2LWPA

The nmr solution structure of the the ubiquitin homology domain of mouse bag-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG family molecular chaperone regulator 1
publication title The NMR solution structure of the ubiquitin homology domain of Bcl-2-associated athanogene 1 (BAG-1-UBH) from Mus musculus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lwpA00
2FUHB 2O2VB 3KYCD 4K7WA 1WM2A 4FJYA 3ZDTA 3DVGX 1V2YA 2K8CA 1YJ1A 2AEHA 5E6PA 2ZCCA 4I6NB 4AJWA 2EMTA 1LXDA 1LM8B 4NNJB 4JL9A 2FCMA 4LJOB 4HK2A 1WY8A 3M95A 3TCAA 3ZDMC 4HJKA 4DK5A 2WWZA 4BKGA 3TMPB 4CO7A 3VTWA 4MM3A 3CMMB 4ZRJA 3MTNB 1J8CA 1XQQA 2PE9A 5DPTA 4DDGD 1M94A 1RLFA 5AZGA 3TJPA 5C23A 1KJTA 2AL3A 4G50A 2D07B 3H7SA 3ZW3A 4AP4C 4NY0A 2DHZA 4W9GA 1WX8A 2CS4A 2DX5B 2Z0EB 3N30A 3RUIB 2IO2B 2GBKA 2ZPYA 1TZ1A 1V5OA 4W9FA 3PHWB 1EUVB 2LRWA 4EUTA 2C5LC 2XBBC 2D10A 2M0XA 4HXDA 2KJHB 1KLVA 2ZNVC 1GUAB 3IBEA 1J19A 4DBGA 4FHKA 4GDKA 2IO0B 4F7ZA 3VXWA 2IY0B 3WIMA 1WX7A 3PHXB 4EEWA 2WX0A 2JXXA 2N1WA 4JQWC 4KSLC 5TR5A 1UH6A 2LD9A 4DHZE 3PV1A 3UQBA 2LXCA 3A1QA 4BKSA 5DCNA 1GJZA 3BINA 2IY1B 2KMCA 4HCNB 2BYFA 2FCQA 2YLMA 2LRUA 3NY5A 1OGWA 4KDLB 3X0WA 1WIAA 3NS8A 2ZVNA 3A4SC 3PVLA 1WR1A 2RD0A 3N32A 5J18A 2NS5A 1L2NA 3NOBA 1RRBA 1TGZB 4EKUA 1WJ4A 2NPTA 2N9XA 3O65B 3PPAA 4GSWA 4PYUA 1KM7A 1WXMA 3M3JA 1I42A 2KD0A 2IO1B 1WZ3A 4KZ0A 5DPRA 5D6JB 3RYTA 3AU4A 4BBNF 4RM8A 4W9HA 3APCA 3IG3A 3KUDB 4LDTB 5J2RA 2DZIA 3TL5A 1WMHA 2ZCBA 2BF8B 1QZEA 2D2QA 2RPQA 1WJUA 3CSTA 3H7PA 4WWNA 3ZO5B 4TQ0A 5JZEB 4II2B 2V3SA 2KLCA 4BVUC 2JPHA 3SHQA 4DDID 2BWES 3BY4B 1X1MA 4XZ4A 1AARA 4AOFA 2M8SA 2KHWB 2HTHA 2PPHA 3L54A 3QQ8B 4EZKA 4W9LA 3VDZA 3ML9A 4IWPA 2PJHA 4KDIC 4RM9A 3SDLC 5J17A 2MBHA 2MA9B 2LI5A 2D11A 3OLMD 2KWCA 3A9JB 2HE7A 3I3TB 3V62A 2A5UA 1V81A 2DAJA 2XEWA 3ZNZB 1L7YA 2C60A 2LJ5A 1IP9A 4IM0A 4PS7A 3R3MA 2KTFA 3D32A 3V60A 2KNBA 2JWZA 3LJ3A 5AZFA 4YL8A 4ANWA 2G4SA 2BYVE 2L7RA 5L83A 4BOZB 2UYZB 3APDA 1SE9A 5D2MB 2PE6B 4ICUA 3ENEA 3JSVB 3DBHI 5JHBA 1D3ZA 2Z0DB 1FXTB 4PS8A 2FCSA 1C3TA 3ZKJC 4HDQA 3GOEA 2LGDA 3OJ3A 4NQKE 4K81A 3W1SC 1NBFC 5IAAC 4KIKB 2KMAA 4GB9A 2O6VB 2LGXA 4A3PA 2JF5A 5LXIB 1V49A 3AI5A 4G3XB 4HDOA 4TUUA 2MBEA 4E71A 4GXBA 4AJYB 4GIVA 2G3QB 4MJSB 1R4NI 1E8WA 3VH4B 2KOXA 5AZHA 3L17A 5CHVC 4EZJA 4HLEA 5GMVA 3C0RB 1YX5B 5KHOA 3PT2B 5E6OA 3EHVA 2XK5B 1UD7A 2N1VA 2K39A 2EKEC 2KN5A 4W9IA 3L16A 2G45B 3VUXA 3ECIA 3RZFA 2ASQA 4OVVA 2R2QA 3WALA 4EFOA 1H8CA 1S1QB 3DBRI 2GBMA 5JH5C 4F8CB 2KO3A 2LGYA 1RFAA 1P0RA 4CHKA 4WJOA 3ZTCA 1MG8A 2V4LA 3KUCB 2LWPA 2KC2A 3IVFA 3L13A 4HPMB 1E90A 4W9CA 1CMXB 2NBWB 1SGHA 4IM2A 1V5TA 4M0WB 3PS6A 2L0FA 4MDKE 3VVWB 1WGHA 1WF9A 3W1YA 4ANVA 2LUEA 1WYWB 4WJQA 3AXCA 3A9KB 1LFDA 4NJ7A 3QHTA 2WYQA 1IPGA 2KANA 3PSEB 3RT3B 4LDTD 4IWQA 5IA7A 3M63B 3QIJA 2JZ3B 1WR6E 1P98A 3UQAA 3VUYA 2MQJA 1Q1OA 2DYMA 4DXAB 3KUZA 1EF1A 2MBQA 1NI2A 4HPLB 3QA8A 1GG3A 4P7IA 4LCDE 2KFKA 3DBSA 2LVOA 2PEAA 1WJNA 1E7VA 2JRIB 2JZZA 3A4RA 1SIFA 1P3QU 3JSVA 3UF8A 1Z5SB 2IBIB 1GNUA 2BKFA 5BO4B 2DAFA 4ANUA 1XD3B 1PQSA 4GDLB 2LVPA 4JLCA 2KTRB 4NAWB 2O2VA 4KIKA 4DHZB 2KX0A 2N9EB 2O6VA 3JYUA 1ZGUB 4GN1A 1IYFA 3B1LX 1OEYA 2BYEA 2Z59B 2BWFA 2RGFA 4ZYNA 1JRUA 1EF5A 2L05A 2FAZA 2JRHA 5LXHA 4E3CA 3U30A 3DBLI 4MJSA 5D94A 3X23A 2IYDB 2K8HA 1E7UA 3WA0A 1EO6A 2K6QA 2HJ8A 1WH3A 2ZJDA 3VUWA 1H4RA 2XK5A 1WZ0A 2KX3A 3KVFB 4HCPB 3OAWA 3VTUA 2CHZA 4GU2A 2ZZPB 2NBUA 2ZVOA 4ZDVA 4ZRIA 1UGMA 4BKTA 1GC6A 3QJZA 3K9PB 4I6LB 2O6VD 2LXAA 5EDSA 3WAPA 1WXVA 2AL6A 4FLHA 4A3OA 3MHSD 4KZCA 1F9JA 2N7EA 2UWQA 2JT4B 3PLUA 2KWUB 3ML8A 2K6DB 3PZDA 3RZWC 3ZRFA 4M8MA 3PLVA 1WM3A 2B3AA 3NHEB 4W9DA 3N3KB 4FHJA 1U4AA 4MGKE 2BGFA 2DZJA 2FCNA 3IFWB 2K25A 3R66C 1G6JA 5C1ZA 3R7QA 3AULA 3UGBB 2OOBB 5LLIA 2KZRA 2L00B 2L0TA 4G0NB 1S3SG 2KXJA 4GDKB 1WGGA 3HM3A 3JVZX 2JY6A 4FA6A 4EOYA 4AUQC 2K1FA 4FADA 3QWZB 4W9EA 2OJRA 1WXAA 3A1QB 1OEYJ 4B6WA 3DDCB 2C7NB 2CHXA 2HD5B 3P2BA 2M1MA 2J0KA 3VFKA 3HHMA 3B0AA 3ZUNA 2MP2B 3ONSA 3PRZA 5KHQA 3UIPB 2NCNA 4GDLA 4JIOU 2GOWA 2KVRA 1TTNA 2KTRA 4A20A 1WRDB 2WX1A 2MWSB 4WWPA 3APFA 