA 1TGZB 2BWFA 1V80A 4MSQB 3OJ4B 4KV2A 3ZNHB 4WWOA 5D7GA 4JIOU 5D6JB 3W1SC 2RR9A 3APFA 2ZPNA 3WIMA 3DBLI 5JZEB 4FHJA 3JSVB 4WQOB 2C7MB 4NQLB 4ZRJA 5JHBA 4LCDE 5J2RA 1EF1A 1V5OA 2ZVNA 2KC2A 4PS3A 3ZW3A 4LJPB 2ZEQA 2DZKA 2K6DB 1WZ0A 2M1MA 1WIAA 3V62A 3APCA 3ZLZA 2KQ7A 2GBKA 1V2YA 2FCNA 2FIFA 3B1LX 3DCGA 3NZUA 3DBSA 3PRPB 3NOBA 4TV3A 3T9LA 1NDDA 4BBNF 2BYEA 5EDSA 3M95A 2XK5A 2KK8A 2JXXA 2KX0A 5G55A 2HD5B 2KFKA 4MM3A 2AWTA 2KWCA 2L7RA 2IY0B 2FNJB 2MBOA 4MGKE 2NPTB 4K1RB 3ZDTA 2MQJA 2JWZA 5DPSA 2REXA 3NS8A 1I42A 2KLCA 1M94A 5CHWA 4WJOA 3WAMA 1WRDB 3BINA 1UZXB 2BKFA 4EZLA 4NAWB 2JY6A 4K81A 3M3JA 1UELA 2BPSA 2PE6B 2MBHA 2MWSB 1QZEA 2ZCCA 1EF5A 3K9PB 4AP4C 3EHVA 2C60A 3CF6E 1LQBA 2I1JA 2V3SA 2O6VB 3AXCA 1RRBA 2N1WA 4LDTD 3TCAA 2M4NA 2V4LA 4G50A 4FJZA 1Q0WB 4WAAA 1SGHA 3L54A 4GIVA 2KFJA 1TTNA 2M0XA 4MGIE 4DHZB 2CS4A 2GBMA 3ZNZB 3K9OB 3DVGY 2CHXA 4YL8A 2D2QA 1WGRA 4KSLC 1NI2A 1Z5SB 5CTRC 4A20A 4ANWA 3L13A 4NJ6A 3NHEB 2KKCA 2LVPA 4NJ7A 2UYZB 4BBNC 2KTFA 4GMVA 1T0YA 3A33B 4ASWC 1VD2A 3KUZA 2WX0A 4JLCA 4IWQA 3HM6X 2KHWB 2WDTB 3CSTA 4LJOB 4RM9A 3EECA 1R4NI 3EFUA 3I3TB 1HE8A 5DPRA 1WF9A 3UF8A 1F9JA 3UIOB 3WALA 2AL6A 5L95C 3ZRCA 3PREA 3PRMB 1WX7A 3H7PA 2RGFA 3LJ3A 4HLEA 3HHMA 3PRZA 3VAWA 4TQ0A 2ZNVC 4GU2A 4MGYE 1KJTA 3PHXB 2FCQA 2KC1A 2WX1A 2ZPYA 1PQSA 4FN2A 5L83A 2DZMA 2BWES 4GSWA 4FLHA 1YX6B 4HCNB 2D10A 3UIPB 1WE6A 1P0RA 2MBEA 1S1QB 4AJWA 2A4ZA 4DK5A 4WJPA 3PS6A 4FHKA 2CHWA 5E6OA 4KZ0A 2JRIB 1OQYA 4W9KA 3ZTCA 2K25A 4PS7A 4A3OA 1BT0A 4N9F4 4GDLB 2NVUI 3VDZA 2JUOA 2Z0EB 3U30A 2K8HA 3BY4B 3W1YA 1E8YA 1P9DU 1WJ6A 5CX3A 2R2QA 4FADA 1C3TA 2MCNB 3JYUA 4GGQA 3L16A 2G45B 2GBNA 2IYDB 2ASQA 4PYUA 2J0MA 4G0NB 3ZNGC 1WY8A 2KDIA 4HJKA 1U4AA 2NS5A 4XC2A 5IAAC 2DENB 4PYZA 1WX9A 2CKHB 3PLUA 1G6JA 4DBGA 4E74A 4FBJB 2HE7A 1V86A 3NZSA 4URKA 2JZZA 2KWUB 1E8XA 2MSED 2KJHB 4CYEA 1E7VA 2MP2B 4EFOA 3DBRI 2FCSA 2W9NA 1GNUA 1SIFA 3C0RB 2MLBA 4AUQC 4EEWA 3ZNID 1OEYA 2N1VA 2IBIB 1Q1OA 4IW0A 2FIDA 1ZW7A 3DVGX 4GB9A 3PSEB 1YX5B 1WGYA 4CHKA 3DQVA 4CO7A 2GOWA 5LLIA 4BVUC 1YD8U 3O65B 3KUCB 4W9IA 3RD2A 3VH4B 4OVVA 2EMTA 1V9JA 2O2VB 3L10B 4KSKC 3TMPB 4HDQA 4JQWC 1C1YB 1TZ1A 3DVNU 2N7DA 2KNBA 2MW5A 2KDBA 4HXDA 3VTUA 1J0GA 1E5WA 2WYQA 3AI5A 4DHZE 5E6NA 3WAOA 4I6PA 2OJRA 3A9KA 2LD9A 3ZIMA 4KIKA 2LRWA 1ZGUB 3A1QA 5KHQA 4F1SA 3VFKA 3EC8A 1WXSA
chains in the Genus database with same CATH superfamily
3VUWA 4E3CA 1L4DB 4BKSA 3HK0A 4HPPA 3R66C 3EFCA 4NPNA 3H8HA 1UD7A 1I7HA 1Z2MA 3IHPC 5JXVA 2KLGA 3DBRB 2BTEA 2DWQA 4CQNA 1X1MA 1FRDA 1SE9A 5TSSA 4I6NB 3O13A 1FCCC 2Y3AA 1QKZA 2K8CA 3QAQA 2Y5CA 2QHOA 2CJNA 3MJ5A 4DDGD 1SF0A 4FJVB 3AEEB 2KTRB 4YSXB 3H9DA 3JVZX 2FBWB 3PTFC 3I9V1 5LXHA 4IDIA 2ZVOA 2I2YA 4BAXA 1AW7A 3W5VB 5J18A 3OWEB 2ON8A 1AYFA 4B95A 2JVCA 1RAXA 2LVOA 1ZUD2 5DPTA 2A5UA 1EO6A 3ECIA 1N63A 5JH5C 2KVRA 3Q8BA 4ICVA 3U8ZA 3RCZA 4XZ4A 4ITKA 2ZJDA 3Q3MC 5J17A 1WYWB 3V05A 2R61A 4P6VF 2BKRB 4MH0E 3GP7A 1EUVB 2IY1B 2M0AA 2WU2B 1K50A 4M8NA 2LFIA 3C19A 2BQQA 3GZNI 3N1ZC 3SDLC 4W9LA 3T3OA 2KJ6A 3KWLA 5KHOA 4B6WA 1WGDA 2L0FA 4HK2A 4MJSB 2MBBB 4ICUA 3P2BA 1EU4A 2XK5B 1TJEA 1CMXB 3QK0A 1WGGA 1TS2A 2KFKB 2KN4A 4MM3B 2BYTA 2GLSA 4YSYB 1UBQA 5AZGA 5IN7A 4S0RA 1T0RC 3GB1A 2PMVA 1JWAD 3NVYA 1QF6A 3AU4A 2O6VD 4WJNA 2JXTA 2BF8B 3T3NA 2KVZA 4C4VA 4X57B 4W9GA 3T8MA 1XT9B 3AE9B 2PJHA 4DXFA 2KYWA 3RYTA 3VUXA 3V6EB 1XO3A 1N60A 1NYQA 2MA9B 2GMIC 1L7YA 4OVZA 3B0AA 4ACFA 2QSDA 3HVDA 4NAMA 2LHDA 1WFYA 3SD5A 2IGDA 2YEPB 3U2SC 3RI7C 3N1XC 4YWGG 2VH2A 3OLMD 3IVFA 2KANA 1KF6B 2WDRB 3H7PB 1JALA 3PO0A 3IAS1 1ZE3D 2I1KA 2RSUA 1OEYJ 5HKHA 2EMSA 3SFDB 3KVFB 3UI3A 3A4RA 1GAQB 1L6VA 3WA0A 4A6QA 1TZOA 3AM9A 2KQ4X 2GRIA 1KH0A 3PHWB 3NVZA 2AYOB 4OZCA 3LYYA 3MTNB 1JWMD 2BBCA 2DZIA 2V4IB 2WXQA 3AU5A 1WI0A 3AEFB 1MJDA 2KTRA 3R7RA 1YN3A 1PGBA 1E90A 3QC8B 4EOYA 1C77A 2INNE 2IDYA 1OQQA 4RH6A 2KX3A 3IG3A 1YN4A 2MHJA 1IYFA 4P1CC 4XE0A 1CK1A 3KWVA 3N32A 3ZTDA 5FR3A 3U7ZA 1LXDA 3SU8X 1RLFA 1J8CA 2D5GA 1N61A 3A9KB 4K3CA 1KFYB 3W5UB 1I4QA 3CMMB 3ZVVA 1K8RB 1RFAA 4DHJB 1TKEA 1UNSA 4BKTA 5AUKA 1WM3A 1TT5B 1ZPSA 2G1EA 2LXAA 4ARIA 4MSQB 1L0XB 1F52A 2JSVX 2MJEA 4KKJA 5E6JA 1C9FA 5JZEB 4FHJA 1ET9A 1SE2A 2C7MB 5JHBA 1V5OA 3HVZA 4DQOC 4ZHOA 2KC2A 3ZW3A 4P16A 2M1MA 1WIAA 1TKGA 3APCA 2GBKA 2FCNA 2FIFA 1VDVA 2X8XX 3DBSA 4WAFA 4TV3A 4BBNF 5GXGB 2XK5A 3Q6BA 2KX0A 2JXXA 2HD5B 1I4XA 2KFKA 4MM3A 2D3CA 2FNJB 2MBOA 4MGKE 4K1RB 1T3QA 2G9HD 3ZDTA 2LHEA 2H89B 1LO5D 3N9YC 2K0PA 3NS8A 2KLCA 3NUHB 3WAMA 1WRDB 4EZLA 4K81A 3M3JA 2BPSA 2PE6B 1DGJA 2MWSB 2ZCCA 1ZDVA 3R2TA 3CF6E 5EE3A 1SE4A 1JWBD 2J42A 3TCAA 2NTSA 2V4LA 4G50A 1JWSD 1Q0WB 4A90A 1SGHA 3DHIC 4C7ZA 4GIVA 4DHZB 1TTNA 1VJKA 2INPE 3DVGY 4ANWA 3L13A 3MHZA 2KKCA 3ZXVA 1XLNA 3DBHB 1VD2A 3Q8EA 3HM6X 2KHWB 2WDTB 3CSTA 2V9HA 1R4NI 3EECA 3UF8A 4C56C 5L95C 4IOIE 3ZRCA 2WP9B 3PREA 2INDC 1BMLC 3H7PA 1RWSA 3LXFA 4YT0B 4GU2A 4MGYE 1KJTA 3PHXB 1WRIA 2QIEB 4FN2A 1GB4A 5L83A 4GSWA 4TMAB 4FLHA 1YX6B 2HJ1A 1SBBB 1WE6A 1P0RA 2MBEA 1WSPA 3U52E 1GPXA 2WXNA 3ZTCA 4PS7A 4A3OA 2WDQB 2QEJC 1PDXA 3VDZA 2Z0EB 1E8YA 5CX3A 3ETRA 3JYUA 1R7SA 5MPOA 3BYYB 1EM7A 2GBNA 2IYDB 4L1BA 5H8YE 1U4AA 4YTMB 2CKHB 1G6JA 4E74A 1D5MC 1MI0A 3B2GA 1FCLA 4URKA 2DLBA 2FCSA 2W9NA 3RNGC 2N1VA 1ZW7A 1YX5B 3DQVA 2WXGA 4EE2A 3VH4B 3BWUD 3TMPB 2O2VB 2WS3B 3OG5A 3DVNU 3VTUA 2KDBA 3Q8CA 1FXIA 1HZ6A 1LGRA 4OW0A 1ET6A 5E6NA 3A9KA 1N62A 3KQ4A 3AECB 5IKCM 3VFKA 3TEYA 4RNAA 4AQ7A 2LGYA 3L17A 3I57A 3VTVA 1ZXHA 4JWUC 5CHVC 3CWIA 1WJUA 2PPHA 2KN5A 3L08A 2PEAA 1S3SG 1I4GA 4OZBA 4EZKA 3TJPA 2KJRA 3DBLB 2MX2A 4J3OD 2RPQA 3AE1B 4S17A 3QARA 4DDID 4ZRIA 1E9MA 1GC7A 3R3MA 2N9EB 4HPLB 2L3ZA 1YN5A 2K1FA 4ZDVA 3A9JB 1C4PA 2E6XA 3RUIB 4G3XB 2L52A 4A3PA 2L1AA 2UU7A 4ZRQA 1YNTE 1JRUA 4IM2A 2J0JA 4YSZB 5G2NA 5IO9A 3DDCB 2MBQA 2JF5A 5AUIA 1D3ZA 2CU1A 3UQBA 4M02A 2ZZPB 4LLGM 5AZFA 1MG4A 2J53A 4K7SA 4M0WB 1ZKHA 3KH0A 4LDTB 5HG2A 2CR5A 3SR6A 3Q8AA 3R8BA 3RT3B 2D3BA 4BKSD 3HRDD 1J7BA 1TKYA 3PPAA 1Q5WB 3DWGC 2SEBD 4G11A 3VRBB 1C78A 1OFFA 4L2YA 1E7PB 1VZ6A 2RDHA 4ANXA 3QA8A 3SFEB 1OQRA 3P1MA 1IPGA 3QWZB 4O1NA 1WM2A 1TY0A 4W9JA 2LRUA 1FNUA 3VQIA 1RM6C 3RZFA 2JZ3B 4MT5A 5G5HA 2KZRA 2ZCBA 3PGEA 1NBFC 1OTRB 4HPMB 2KOXA 1AARA 3FKYA 3NY5A 2JT4B 3B2FA 3ALBA 4QAYA 2W55A 2FUHB 3UQAA 2DX5B 2QJLA 1WX8A 1WR6E 4W9HA 2WXIA 1I4RA 5BMGA 5BO4B 3I5JC 2IGGA 1UGJA 4K7WA 3P42A 5AZHA 4M01A 2IO0B 3TSSA 4BFRA 2ONQA 3LDZE 2OHFA 1WJ4A 2KDEB 2K6QA 1XD3B 1KOTA 3BVMA 3AE2B 2FCMA 3QIJA 3RNCC 3AB5A 3EGRA 3PT2B 2MJDA 3W9CB 2J7QB 3Q2AC 4TKNA 2M17A 2O2VA 3B9JA 2FE8A 2EKIA 2Z8LA 2E3TA 3VH3B 4US8A 4HJGE 1JMLA 3W1SA 1KLVA 5LNK1 4MEMA 2HTHA 4KZCA 2WXHA 2V1YA 2RPVA 1I35A 1E6EB 2JRHA 5D3IB 3RFZB 1FO4A 3AH7A 2BW2A 