4HVBA 2M4NA 3VAWA 4GMVA 3V6CB 1ISNA 3K9OB 1YX6B 3B08A 4MGYE 3IHPC 1OTRB 1WE7A 2I1JA 3W1SA 2J7QB 1Y8RC 2L8JA 3Q3FA 3SU8X 3TBLD 1Q5WB 3UIOB 3ZIMA 1WMHB 1YIWA 2YVCA 4M8NA 2G4DB 2FIDA 3H7PB 2MBOA 2MLBA 4RMAA 4XX5A 4W9KA 4ANXA 3PRPB 2WDTB 3L0WB 5AEKB 3WANA 4IW0A 4K1RB 3QAQA 3QK0A 4BFRA 4MGZE 4ICVA 2GBJA 3QC8B 3CF6E 5CX3A 5G55A 2GBRA 1UELA 1ZKHA 4IC7B 1LQBA 2DZKA 1WJ6A 1TBEA 3GZNI 2FNJB 3SD5A 2C7MB 3WAOA 3RCZA 5HKHA 4FJZA 5CHWA 3ZLZA 4LJPB 4WQOB 1WFYA 1UZXB 3A9JA 2V1YA 4I6PA 4WWOA 2KLGA 1E8XA 2D3GA 2AWTA 2NVUI 3Q3JA 3ZNGC 2MX2A 4DHJB 3U7DA 1WE6A 3DCGA 1R4MI 1T0YA 3EFUA 2IZVB 1A5RA 4MH0E 4IM3A 2KFJA 4DWFA 4NQLB 4ASWC 4JGHB 3DVNU 3PTFC 4NJ6A 1ZW7A 2RSUA 2Y5BB 2MCNB 2J0JA 3V6EB 3U8ZA 1OQYA 4GGQA 2KJ6A 1NDDA 4MGIE 3RULA 3KW5B 2KQSA 4TQ1A 2L3ZA 4KVGB 2KDBA 3HK0A 4XC2A 1C1YB 5CHFA 4HWIB 2CR5A 2N9PC 4G11A 4B9KA 2KC1A 3EECA 3HM6X 1VD2A 3ZNID 5E6NA 2KDFB 2MBBB 3ZRCA 4MELA 1VCBA 1I35A 2RR9A 2EMSA 4IUMB 4J6IA 1WGDA 1K8RB 4MSMB 1WGYA 1WI0A 3M62B 4WJPA 3DOWA 3KYDD 2MP2A 4B95A 2MRPA 3L10B 2N4FA 1V9JA 1XT9B 2NBVB 2DYOA 3HIZA 3ZTDA 2C7HA 1E5WA 3UINB 1YQBA 5L95C 3NZUA 1V80A 3VTVA 2CHWA 1HE8A 3DVNV 1BT0A 4NPNA 2ZEQA 4FN2A 3ALBA 2MW5A 5CTRC 2L76A 5DPSA 4PS3A 2I1KA 3EC8A 3JW0X 2C9WB 4BKSD 4CYEA 3H6NA 1WX9A 3OJ4B 3VH3B 3QCAA 2KQ7A 1E8YA 5FR6A 3VHTC 3RD2A 4N9F4 4WAAA 3NZSA 3KH0A 1KOTA 1J0GA 1P1AA 3LDZE 3H9DA 4FJVB 2JUOA 1E8ZA 2KK8A 4KV2A 5DPWA 2M17A 2GMIC 3ZNHB 2KDEB 2K8BA 2NR2A 3A9KA 3PRMB 2J0MA 3A33B 3CSFA 4IG7B 4TV3A 4W9JA 3V61A 1WXSA 4TKNA 4URKA 2DENB 2N7DA 4WJNA 4BBNC 2BKRB 3R7RA 1RAXA 2KKCA 2LVQA 3T9LA 2DZMA 2LASA 4OVUA 1UBIA 2LZ6A 2KDIA 2CU1A 4ZRKA 2KWVB 1UBQA 1YD8U 2IO3B 2FIFA 2QHOA 3VQIA 3ZVVA 4F1SA 3H1UA 3PREA 4X57B 1GC7A 1Q0WB 3QX1A 3DPDA 1Z2MA 4K7UA 2AYOB 2W9NA 3DQVA 4II3B 4IWOA 3PGEA 4K7SA 3AU5A 3DVGY 3T8MA 4MSQB 4FBJB 2KFKB 5JHAA 4AWJA 2VRRB 4GOCA 4EZLA 5G2NA 3MJWA 2ZPNA 3TIXA 1V86A 2KJRA 2GBNA 3L08A 2JVCA 1WGRA 4BOSC 2BPSA 4MEMA 4E74A 2A4ZA 2DYBA 1P9DU 4NAWA 4PYZA 1V6EA 2R2OA 2MSED 4FULA 4KSKC 2CKHB 2NPTB 3QARA 2ZNVB 2REXA 5D7GA 3S2AA 3WAMA 4DHJD
chains in the Genus database with same CATH superfamily
3SFEB 3KYCD 3ZDTA 2AEHA 5E6PA 1TT5B 4JWSC 1YMHE 4YWGG 4LNOA 1LM8B 1WY8A 3KWLA 3M95A 3ZDMC 1UWMA 3I57A 2OJWA 1MFWA 4MM3A 4FXCA 5DPTA 1M94A 1RLFA 5C23A 1Y56A 2D07B 1UUPA 2ON8A 2TSSA 4PK1A 5AUIA 2WDQB 3AB5A 4NY0A 3ZYYX 3N30A 2IO2B 2GBKA 2ZPYA 2LRWA 4EUTA 1NVID 4KGTA 2E3TA 4GDKA 3MHZA 2H89B 3PZ8A 3PHXB 2JX5A 4KSLC 3PV1A 3TEWA 2LXCA 1ZDXA 1M4VA 2QCZA 4HCNB 1K50A 2FCQA 2YLMA 3X0WA 3NY5A 1WIAA 3PVLA 2ZVNA 3N32A 4EKUA 1QOGA 2N0SB 2NPTA 2KD0A 2IO1B 3NJTA 3P4PB 1WZ3A 4D2KA 5BYQA 3RYTA 2V4IB 4W9HA 3IG3A 5J2RA 2BF8B 5JZEB 4WWNA 4TQ0A 4ZRQA 2W82A 4WIPA 3SHQA 4DDID 3OWEB 1AARA 2HTHA 2WGSA 4EZKA 4C4VA 4IWPA 4RM9A 5J17A 2MA9B 2D11A 1L4ZB 3OLMD 2KWCA 1IP9A 3ZNZB 2C60A 2N7JA 3R3MA 3V60A 4YTNB 1T5XD 1MVKA 2JWZA 5BMHA 5AZFA 2G4SA 2W54A 5L83A 2L7RA 2KQ4X 2XNAC 1E9MA 2PTLA 3APDA 4MT5A 3R8BA 2RDBC 5D2MB 1T0RC 2PE6B 1KF6B 3ENEA 5JHBA 1D3ZA 4PS8A 1XCQL 2FCSA 1C3TA 4P16A 3Q8AA 4K81A 1PDXA 4KIKB 2KMAA 4GB9A 1L6VA 1TS2A 4OVZA 2I2YA 5LXIB 4G3XB 3AI5A 3OG5A 4DXGA 4YSYB 1ZE3D 4MJSB 1R4NI 3VH4B 2AQ1B 3C0RB 3RN9C 1DGJA 3L16A 4C7ZA 3RZFA 2ASQA 4OVVA 2QDFA 2R2QA 2ZW1A 3WALA 3AE8B 1S1QB 1MG8A 2V4LA 2LWPA 3IVFA 4W9CA 4IM2A 1V5TA 4MDKE 3W1YA 1WF9A 4ANVA 4WJQA 2KANA 4K3CA 3KQ4A 4YTPB 1Q1OA 4DXAB 1EF1A 1JWUD 1YJJA 1EU3A 4LCDE 2LFIA 5IP4D 2PEAA 5TSSA 3IXSA 3WCQA 4LLGM 1SIFA 1OFFA 4A55A 1EM7A 2IBIB 1GNUA 1MHHE 2WQYB 4GDLB 4ARCA 2WXQA 4DHZB 2O6VA 1ZGUB 4GN1A 1FD6A 1KTKA 2BYEA 2JQRB 2QILA 2JRHA 3NZ3A 5D94A 2K8HA 2K22A 3WA0A 3VUWA 4A90A 3KVFB 4NAMA 1JW9D 4HCPB 2L32A 2NBUA 1EU4A 4FLHA 4KZCA 2UWQA 1DYQA 1QILA 2K6DB 5HG2A 3ZRFA 4OZAA 3N3KB 1U4AA 2DZJA 2FCNA 2K25A 3R66C 1L0VB 1G6JA 4EE2A 2BS2B 3AULA 1I4XA 2OOBB 5LLIA 2L00B 4G0NB 2L0TA 2KXJA 1I7HA 2JY6A 2LHEA 4FA6A 4EOYA 2LGSA 3RPFC 1ESFA 4FADA 4OZCA 2LJIA 3DBLB 4B6WA 1FMAD 1TY0A 3DDCB 1SE4A 2M1MA 3VFKA 4XDDA 3DHHC 2AQ2B 2GOWA 2KVRA 3BWUD 2MWSB 4HVBA 3TEZA 2I38A 3Q3OC 1XF5L 3B08A 1LGRA 3IHPC 3W1SA 1WE7A 2L8JA 1Y8RC 1WMHB 4M8NA 3H7PB 2WDTB 4YT0B 5AEKB 1IUEA 3QAQA 4MGZE 2M56B 3QC8B 1UELA 2GBRA 5HKHA 1TBEA 3GZNI 2FNJB 1VJKA 2K9XA 1F0ZA 4HKZE 3DBHB 1WFYA 1A70A 3A9JA 1XLOA 4CQNA 4LTUA 2NVUI 3AMZA 4HKQA 4ZHOA 2BTEA 1VR9A 1WE6A 1N60A 5BYSA 2N9KA 4MH0E 1A5RA 4BZAA 1RWSA 1FIQA 2Y5BB 5G5HA 2BT6A 3RULA 3ZXVA 4KVGB 4XC2A 4G11A 4H2AA 5E6NA 3ZRCA 4J6IA 4MSMB 1WGYA 1WI0A 3M62B 4WJPA 2GLSA 3L10B 1T0QC 2FBWB 1I4HA 1V9JA 2NBVB 3ZTDA 2M19A 3AEFB 3UINB 5L95C 3LB8C 3VTVA 2CHWA 1BT0A 2GRIA 1I4PA 1YN4A 2MW5A 4IOIE 5DPSA 1V1OA 4PS3A 3EC8A 2K3UA 3OJ4B 4WAFA 2KQ7A 1E8YA 3Q8FA 4N9F4 1R4MB 1MPEA 3NVYA 2LEKA 4O1NA 3H9DA 1Q10A 4M0WA 1E8ZA 2V3PA 4C7YA 4WH4A 2W55A 1GPXA 4W9JA 4RNAA 3TUOA 3V61A 2WDVB 2DENB 2BKRB 2JYTA 2MJEA 2LASA 4OVUA 1HTOA 3MC8A 2FIFA 1UBQA 3ZVVA 2IO3B 2D3BA 1FFUA 3DPDA 4K7UA 3ZJUA 1XLQA 2K5PA 1QF6A 4NJCA 3DVGY 1C9FA 4MSQB 4FBJB 2KFKB 2KAJA 3TIXA 1ROEA 2GBNA 3L08A 2JVCA 1WGRA 5HHDG 4OW0A 2DYBA 2R2OA 3B9JA 2MSED 4FULA 2CKHB 3QARA 2IJ0A 2FUHB 2O2VB 2WS3B 3MJ5A 3DVGX 1V2YA 1MG4A 4I6NB 4AJWA 1LXDA 2R61A 2UU7A 4LJOB 3MP9A 3RNFC 3TCAA 5EE0A 3Q2AC 1PYWD 1K52A 3TMPB 4CO7A 3BYTB 3CMMB 2IGDA 1XQQA 1XLNA 3R2TA 3H7SA 1FNWA 2G1EA 4XDCA 4PT5A 4TMAB 1D5ZC 1JALA 1TZ1A 1I4GA 2BBCA 2FUG1 2D10A 2KJHB 3IBEA 1GUAB 1KFYB 1J19A 4DBGA 3VXWA 3WIMA 1WX7A 2Y5PA 2JXXA 2N1WA 5TR5A 4DHZE 3UQBA 3A1QA 4BKSA 5DCNA 3P4QB 1SE3A 4KDLB 3SR6A 2LRUA 1QOBA 1OGWA 4C56C 1WR1A 2RD0A 5J18A 2NS5A 4M01A 1TGZB 1WJ4A 4PYUA 1KM7A 5BMGA 5MPOA 1I42A 3AE7B 5DPRA 4BBNF 3KUDB 4LNNA 2MJ3A 1QZEA 3P4RB 3ZO5B 4II2B 1C4CA 4BVUC 1I4RA 3BY4B 1D5XC 2KHWB 2PPHA 5BYRA 5GXGB 3TEXA 3VDZA 1JWMD 2L52A 2PJHA 3SDLC 2PKOA 4K3BA 2AX5A 3DWMA 3AEEB 2XEWA 4PS7A 1P7FA 2KTFA 3D32A 1GOZA 2DWQA 2KNBA 1EWCA 4L1BA 1F77A 4YL8A 4ANWA 4BOZB 2L83A 4ICUA 3JSVB 1FXTB 3KLSX 3GOEA 2LGDA 3W1SC 1ZXHA 1V49A 2MBEA 2KWDA 2WXOA 2WU5B 4GIVA 4RGOS 2MEKA 4EZJA 2XK5B 2INDC 3AE1B 1UD7A 2G45B 3N9YC 3P42A 3RNAC 4US9A 5JH5C 2GBMA 2LGYA 1RFAA 4CHKA 4WJOA 3KUCB 1QOFA 3L13A 1E90A 3DHGC 3T3NA 3VVWB 1SF0A 5H8YE 1L0YB 1WYWB 2IDYA 3AXCA 3A9KB 2JSVX 2JWUA 3Q8BA 1LFDA 1IPGA 1L4DB 3RT3B 4LDTD 5IA7A 3U2SC 1NEKB 2W3SA 3M63B 3UQAA 1YOVB 2ACZB 2MQJA 3KUZA 1NI2A 4HPLB 3AEDB 3FILA 3RNEC 1WJNA 2JRIB 1R4NB 3UF8A 2BKFA 3V05A 1ENFA 4REZA 1TY2A 4NAWB 1HZ5A 4KIKA 4AS1A 3BIID 1IYFA 2Y3AA 1OEYA 2Z59B 3W5VB 4E3CA 3N20C 4MJSA 3X23A 2IPKD 1E7UA 2YEPF 1EO6A 1VLBA 1J7CA 2NTSA 4IDIA 1GB1A 2ZJDA 2MH7A 2QC8A 4DXFA 1L6UA 1ZPSA 4N59A 1UF0A 2LUMA 3LXFA 2J52A 2ZVOA 4ZDVA 4BKTA 3QJZA 2INPE 1E6EB 4I6LB 1JWAD 1OQQA 3MHSD 1HA5A 4BAXA 2KWUB 1PGAA 1AN8A 3RZWC 3W9CB 2KYWA 1WM3A 2WXLA 4W9DA 4MGKE 4S17A 1SSNA 4US8A 3IFWB 3NS1A 5C1ZA 4HRSA 2Y5CA 3E9SA 3UGBB 1YNTE 1OQRA 1B1ZA 1BUIC 1S3SG 4GDKB 3Q3MC 1ET9A 3HM3A 1IBXA 4JWUC 3VRBB 3QWZB 4W9EA 2PVOD 3E56A 2C7NB 3P2BA 2ZW0A 3B0AA 2MP2B 5T8IA 1FXIA 4GDLA 4YSXB 1KLUD 2WX1A 2BYTA 3MC0B 5I4DA 2M4NA 3VAWA 4GMVA 1FNVA 4GLSC 4HEA1 4MGYE 2OHFA 3Q3FA 2X38A 3SU8X 3UIOB 5FK9C 1NYRA 4JE3B 4RMAA 4ANXA 2MBOA 3L0WB 3MC9A 4BFRA 5JXVA 5G55A 5LNK1 3CF6E 4IC7B 1ZKHA 2DZKA 3AE4B 4RFBA 3SD5A 3RCZA 5CHWA 4WQOB 1KH0A 1B9RA 2KLGA 1CJEA 3P1MA 3ZNGC 4B0EA 4ZOHC 3DCGA 4LNIA 2IZVB 4DWFA 2WXKA 1QQRA 4ASWC 4JGHB 4NJ6A 1OQYA 2KJ6A 3KW5B 4AQ7A 1PGBA 5CHFA 4F1SA 1C1YB 2KC1A 3EECA 3HM6X 1VD2A 3SEBA 3AE3B 2RR9A 4IUMB 3KYDD 4B95A 2MRPA 1XLPA 3BZDB 1YQ4B 2C7HA 1V80A 1HE8A 3DVNV 3U52E 1C4PA 3ALBA 3N1ZC 4FN2A 5CTRC 2QEJC 5IOIA 4BKSD 1JWBD 2MHJA 4WAAA 2WDRB 2B76B 3LDZE 2MJDA 2KK8A 4KV2A 1QLBB 3PRMB 1L5PA 3L4PA 2J0MA 3CSFA 4IG7B 3R2IA 1WXSA 2RPVA 4BBNC 1F2RI 3T9LA 2HTME 4A6QA 4HJGE 2KDIA 2CU1A 5BMIA 3ABVB 2QHOA 1YD8U 3NG0A 1JQ4A 1ZXIA 4TSSA 3H1UA 3PREA 4S0RA 4YXDB 2W9NA 4II3B 3PGEA 4K7SA 3AU5A 1V8CA 3TSSA 1V1PB 4AWJA 3MJWA 2ZPNA 1V86A 2KJRA 2PW9A 2SEBD 2JZPA 2REXA 3BYYB 3WAMA 4K7WA 1WM2A 4ACFA 2L1AA 1SB3C 2EMTA 2D3CA 4NNJB 4JL9A 2DNFA 4HK2A 4L23A 4HJKA 4DK5A 2IGHA 2WWZA 1TYGB 4BKGA 2N9LA 3VTWA 3B2FA 3EFCA 3MTNB 1YN5A 2WP9B 1E7PB 4DDGD 5AZGA 3RNGC 3DHIC 3AEBB 2AL3A 2QMTA 5IN7A 3Q8CA 2BS3B 1KRHA 2Q5WD 2CS4A 2Z0EB 3EA6A 1FO4A 1EUVB 5FKAC 2C5LC 2XBBC 1KLVA 