2AQ3B 1P3QU 4KDLB 4WJQA 3ZJUA 4WH4A 3Q3FA 1D6EC 1GOZA 4AWJA 1YIWA 3DVNV 4LNFA 5DCNA 3FILB 4WWMA 2FAZA 5EE0A 4KGRA 2SAKA 1HA5A 5FK9C 4KGTA 1A70A 2D11A 2D3GA 2KWDA 3A9JA 4KDIC 3PZ8A 1F1HA 2WXFA 3ML9A 2WLBA 3Q3NC 3BK2A 2N0SB 4XDCA 2L00B 2V0GA 2Z59B 1FEHA 4BOZB 4W9CA 3ZGZA 4ANVA 1V6EA 3VUYA 1N5WA 2IO3B 1KM7A 2JQRB 1IBXA 4XDDA 1WH3A 2N4FA 1WR1A 4GXBA 4WQMA 2EELA 1E8WA 3Q3OC 4I6LB 2IO2B 1I4HA 2DYOA 4M0WA 3ZQ4A 3ONSA 1QOFA 4TQ1A 3SHQA 4WWNA 1R4MI 1V49A 2RDGA 2LASA 3R7QA 1YOVB 2KMAA 1IGDA 2HTME 4HROA 1XLOA 4B9KA 4C7YA 1M4VA 4RMAA 4RGOS 1LFDA 2NBVB 3BVGA 5HHDG 1VZ7A 1TGZB 2KMMA 1YJIA 4RF0A 4USAA 5EE9A 3JSVB 4WQOB 4NQLB 5J2RA 3GZNB 2ZVNA 4PS3A 2ZEQA 2K6DB 1WZ0A 3MC9A 2QDFA 2KQ7A 3B1LX 1R4MB 3NOBA 3T9LA 1NDDA 4PK1A 2PTLA 2KK8A 2AWTA 1TS4A 2JWZA 2DNFA 5CHWA 4WJOA 5EE1A 4YXDB 2MBHA 1QZEA 4B0MA 1F2RC 3K9PB 4NZLB 4AP4C 3MFGA 2V3SA 3NS1A 1RRBA 2N1WA 1KTKA 4FJZA 4WAAA 1C76A 1D5ZC 4OHJA 3L54A 4MGIE 2M0XA 1EWCA 1WGRA 4KSLC 1Z5SB 2IPKD 5CTRC 4NJ6A 4BBNC 2KTFA 4M00A 1T0YA 3A33B 4KGSA 2WXMA 1HQRD 1C79A 3I3TB 5DPRA 1F9JA 2RDBC 3MC8A 1MHHE 2L32A 2W3SA 3PRZA 4TQ0A 2WX1A 1FNVA 2ICIA 1NYRA 1FD6A 1MVKA 1EU3A 4KKIA 5BYRA 3LB8C 2ACZB 1PGXA 2KACA 1D4BA 1QT9A 4WJPA 3PS6A 4KZ0A 3FILA 4W9KA 1IGCA 1STEA 4GDLB 2JUOA 2K8HA 2AQ2B 3W1YA 1P9DU 2R2QA 2MCNB 4GGQA 3P4RB 2BT6A 1V1PB 3ZNGC 2HDEA 4IKGA 3RMKC 1XF5L 4XWTA 2DENB 1WX9A 2H88B 2JU6X 4FBJB 3I63C 3N20C 2MSED 4CYEA 1CQVA 2MLBA 1KRHA 4GB9A 5BYSA 4CHKA 4JE3B 1VZ8A 4N59A 1YD8U 1E0ZA 4W9IA 3L10B 2WXOA 3E56A 4HKZE 3BVZA 2N7DA 2KNBA 1J0GA 2WYQA 1FM0D 3AI5A 3ZIMA 2LD9A 1ZGUB 5KHQA 4F1SA 3ABVB 2RMMA 4LK0M 2QC8A 2YLMA 4NNJB 3KW5B 2G4DB 2NR2A 2BB5A 4JX1C 3URYA 1A5RA 4K7UA 3PV1A 2NBWB 3AULA 4A9AA 3QHTA 1WXVA 4B0EA 3KYDD 3RZWC 5C2TB 2N9KA 3JSVA 1UF0A 4KVGB 2BYVE 2MRPA 2PKOA 1D5XC 2WDVB 3AN1A 4GOCA 4XX5A 4PS8A 3RULA 2KDMA 2LZ6A 2LUEA 2K39A 3OAWA 3AE7B 4US9A 1FNWA 4ZRPA 2JYEA 2OOBB 1ISNA 2JPHA 2X38A 4HVBA 1WJNA 2BS4B 2BVCA 2L0TA 3UGBB 4FJYA 2KAJA 1WE7A 3X0WA 1HEZE 3HIZA 5E6PA 1V5TA 1QOBA 1UH6A 4PT5A 4JWSC 3AE5B 2LEKA 3FAHA 4IM0A 5I4DA 5CHFA 1WWTA 2J52A 3IT4B 3Q3JA 2K5PA 4HDOA 4DHJD 3QQ8B 3WAPA 1MHXA 4GDKB 1P1AA 1B9RA 1UUPA 3H1UA 3M63B 3KLSX 4LNNA 2LVQA 4ZYNA 1UGMA 4HCPB 1R4NB 2WNMA 2C9WB 3GE8C 2AQ1B 4II2B 2LJIA 3M62B 2Z0DB 3KYCD 5HFYA 1YQ3B 2JZPA 2MJ3A 4IC7B 1TBEA 2Y5BB 2VZKB 4ZYSA 3B08A 1J7AA 4HEA1 1RYJA 2DAJA 2NMQA 1L4ZB 2AEHA 2W54A 4IUMB 4GDLA 4TSSA 3L4PA 2XBBC 4YTPB 5AEKB 4D2KA 3U7DA 2IO1B 1FRRA 3TL5A 4RGNA 1CJEA 4J6IA 1V1PA 4C80A 3N1YC 3WANA 1ENFA 4FA6A 4IWPA 1J19A 3QCAA 4MDKE 2AX5A 3V60A 4MELA 1UWMA 4DWFA 3RNBC 2K8BA 4OVUA 4RGTA 1YQBA 1E7UA 3IBEA 3V61A 1N6ZA 2PIAA 1C4CA 1L0YB 4EUTA 1VRAB 1ESFA 4BOSC 1CZPA 2DYBA 3S2AA 3N3KB 2N7JA 3ZUNA 4TUUA 4RF1A 1QOGA 2VH1A 3Q14C 2N9LA 2PVOD 2HJ8A 3BK1A 4UDUC 4IWOA 1IBXB 3DPDA 4JPSA 2IZVB 3AEDB 4NQKE 4F7ZA 3VVWB 3DHGC 3Q69A 3L0WB 3BYTB 5D2MB 4EZJA 2L76A 5FKAC 2KXJA 2CU3A 2D3AA 5JHAA 1DOYA 2C7HA 2GBRA 2L05A 2ZNVB 1FIQA 2AL3A 3ENEA 5BMHA 2QCZA 3CIRB 1SSNA 2DHZA 3AE4B 2W82A 4NY0A 1PUTA 4A55A 1SXTA 4N6EB 2DZJA 1L0VB 1V81A 3MHSD 3OJ3A 2GI9A 2NTTA 1V1OA 2DAFA 3JW0X 1WYGA 2KO3A 5H92C 1HTQA 2C5LC 2LWPA 1TYGB 2PE9A 4MH8A 4GLSC 4KIKB 2LGXA 4P7IA 3A1QB 3RPFC 3BZDB 3AE6B 1RFKA 5GMVA 5FR6A 4GDKA 3IT6B 2WGSA 3ZRFA 2DBYA 1XEEA 2LGDA 1ZXIA 1SJHD 1H4RA 2BWFA 3RNEC 1V80A 3OJ4B 4KV2A 3ZNHB 5D6JB 3W1SC 2RR9A 3APFA 1L6UA 2MH7A 1HXYD 1AN8A 3HUIA 4ZRJA 4ARCA 2IGHA 1C4AA 3P4PB 1NENB 2IJ0A 1K52A 3DCGA 2PW9A 2BYEA 4XYCA 3M95A 2TSSA 5G55A 2KWCA 2L7RA 2IY0B 3ZXRA 2NPTB 2JX5A 2MQJA 1SJED 3BINA 1UZXB 4NAWB 5IP4D 1UELA 3NZ3A 1V97A 1QLBB 4XGAB 1LQBA 2I1JA 1FFVA 2O6VB 1B1ZA 4LDTD 2K3UA 2M4NA 3NVWA 1SB3C 2OJWA 2KFJA 2CS4A 3ZNZB 3AEGB 2CHXA 4YL8A 2D2QA 1NI2A 4A20A 1BUIC 1FPYA 3VR9B 3NHEB 2UYZB 1ZOYB 4GMVA 3NG0A 4JLCA 2WX0A 4IWQA 3AMZA 3EFUA 3WALA 1WF9A 3PRMB 3GE3C 1WX7A 2RGFA 3LJ3A 3W2DA 3HHMA 3VAWA 4HLEA 2ZNVC 2FCQA 3IXSA 2BWES 2LUMA 2D10A 4AJWA 1SE3A 1S1QB 2A4ZA 4DK5A 3ZJVA 4FHKA 2K25A 3TUOA 1ZDXA 5G5GA 3U30A 3BY4B 1WJ6A 1EWYC 2J4XA 1WY8A 2KDIA 2NS5A 4PYZA 3PLUA 1I4PA 4DBGA 4N58A 4H2AA 2KWUB 2KJHB 1E7VA 1WGKA 2MP2B 4LNKA 1GNUA 1SIFA 3C0RB 3FC4A 4EEWA 2LMCA 4NJCA 3ZNID 4HKQA 2IBIB 1Q1OA 4IW0A 3DVGX 1P7FA 2GOWA 1QQRA 4BVUC 1E10A 3KUCB 3TEXA 2EMTA 4KSKC 2WXRA 4HDQA 2MW5A 4HXDA 1E5WA 4DHZE 1XLQA 4KIKA 3A1QA 3RN9C 3EC8A 4REZA 3KUDB 1WXMA 2NCNA 1K51A 3IFWB 1TS3A 2C7NB 1IP9A 1T5XD 4RGMA 2WXJA 3P4SB 4F8CB 2I38A 3ZYYX 2K22A 1FXTB 4R3DA 1XQQA 2PVGC 1WMHB 4RFBA 3MJWA 4WURA 5C3JB 3ZKJC 4L23A 2WXLA 2V3NA 1WZ3A 2JWUA 2PLPA 1TIFA 3QJZA 3H7SA 1NVID 1JROA 1YMHE 1GC6A 4DXAB 3UINB 3VTWA 3X23A 4ANUA 3V6CB 2NPTA 4WWPA 3PLVA 3TEWA 1OGWA 5IOIA 3QX1A 1MPEA 3APDA 4FXCA 4NAWA 1VCBA 2ZW0A 5LXIB 3NVVA 3R2IA 2L83A 1MFWA 2O6VA 2L8JA 2WWZA 1YQ4B 3AV8A 1DOXA 3VXWA 1XLPA 1UBIA 4MGZE 2G4SA 2BGFA 2KD0A 1YJJA 1TY2A 2YVCA 4GN1A 2KDFB 4BKGA 5T8IA 4II3B 1KLGD 3ZJTA 4MACA 1VR9A 3MP9A 3P4QB 2LJ5A 3DHHC 1NI3A 5C23A 3GS2A 5TR5A 1XCQL 2LGSA 1FFUA 1T0SC 3A4SC 3PVLA 4C00A 3RNFC 2D07B 4K3BA 2G3QB 3AE8B 3IAM1 1GJZA 2LXCA 4W9EA 2RD0A 1MG8A 2V3PA 3H6NA 1QOAA 3BIID 4FULA 1F77A 4JGHB 2CHZA 3ZO5B 5HI1A 1E8ZA 2NBUA 1WXAA 1NEKB 3PZ7A 1QILA 3RNAC 4IM3A 2DYMA 2W3RA 3VHTC 2MP2A 3VRAB 1HTOA 2JYTA 2WXPA 2GB1A 2N7EA 2XEWA 3P63A 4MJSA 2WU5B 3U4EG 1F0ZA 1WXQA 3C8YA 3DBHI 4ZOHC 3Q8FA 2B76B 2QILA 4JL9A 1P98A 1L2NA 1V8CA 1WGHA 3MC0B 1GB1A 1ACCA 2KWVB 4ZRKA 4P1BC 1DOIA 3ML8A 5C1ZA 4AOFA 1ROEA 3D32A 1FMAD 4EKUA 1LM8B 1JW9D 4BZAA 2UWQA 1YJ1A 3CSFA 3N30A 2BYFA 1DYQA 2J0KA 4W9DA 5BMIA 3V3XA 1WMHA 4LNIA 2M8SA 3TIXA 2MEKA 3SEBA 3GOEA 2Q5WD 4RM8A 4AJYB 2N9PC 1GG3A 3ZDMC 2Y5PA 1VLBA 2EKEC 2WXKA 2LGIA 1UWXA 4M8MA 3DWMA 5DPWA 4E71A 5D94A 3WCQA 4ZHPA 3AEBB 2R2OA 3PZDA 1JQ4A 5BYQA 2VRRB 2WHIA 4HWIB 3TEZA 2GBJA 2B3AA 4W9FA 2N9XA 1Y56A 1IUEA 4IG7B 3VR8B 1XXGA 2M56B 2KQSA 1SIJA 1PYWD 1T0QC 2XNAC 3EA6A 4DXGA 1T6BX 3DOWA 5IA7A 1Y8RC 1XCTL 2LI5A 1H8CA 1SEBD 2KMCA 3HM3A 1GUAB 3TBLD 4MSMB 2M19A 2YEPF 3AEAB 4WWOA 5D7GA 4JIOU 1N5XA 2ZPNA 3WIMA 3DBLI 1J7CA 2QMTA 4KX6B 1JCKB 4LCDE 3AE3B 1BXTA 1EF1A 1PGAA 4YTNB 4LJPB 2DZKA 3V62A 1JRPA 3ZLZA 1V2YA 2BB6A 3NZUA 3PRPB 5EDSA 1Q10A 4LNOA 5DPSA 2REXA 1I42A 4AS1A 1M94A 2BKFA 2JY6A 3NJTA 1EF5A 3EHVA 2C60A 3AXCA 4RCOA 3E9SA 4WIPA 2GBMA 3K9OB 1HZ5A 1P7EA 2LVPA 4LTUA 4NJ7A 2ZW1A 1FXAA 4ASWC 3KUZA 1JWUD 2WQYB 3EUB2 4LJOB 4RM9A 4XWWA 3UIOB 1HE8A 2AL6A 4OZAA 2KT7A 1K53A 3NRZA 2KC1A 2ZPYA 2CJOA 1PQSA 2XN9C 2DZMA 2VZKD 4A8XC 1AWDA 4HCNB 3UIPB 4HRSA 5E6OA 2CHWA 2JRIB 1OQYA 1BT0A 2BS2B 4N9F4 2K9XA 2INCC 2NVUI 1L5PA 1PFDA 4Q2JA 4FADA 1C3TA 1ZP0B 3L16A 2G45B 2ASQA 4PYUA 2J0MA 4G0NB 4HJKA 4XC2A 5IAAC 2HE7A 1TS5A 1V86A 3NZSA 2JZZA 1E8XA 2OEDA 4EFOA 3DBRI 4AUQC 4C4VB 1OEYA 2FIDA 3J9CA 3PSEB 1WGYA 4CO7A 5LLIA 3O65B 3RD2A 4OVVA 1V9JA 4JQWC 1C1YB 1TZ1A 1KLUD 5D3DA 3WAOA 4I6PA 1F2RI 2OJRA 2BS3B 2FUG1 2LRWA 1WXSA