4B0MA 4FHKA 1ZOYB 2IO0B 4F7ZA 1KLGD 2WX0A 2LMCA 3GE3C 1VRAB 1GJZA 3BINA 2KMCA 3RI7C 4M00A 3NS8A 2JU6X 3A4SC 4RF0A 1L2NA 1RRBA 3V3XA 1C77A 1XEEA 1F2RC 2N9XA 3BVZA 4P6VF 3RNBC 4KZ0A 4NZLB 3BK2A 3HRDD 3APCA 2KVZA 4LDTB 2ZCBA 2RPQA 1WJUA 3RMKC 1JWSD 2V3SA 2KLCA 3AH7A 2BWES 3I9V1 4AOFA 3H8HA 1VDVA 3L54A 3QQ8B 4ZYSA 3BVMA 5EE3A 3ML9A 1TJEA 1CK1A 4KDIC 1WRIA 2MBHA 2V0GA 2LI5A 3A9JB 1ZDVA 3V62A 2A5UA 1V81A 1LO5D 2DAJA 2LJ5A 4L2YA 2XN9C 3LJ3A 4USAA 2UYZB 5EE9A 2ICIA 2JXTA 3DBHI 3ZKJC 4HDQA 3AE9B 4NQKE 2V3NA 4XWWA 4WWMA 1ZUD2 4A3PA 1PFDA 3P63A 4E71A 2DBYA 4GXBA 4AJYB 5H92C 1E8WA 1UGJA 2KOXA 3L17A 5CHVC 1ZP0B 1FCCC 2EKIA 3O13A 1HZ6A 2K39A 1N63A 3VUXA 4DQOC 3DBRI 2BB5A 2LGIA 1P0RA 4RH6A 4YTMB 4HPMB 4JPSA 2NBWB 1SGHA 4M0WB 3PS6A 2LUEA 2WXNA 4NJ7A 1NYQA 3EGRA 4IWQA 3U4EG 3VUYA 2DYMA 3SFDB 4ZHPA 3RFZB 2CU3A 3HVDA 3QA8A 1K53A 1TS5A 1GG3A 4P7IA 1FPYA 2J42A 3DBSA 1RFKA 1BMLC 2JZZA 3A4RA 5IO9A 3JSVA 3T3OA 1N5XA 5BO4B 2DAFA 1D4BA 1PQSA 4JLCA 2KTRB 2KX0A 1NI3A 3B1LX 3PZ7A 2J53A 1C4AA 2KDMA 2RGFA 3AM9A 1NENB 2L05A 5LXHA 2FAZA 3IT4B 2IYDB 1JMLA 2HJ8A 1WH3A 3LYYA 1H4RA 2XK5A 1WZ0A 3I63C 3OAWA 4GU2A 1L0XB 4ZRIA 1UGMA 3K9PB 2CJOA 2O6VD 1STEA 1WXVA 2AL6A 4A3OA 3RNCC 1F9JA 2N7EA 2JT4B 3PLUA 3I5JC 1FCLA 4M8MA 2B3AA 1T3QA 2BVCA 3NVWA 2BGFA 2FE8A 3AE2B 3R7QA 1FNUA 1SJHD 3ZGZA 2KZRA 4KGRA 3JVZX 3DWGC 2IGGA 4AUQC 1VZ7A 2K1FA 3IAM1 2OJRA 1WXAA 3A1QB 1WGKA 2GB1A 2CHXA 2QIEB 3P4SB 1TS3A 3ZUNA 3IT6B 4RGNA 3PRZA 5KHQA 3UIPB 1C78A 3NRZA 3UI3A 1TZOA 1TTNA 4A20A 1WRDB 4A9AA 4WWPA 3APFA 1RM6C 2M0AA 1ISNA 1FFVA 1SXTA 2J7QB 1Q5WB 2YVCA 3AE5B 2FIDA 3PRPB 4IW0A 3QK0A 4OHJA 1XCTL 4ICVA 5CX3A 3NUHB 1V97A 2C7MB 3ZLZA 1BXTA 1K51A 4I6PA 1IGDA 2VH2A 1E8XA 3C19A 4WWOA 2D3GA 3Q69A 2J4XA 3Q3JA 4N58A 4IM3A 4MH8A 1R7SA 3PTFC 2WXPA 2J0JA 3V6EB 3U8ZA 4J3OD 4GGQA 3VR8B 4MGIE 3Q8EA 4TQ1A 3ZJVA 2CR5A 2K0PA 2N9PC 3ZNID 4IKGA 2KDFB 2MBBB 1J7BA 4MELA 1I35A 4WQMA 1YQ3B 1WGDA 1K8RB 1N5WA 2PMVA 1JCKB 2MP2A 2RDHA 4XYCA 3HIZA 1E5WA 1AW7A 1YQBA 3NZUA 2L76A 5FR3A 4RCOA 2E6XA 3MFGA 1DOIA 4MM3B 2LHDA 1WXQA 1WX9A 3VH3B 1HTQA 5FR6A 2INCC 3BK1A 3VHTC 4RF1A 1FRRA 3NZSA 1J0GA 1P1AA 2G9HD 2GI9A 3HUIA 4FJVB 5DPWA 2M17A 1XXGA 1P7EA 2KN4A 2K8BA 2NR2A 2PIAA 5HI1A 3A33B 2WNMA 1D5MC 4TKNA 2VH1A 1YN3A 2DLBA 1F52A 4JX1C 2LVQA 1TKYA 1HQRD 2DZMA 5G5GA 1UBIA 3Q14C 2X8XX 2OEDA 1GC7A 3QX1A 3IAS1 4IWOA 4P1CC 3FILB 5JHAA 2VRRB 4GOCA 4EZLA 5G2NA 2D3AA 4MEMA 4E74A 2A4ZA 1P9DU 2NPTB 3S2AA 4DHJD 1N6ZA 2WXIA 3HVZA 3AE6B 1VZ6A 4FJYA 2K8CA 2HJ1A 1YJ1A 2ZCCA 1IGCA 2FCMA 3ZJTA 1MI0A 5EE1A 1RYJA 4RGTA 4ZRJA 2WHIA 4XE0A 1J8CA 2PE9A 1T6BX 4LNFA 3TJPA 4C4VB 1KJTA 4G50A 4M02A 4AP4C 3ZW3A 3GB1A 2DHZA 4W9GA 1DOYA 1WX8A 2DX5B 3RUIB 3FKYA 1V5OA 4W9FA 3PHWB 5E6JA 1N61A 2M0XA 4HXDA 2ZNVC 2NTTA 2IY0B 1FXAA 4EEWA 3URYA 4JQWC 1UH6A 2LD9A 1F1HA 2IY1B 1IBXB 2BYFA 3C8YA 1V1PA 1YJIA 2YEPB 3NOBA 2WXGA 5IKCM 1WSPA 3O65B 3PPAA 4GSWA 3GZNB 1WXMA 2HDEA 3M3JA 1PGXA 5AUKA 2ONQA 5C3JB 5D6JB 3AU4A 3TEYA 4RM8A 1EWYC 2DZIA 1SE2A 3TL5A 1WMHA 2D2QA 3CSTA 3H7PA 4QAYA 2VZKB 2JPHA 4XZ4A 1X1MA 2EELA 2M8SA 5C2TB 1CQVA 4KKJA 4YSZB 4W9LA 3Q3NC 1ET6A 2HE7A 3I3TB 1L7YA 4XWTA 4IM0A 2WXFA 1UWXA 2BYVE 3W2DA 1SE9A 3AEAB 3Q6BA 2PLPA 2Z0DB 2SAKA 3OJ3A 3NVVA 1NBFC 5IAAC 2O6VB 3AEGB 2LGXA 2JF5A 1FRDA 4HDOA 4TUUA 2G3QB 2BQQA 5AZHA 2WU2B 4HLEA 5GMVA 1YX5B 5KHOA 4ARIA 3PT2B 5E6OA 3EHVA 1TS4A 2N1VA 1T0SC 1SJED 2EKEC 2KN5A 4W9IA 3ECIA 4EFOA 1H8CA 1QKZA 4F8CB 2BB6A 2KO3A 3ZTCA 1J7AA 1GB4A 2KC2A 1CMXB 1C79A 2L0FA 1WGHA 1JRPA 3QHTA 2WYQA 2QSDA 4WURA 4HROA 3PSEB 3EUB2 3QIJA 2JZ3B 1WR6E 1P98A 2JYEA 3AN1A 2MBQA 1HXYD 2KFKA 2LVOA 1E7VA 1P3QU 1Z5SB 2WXJA 4OZBA 4ANUA 1XD3B 2LVPA 2NMQA 1SBBB 2O2VA 2N9EB 2KT7A 3JYUA 3NVZA 3DBRB 2BWFA 2WXMA 4ZYNA 1JRUA 3CWIA 1EF5A 1ACCA 3U30A 3DBLI 4Q2JA 2K6QA 1N62A 2KX3A 4RGMA 1WYGA 3VTUA 2CHZA 2ZZPB 1CZPA 1WWTA 2Z8LA 2BW2A 1GC6A 3ZQ4A 3KWVA 2LXAA 5EDSA 3WAPA 4C80A 2PVGC 3ML8A 3PZDA 3N1YC 3N1XC 3PLVA 1UNSA 3NHEB 4A8XC 4FHJA 2V9HA 1E10A 2WLBA 1SEBD 3CIRB 1AWDA 1WGGA 3FC4A 1VZ8A 1HEZE 2INNE 1OEYJ 2HD5B 2CJNA 3VR9B 2H88B 2J0KA 3HHMA 1QT9A 3ONSA 3ETRA 1C76A 2D5GA 4HPPA 4JIOU 2NCNA 3GE8C 4C00A 2KTRA 1SIJA 1FEHA 4KX6B 4XGAB 3V6CB 3K9OB 2KMMA 1YX6B 5HFYA 1OTRB 2I1JA 1XO3A 3TBLD 3ZXRA 3ZIMA 1E0ZA 1YIWA 2G4DB 2MLBA 1JROA 4XX5A 1MJDA 4W9KA 3WANA 4K1RB 3W5UB 2GBJA 2RDGA 1LQBA 1WJ6A 3WAOA 5D3DA 4FJZA 4LJPB 2W3RA 1UZXB 4ITKA 2V1YA 3U7ZA 2AWTA 2BS4B 2VZKD 3AV8A 2MX2A 4DHJB 3U7DA 1R4MI 1T0YA 5D3IB 3EFUA 4UDUC 2KFJA 4NQLB 2WXHA 1AYFA 3DVNU 3BVGA 1ZW7A 2RSUA 2MCNB 4KGSA 1NDDA 1TKEA 2KQSA 2L3ZA 3VRAB 2KDBA 3HK0A 4HWIB 3PO0A 4B9KA 3B2GA 1VCBA 3AECB 2EMSA 4N6EB 4LNKA 1MHXA 3DOWA 1DOXA 2N4FA 1XT9B 2DYOA 4P1BC 1TKGA 4NPNA 4MACA 1D6EC 2ZEQA 1FM0D 3GP7A 2RMMA 2I1KA 3JW0X 2C9WB 4CYEA 3H6NA 1TIFA 3GS2A 3QCAA 3RD2A 4KKIA 3KH0A 1KOTA 4R3DA 2JUOA 2AQ3B 2GMIC 3ZNHB 3A9KA 2KDEB 2KACA 2QJLA 4TV3A 4URKA 1PUTA 2N7DA 4WJNA 3R7RA 1RAXA 2KKCA 1GAQB 2LZ6A 4ZRKA 2KWVB 3VQIA 2WXRA 1QOAA 4X57B 1Q0WB 4LK0M 1Z2MA 2AYOB 3DQVA 3J9CA 4ZRPA 3T8MA 3FAHA 4BOSC 2BPSA 4NAWA 4PYZA 1V6EA 4KSKC 2ZNVB 5D7GA 1I4QA
chains in the Genus database with same CATH topology
2FUHB 2O2VB 3KYCD 4K7WA 1WM2A 4FJYA 3ZDTA 3DVGX 1V2YA 2K8CA 1YJ1A 2AEHA 5E6PA 2ZCCA 4I6NB 4AJWA 2EMTA 1LXDA 1LM8B 4NNJB 4JL9A 2FCMA 4LJOB 4HK2A 1WY8A 3M95A 3TCAA 3ZDMC 4HJKA 4DK5A 2WWZA 4BKGA 3TMPB 4CO7A 3VTWA 4MM3A 3CMMB 4ZRJA 3MTNB 1J8CA 1XQQA 2PE9A 5DPTA 4DDGD 1M94A 1RLFA 5AZGA 3TJPA 5C23A 1KJTA 2AL3A 4G50A 2D07B 3H7SA 3ZW3A 4AP4C 4NY0A 2DHZA 4W9GA 1WX8A 2CS4A 2DX5B 2Z0EB 3N30A 3RUIB 2IO2B 2GBKA 2ZPYA 1TZ1A 1V5OA 4W9FA 3PHWB 1EUVB 2LRWA 4EUTA 2C5LC 2XBBC 2D10A 2M0XA 4HXDA 2KJHB 1KLVA 2ZNVC 1GUAB 3IBEA 1J19A 4DBGA 4FHKA 4GDKA 2IO0B 4F7ZA 3VXWA 2IY0B 3WIMA 1WX7A 3PHXB 4EEWA 2WX0A 2JXXA 2N1WA 4JQWC 4KSLC 5TR5A 1UH6A 2LD9A 4DHZE 3PV1A 3UQBA 2LXCA 3A1QA 4BKSA 5DCNA 1GJZA 3BINA 2IY1B 2KMCA 4HCNB 2BYFA 2FCQA 2YLMA 2LRUA 3NY5A 1OGWA 4KDLB 3X0WA 1WIAA 3NS8A 2ZVNA 3A4SC 3PVLA 1WR1A 2RD0A 3N32A 5J18A 2NS5A 1L2NA 3NOBA 1RRBA 1TGZB 4EKUA 1WJ4A 2NPTA 2N9XA 3O65B 3PPAA 4GSWA 4PYUA 1KM7A 1WXMA 3M3JA 1I42A 2KD0A 2IO1B 1WZ3A 4KZ0A 5DPRA 5D6JB 3RYTA 3AU4A 4BBNF 4RM8A 4W9HA 3APCA 3IG3A 3KUDB 4LDTB 5J2RA 2DZIA 3TL5A 1WMHA 2ZCBA 2BF8B 1QZEA 2D2QA 2RPQA 1WJUA 3CSTA 3H7PA 4WWNA 3ZO5B 4TQ0A 5JZEB 4II2B 2V3SA 2KLCA 4BVUC 2JPHA 3SHQA 4DDID 2BWES 3BY4B 1X1MA 4XZ4A 1AARA 4AOFA 2M8SA 2KHWB 2HTHA 2PPHA 3L54A 3QQ8B 4EZKA 4W9LA 3VDZA 3ML9A 4IWPA 2PJHA 4KDIC 4RM9A 3SDLC 5J17A 2MBHA 2MA9B 2LI5A 2D11A 3OLMD 2KWCA 3A9JB 2HE7A 3I3TB 3V62A 2A5UA 1V81A 2DAJA 2XEWA 3ZNZB 1L7YA 2C60A 2LJ5A 1IP9A 4IM0A 4PS7A 3R3MA 2KTFA 3D32A 3V60A 2KNBA 2JWZA 3LJ3A 5AZFA 4YL8A 4ANWA 2G4SA 2BYVE 2L7RA 5L83A 4BOZB 2UYZB 3APDA 1SE9A 5D2MB 2PE6B 4ICUA 3ENEA 3JSVB 3DBHI 5JHBA 1D3ZA 2Z0DB 1FXTB 4PS8A 2FCSA 1C3TA 3ZKJC 4HDQA 3GOEA 2LGDA 3OJ3A 4NQKE 4K81A 3W1SC 1NBFC 5IAAC 4KIKB 2KMAA 4GB9A 2O6VB 2LGXA 4A3PA 2JF5A 5LXIB 1V49A 3AI5A 4G3XB 4HDOA 4TUUA 2MBEA 4E71A 4GXBA 4AJYB 4GIVA 2G3QB 4MJSB 1R4NI 1E8WA 3VH4B 2KOXA 5AZHA 3L17A 5CHVC 4EZJA 4HLEA 5GMVA 3C0RB 1YX5B 5KHOA 3PT2B 5E6OA 3EHVA 2XK5B 1UD7A 2N1VA 2K39A 2EKEC 2KN5A 4W9IA 3L16A 2G45B 3VUXA 3ECIA 3RZFA 2ASQA 4OVVA 2R2QA 3WALA 4EFOA 1H8CA 1S1QB 3DBRI 2GBMA 5JH5C 4F8CB 2KO3A 2LGYA 1RFAA 1P0RA 4CHKA 4WJOA 3ZTCA 1MG8A 2V4LA 3KUCB 2LWPA 2KC2A 3IVFA 3L13A 4HPMB 1E90A 4W9CA 1CMXB 2NBWB 1SGHA 4IM2A 1V5TA 4M0WB 3PS6A 2L0FA 4MDKE 3VVWB 1WGHA 1WF9A 3W1YA 4ANVA 2LUEA 1WYWB 4WJQA 3AXCA 3A9KB 1LFDA 4NJ7A 3QHTA 2WYQA 1IPGA 2KANA 3PSEB 3RT3B 4LDTD 4IWQA 5IA7A 3M63B 3QIJA 2JZ3B 1WR6E 1P98A 3UQAA 3VUYA 2MQJA 1Q1OA 2DYMA 4DXAB 3KUZA 1EF1A 2MBQA 1NI2A 4HPLB 3QA8A 1GG3A 4P7IA 4LCDE 2KFKA 3DBSA 2LVOA 2PEAA 1WJNA 1E7VA 2JRIB 2JZZA 3A4RA 1SIFA 1P3QU 3JSVA 3UF8A 1Z5SB 2IBIB 1GNUA 2BKFA 5BO4B 2DAFA 4ANUA 1XD3B 1PQSA 4GDLB 2LVPA 4JLCA 2KTRB 4NAWB 2O2VA 4KIKA 4DHZB 2KX0A 2N9EB 2O6VA 3JYUA 1ZGUB 4GN1A 1IYFA 3B1LX 1OEYA 2BYEA 2Z59B 2BWFA 2RGFA 4ZYNA 1JRUA 1EF5A 2L05A 2FAZA 2JRHA 5LXHA 4E3CA 3U30A 3DBLI 4MJSA 5D94A 3X23A 2IYDB 2K8HA 1E7UA 3WA0A 1EO6A 2K6QA 2HJ8A 1WH3A 2ZJDA 3VUWA 1H4RA 2XK5A 1WZ0A 2KX3A 3KVFB 4HCPB 3OAWA 3VTUA 2CHZA 4GU2A 2ZZPB 2NBUA 2ZVOA 