chains in the Genus database with same CATH topology
3KUDB 1WXMA 2LGYA 3VUWA 2YLMA 4NNJB 4E3CA 2NCNA 3KW5B 3L17A 4BKSA 2G4DB 2NR2A 3HK0A 3R66C 3IFWB 3VTVA 4NPNA 1A5RA 1UD7A 5CHVC 2C7NB 1Z2MA 1IP9A 3IHPC 4K7UA 3PV1A 2NBWB 1WJUA 2KLGA 4F8CB 3AULA 2PPHA 2KN5A 3QHTA 1FXTB 1WXVA 3L08A 1XQQA 1X1MA 3KYDD 3RZWC 2PEAA 1S3SG 4EZKA 3JSVA 1SE9A 1WMHB 3MJWA 3TJPA 2KJRA 4KVGB 2BYVE 2MX2A 2MRPA 4I6NB 2RPQA 3ZKJC 4GOCA 2K8CA 3QARA 4DDID 4ZRIA 4XX5A 3QAQA 4PS8A 1GC7A 1WZ3A 2LZ6A 2QHOA 3R3MA 2N9EB 3RULA 2LUEA 4HPLB 2L3ZA 3QJZA 2K39A 3H7SA 3OAWA 2K1FA 4ZDVA 3A9JB 4DDGD 1GC6A 4DXAB 3RUIB 3UINB 4G3XB 4FJVB 3VTWA 3X23A 2KTRB 4A3PA 4ANUA 2OOBB 3V6CB 3H9DA 1ISNA 2NPTA 3JVZX 3PLVA 4WWPA 1JRUA 1OGWA 2JPHA 4IM2A 4HVBA 1WJNA 3QX1A 2J0JA 2L0TA 3APDA 3UGBB 3PTFC 5LXHA 4FJYA 5G2NA 4NAWA 1VCBA 1WE7A 2ZVOA 3X0WA 3HIZA 5E6PA 3DDCB 1V5TA 2MBQA 2JF5A 5LXIB 5J18A 1D3ZA 2CU1A 1UH6A 3UQBA 4B95A 2JVCA 2ZZPB 2O6VA 5AZFA 2L8JA 1RAXA 2WWZA 4K7SA 4M0WB 3VXWA 1ZKHA 2LVOA 3KH0A 5DPTA 4IM0A 4LDTB 1UBIA 2A5UA 4MGZE 2CR5A 5CHFA 1EO6A 2G4SA 2BGFA 2KD0A 3Q3JA 2YVCA 3RT3B 3ECIA 4HDOA 4GN1A 3QQ8B 4DHJD 4BKSD 3WAPA 5JH5C 2KDFB 2KVRA 4ICVA 3U8ZA 3RCZA 4XZ4A 4GDKB 1P1AA 3PPAA 2ZJDA 4BKGA 1Q5WB 3H1UA 3M63B 4G11A 4II3B 5J17A 1WYWB 2BKRB 4MH0E 4ANXA 2LVQA 4ZYNA 3QA8A 1EUVB 1UGMA 2IY1B 4HCPB 2C9WB 2LJ5A 4M8NA 5C23A 4II2B 1IPGA 3GZNI 3QWZB 3SDLC 5TR5A 1WM2A 3M62B 4W9JA 2Z0DB 3KYCD 4W9LA 2LRUA 3VQIA 3RZFA 2KJ6A 2JZ3B 4IC7B 2KZRA 3A4SC 2ZCBA 3PGEA 1NBFC 5KHOA 1TBEA 1OTRB 1WGDA 3PVLA 2Y5BB 4B6WA 3B08A 4HPMB 2L0FA 4HK2A 4MJSB 2D07B 2MBBB 2G3QB 4ICUA 2KOXA 2DAJA 1AARA 3P2BA 2AEHA 2JT4B 3NY5A 1GJZA 2LXCA 3ALBA 4W9EA 2XK5B 2RD0A 2FUHB 4IUMB 1MG8A 3UQAA 1CMXB 3QK0A 1WGGA 2KFKB 4GDLA 2DX5B 3H6NA 2XBBC 1WX8A 1WR6E 4W9HA 5AEKB 4FULA 4JGHB 5AZGA 1UBQA 5BO4B 3U7DA 2IO1B 2CHZA 3TL5A 4J6IA 3ZO5B 1E8ZA 2NBUA 4K7WA 1WXAA 3WANA 5AZHA 4FA6A 2IO0B 3AU4A 4IWPA 4BFRA 1J19A 2O6VD 4IM3A 2DYMA 3QCAA 4MDKE 3LDZE 4WJNA 3VHTC 1WJ4A 2BF8B 2KDEB 2K6QA 2MP2A 1XD3B 3V60A 4MELA 1KOTA 4X57B 4DWFA 4W9GA 3T8MA 2K8BA 4OVUA 2N7EA 2XEWA 2FCMA 3QIJA 1XT9B 2PJHA 4MJSA 3PT2B 3RYTA 3VUXA 3V6EB 2MA9B 2GMIC 1YQBA 1L7YA 2J7QB 1E7UA 3B0AA 4TKNA 2M17A 3IBEA 3V61A 2O2VA 3DBHI 4JL9A 1P98A 1L2NA 1WFYA 3VH3B 3SD5A 4EUTA 3W1SA 1KLVA 1WGHA 4BOSC 2DYBA 4MEMA 3S2AA 3N3KB 2HTHA 3ZUNA 4KZCA 2V1YA 2KWVB 4TUUA 4ZRKA 1I35A 3OLMD 3IVFA 2KANA 3H7PB 3ML8A 2JRHA 5C1ZA 4AOFA 3D32A 2I1KA 4EKUA 2HJ8A 1LM8B 1OEYJ 1P3QU 2RSUA 5HKHA 4KDLB 2EMSA 4IWOA 4WJQA 3KVFB 3DPDA 2UWQA 3A4RA 1YJ1A 2IZVB 3CSFA 3Q3FA 3N30A 4NQKE 3WA0A 2BYFA 2J0KA 4W9DA 1YIWA 4AWJA 4F7ZA 1WMHA 3DVNV 2M8SA 5DCNA 3TIXA 3VVWB 2FAZA 3GOEA 3L0WB 4RM8A 4AJYB 3PHWB 5D2MB 4EZJA 2N9PC 1GG3A 2L76A 2AYOB 2KXJA 3ZDMC 2EKEC 3MTNB 2D11A 2D3GA 2DZIA 3A9JA 3AU5A 4KDIC 3ML9A 4M8MA 1WI0A 2C7HA 2L05A 2GBRA 2ZNVB 5JHAA 5DPWA 2AL3A 4E71A 5D94A 3ENEA 2KTRA 3R7RA 2L00B 2R2OA 2DHZA 2Z59B 3QC8B 1E90A 3PZDA 4EOYA 4BOZB 4W9CA 4ANVA 1V6EA 3VUYA 2VRRB 4NY0A 2KX3A 3IG3A 2IO3B 4HWIB 1KM7A 2GBJA 1WH3A 2N4FA 2B3AA 2DZJA 1WR1A 4GXBA 4W9FA 2N9XA 1V81A 3MHSD 1IYFA 3OJ3A 1E8WA 4I6LB 4IG7B 2IO2B 3N32A 2DYOA 2KQSA 2DAFA 3ZTDA 3ONSA 3JW0X 4TQ1A 2KO3A 2C5LC 3SHQA 2LWPA 4WWNA 1R4MI 3DOWA 1V49A 1LXDA 2LASA 1RLFA 2PE9A 1Y8RC 3R7QA 3SU8X 5IA7A 1J8CA 3A9KB 4KIKB 2LGXA 2KMAA 4P7IA 2LI5A 3A1QB 3CMMB 1H8CA 5GMVA 5FR6A 4B9KA 4GDKA 3ZVVA 1K8RB 1RFAA 2KMCA 3HM3A 4DHJB 3ZRFA 4BKTA 2LGDA 1WM3A 4RMAA 1GUAB 1LFDA 2NBVB 1H4RA 4MSMB 3TBLD 2LXAA 1TGZB 2BWFA 1V80A 4MSQB 3OJ4B 4KV2A 3ZNHB 4WWOA 5D7GA 4JIOU 5D6JB 3W1SC 2RR9A 3APFA 2ZPNA 3WIMA 3DBLI 5JZEB 4FHJA 3JSVB 4WQOB 2C7MB 4NQLB 4ZRJA 5JHBA 4LCDE 5J2RA 1EF1A 1V5OA 2ZVNA 2KC2A 4PS3A 3ZW3A 4LJPB 2ZEQA 2DZKA 2K6DB 1WZ0A 2M1MA 1WIAA 3V62A 3APCA 3ZLZA 2KQ7A 2GBKA 1V2YA 2FCNA 2FIFA 3B1LX 3DCGA 3NZUA 3DBSA 3PRPB 3NOBA 4TV3A 3T9LA 1NDDA 4BBNF 2BYEA 5EDSA 3M95A 2XK5A 2KK8A 2JXXA 2KX0A 5G55A 2HD5B 2KFKA 4MM3A 2AWTA 2KWCA 2L7RA 2IY0B 2FNJB 2MBOA 4MGKE 2NPTB 4K1RB 3ZDTA 2MQJA 2JWZA 5DPSA 2REXA 3NS8A 1I42A 2KLCA 1M94A 5CHWA 4WJOA 3WAMA 1WRDB 3BINA 1UZXB 2BKFA 4EZLA 4NAWB 2JY6A 4K81A 3M3JA 1UELA 2BPSA 2PE6B 2MBHA 2MWSB 1QZEA 2ZCCA 1EF5A 3K9PB 4AP4C 3EHVA 2C60A 3CF6E 1LQBA 2I1JA 2V3SA 2O6VB 3AXCA 1RRBA 2N1WA 4LDTD 3TCAA 2M4NA 2V4LA 4G50A 4FJZA 1Q0WB 4WAAA 1SGHA 3L54A 4GIVA 2KFJA 1TTNA 2M0XA 4MGIE 4DHZB 2CS4A 2GBMA 3ZNZB 3K9OB 3DVGY 2CHXA 4YL8A 2D2QA 1WGRA 4KSLC 1NI2A 1Z5SB 5CTRC 4A20A 4ANWA 3L13A 4NJ6A 3NHEB 2KKCA 2LVPA 4NJ7A 2UYZB 4BBNC 2KTFA 4GMVA 1T0YA 3A33B 4ASWC 1VD2A 3KUZA 2WX0A 4JLCA 4IWQA 3HM6X 2KHWB 2WDTB 3CSTA 4LJOB 4RM9A 3EECA 1R4NI 3EFUA 3I3TB 1HE8A 5DPRA 1WF9A 3UF8A 1F9JA 3UIOB 3WALA 2AL6A 5L95C 3ZRCA 3PREA 3PRMB 1WX7A 3H7PA 2RGFA 3LJ3A 4HLEA 3HHMA 3PRZA 3VAWA 4TQ0A 2ZNVC 4GU2A 4MGYE 1KJTA 3PHXB 2FCQA 2KC1A 2WX1A 2ZPYA 1PQSA 4FN2A 5L83A 2DZMA 2BWES 4GSWA 4FLHA 1YX6B 4HCNB 2D10A 3UIPB 1WE6A 1P0RA 2MBEA 1S1QB 4AJWA 2A4ZA 4DK5A 4WJPA 3PS6A 4FHKA 2CHWA 5E6OA 4KZ0A 2JRIB 1OQYA 4W9KA 3ZTCA 2K25A 4PS7A 4A3OA 1BT0A 4N9F4 4GDLB 2NVUI 3VDZA 2JUOA 2Z0EB 3U30A 2K8HA 3BY4B 3W1YA 1E8YA 1P9DU 1WJ6A 5CX3A 2R2QA 4FADA 1C3TA 2MCNB 3JYUA 4GGQA 3L16A 2G45B 2GBNA 2IYDB 2ASQA 4PYUA 2J0MA 4G0NB 3ZNGC 1WY8A 2KDIA 4HJKA 1U4AA 2NS5A 4XC2A 5IAAC 2DENB 4PYZA 1WX9A 2CKHB 3PLUA 1G6JA 4DBGA 4E74A 4FBJB 2HE7A 1V86A 3NZSA 4URKA 2JZZA 2KWUB 1E8XA 2MSED 2KJHB 4CYEA 1E7VA 2MP2B 4EFOA 3DBRI 2FCSA 2W9NA 1GNUA 1SIFA 3C0RB 2MLBA 4AUQC 4EEWA 3ZNID 1OEYA 2N1VA 2IBIB 1Q1OA 4IW0A 2FIDA 1ZW7A 3DVGX 4GB9A 3PSEB 1YX5B 1WGYA 4CHKA 3DQVA 4CO7A 2GOWA 5LLIA 4BVUC 1YD8U 3O65B 3KUCB 4W9IA 3RD2A 3VH4B 4OVVA 2EMTA 1V9JA 2O2VB 3L10B 4KSKC 3TMPB 4HDQA 4JQWC 1C1YB 1TZ1A 3DVNU 2N7DA 2KNBA 2MW5A 2KDBA 4HXDA 3VTUA 1J0GA 1E5WA 2WYQA 3AI5A 4DHZE 5E6NA 3WAOA 4I6PA 2OJRA 3A9KA 2LD9A 3ZIMA 4KIKA 2LRWA 1ZGUB 3A1QA 5KHQA 4F1SA 3VFKA 3EC8A 1WXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUD B;  1WXM A;  2LGY A;  3VUW A;  2YLM A;  4NNJ B;  4E3C A;  2NCN A;  3KW5 B;  3L17 A;  4BKS A;  2G4D B;  2NR2 A;  3HK0 A;  3R66 C;  3IFW B;  3VTV A;  4NPN A;  1A5R A;  1UD7 A;  5CHV C;  2C7N B;  1Z2M A;  1IP9 A;  3IHP C;  4K7U A;  3PV1 A;  2NBW B;  1WJU A;  2KLG A;  4F8C B;  3AUL A;  2PPH A;  2KN5 A;  3QHT A;  1FXT B;  1WXV A;  3L08 A;  1XQQ A;  1X1M A;  3KYD D;  3RZW C;  2PEA A;  1S3S G;  4EZK A;  3JSV A;  1SE9 A;  1WMH B;  3MJW A;  3TJP A;  2KJR A;  4KVG B;  2BYV E;  2MX2 A;  2MRP A;  4I6N B;  2RPQ A;  3ZKJ C;  4GOC A;  2K8C A;  3QAR A;  4DDI D;  4ZRI A;  4XX5 A;  3QAQ A;  4PS8 A;  1GC7 A;  1WZ3 A;  2LZ6 A;  2QHO A;  3R3M A;  2N9E