4ZDVA 4ZRIA 1UGMA 4BKTA 1GC6A 3QJZA 3K9PB 4I6LB 2O6VD 2LXAA 5EDSA 3WAPA 1WXVA 2AL6A 4FLHA 4A3OA 3MHSD 4KZCA 1F9JA 2N7EA 2UWQA 2JT4B 3PLUA 2KWUB 3ML8A 2K6DB 3PZDA 3RZWC 3ZRFA 4M8MA 3PLVA 1WM3A 2B3AA 3NHEB 4W9DA 3N3KB 4FHJA 1U4AA 4MGKE 2BGFA 2DZJA 2FCNA 3IFWB 2K25A 3R66C 1G6JA 5C1ZA 3R7QA 3AULA 3UGBB 2OOBB 5LLIA 2KZRA 2L00B 2L0TA 4G0NB 1S3SG 2KXJA 4GDKB 1WGGA 3HM3A 3JVZX 2JY6A 4FA6A 4EOYA 4AUQC 2K1FA 4FADA 3QWZB 4W9EA 2OJRA 1WXAA 3A1QB 1OEYJ 4B6WA 3DDCB 2C7NB 2CHXA 2HD5B 3P2BA 2M1MA 2J0KA 3VFKA 3HHMA 3B0AA 3ZUNA 2MP2B 3ONSA 3PRZA 5KHQA 3UIPB 2NCNA 4GDLA 4JIOU 2GOWA 2KVRA 1TTNA 2KTRA 4A20A 1WRDB 2WX1A 2MWSB 4WWPA 3APFA 4HVBA 2M4NA 3VAWA 4GMVA 3V6CB 1ISNA 3K9OB 1YX6B 3B08A 4MGYE 3IHPC 1OTRB 1WE7A 2I1JA 3W1SA 2J7QB 1Y8RC 2L8JA 3Q3FA 3SU8X 3TBLD 1Q5WB 3UIOB 3ZIMA 1WMHB 1YIWA 2YVCA 4M8NA 2G4DB 2FIDA 3H7PB 2MBOA 2MLBA 4RMAA 4XX5A 4W9KA 4ANXA 3PRPB 2WDTB 3L0WB 5AEKB 3WANA 4IW0A 4K1RB 3QAQA 3QK0A 4BFRA 4MGZE 4ICVA 2GBJA 3QC8B 3CF6E 5CX3A 5G55A 2GBRA 1UELA 1ZKHA 4IC7B 1LQBA 2DZKA 1WJ6A 1TBEA 3GZNI 2FNJB 3SD5A 2C7MB 3WAOA 3RCZA 5HKHA 4FJZA 5CHWA 3ZLZA 4LJPB 4WQOB 1WFYA 1UZXB 3A9JA 2V1YA 4I6PA 4WWOA 2KLGA 1E8XA 2D3GA 2AWTA 2NVUI 3Q3JA 3ZNGC 2MX2A 4DHJB 3U7DA 1WE6A 3DCGA 1R4MI 1T0YA 3EFUA 2IZVB 1A5RA 4MH0E 4IM3A 2KFJA 4DWFA 4NQLB 4ASWC 4JGHB 3DVNU 3PTFC 4NJ6A 1ZW7A 2RSUA 2Y5BB 2MCNB 2J0JA 3V6EB 3U8ZA 1OQYA 4GGQA 2KJ6A 1NDDA 4MGIE 3RULA 3KW5B 2KQSA 4TQ1A 2L3ZA 4KVGB 2KDBA 3HK0A 4XC2A 1C1YB 5CHFA 4HWIB 2CR5A 2N9PC 4G11A 4B9KA 2KC1A 3EECA 3HM6X 1VD2A 3ZNID 5E6NA 2KDFB 2MBBB 3ZRCA 4MELA 1VCBA 1I35A 2RR9A 2EMSA 4IUMB 4J6IA 1WGDA 1K8RB 4MSMB 1WGYA 1WI0A 3M62B 4WJPA 3DOWA 3KYDD 2MP2A 4B95A 2MRPA 3L10B 2N4FA 1V9JA 1XT9B 2NBVB 2DYOA 3HIZA 3ZTDA 2C7HA 1E5WA 3UINB 1YQBA 5L95C 3NZUA 1V80A 3VTVA 2CHWA 1HE8A 3DVNV 1BT0A 4NPNA 2ZEQA 4FN2A 3ALBA 2MW5A 5CTRC 2L76A 5DPSA 4PS3A 2I1KA 3EC8A 3JW0X 2C9WB 4BKSD 4CYEA 3H6NA 1WX9A 3OJ4B 3VH3B 3QCAA 2KQ7A 1E8YA 5FR6A 3VHTC 3RD2A 4N9F4 4WAAA 3NZSA 3KH0A 1KOTA 1J0GA 1P1AA 3LDZE 3H9DA 4FJVB 2JUOA 1E8ZA 2KK8A 4KV2A 5DPWA 2M17A 2GMIC 3ZNHB 2KDEB 2K8BA 2NR2A 3A9KA 3PRMB 2J0MA 3A33B 3CSFA 4IG7B 4TV3A 4W9JA 3V61A 1WXSA 4TKNA 4URKA 2DENB 2N7DA 4WJNA 4BBNC 2BKRB 3R7RA 1RAXA 2KKCA 2LVQA 3T9LA 2DZMA 2LASA 4OVUA 1UBIA 2LZ6A 2KDIA 2CU1A 4ZRKA 2KWVB 1UBQA 1YD8U 2IO3B 2FIFA 2QHOA 3VQIA 3ZVVA 4F1SA 3H1UA 3PREA 4X57B 1GC7A 1Q0WB 3QX1A 3DPDA 1Z2MA 4K7UA 2AYOB 2W9NA 3DQVA 4II3B 4IWOA 3PGEA 4K7SA 3AU5A 3DVGY 3T8MA 4MSQB 4FBJB 2KFKB 5JHAA 4AWJA 2VRRB 4GOCA 4EZLA 5G2NA 3MJWA 2ZPNA 3TIXA 1V86A 2KJRA 2GBNA 3L08A 2JVCA 1WGRA 4BOSC 2BPSA 4MEMA 4E74A 2A4ZA 2DYBA 1P9DU 4NAWA 4PYZA 1V6EA 2R2OA 2MSED 4FULA 4KSKC 2CKHB 2NPTB 3QARA 2ZNVB 2REXA 5D7GA 3S2AA 3WAMA 4DHJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUH B;  2O2V B;  3KYC D;  4K7W A;  1WM2 A;  4FJY A;  3ZDT A;  3DVG X;  1V2Y A;  2K8C A;  1YJ1 A;  2AEH A;  5E6P A;  2ZCC A;  4I6N B;  4AJW A;  2EMT A;  1LXD A;  1LM8 B;  4NNJ B;  4JL9 A;  2FCM A;  4LJO B;  4HK2 A;  1WY8 A;  3M95 A;  3TCA A;  3ZDM C;  4HJK A;  4DK5 A;  2WWZ A;  4BKG A;  3TMP B;  4CO7 A;  3VTW A;  4MM3 A;  3CMM B;  4ZRJ A;  3MTN B;  1J8C A;  1XQQ A;  2PE9 A;  5DPT A;  4DDG D;  1M94 A;  1RLF A;  5AZG A;  3TJP A;  5C23 A;  1KJT A;  2AL3 A;  4G50 A;  2D07 B;  3H7S A;  3ZW3 A;  4AP4 C;  4NY0 A;  2DHZ A;  4W9G A;  1WX8 A;  2CS4 A;  2DX5 B;  2Z0E B;  3N30 A;  3RUI B;  2IO2 B;  2GBK A;  2ZPY A;  1TZ1 A;  1V5O A;  4W9F A;  3PHW B;  1EUV B;  2LRW A;  4EUT A;  2C5L C;  2XBB C;  2D10 A;  2M0X A;  4HXD A;  2KJH B;  1KLV A;  2ZNV C;  1GUA B;  3IBE A;  1J19 A;  4DBG A;  4FHK A;  4GDK A;  2IO0 B;  4F7Z A;  3VXW A;  2IY0 B;  3WIM A;  1WX7 A;  3PHX B;  4EEW A;  2WX0 A;  2JXX A;  2N1W A;  4JQW C;  4KSL C;  5TR5 A;  1UH6 A;  2LD9 A;  4DHZ E;  3PV1 A;  3UQB A;  2LXC A;  3A1Q A;  4BKS A;  5DCN A;  1GJZ A;  3BIN A;  2IY1 B;  2KMC A;  4HCN B;  2BYF A;  2FCQ A;  2YLM A;  2LRU A;  3NY5 A;  1OGW A;  4KDL B;  3X0W A;  1WIA A;  3NS8 A;  2ZVN A;  3A4S C;  3PVL A;  1WR1 A;  2RD0 A;  3N32 A;  5J18 A;  2NS5 A;  1L2N A;  