B;  3RUL A;  2LUE A;  4HPL B;  2L3Z A;  3QJZ A;  2K39 A;  3H7S A;  3OAW A;  2K1F A;  4ZDV A;  3A9J B;  4DDG D;  1GC6 A;  4DXA B;  3RUI B;  3UIN B;  4G3X B;  4FJV B;  3VTW A;  3X23 A;  2KTR B;  4A3P A;  4ANU A;  2OOB B;  3V6C B;  3H9D A;  1ISN A;  2NPT A;  3JVZ X;  3PLV A;  4WWP A;  1JRU A;  1OGW A;  2JPH A;  4IM2 A;  4HVB A;  1WJN A;  3QX1 A;  2J0J A;  2L0T A;  3APD A;  3UGB B;  3PTF C;  5LXH A;  4FJY A;  5G2N A;  4NAW A;  1VCB A;  1WE7 A;  2ZVO A;  3X0W A;  3HIZ A;  5E6P A;  3DDC B;  1V5T A;  2MBQ A;  2JF5 A;  5LXI B;  5J18 A;  1D3Z A;  2CU1 A;  1UH6 A;  3UQB A;  4B95 A;  2JVC A;  2ZZP B;  2O6V A;  5AZF A;  2L8J A;  1RAX A;  2WWZ A;  4K7S A;  4M0W B;  3VXW A;  1ZKH A;  2LVO A;  3KH0 A;  5DPT A;  4IM0 A;  4LDT B;  1UBI A;  2A5U A;  4MGZ E;  2CR5 A;  5CHF A;  1EO6 A;  2G4S A;  2BGF A;  2KD0 A;  3Q3J A;  2YVC A;  3RT3 B;  3ECI A;  4HDO A;  4GN1 A;  3QQ8 B;  4DHJ D;  4BKS D;  3WAP A;  5JH5 C;  2KDF B;  2KVR A;  4ICV A;  3U8Z A;  3RCZ A;  4XZ4 A;  4GDK B;  1P1A A;  3PPA A;  2ZJD A;  4BKG A;  1Q5W B;  3H1U A;  3M63 B;  4G11 A;  4II3 B;  5J17 A;  1WYW B;  2BKR B;  4MH0 E;  4ANX A;  2LVQ A;  4ZYN A;  3QA8 A;  1EUV B;  1UGM A;  2IY1 B;  4HCP B;  2C9W B;  2LJ5 A;  4M8N A;  5C23 A;  4II2 B;  1IPG A;  3GZN I;  3QWZ B;  3SDL C;  5TR5 A;  1WM2 A;  3M62 B;  4W9J A;  2Z0D B;  3KYC D;  4W9L A;  2LRU A;  3VQI A;  3RZF A;  2KJ6 A;  2JZ3 B;  4IC7 B;  2KZR A;  3A4S C;  2ZCB A;  3PGE A;  1NBF C;  5KHO A;  1TBE A;  1OTR B;  1WGD A;  3PVL A;  2Y5B B;  4B6W A;  3B08 A;  4HPM B;  2L0F A;  4HK2 A;  4MJS B;  2D07 B;  2MBB B;  2G3Q B;  4ICU A;  2KOX A;  2DAJ A;  1AAR A;  3P2B A;  2AEH A;  2JT4 B;  3NY5 A;  1GJZ A;  2LXC A;  3ALB A;  4W9E A;  2XK5 B;  2RD0 A;  2FUH B;  4IUM B;  1MG8 A;  3UQA A;  1CMX B;  3QK0 A;  1WGG A;  2KFK B;  4GDL A;  2DX5 B;  3H6N A;  2XBB C;  1WX8 A;  1WR6 E;  4W9H A;  5AEK B;  4FUL A;  4JGH B;  5AZG A;  1UBQ A;  5BO4 B;  3U7D A;  2IO1 B;  2CHZ A;  3TL5 A;  4J6I A;  3ZO5 B;  1E8Z A;  2NBU A;  4K7W A;  1WXA A;  3WAN A;  5AZH A;  4FA6 A;  2IO0 B;  3AU4 A;  4IWP A;  4BFR A;  1J19 A;  2O6V D;  4IM3 A;  2DYM A;  3QCA A;  4MDK E;  3LDZ E;  4WJN A;  3VHT C;  1WJ4 A;  2BF8 B;  2KDE B;  2K6Q A;  2MP2 A;  1XD3 B;  3V60 A;  4MEL A;  1KOT A;  4X57 B;  4DWF A;  4W9G A;  3T8M A;  2K8B A;  4OVU A;  2N7E A;  2XEW A;  2FCM A;  3QIJ A;  1XT9 B;  2PJH A;  4MJS A;  3PT2 B;  3RYT A;  3VUX A;  3V6E B;  2MA9 B;  2GMI C;  1YQB A;  1L7Y A;  2J7Q B;  1E7U A;  3B0A A;  4TKN A;  2M17 A;  3IBE A;  3V61 A;  2O2V A;  3DBH I;  4JL9 A;  1P98 A;  1L2N A;  1WFY A;  3VH3 B;  3SD5 A;  4EUT A;  3W1S A;  1KLV A;  1WGH A;  4BOS C;  2DYB A;  4MEM A;  3S2A A;  3N3K B;  2HTH A;  3ZUN A;  4KZC A;  2V1Y A;  2KWV B;  4TUU A;  4ZRK A;  1I35 A;  3OLM D;  3IVF A;  2KAN A;  3H7P B;  3ML8 A;  2JRH A;  5C1Z A;  4AOF A;  3D32 A;  2I1K A;  4EKU A;  2HJ8 A;  1LM8 B;  1OEY J;  1P3Q U;  2RSU A;  5HKH A;  4KDL B;  2EMS A;  4IWO A;  4WJQ A;  3KVF B;  3DPD A;  2UWQ A;  3A4R A;  1YJ1 A;  2IZV B;  3CSF A;  3Q3F A;  3N30 A;  4NQK E;  3WA0 A;  2BYF A;  2J0K A;  4W9D A;  1YIW A;  4AWJ A;  4F7Z A;  1WMH A;  3DVN V;  2M8S A;  5DCN A;  3TIX A;  3VVW B;  2FAZ A;  3GOE A;  3L0W B;  4RM8 A;  4AJY B;  3PHW B;  5D2M B;  4EZJ A;  2N9P C;  1GG3 A;  2L76 A;  2AYO B;  2KXJ A;  3ZDM C;  2EKE C;  3MTN B;  2D11 A;  2D3G A;  2DZI A;  3A9J A;  3AU5 A;  4KDI C;  3ML9 A;  4M8M A;  1WI0 A;  2C7H A;  2L05 A;  2GBR A;  2ZNV B;  5JHA A;  5DPW A;  2AL3 A;  4E71 A;  5D94 A;  3ENE A;  2KTR A;  3R7R A;  2L00 B;  2R2O A;  2DHZ A;  2Z59 B;  3QC8 B;  1E90 A;  3PZD A;  4EOY A;  4BOZ B;  4W9C A;  4ANV A;  1V6E A;  3VUY A;  2VRR B;  4NY0 A;  2KX3 A;  3IG3 A;  2IO3 B;  4HWI B;  1KM7 A;  2GBJ A;  1WH3 A;  2N4F A;  2B3A A;  2DZJ A;  1WR1 A;  4GXB A;  4W9F A;  2N9X A;  1V81 A;  3MHS D;  1IYF A;  3OJ3 A;  1E8W A;  4I6L B;  4IG7 B;  2IO2 B;  3N32 A;  2DYO A;  2KQS A;  2DAF A;  3ZTD A;  3ONS A;  3JW0 X;  4TQ1 A;  2KO3 A;  2C5L C;  3SHQ A;  2LWP A;  4WWN A;  1R4M I;  3DOW A;  1V49 A;  1LXD A;  2LAS A;  1RLF A;  2PE9 A;  1Y8R C;  3R7Q A;  3SU8 X;  5IA7 A;  1J8C A;  3A9K B;  4KIK B;  2LGX A;  2KMA A;  4P7I A;  2LI5 A;  3A1Q B;  3CMM B;  1H8C A;  5GMV A;  5FR6 A;  4B9K A;  4GDK A;  3ZVV A;  1K8R B;  1RFA A;  2KMC A;  3HM3 A;  4DHJ B;  3ZRF A;  4BKT A;  2LGD A;  1WM3 A;  4RMA A;  1GUA B;  1LFD A;  2NBV B;  1H4R A;  4MSM B;  3TBL D;  2LXA A;  1TGZ B;  2BWF A;  1V80 A;  4MSQ B;  3OJ4 B;  4KV2 A;  3ZNH B;  4WWO A;  5D7G A;  4JIO U;  5D6J B;  3W1S C;  2RR9 A;  3APF A;  2ZPN A;  3WIM A;  3DBL I;  5JZE B;  4FHJ A;  3JSV B;  4WQO B;  2C7M B;  4NQL B;  4ZRJ A;  5JHB A;  4LCD E;  5J2R A;  1EF1 A;  1V5O A;  2ZVN A;  2KC2 A;  4PS3 A;  3ZW3 A;  4LJP B;  2ZEQ A;  2DZK A;  2K6D B;  1WZ0 A;  2M1M A;  1WIA A;  3V62 A;  3APC A;  3ZLZ A;  2KQ7 A;  2GBK A;  1V2Y A;  2FCN A;  2FIF A;  3B1L X;  3DCG A;  3NZU A;  3DBS A;  3PRP B;  3NOB A;  4TV3 A;  3T9L A;  1NDD A;  4BBN F;  2BYE A;  5EDS A;  3M95 A;  2XK5 A;  2KK8 A;  2JXX A;  2KX0 A;  5G55 A;  2HD5 B;  2KFK A;  4MM3 A;  2AWT A;  2KWC A;  2L7R A;  2IY0 B;  2FNJ B;  2MBO A;  4MGK E;  2NPT B;  4K1R B;  3ZDT A;  2MQJ A;  2JWZ A;  5DPS A;  2REX A;  3NS8 A;  1I42 A;  2KLC A;  1M94 A;  5CHW A;  4WJO A;  3WAM A;  1WRD B;  3BIN A;  1UZX B;  2BKF A;  4EZL A;  4NAW B;  2JY6 A;  4K81 A;  3M3J A;  1UEL A;  2BPS A;  2PE6 B;  2MBH A;  2MWS B;  1QZE A;  2ZCC A;  1EF5 A;  3K9P B;  4AP4 C;  3EHV A;  2C60 A;  3CF6 E;  1LQB A;  2I1J A;  2V3S A;  2O6V B;  3AXC A;  1RRB A;  2N1W A;  4LDT D;  3TCA A;  2M4N A;  2V4L A;  4G50 A;  4FJZ A;  1Q0W B;  4WAA A;  1SGH A;  3L54 A;  4GIV A;  2KFJ A;  1TTN A;  2M0X A;  4MGI E;  4DHZ B;  2CS4 A;  2GBM A;  3ZNZ B;  3K9O B;  3DVG Y;  2CHX A;  4YL8 A;  2D2Q A;  1WGR A;  4KSL C;  1NI2 A;  1Z5S B;  5CTR C;  4A20 A;  4ANW A;  3L13 A;  4NJ6 A;  3NHE B;  2KKC A;  2LVP A;  4NJ7 A;  2UYZ B;  4BBN C;  2KTF A;  4GMV A;  1T0Y A;  3A33 B;  4ASW C;  1VD2 A;  3KUZ A;  2WX0 A;  4JLC A;  4IWQ A;  3HM6 X;  2KHW B;  2WDT B;  3CST A;  4LJO B;  4RM9 A;  3EEC A;  1R4N I;  3EFU A;  3I3T B;  1HE8 A;  5DPR A;  1WF9 A;  3UF8 A;  1F9J A;  3UIO B;  3WAL A;  2AL6 A;  5L95 C;  3ZRC A;  3PRE A;  3PRM B;  1WX7 A;  3H7P A;  2RGF A;  3LJ3 A;  4HLE A;  3HHM A;  3PRZ A;  3VAW A;  4TQ0 A;  2ZNV C;  4GU2 A;  4MGY E;  1KJT A;  3PHX B;  2FCQ A;  2KC1 A;  2WX1 A;  2ZPY A;  1PQS A;  4FN2 A;  5L83 A;  2DZM A;  2BWE S;  4GSW A;  4FLH A;  1YX6 B;  4HCN B;  2D10 A;  3UIP B;  1WE6 A;  1P0R A;  2MBE A;  1S1Q B;  4AJW A;  2A4Z A;  4DK5 A;  4WJP A;  3PS6 A;  4FHK A;  2CHW A;  5E6O A;  4KZ0 A;  2JRI B;  1OQY A;  4W9K A;  3ZTC A;  2K25 