3NOB A;  1RRB A;  1TGZ B;  4EKU A;  1WJ4 A;  2NPT A;  2N9X A;  3O65 B;  3PPA A;  4GSW A;  4PYU A;  1KM7 A;  1WXM A;  3M3J A;  1I42 A;  2KD0 A;  2IO1 B;  1WZ3 A;  4KZ0 A;  5DPR A;  5D6J B;  3RYT A;  3AU4 A;  4BBN F;  4RM8 A;  4W9H A;  3APC A;  3IG3 A;  3KUD B;  4LDT B;  5J2R A;  2DZI A;  3TL5 A;  1WMH A;  2ZCB A;  2BF8 B;  1QZE A;  2D2Q A;  2RPQ A;  1WJU A;  3CST A;  3H7P A;  4WWN A;  3ZO5 B;  4TQ0 A;  5JZE B;  4II2 B;  2V3S A;  2KLC A;  4BVU C;  2JPH A;  3SHQ A;  4DDI D;  2BWE S;  3BY4 B;  1X1M A;  4XZ4 A;  1AAR A;  4AOF A;  2M8S A;  2KHW B;  2HTH A;  2PPH A;  3L54 A;  3QQ8 B;  4EZK A;  4W9L A;  3VDZ A;  3ML9 A;  4IWP A;  2PJH A;  4KDI C;  4RM9 A;  3SDL C;  5J17 A;  2MBH A;  2MA9 B;  2LI5 A;  2D11 A;  3OLM D;  2KWC A;  3A9J B;  2HE7 A;  3I3T B;  3V62 A;  2A5U A;  1V81 A;  2DAJ A;  2XEW A;  3ZNZ B;  1L7Y A;  2C60 A;  2LJ5 A;  1IP9 A;  4IM0 A;  4PS7 A;  3R3M A;  2KTF A;  3D32 A;  3V60 A;  2KNB A;  2JWZ A;  3LJ3 A;  5AZF A;  4YL8 A;  4ANW A;  2G4S A;  2BYV E;  2L7R A;  5L83 A;  4BOZ B;  2UYZ B;  3APD A;  1SE9 A;  5D2M B;  2PE6 B;  4ICU A;  3ENE A;  3JSV B;  3DBH I;  5JHB A;  1D3Z A;  2Z0D B;  1FXT B;  4PS8 A;  2FCS A;  1C3T A;  3ZKJ C;  4HDQ A;  3GOE A;  2LGD A;  3OJ3 A;  4NQK E;  4K81 A;  3W1S C;  1NBF C;  5IAA C;  4KIK B;  2KMA A;  4GB9 A;  2O6V B;  2LGX A;  4A3P A;  2JF5 A;  5LXI B;  1V49 A;  3AI5 A;  4G3X B;  4HDO A;  4TUU A;  2MBE A;  4E71 A;  4GXB A;  4AJY B;  4GIV A;  2G3Q B;  4MJS B;  1R4N I;  1E8W A;  3VH4 B;  2KOX A;  5AZH A;  3L17 A;  5CHV C;  4EZJ A;  4HLE A;  5GMV A;  3C0R B;  1YX5 B;  5KHO A;  3PT2 B;  5E6O A;  3EHV A;  2XK5 B;  1UD7 A;  2N1V A;  2K39 A;  2EKE C;  2KN5 A;  4W9I A;  3L16 A;  2G45 B;  3VUX A;  3ECI A;  3RZF A;  2ASQ A;  4OVV A;  2R2Q A;  3WAL A;  4EFO A;  1H8C A;  1S1Q B;  3DBR I;  2GBM A;  5JH5 C;  4F8C B;  2KO3 A;  2LGY A;  1RFA A;  1P0R A;  4CHK A;  4WJO A;  3ZTC A;  1MG8 A;  2V4L A;  3KUC B;  2LWP A;  2KC2 A;  3IVF A;  3L13 A;  4HPM B;  1E90 A;  4W9C A;  1CMX B;  2NBW B;  1SGH A;  4IM2 A;  1V5T A;  4M0W B;  3PS6 A;  2L0F A;  4MDK E;  3VVW B;  1WGH A;  1WF9 A;  3W1Y A;  4ANV A;  2LUE A;  1WYW B;  4WJQ A;  3AXC A;  3A9K B;  1LFD A;  4NJ7 A;  3QHT A;  2WYQ A;  1IPG A;  2KAN A;  3PSE B;  3RT3 B;  4LDT D;  4IWQ A;  5IA7 A;  3M63 B;  3QIJ A;  2JZ3 B;  1WR6 E;  1P98 A;  3UQA A;  3VUY A;  2MQJ A;  1Q1O A;  2DYM A;  4DXA B;  3KUZ A;  1EF1 A;  2MBQ A;  1NI2 A;  4HPL B;  3QA8 A;  1GG3 A;  4P7I A;  4LCD E;  2KFK A;  3DBS A;  2LVO A;  2PEA A;  1WJN A;  1E7V A;  2JRI B;  2JZZ A;  3A4R A;  1SIF A;  1P3Q U;  3JSV A;  3UF8 A;  1Z5S B;  2IBI B;  1GNU A;  2BKF A;  5BO4 B;  2DAF A;  4ANU A;  1XD3 B;  1PQS A;  4GDL B;  2LVP A;  4JLC A;  2KTR B;  4NAW B;  2O2V A;  4KIK A;  4DHZ B;  2KX0 A;  2N9E B;  2O6V A;  3JYU A;  1ZGU B;  4GN1 A;  1IYF A;  3B1L X;  1OEY A;  2BYE A;  2Z59 B;  2BWF A;  2RGF A;  4ZYN A;  1JRU A;  1EF5 A;  2L05 A;  2FAZ A;  2JRH A;  5LXH A;  4E3C A;  3U30 A;  3DBL I;  4MJS A;  5D94 A;  3X23 A;  2IYD B;  2K8H A;  1E7U A;  3WA0 A;  1EO6 A;  2K6Q A;  2HJ8 A;  1WH3 A;  2ZJD A;  3VUW A;  1H4R A;  2XK5 A;  1WZ0 A;  2KX3 A;  3KVF B;  4HCP B;  3OAW A;  3VTU A;  2CHZ A;  4GU2 A;  2ZZP B;  2NBU A;  2ZVO A;  4ZDV A;  4ZRI A;  1UGM A;  4BKT A;  1GC6 A;  3QJZ A;  3K9P B;  4I6L B;  2O6V D;  2LXA A;  5EDS A;  3WAP A;  1WXV A;  2AL6 A;  4FLH A;  4A3O A;  3MHS D;  4KZC A;  1F9J A;  2N7E A;  2UWQ A;  2JT4 B;  3PLU A;  2KWU B;  3ML8 A;  2K6D B;  3PZD A;  3RZW C;  3ZRF A;  4M8M A;  3PLV A;  1WM3 A;  2B3A A;  3NHE B;  4W9D A;  3N3K B;  4FHJ A;  1U4A A;  4MGK E;  2BGF A;  2DZJ A;  2FCN A;  3IFW B;  2K25 A;  3R66 C;  1G6J A;  5C1Z A;  3R7Q A;  3AUL A;  3UGB B;  2OOB B;  5LLI A;  2KZR A;  2L00 B;  2L0T A;  4G0N B;  1S3S G;  2KXJ A;  4GDK B;  1WGG A;  3HM3 A;  3JVZ X;  2JY6 A;  4FA6 A;  4EOY A;  4AUQ C;  2K1F A;  4FAD A;  3QWZ B;  4W9E A;  2OJR A;  1WXA A;  3A1Q B;  1OEY J;  4B6W A;  3DDC B;  2C7N B;  2CHX A;  2HD5 B;  3P2B A;  2M1M A;  2J0K A;  3VFK A;  3HHM A;  3B0A A;  3ZUN A;  2MP2 B;  3ONS