A;  4PS7 A;  4A3O A;  1BT0 A;  4N9F 4;  4GDL B;  2NVU I;  3VDZ A;  2JUO A;  2Z0E B;  3U30 A;  2K8H A;  3BY4 B;  3W1Y A;  1E8Y A;  1P9D U;  1WJ6 A;  5CX3 A;  2R2Q A;  4FAD A;  1C3T A;  2MCN B;  3JYU A;  4GGQ A;  3L16 A;  2G45 B;  2GBN A;  2IYD B;  2ASQ A;  4PYU A;  2J0M A;  4G0N B;  3ZNG C;  1WY8 A;  2KDI A;  4HJK A;  1U4A A;  2NS5 A;  4XC2 A;  5IAA C;  2DEN B;  4PYZ A;  1WX9 A;  2CKH B;  3PLU A;  1G6J A;  4DBG A;  4E74 A;  4FBJ B;  2HE7 A;  1V86 A;  3NZS A;  4URK A;  2JZZ A;  2KWU B;  1E8X A;  2MSE D;  2KJH B;  4CYE A;  1E7V A;  2MP2 B;  4EFO A;  3DBR I;  2FCS A;  2W9N A;  1GNU A;  1SIF A;  3C0R B;  2MLB A;  4AUQ C;  4EEW A;  3ZNI D;  1OEY A;  2N1V A;  2IBI B;  1Q1O A;  4IW0 A;  2FID A;  1ZW7 A;  3DVG X;  4GB9 A;  3PSE B;  1YX5 B;  1WGY A;  4CHK A;  3DQV A;  4CO7 A;  2GOW A;  5LLI A;  4BVU C;  1YD8 U;  3O65 B;  3KUC B;  4W9I A;  3RD2 A;  3VH4 B;  4OVV A;  2EMT A;  1V9J A;  2O2V B;  3L10 B;  4KSK C;  3TMP B;  4HDQ A;  4JQW C;  1C1Y B;  1TZ1 A;  3DVN U;  2N7D A;  2KNB A;  2MW5 A;  2KDB A;  4HXD A;  3VTU A;  1J0G A;  1E5W A;  2WYQ A;  3AI5 A;  4DHZ E;  5E6N A;  3WAO A;  4I6P A;  2OJR A;  3A9K A;  2LD9 A;  3ZIM A;  4KIK A;  2LRW A;  1ZGU B;  3A1Q A;  5KHQ A;  4F1S A;  3VFK A;  3EC8 A;  1WXS A; 
#chains in the Genus database with same CATH topology
 3VUW A;  4E3C A;  1L4D B;  4BKS A;  3HK0 A;  4HPP A;  3R66 C;  3EFC A;  4NPN A;  3H8H A;  1UD7 A;  1I7H A;  1Z2M A;  3IHP C;  5JXV A;  2KLG A;  3DBR B;  2BTE A;  2DWQ A;  4CQN A;  1X1M A;  1FRD A;  1SE9 A;  5TSS A;  4I6N B;  3O13 A;  1FCC C;  2Y3A A;  1QKZ A;  2K8C A;  3QAQ A;  2Y5C A;  2QHO A;  2CJN A;  3MJ5 A;  4DDG D;  1SF0 A;  4FJV B;  3AEE B;  2KTR B;  4YSX B;  3H9D A;  3JVZ X;  2FBW B;  3PTF C;  3I9V 1;  5LXH A;  4IDI A;  2ZVO A;  2I2Y A;  4BAX A;  1AW7 A;  3W5V B;  5J18 A;  3OWE B;  2ON8 A;  1AYF A;  4B95 A;  2JVC A;  1RAX A;  2LVO A;  1ZUD 2;  5DPT A;  2A5U A;  1EO6 A;  3ECI A;  1N63 A;  5JH5 C;  2KVR A;  3Q8B A;  4ICV A;  3U8Z A;  3RCZ A;  4XZ4 A;  4ITK A;  2ZJD A;  3Q3M C;  5J17 A;  1WYW B;  3V05 A;  2R61 A;  4P6V F;  2BKR B;  4MH0 E;  3GP7 A;  1EUV B;  2IY1 B;  2M0A A;  2WU2 B;  1K50 A;  4M8N A;  2LFI A;  3C19 A;  2BQQ A;  3GZN I;  3N1Z C;  3SDL C;  4W9L A;  3T3O A;  2KJ6 A;  3KWL A;  5KHO A;  4B6W A;  1WGD A;  2L0F A;  4HK2 A;  4MJS B;  2MBB B;  4ICU A;  3P2B A;  1EU4 A;  2XK5 B;  1TJE A;  1CMX B;  3QK0 A;  1WGG A;  1TS2 A;  2KFK B;  2KN4 A;  4MM3 B;  2BYT A;  2GLS A;  4YSY B;  1UBQ A;  5AZG A;  5IN7 A;  4S0R A;  1T0R C;  3GB1 A;  2PMV A;  1JWA D;  3NVY A;  1QF6 A;  3AU4 A;  2O6V D;  4WJN A;  2JXT A;  2BF8 B;  3T3N A;  2KVZ A;  4C4V A;  4X57 B;  4W9G A;  3T8M A;  1XT9 B;  3AE9 B;  2PJH A;  4DXF A;  2KYW A;  3RYT A;  3VUX A;  3V6E B;  1XO3 A;  1N60 A;  1NYQ A;  2MA9 B;  2GMI C;  1L7Y A;  4OVZ A;  3B0A A;  4ACF A;  2QSD A;  3HVD A;  4NAM A;  2LHD A;  1WFY A;  3SD5 A;  2IGD A;  2YEP B;  3U2S C;  3RI7 C;  3N1X C;  4YWG G;  2VH2 A;  3OLM D;  3IVF A;  2KAN A;  1KF6 B;  2WDR B;  3H7P B;  1JAL A;  3PO0 A;  3IAS 1;  1ZE3 D;  2I1K A;  2RSU A;  1OEY J;  5HKH A;  2EMS A;  3SFD B;  3KVF B;  3UI3 A;  3A4R A;  1GAQ B;  1L6V A;  3WA0 A;  4A6Q A;  1TZO A;  3AM9 A;  2KQ4 X;  2GRI A;  1KH0 A;  3PHW B;  3NVZ A;  2AYO B;  4OZC A;  3LYY A;  3MTN B;  1JWM D;  2BBC A;  2DZI A;  2V4I B;  2WXQ A;  3AU5 A;  1WI0 A;  3AEF B;  1MJD A;  2KTR A;  3R7R A;  1YN3 A;  1PGB A;  1E90 A;  3QC8 B;  4EOY A;  1C77 A;  2INN E;  2IDY A;  1OQQ A;  4RH6 A;  2KX3 A;  3IG3 A;  1YN4 A;  2MHJ A;  1IYF A;  4P1C C;  4XE0 A;  1CK1 A;  3KWV A;  3N32 A;  3ZTD A;  5FR3 A;  3U7Z A;  1LXD A;  3SU8 X;  1RLF A;  1J8C A;  2D5G A;  1N61 A;  3A9K B;  4K3C A;  1KFY B;  3W5U B;  1I4Q A;  3CMM B;  3ZVV A;  1K8R B;  1RFA A;  4DHJ B;  1TKE A;  1UNS A;  4BKT A;  5AUK A;  1WM3 A;  1TT5 B;  1ZPS A;  2G1E A;  2LXA A;  4ARI A;  4MSQ B;  1L0X B;  1F52 A;  2JSV X;  2MJE A;  4KKJ A;  5E6J A;  1C9F A;  5JZE B;  4FHJ A;  1ET9 A;  1SE2 A;  2C7M B;  5JHB A;  1V5O A;  3HVZ A;  4DQO C;  4ZHO A;  2KC2 A;  3ZW3 A;  4P16 A;  2M1M A;  1WIA A;  1TKG A;  3APC A;  2GBK A;  2FCN A;  2FIF A;  1VDV A;  2X8X X;  3DBS A;  4WAF A;  4TV3 A;  4BBN F;  5GXG B;  2XK5 A;  3Q6B A;  2KX0 A;  2JXX A;  2HD5 B;  1I4X A;  2KFK A;  4MM3 A;  2D3C A;  2FNJ B;  2MBO A;  4MGK E;  4K1R B;  1T3Q A;  2G9H D;  3ZDT A;  2LHE A;  2H89 B;  1LO5 D;  3N9Y C;  2K0P A;  3NS8 A;  2KLC A;  3NUH B;  3WAM A;  1WRD B;  4EZL A;  4K81 A;  3M3J A;  2BPS A;  2PE6 B;  1DGJ A;  2MWS B;  2ZCC A;  1ZDV A;  3R2T A;  3CF6 E;  5EE3 A;  1SE4 A;  1JWB D;  2J42 A;  3TCA A;  2NTS A;  2V4L A;  4G50 A;  1JWS D;  1Q0W B;  4A90 A;  1SGH A;  3DHI C;  4C7Z A;  4GIV A;  4DHZ B;  1TTN A;  1VJK A;  2INP E;  3DVG Y;  4ANW A;  3L13 A;  3MHZ A;  2KKC A;  3ZXV A;  1XLN A;  3DBH B;  1VD2 A;  3Q8E A;  3HM6 X;  2KHW B;  2WDT B;  3CST A;  2V9H A;  1R4N I;  3EEC A;  3UF8 A;  4C56 C;  5L95 C;  4IOI E;  3ZRC A;  2WP9 B;  3PRE A;  2IND C;  1BML C;  3H7P A;  1RWS A;  3LXF A;  4YT0 B;  4GU2 A;  4MGY E;  1KJT A;  3PHX B;  1WRI A;  2QIE B;  4FN2 A;  1GB4 A;  5L83 A;  4GSW A;  4TMA B;  4FLH A;  1YX6 B;  2HJ1 A;  1SBB B;  1WE6 A;  1P0R A;  2MBE A;  1WSP A;  3U52 E;  1GPX A;  2WXN A;  3ZTC A;  4PS7 A;  4A3O A;  2WDQ B;  2QEJ C;  1PDX A;  3VDZ A;  2Z0E B;  1E8Y A;  5CX3 A;  3ETR A;  3JYU A;  1R7S A;  5MPO A;  3BYY B;  1EM7 A;  2GBN A;  2IYD B;  4L1B A;  5H8Y E;  1U4A A;  4YTM B;  2CKH B;  1G6J A;  4E74 A;  1D5M C;  1MI0 A;  3B2G A;  1FCL A;  4URK A;  2DLB A;  2FCS A;  2W9N A;  3RNG C;  2N1V A;  1ZW7 A;  1YX5 B;  3DQV A;  2WXG A;  4EE2 A;  3VH4 B;  3BWU D;  3TMP B;  2O2V B;  2WS3 B;  3OG5 A;  3DVN U;  3VTU A;  2KDB A;  3Q8C A;  1FXI A;  1HZ6 A;  1LGR A;  4OW0 A;  1ET6 A;  5E6N A;  3A9K A;  1N62 A;  3KQ4 A;  3AEC B;  5IKC M;  3VFK A;  3TEY A;  4RNA A;  4AQ7 A;  2LGY A;  3L17 A;  3I57 A;  3VTV A;  1ZXH A;  4JWU C;  5CHV C;  3CWI A;  1WJU A;  2PPH A;  2KN5 A;  3L08 A;  2PEA A;  1S3S G;  1I4G A;  4OZB A;  4EZK A;  3TJP A;  2KJR A;  3DBL B;  2MX2 A;  4J3O D;  2RPQ A;  3AE1 B;  4S17 A;  3QAR A;  4DDI D;  4ZRI A;  1E9M A;  1GC7 A;  3R3M A;  2N9E B;  4HPL B;  2L3Z A;  1YN5 A;  2K1F A;  4ZDV A;  3A9J B;  1C4P A;  2E6X A;  3RUI B;  4G3X B;  2L52 A;  4A3P A;  2L1A A;  2UU7 A;  4ZRQ A;  1YNT E;  1JRU A;  4IM2 A;  2J0J A;  4YSZ B;  5G2N A;  5IO9 A;  3DDC B;  2MBQ A;  2JF5 A;  5AUI A;  1D3Z A;  2CU1 A;  3UQB A;  4M02 A;  2ZZP B;  4LLG M;  5AZF A;  1MG4 A;  2J53 A;  4K7S A;  4M0W B;  1ZKH A;  3KH0 A;  4LDT B;  5HG2 A;  2CR5 A;  3SR6 A;  3Q8A A;  3R8B A;  3RT3 B;  2D3B A;  4BKS D;  3HRD D;  1J7B A;  1TKY A;  3PPA A;  1Q5W B;  3DWG C;  2SEB D;  4G11 A;  3VRB B;  1C78 A;  1OFF A;  4L2Y A;  1E7P B;  1VZ6 A;  2RDH A;  4ANX A;  3QA8 A;  3SFE B;  1OQR A;  3P1M A;  1IPG A;  3QWZ B;  4O1N A;  1WM2 A;  1TY0 A;  4W9J A;  2LRU A;  1FNU A;  3VQI A;  1RM6 C;  3RZF A;  2JZ3 B;  4MT5 A;  5G5H A;  2KZR A;  2ZCB A;  3PGE A;  1NBF C;  1OTR B;  4HPM B;  2KOX A;  1AAR A;  3FKY A;  3NY5 A;  2JT4 B;  3B2F A;  3ALB A;  4QAY A;  2W55 A;  2FUH B;  3UQA A;  2DX5 B;  2QJL A;  1WX8 A;  1WR6 E;  4W9H A;  2WXI A;  1I4R A;  5BMG A;  5BO4 B;  3I5J C;  2IGG A;  1UGJ A;  4K7W A;  3P42 A;  5AZH A;  4M01 A;  2IO0 B;  3TSS A;  4BFR A;  2ONQ A;  3LDZ E;  2OHF A;  1WJ4 A;  2KDE B;  2K6Q A;  1XD3 B;  1KOT A;  3BVM A;  3AE2 B;  2FCM A;  3QIJ A;  3RNC C;  3AB5 A;  3EGR A;  3PT2 B;  2MJD A;  3W9C B;  2J7Q B;  3Q2A C;  4TKN A;  2M17 A;  2O2V A;  3B9J A;  2FE8 A;  2EKI A;  2Z8L A;  2E3T A;  3VH3 B;  4US8 A;  4HJG E;  1JML A;  3W1S A;  1KLV A;  5LNK 1;  4MEM A;  2HTH A;  4KZC A;  2WXH A;  2V1Y A;  2RPV A;  1I35 A;  1E6E B;  2JRH A;  5D3I B;  3RFZ B;  1FO4 A;  3AH7 A;  2BW2 A;  2AQ3 B;  1P3Q U;  4KDL B;  4WJQ A;  3ZJU A;  4WH4 A;  3Q3F A;  1D6E C;  1GOZ A;  4AWJ A;  1YIW A;  3DVN V;  4LNF A;  5DCN A;  3FIL B;  4WWM A;  2FAZ A;  5EE0 A;  4KGR A;  2SAK A;  1HA5 A;  5FK9 C;  4KGT A;  1A70 A;  2D11 A;  2D3G A;  2KWD A;  3A9J A;  4KDI C;  3PZ8 A;  1F1H A;  2WXF A;  3ML9 A;  2WLB A;  3Q3N C;  3BK2 A;  2N0S B;  4XDC A;  2L00 B;  2V0G A;  2Z59 B;  1FEH A;  4BOZ B;  4W9C A;  3ZGZ A;  4ANV A;  1V6E A;  3VUY A;  1N5W A;  2IO3 B;  1KM7 A;  2JQR B;  1IBX A;  4XDD A;  1WH3 A;  2N4F A;  1WR1 A;  4GXB A;  4WQM A;  2EEL A;  1E8W A;  3Q3O C;  4I6L B;  2IO2 B;  1I4H A;  2DYO A;  4M0W A;  3ZQ4 A;  3ONS A;  1QOF A;  4TQ1 A;  3SHQ A;  4WWN A;  1R4M I;  1V49 A;  2RDG A;  2LAS A;  3R7Q A;  1YOV B;  2KMA A;  1IGD A;  2HTM E;  4HRO A;  1XLO A;  4B9K A;  4C7Y A;  1M4V A;  4RMA A;  4RGO S;  1LFD A;  2NBV B;  3BVG A;  5HHD G;  1VZ7 A;  1TGZ B;  2KMM A;  1YJI A;  4RF0 A;  4USA A;  5EE9 A;  3JSV B;  4WQO B;  4NQL B;  5J2R A;  3GZN B;  2ZVN A;  4PS3 A;  2ZEQ A;  2K6D B;  1WZ0 A;  3MC9 A;  2QDF A;  2KQ7 A;  3B1L X;  1R4M B;  3NOB A;  3T9L A;  1NDD A;  4PK1 A;  2PTL A;  2KK8 A;  2AWT A;  1TS4 A;  2JWZ A;  2DNF A;  5CHW A;  4WJO A;  5EE1 A;  4YXD B;  2MBH A;  1QZE A;  4B0M A;  1F2R C;  3K9P B;  4NZL B;  4AP4 C;  3MFG A;  2V3S A;  3NS1 A;  1RRB A;  2N1W A;  1KTK A;  4FJZ A;  4WAA A;  1C76 A;  1D5Z C;  4OHJ A;  3L54 A;  4MGI E;  2M0X A;  1EWC A;  1WGR A;  4KSL C;  1Z5S B;  2IPK D;  5CTR C;  4NJ6 A;  4BBN C;  2KTF A;  4M00 A;  1T0Y A;  3A33 B;  4KGS A;  2WXM A;  1HQR D;  1C79 A;  3I3T B;  5DPR A;  1F9J A;  2RDB C;  3MC8 A;  1MHH E;  2L32 A;  2W3S A;  3PRZ A;  4TQ0 A;  2WX1 A;  1FNV A;  2ICI A;  1NYR A;  1FD6 A;  1MVK A;  1EU3 A;  4KKI A;  5BYR A;  3LB8 C;  2ACZ B;  1PGX A;  2KAC A;  1D4B A;  1QT9 A;  4WJP A;  3PS6 A;  4KZ0 A;  3FIL A;  4W9K A;  1IGC A;  1STE A;  4GDL B;  2JUO A;  2K8H A;  2AQ2 B;  3W1Y A;  1P9D U;  2R2Q A;  2MCN B;  4GGQ A;  3P4R B;  2BT6 A;  1V1P B;  3ZNG C;  2HDE A;  4IKG A;  3RMK C;  1XF5 L;  4XWT A;  2DEN B;  1WX9 A;  2H88 B;  2JU6 X;  4FBJ B;  3I63 C;  3N20 C;  2MSE D;  4CYE A;  1CQV A;  2MLB A;  1KRH A;  4GB9 A;  5BYS A;  4CHK A;  4JE3 B;  1VZ8 A;  4N59 A;  1YD8 U;  1E0Z A;  4W9I A;  3L10 B;  2WXO A;  3E56 A;  4HKZ E;  3BVZ A;  2N7D A;  2KNB A;  1J0G A;  2WYQ A;  1FM0 D;  3AI5 A;  3ZIM A;  2LD9 A;  1ZGU B;  5KHQ A;  4F1S A;  3ABV B;  2RMM A;  4LK0 M;  2QC8 A;  2YLM A;  4NNJ B;  3KW5 B;  2G4D B;  2NR2 A;  2BB5 A;  4JX1 C;  3URY A;  1A5R A;  4K7U A;  3PV1 A;  2NBW B;  3AUL A;  4A9A A;  3QHT A;  1WXV A;  4B0E A;  3KYD D;  3RZW C;  5C2T B;  2N9K A;  3JSV A;  1UF0 A;  4KVG B;  2BYV E;  2MRP A;  2PKO A;  1D5X C;  2WDV B;  3AN1 A;  4GOC A;  4XX5 A;  4PS8 A;  3RUL A;  2KDM A;  2LZ6 A;  2LUE A;  2K39 A;  3OAW A;  3AE7 B;  4US9 A;  1FNW A;  4ZRP A;  2JYE A;  2OOB B;  1ISN A;  2JPH A;  2X38 A;  4HVB A;  1WJN A;  2BS4 B;  2BVC A;  2L0T A;  3UGB B;  4FJY A;  2KAJ A;  1WE7 A;  3X0W A;  1HEZ E;  3HIZ A;  5E6P A;  1V5T A;  1QOB A;  1UH6 A;  4PT5 A;  4JWS C;  3AE5 B;  2LEK A;  3FAH A;  4IM0 A;  5I4D A;  5CHF A;  1WWT A;  2J52 A;  3IT4 B;  3Q3J A;  2K5P A;  4HDO A;  4DHJ D;  3QQ8 B;  3WAP A;  1MHX A;  4GDK B;  1P1A A;  1B9R A;  1UUP A;  3H1U A;  3M63 B;  3KLS X;  4LNN A;  2LVQ A;  4ZYN A;  1UGM A;  4HCP B;  1R4N B;  2WNM A;  2C9W B;  3GE8 C;  2AQ1 B;  4II2 B;  2LJI A;  3M62 B;  2Z0D B;  3KYC D;  5HFY A;  1YQ3 B;  2JZP A;  2MJ3 A;  4IC7 B;  1TBE A;  2Y5B B;  2VZK B;  4ZYS A;  3B08 A;  1J7A A;  4HEA 1;  1RYJ A;  2DAJ A;  2NMQ A;  1L4Z B;  2AEH A;  2W54 A;  4IUM B;  4GDL A;  4TSS A;  3L4P A;  2XBB C;  4YTP B;  5AEK B;  4D2K A;  3U7D A;  2IO1 B;  1FRR A;  3TL5 A;  4RGN A;  1CJE A;  4J6I A;  1V1P A;  4C80 A;  3N1Y C;  3WAN A;  1ENF A;  4FA6 A;  4IWP A;  1J19 A;  3QCA A;  4MDK E;  2AX5 A;  3V60 A;  4MEL A;  1UWM A;  4DWF A;  3RNB C;  2K8B A;  4OVU A;  4RGT A;  1YQB A;  1E7U A;  3IBE A;  3V61 A;  1N6Z A;  2PIA A;  1C4C A;  1L0Y B;  4EUT A;  1VRA B;  1ESF A;  4BOS C;  1CZP A;  2DYB A;  3S2A A;  3N3K B;  2N7J A;  3ZUN A;  4TUU A;  4RF1 A;  1QOG A;  2VH1 A;  3Q14 C;  2N9L A;  2PVO D;  2HJ8 A;  3BK1 A;  4UDU C;  4IWO A;  1IBX B;  3DPD A;  4JPS A;  2IZV B;  3AED B;  4NQK E;  4F7Z A;  3VVW B;  3DHG C;  3Q69 A;  3L0W B;  3BYT B;  5D2M B;  4EZJ A;  2L76 A;  5FKA C;  2KXJ A;  2CU3 A;  2D3A A;  5JHA A;  1DOY A;  2C7H A;  2GBR A;  2L05 A;  2ZNV B;  1FIQ A;  2AL3 A;  3ENE A;  5BMH A;  2QCZ A;  3CIR B;  1SSN A;  2DHZ A;  3AE4 B;  2W82 A;  4NY0 A;  1PUT A;  4A55 A;  1SXT A;  4N6E B;  2DZJ A;  1L0V B;  1V81 A;  3MHS D;  3OJ3 A;  2GI9 A;  2NTT A;  1V1O A;  2DAF A;  3JW0 X;  1WYG A;  2KO3 A;  5H92 C;  1HTQ A;  2C5L C;  2LWP A;  1TYG B;  2PE9 A;  4MH8 A;  4GLS C;  4KIK B;  2LGX A;  4P7I A;  3A1Q B;  3RPF C;  3BZD B;  3AE6 B;  1RFK A;  5GMV A;  5FR6 A;  4GDK A;  3IT6 B;  2WGS A;  3ZRF A;  2DBY A;  1XEE A;  2LGD A;  1ZXI A;  1SJH D;  1H4R A;  2BWF A;  3RNE C;  1V80 A;  3OJ4 B;  4KV2 A;  3ZNH B;  5D6J B;  3W1S C;  2RR9 A;  3APF A;  1L6U A;  2MH7 A;  1HXY D;  1AN8 A;  3HUI A;  4ZRJ A;  4ARC A;  2IGH A;  1C4A A;  3P4P B;  1NEN B;  2IJ0 A;  1K52 A;  3DCG A;  2PW9 A;  2BYE A;  4XYC A;  3M95 A;  2TSS A;  5G55 A;  2KWC A;  2L7R A;  2IY0 B;  3ZXR A;  2NPT B;  2JX5 A;  2MQJ A;  1SJE D;  3BIN A;  1UZX B;  4NAW B;  5IP4 D;  1UEL A;  3NZ3 A;  1V97 A;  1QLB B;  4XGA B;  1LQB A;  2I1J A;  1FFV A;  2O6V B;  1B1Z A;  4LDT D;  2K3U A;  2M4N A;  3NVW A;  1SB3 C;  2OJW A;  2KFJ A;  2CS4 A;  3ZNZ B;  3AEG B;  2CHX A;  4YL8 A;  2D2Q A;  1NI2 A;  4A20 A;  1BUI C;  1FPY A;  3VR9 B;  3NHE B;  2UYZ B;  1ZOY B;  4GMV A;  3NG0 A;  4JLC A;  2WX0 A;  4IWQ A;  3AMZ A;  3EFU A;  3WAL A;  1WF9 A;  3PRM B;  3GE3 C;  1WX7 A;  2RGF A;  3LJ3 A;  3W2D A;  3HHM A;  3VAW A;  4HLE A;  2ZNV C;  2FCQ A;  3IXS A;  2BWE S;  2LUM A;  2D10 A;  4AJW A;  1SE3 A;  1S1Q B;  2A4Z A;  4DK5 A;  3ZJV A;  4FHK A;  2K25 A;  3TUO A;  1ZDX A;  5G5G A;  3U30 A;  3BY4 B;  1WJ6 A;  1EWY C;  2J4X A;  1WY8 A;  2KDI A;  2NS5 A;  4PYZ A;  3PLU A;  1I4P A;  4DBG A;  4N58 A;  4H2A A;  2KWU B;  2KJH B;  1E7V A;  1WGK A;  2MP2 B;  4LNK A;  1GNU A;  1SIF A;  3C0R B;  3FC4 A;  4EEW A;  2LMC A;  4NJC A;  3ZNI D;  4HKQ A;  2IBI B;  1Q1O A;  4IW0 A;  3DVG X;  1P7F A;  2GOW A;  1QQR A;  4BVU C;  1E10 A;  3KUC B;  3TEX A;  2EMT A;  4KSK C;  2WXR A;  4HDQ A;  2MW5 A;  4HXD A;  1E5W A;  4DHZ E;  1XLQ A;  4KIK A;  3A1Q A;  3RN9 C;  3EC8 A;  4REZ A;  3KUD B;  1WXM A;  2NCN A;  1K51 A;  3IFW B;  1TS3 A;  2C7N B;  1IP9 A;  1T5X D;  4RGM A;  2WXJ A;  3P4S B;  4F8C B;  2I38 A;  3ZYY X;  2K22 A;  1FXT B;  4R3D A;  1XQQ A;  2PVG C;  1WMH B;  4RFB A;  3MJW A;  4WUR A;  5C3J B;  3ZKJ C;  4L23 A;  2WXL A;  2V3N A;  1WZ3 A;  2JWU A;  2PLP A;  1TIF A;  3QJZ A;  3H7S A;  1NVI D;  1JRO A;  1YMH E;  1GC6 A;  4DXA B;  3UIN B;  3VTW A;  3X23 A;  4ANU A;  3V6C B;  2NPT A;  4WWP A;  3PLV A;  3TEW A;  1OGW A;  5IOI A;  3QX1 A;  1MPE A;  3APD A;  4FXC A;  4NAW A;  1VCB A;  2ZW0 A;  5LXI B;  3NVV A;  3R2I A;  2L83 A;  1MFW A;  2O6V A;  2L8J A;  2WWZ A;  1YQ4 B;  3AV8 A;  1DOX A;  3VXW A;  1XLP A;  1UBI A;  4MGZ E;  2G4S A;  2BGF A;  2KD0 A;  1YJJ A;  1TY2 A;  2YVC A;  4GN1 A;  2KDF B;  4BKG A;  5T8I A;  4II3 B;  1KLG D;  3ZJT A;  4MAC A;  1VR9 A;  3MP9 A;  3P4Q B;  2LJ5 A;  3DHH C;  1NI3 A;  5C23 A;  3GS2 A;  5TR5 A;  1XCQ L;  2LGS A;  1FFU A;  1T0S C;  3A4S C;  3PVL A;  4C00 A;  3RNF C;  2D07 B;  4K3B A;  2G3Q B;  3AE8 B;  3IAM 1;  1GJZ A;  2LXC A;  4W9E A;  2RD0 A;  1MG8 A;  2V3P A;  3H6N A;  1QOA A;  3BII D;  4FUL A;  1F77 A;  4JGH B;  2CHZ A;  3ZO5 B;  5HI1 A;  1E8Z A;  2NBU A;  1WXA A;  1NEK B;  3PZ7 A;  1QIL A;  3RNA C;  4IM3 A;  2DYM A;  2W3R A;  3VHT C;  2MP2 A;  3VRA B;  1HTO A;  2JYT A;  2WXP A;  2GB1 A;  2N7E A;  2XEW A;  3P63 A;  4MJS A;  2WU5 B;  3U4E G;  1F0Z A;  1WXQ A;  3C8Y A;  3DBH I;  4ZOH C;  3Q8F A;  2B76 B;  2QIL A;  4JL9 A;  1P98 A;  1L2N A;  1V8C A;  1WGH A;  3MC0 B;  1GB1 A;  1ACC A;  2KWV B;  4ZRK A;  4P1B C;  1DOI A;  3ML8 A;  5C1Z A;  4AOF A;  1ROE A;  3D32 A;  1FMA D;  4EKU A;  1LM8 B;  1JW9 D;  4BZA A;  2UWQ A;  1YJ1 A;  3CSF A;  3N30 A;  2BYF A;  1DYQ A;  2J0K A;  4W9D A;  5BMI A;  3V3X A;  1WMH A;  4LNI A;  2M8S A;  3TIX A;  2MEK A;  3SEB A;  3GOE A;  2Q5W D;  4RM8 A;  4AJY B;  2N9P C;  1GG3 A;  3ZDM C;  2Y5P A;  1VLB A;  2EKE C;  2WXK A;  2LGI A;  1UWX A;  4M8M A;  3DWM A;  5DPW A;  4E71 A;  5D94 A;  3WCQ A;  4ZHP A;  3AEB B;  2R2O A;  3PZD A;  1JQ4 A;  5BYQ A;  2VRR B;  2WHI A;  4HWI B;  3TEZ A;  2GBJ A;  2B3A A;  4W9F A;  2N9X A;  1Y56 A;  1IUE A;  4IG7 B;  3VR8 B;  1XXG A;  2M56 B;  2KQS A;  1SIJ A;  1PYW D;  1T0Q C;  2XNA C;  3EA6 A;  4DXG A;  1T6B X;  3DOW A;  5IA7 A;  1Y8R C;  1XCT L;  2LI5 A;  1H8C A;  1SEB D;  2KMC A;  3HM3 A;  1GUA B;  3TBL D;  4MSM B;  2M19 A;  2YEP F;  3AEA B;  4WWO A;  5D7G A;  4JIO U;  1N5X A;  2ZPN A;  3WIM A;  3DBL I;  1J7C A;  2QMT A;  4KX6 B;  1JCK B;  4LCD E;  3AE3 B;  1BXT A;  1EF1 A;  1PGA A;  4YTN B;  4LJP B;  2DZK A;  3V62 A;  1JRP A;  3ZLZ A;  1V2Y A;  2BB6 A;  3NZU A;  3PRP B;  5EDS A;  1Q10 A;  4LNO A;  5DPS A;  2REX A;  1I42 A;  4AS1 A;  1M94 A;  2BKF A;  2JY6 A;  3NJT A;  1EF5 A;  3EHV A;  2C60 A;  3AXC A;  4RCO A;  3E9S A;  4WIP A;  2GBM A;  3K9O B;  1HZ5 A;  1P7E A;  2LVP A;  4LTU A;  4NJ7 A;  2ZW1 A;  1FXA A;  4ASW C;  3KUZ A;  1JWU D;  2WQY B;  3EUB 2;  4LJO B;  4RM9 A;  4XWW A;  3UIO B;  1HE8 A;  2AL6 A;  4OZA A;  2KT7 A;  1K53 A;  3NRZ A;  2KC1 A;  2ZPY A;  2CJO A;  1PQS A;  2XN9 C;  2DZM A;  2VZK D;  4A8X C;  1AWD A;  4HCN B;  3UIP B;  4HRS A;  5E6O A;  2CHW A;  2JRI B;  1OQY A;  1BT0 A;  2BS2 B;  4N9F 4;  2K9X A;  2INC C;  2NVU I;  1L5P A;  1PFD A;  4Q2J A;  4FAD A;  1C3T A;  1ZP0 B;  3L16 A;  2G45 B;  2ASQ A;  4PYU A;  2J0M A;  4G0N B;  4HJK A;  4XC2 A;  5IAA C;  2HE7 A;  1TS5 A;  1V86 A;  3NZS A;  2JZZ A;  1E8X A;  2OED A;  4EFO A;  3DBR I;  4AUQ C;  4C4V B;  1OEY A;  2FID A;  3J9C A;  3PSE B;  1WGY A;  4CO7 A;  5LLI A;  3O65 B;  3RD2 A;  4OVV A;  1V9J A;  4JQW C;  1C1Y B;  1TZ1 A;  1KLU D;  5D3D A;  3WAO A;  4I6P A;  1F2R I;  2OJR A;  2BS3 B;  2FUG 1;  2LRW A;  1WXS A; 
#chains in the Genus database with same CATH homology
 3KUD B;  1WXM A;  2LGY A;  3VUW A;  2YLM A;  4NNJ B;  4E3C A;  2NCN A;  3KW5 B;  3L17 A;  4BKS A;  2G4D B;  2NR2 A;  3HK0 A;  3R66 C;  3IFW B;  3VTV A;  4NPN A;  1A5R A;  1UD7 A;  5CHV C;  2C7N B;  1Z2M A;  1IP9 A;  3IHP C;  4K7U A;  3PV1 A;  2NBW B;  1WJU A;  2KLG A;  4F8C B;  3AUL A;  2PPH A;  2KN5 A;  3QHT A;  1FXT B;  1WXV A;  3L08 A;  1XQQ A;  1X1M A;  3KYD D;  3RZW C;  2PEA A;  1S3S G;  4EZK A;  3JSV A;  1SE9 A;  1WMH B;  3MJW A;  3TJP A;  2KJR A;  4KVG B;  2BYV E;  2MX2 A;  2MRP A;  4I6N B;  2RPQ A;  3ZKJ C;  4GOC A;  2K8C A;  3QAR A;  4DDI D;  4ZRI A;  4XX5 A;  3QAQ A;  4PS8 A;  1GC7 A;  1WZ3 A;  2LZ6 A;  2QHO A;  3R3M A;  2N9E B;  3RUL A;  2LUE A;  4HPL B;  2L3Z A;  3QJZ A;  2K39 A;  3H7S A;  3OAW A;  2K1F A;  4ZDV A;  3A9J B;  4DDG D;  1GC6 A;  4DXA B;  3RUI B;  3UIN B;  4G3X B;  4FJV B;  3VTW A;  3X23 A;  2KTR B;  4A3P A;  4ANU A;  2OOB B;  3V6C B;  3H9D A;  1ISN A;  2NPT A;  3JVZ X;  3PLV A;  4WWP A;  1JRU A;  1OGW A;  2JPH A;  4IM2 A;  4HVB A;  1WJN A;  3QX1 A;  2J0J A;  2L0T A;  3APD A;  3UGB B;  3PTF C;  5LXH A;  4FJY A;  5G2N A;  4NAW A;  1VCB A;  1WE7 A;  2ZVO A;  3X0W A;  3HIZ A;  5E6P A;  3DDC B;  1V5T A;  2MBQ A;  2JF5 A;  5LXI B;  5J18 A;  1D3Z A;  2CU1 A;  1UH6 A;  3UQB A;  4B95 A;  2JVC A;  2ZZP B;  2O6V A;  5AZF A;  2L8J A;  1RAX A;  2WWZ A;  4K7S A;  4M0W B;  3VXW A;  1ZKH A;  2LVO A;  3KH0 A;  5DPT A;  4IM0 A;  4LDT B;  1UBI A;  2A5U A;  4MGZ E;  2CR5 A;  5CHF A;  1EO6 A;  2G4S A;  2BGF A;  2KD0 A;  3Q3J A;  2YVC A;  3RT3 B;  3ECI A;  4HDO A;  4GN1 A;  3QQ8 B;  4DHJ D;  4BKS D;  3WAP A;  5JH5 C;  2KDF B;  2KVR A;  4ICV A;  3U8Z A;  3RCZ A;  4XZ4 A;  4GDK B;  1P1A A;  3PPA A;  2ZJD A;  4BKG A;  1Q5W B;  3H1U A;  3M63 B;  4G11 A;  4II3 B;  5J17 A;  1WYW B;  2BKR B;  4MH0 E;  4ANX A;  2LVQ A;  4ZYN A;  3QA8 A;  1EUV B;  1UGM A;  2IY1 B;  4HCP B;  2C9W B;  2LJ5 A;  4M8N A;  5C23 A;  4II2 B;  1IPG A;  3GZN I;  3QWZ B;  3SDL C;  5TR5 A;  1WM2 A;  3M62 B;  4W9J A;  2Z0D B;  3KYC D;  4W9L A;  2LRU A;  3VQI A;  3RZF A;  2KJ6 A;  2JZ3 B;  4IC7 B;  2KZR A;  3A4S C;  2ZCB A;  3PGE A;  1NBF C;  5KHO A;  1TBE A;  1OTR B;  1WGD A;  3PVL A;  2Y5B B;  4B6W A;  3B08 A;  4HPM B;  2L0F A;  4HK2 A;  4MJS B;  2D07 B;  2MBB B;  2G3Q B;  4ICU A;  2KOX A;  2DAJ A;  1AAR A;  3P2B A;  2AEH A;  2JT4 B;  3NY5 A;  1GJZ A;  2LXC A;  3ALB A;  4W9E A;  2XK5 B;  2RD0 A;  2FUH B;  4IUM B;  1MG8 A;  3UQA A;  1CMX B;  3QK0 A;  1WGG A;  2KFK B;  4GDL A;  2DX5 B;  3H6N A;  2XBB C;  1WX8 A;  1WR6 E;  4W9H A;  5AEK B;  4FUL A;  4JGH B;  5AZG A;  1UBQ A;  5BO4 B;  3U7D A;  2IO1 B;  2CHZ A;  3TL5 A;  4J6I A;  3ZO5 B;  1E8Z A;  2NBU A;  4K7W A;  1WXA A;  3WAN A;  5AZH A;  4FA6 A;  2IO0 B;  3AU4 A;  4IWP A;  4BFR A;  1J19 A;  2O6V D;  4IM3 A;  2DYM A;  3QCA A;  4MDK E;  3LDZ E;  4WJN A;  3VHT C;  1WJ4 A;  2BF8 B;  2KDE B;  2K6Q A;  2MP2 A;  1XD3 B;  3V60 A;  4MEL A;  1KOT A;  4X57 B;  4DWF A;  4W9G A;  3T8M A;  2K8B A;  4OVU A;  2N7E A;  2XEW A;  2FCM A;  3QIJ A;  1XT9 B;  2PJH A;  4MJS A;  3PT2 B;  3RYT A;  3VUX A;  3V6E B;  2MA9 B;  2GMI C;  1YQB A;  1L7Y A;  2J7Q B;  1E7U A;  3B0A A;  4TKN A;  2M17 A;  3IBE A;  3V61 A;  2O2V A;  3DBH I;  4JL9 A;  1P98 A;  1L2N A;  1WFY A;  3VH3 B;  3SD5 A;  4EUT A;  3W1S A;  1KLV A;  1WGH A;  4BOS C;  2DYB A;  4MEM A;  3S2A A;  3N3K B;  2HTH A;  3ZUN A;  4KZC A;  2V1Y A;  2KWV B;  4TUU A;  4ZRK A;  1I35 A;  3OLM D;  3IVF A;  2KAN A;  3H7P B;  3ML8 A;  2JRH A;  5C1Z A;  4AOF A;  3D32 A;  2I1K A;  4EKU A;  2HJ8 A;  1LM8 B;  1OEY J;  1P3Q U;  2RSU A;  5HKH A;  4KDL B;  2EMS A;  4IWO A;  4WJQ A;  3KVF B;  3DPD A;  2UWQ A;  3A4R A;  1YJ1 A;  2IZV B;  3CSF A;  3Q3F A;  3N30 A;  4NQK E;  3WA0 A;  2BYF A;  2J0K A;  4W9D A;  1YIW A;  4AWJ A;  4F7Z A;  1WMH A;  3DVN V;  2M8S A;  5DCN A;  3TIX A;  3VVW B;  2FAZ A;  3GOE A;  3L0W B;  4RM8 A;  4AJY B;  3PHW B;  5D2M B;  4EZJ A;  2N9P C;  1GG3 A;  2L76 A;  2AYO B;  2KXJ A;  3ZDM C;  2EKE C;  3MTN B;  2D11 A;  2D3G A;  2DZI A;  3A9J A;  3AU5 A;  4KDI C;  3ML9 A;  4M8M A;  1WI0 A;  2C7H A;  2L05 A;  2GBR A;  2ZNV B;  5JHA A;  5DPW A;  2AL3 A;  4E71 A;  5D94 A;  3ENE A;  2KTR A;  3R7R A;  2L00 B;  2R2O A;  2DHZ A;  2Z59 B;  3QC8 B;  1E90 A;  3PZD A;  4EOY A;  4BOZ B;  4W9C A;  4ANV A;  1V6E A;  3VUY A;  2VRR B;  4NY0 A;  2KX3 A;  3IG3 A;  2IO3 B;  4HWI B;  1KM7 A;  2GBJ A;  1WH3 A;  2N4F A;  2B3A A;  2DZJ A;  1WR1 A;  4GXB A;  4W9F A;  2N9X A;  1V81 A;  3MHS D;  1IYF A;  3OJ3 A;  1E8W A;  4I6L B;  4IG7 B;  2IO2 B;  3N32 A;  2DYO A;  2KQS A;  2DAF A;  3ZTD A;  3ONS A;  3JW0 X;  4TQ1 A;  2KO3 A;  2C5L C;  3SHQ A;  2LWP A;  4WWN A;  1R4M I;  3DOW A;  1V49 A;  1LXD A;  2LAS A;  1RLF A;  2PE9 A;  1Y8R C;  3R7Q A;  3SU8 X;  5IA7 A;  1J8C A;  3A9K B;  4KIK B;  2LGX A;  2KMA A;  4P7I A;  2LI5 A;  3A1Q B;  3CMM B;  1H8C A;  5GMV A;  5FR6 A;  4B9K A;  4GDK A;  3ZVV A;  1K8R B;  1RFA A;  2KMC A;  3HM3 A;  4DHJ B;  3ZRF A;  4BKT A;  2LGD A;  1WM3 A;  4RMA A;  1GUA B;  1LFD A;  2NBV B;  1H4R A;  4MSM B;  3TBL D;  2LXA A;  1TGZ B;  2BWF A;  1V80 A;  4MSQ B;  3OJ4 B;  4KV2 A;  3ZNH B;  4WWO A;  5D7G A;  4JIO U;  5D6J B;  3W1S C;  2RR9 A;  3APF A;  2ZPN A;  3WIM A;  3DBL I;  5JZE B;  4FHJ A;  3JSV B;  4WQO B;  2C7M B;  4NQL B;  4ZRJ A;  5JHB A;  4LCD E;  5J2R A;  1EF1 A;  1V5O A;  2ZVN A;  2KC2 A;  4PS3 A;  3ZW3 A;  4LJP B;  2ZEQ A;  2DZK A;  2K6D B;  1WZ0 A;  2M1M A;  1WIA A;  3V62 A;  3APC A;  3ZLZ A;  2KQ7 A;  2GBK A;  1V2Y A;  2FCN A;  2FIF A;  3B1L X;  3DCG A;  3NZU A;  3DBS A;  3PRP B;  3NOB A;  4TV3 A;  3T9L A;  1NDD A;  4BBN F;  2BYE A;  5EDS A;  3M95 A;  2XK5 A;  2KK8 A;  2JXX A;  2KX0 A;  5G55 A;  2HD5 B;  2KFK A;  4MM3 A;  2AWT A;  2KWC A;  2L7R A;  2IY0 B;  2FNJ B;  2MBO A;  4MGK E;  2NPT B;  4K1R B;  3ZDT A;  2MQJ A;  2JWZ A;  5DPS A;  2REX A;  3NS8 A;  1I42 A;  2KLC A;  1M94 A;  5CHW A;  4WJO A;  3WAM A;  1WRD B;  3BIN A;  1UZX B;  2BKF A;  4EZL A;  4NAW B;  2JY6 A;  4K81 A;  3M3J A;  1UEL A;  2BPS A;  2PE6 B;  2MBH A;  2MWS B;  1QZE A;  2ZCC A;  1EF5 A;  3K9P B;  4AP4 C;  3EHV A;  2C60 A;  3CF6 E;  1LQB A;  2I1J A;  2V3S A;  2O6V B;  3AXC A;  1RRB A;  2N1W A;  4LDT D;  3TCA A;  2M4N A;  2V4L A;  4G50 A;  4FJZ A;  1Q0W B;  4WAA A;  1SGH A;  3L54 A;  4GIV A;  2KFJ A;  1TTN A;  2M0X A;  4MGI E;  4DHZ B;  2CS4 A;  2GBM A;  3ZNZ B;  3K9O B;  3DVG Y;  2CHX A;  4YL8 A;  2D2Q A;  1WGR A;  4KSL C;  1NI2 A;  1Z5S B;  5CTR C;  4A20 A;  4ANW A;  3L13 A;  4NJ6 A;  3NHE B;  2KKC A;  2LVP A;  4NJ7 A;  2UYZ B;  4BBN C;  2KTF A;  4GMV A;  1T0Y A;  3A33 B;  4ASW C;  1VD2 A;  3KUZ A;  2WX0 A;  4JLC A;  4IWQ A;  3HM6 X;  2KHW B;  2WDT B;  3CST A;  4LJO B;  4RM9 A;  3EEC A;  1R4N I;  3EFU A;  3I3T B;  1HE8 A;  5DPR A;  1WF9 A;  3UF8 A;  1F9J A;  3UIO B;  3WAL A;  2AL6 A;  5L95 C;  3ZRC A;  3PRE A;  3PRM B;  1WX7 A;  3H7P A;  2RGF A;  3LJ3 A;  4HLE A;  3HHM A;  3PRZ A;  3VAW A;  4TQ0 A;  2ZNV C;  4GU2 A;  4MGY E;  1KJT A;  3PHX B;  2FCQ A;  2KC1 A;  2WX1 A;  2ZPY A;  1PQS A;  4FN2 A;  5L83 A;  2DZM A;  2BWE S;  4GSW A;  4FLH A;  1YX6 B;  4HCN B;  2D10 A;  3UIP B;  1WE6 A;  1P0R A;  2MBE A;  1S1Q B;  4AJW A;  2A4Z A;  4DK5 A;  4WJP A;  3PS6 A;  4FHK A;  2CHW A;  5E6O A;  4KZ0 A;  2JRI B;  1OQY A;  4W9K A;  3ZTC A;  2K25 A;  4PS7 A;  4A3O A;  1BT0 A;  4N9F 4;  4GDL B;  2NVU I;  3VDZ A;  2JUO A;  2Z0E B;  3U30 A;  2K8H A;  3BY4 B;  3W1Y A;  1E8Y A;  1P9D U;  1WJ6 A;  5CX3 A;  2R2Q A;  4FAD A;  1C3T A;  2MCN B;  3JYU A;  4GGQ A;  3L16 A;  2G45 B;  2GBN A;  2IYD B;  2ASQ A;  4PYU A;  2J0M A;  4G0N B;  3ZNG C;  1WY8 A;  2KDI A;  4HJK A;  1U4A A;  2NS5 A;  4XC2 A;  5IAA C;  2DEN B;  4PYZ A;  1WX9 A;  2CKH B;  3PLU A;  1G6J A;  4DBG A;  4E74 A;  4FBJ B;  2HE7 A;  1V86 A;  3NZS A;  4URK A;  2JZZ A;  2KWU B;  1E8X A;  2MSE D;  2KJH B;  4CYE A;  1E7V A;  2MP2 B;  4EFO A;  3DBR I;  2FCS A;  2W9N A;  1GNU A;  1SIF A;  3C0R B;  2MLB A;  4AUQ C;  4EEW A;  3ZNI D;  1OEY A;  2N1V A;  2IBI B;  1Q1O A;  4IW0 A;  2FID A;  1ZW7 A;  3DVG X;  4GB9 A;  3PSE B;  1YX5 B;  1WGY A;  4CHK A;  3DQV A;  4CO7 A;  2GOW A;  5LLI A;  4BVU C;  1YD8 U;  3O65 B;  3KUC B;  4W9I A;  3RD2 A;  3VH4 B;  4OVV A;  2EMT A;  1V9J A;  2O2V B;  3L10 B;  4KSK C;  3TMP B;  4HDQ A;  4JQW C;  1C1Y B;  1TZ1 A;  3DVN U;  2N7D A;  2KNB A;  2MW5 A;  2KDB A;  4HXD A;  3VTU A;  1J0G A;  1E5W A;  2WYQ A;  3AI5 A;  4DHZ E;  5E6N A;  3WAO A;  4I6P A;  2OJR A;  3A9K A;  2LD9 A;  3ZIM A;  4KIK A;  2LRW A;  1ZGU B;  3A1Q A;  5KHQ A;  4F1S A;  3VFK A;  3EC8 A;  1WXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...