A;  3PRZ A;  5KHQ A;  3UIP B;  2NCN A;  4GDL A;  4JIO U;  2GOW A;  2KVR A;  1TTN A;  2KTR A;  4A20 A;  1WRD B;  2WX1 A;  2MWS B;  4WWP A;  3APF A;  4HVB A;  2M4N A;  3VAW A;  4GMV A;  3V6C B;  1ISN A;  3K9O B;  1YX6 B;  3B08 A;  4MGY E;  3IHP C;  1OTR B;  1WE7 A;  2I1J A;  3W1S A;  2J7Q B;  1Y8R C;  2L8J A;  3Q3F A;  3SU8 X;  3TBL D;  1Q5W B;  3UIO B;  3ZIM A;  1WMH B;  1YIW A;  2YVC A;  4M8N A;  2G4D B;  2FID A;  3H7P B;  2MBO A;  2MLB A;  4RMA A;  4XX5 A;  4W9K A;  4ANX A;  3PRP B;  2WDT B;  3L0W B;  5AEK B;  3WAN A;  4IW0 A;  4K1R B;  3QAQ A;  3QK0 A;  4BFR A;  4MGZ E;  4ICV A;  2GBJ A;  3QC8 B;  3CF6 E;  5CX3 A;  5G55 A;  2GBR A;  1UEL A;  1ZKH A;  4IC7 B;  1LQB A;  2DZK A;  1WJ6 A;  1TBE A;  3GZN I;  2FNJ B;  3SD5 A;  2C7M B;  3WAO A;  3RCZ A;  5HKH A;  4FJZ A;  5CHW A;  3ZLZ A;  4LJP B;  4WQO B;  1WFY A;  1UZX B;  3A9J A;  2V1Y A;  4I6P A;  4WWO A;  2KLG A;  1E8X A;  2D3G A;  2AWT A;  2NVU I;  3Q3J A;  3ZNG C;  2MX2 A;  4DHJ B;  3U7D A;  1WE6 A;  3DCG A;  1R4M I;  1T0Y A;  3EFU A;  2IZV B;  1A5R A;  4MH0 E;  4IM3 A;  2KFJ A;  4DWF A;  4NQL B;  4ASW C;  4JGH B;  3DVN U;  3PTF C;  4NJ6 A;  1ZW7 A;  2RSU A;  2Y5B B;  2MCN B;  2J0J A;  3V6E B;  3U8Z A;  1OQY A;  4GGQ A;  2KJ6 A;  1NDD A;  4MGI E;  3RUL A;  3KW5 B;  2KQS A;  4TQ1 A;  2L3Z A;  4KVG B;  2KDB A;  3HK0 A;  4XC2 A;  1C1Y B;  5CHF A;  4HWI B;  2CR5 A;  2N9P C;  4G11 A;  4B9K A;  2KC1 A;  3EEC A;  3HM6 X;  1VD2 A;  3ZNI D;  5E6N A;  2KDF B;  2MBB B;  3ZRC A;  4MEL A;  1VCB A;  1I35 A;  2RR9 A;  2EMS A;  4IUM B;  4J6I A;  1WGD A;  1K8R B;  4MSM B;  1WGY A;  1WI0 A;  3M62 B;  4WJP A;  3DOW A;  3KYD D;  2MP2 A;  4B95 A;  2MRP A;  3L10 B;  2N4F A;  1V9J A;  1XT9 B;  2NBV B;  2DYO A;  3HIZ A;  3ZTD A;  2C7H A;  1E5W A;  3UIN B;  1YQB A;  5L95 C;  3NZU A;  1V80 A;  3VTV A;  2CHW A;  1HE8 A;  3DVN V;  1BT0 A;  4NPN A;  2ZEQ A;  4FN2 A;  3ALB A;  2MW5 A;  5CTR C;  2L76 A;  5DPS A;  4PS3 A;  2I1K A;  3EC8 A;  3JW0 X;  2C9W B;  4BKS D;  4CYE A;  3H6N A;  1WX9 A;  3OJ4 B;  3VH3 B;  3QCA A;  2KQ7 A;  1E8Y A;  5FR6 A;  3VHT C;  3RD2 A;  4N9F 4;  4WAA A;  3NZS A;  3KH0 A;  1KOT A;  1J0G A;  1P1A A;  3LDZ E;  3H9D A;  4FJV B;  2JUO A;  1E8Z A;  2KK8 A;  4KV2 A;  5DPW A;  2M17 A;  2GMI C;  3ZNH B;  2KDE B;  2K8B A;  2NR2 A;  3A9K A;  3PRM B;  2J0M A;  3A33 B;  3CSF A;  4IG7 B;  4TV3 A;  4W9J A;  3V61 A;  1WXS A;  4TKN A;  4URK A;  2DEN B;  2N7D A;  4WJN A;  4BBN C;  2BKR B;  3R7R A;  1RAX A;  2KKC A;  2LVQ A;  3T9L A;  2DZM A;  2LAS A;  4OVU A;  1UBI A;  2LZ6 A;  2KDI A;  2CU1 A;  4ZRK A;  2KWV B;  1UBQ A;  1YD8 U;  2IO3 B;  2FIF A;  2QHO A;  3VQI A;  3ZVV A;  4F1S A;  3H1U A;  3PRE A;  4X57 B;  1GC7 A;  1Q0W B;  3QX1 A;  3DPD A;  1Z2M A;  4K7U A;  2AYO B;  2W9N A;  3DQV A;  4II3 B;  4IWO A;  3PGE A;  4K7S A;  3AU5 A;  3DVG Y;  3T8M A;  4MSQ B;  4FBJ B;  2KFK B;  5JHA A;  4AWJ A;  2VRR B;  4GOC A;  4EZL A;  5G2N A;  3MJW A;  2ZPN A;  3TIX A;  1V86 A;  2KJR A;  2GBN A;  3L08 A;  2JVC A;  1WGR A;  4BOS C;  2BPS A;  4MEM A;  4E74 A;  2A4Z A;  2DYB A;  1P9D U;  4NAW A;  4PYZ A;  1V6E A;  2R2O A;  2MSE D;  4FUL A;  4KSK C;  2CKH B;  2NPT B;  3QAR A;  2ZNV B;  2REX A;  5D7G A;  3S2A A;  3WAM A;  4DHJ D; 
#chains in the Genus database with same CATH topology
 3SFE B;  3KYC D;  3ZDT A;  2AEH A;  5E6P A;  1TT5 B;  4JWS C;  1YMH E;  4YWG G;  4LNO A;  1LM8 B;  1WY8 A;  3KWL A;  3M95 A;  3ZDM C;  1UWM A;  3I57 A;  2OJW A;  1MFW A;  4MM3 A;  4FXC A;  5DPT A;  1M94 A;  1RLF A;  5C23 A;  1Y56 A;  2D07 B;  1UUP A;  2ON8 A;  2TSS A;  4PK1 A;  5AUI A;  2WDQ B;  3AB5 A;  4NY0 A;  3ZYY X;  3N30 A;  2IO2 B;  2GBK A;  2ZPY A;  2LRW A;  4EUT A;  1NVI D;  4KGT A;  2E3T A;  4GDK A;  3MHZ A;  2H89 B;  3PZ8 A;  3PHX B;  2JX5 A;  4KSL C;  3PV1 A;  3TEW A;  2LXC A;  1ZDX A;  1M4V A;  2QCZ A;  4HCN B;  1K50 A;  2FCQ A;  2YLM A;  3X0W A;  3NY5 A;  1WIA A;  3PVL A;  2ZVN A;  3N32 A;  4EKU A;  1QOG A;  2N0S B;  2NPT A;  2KD0 A;  2IO1 B;  3NJT A;  3P4P B;  1WZ3 A;  4D2K A;  5BYQ A;  3RYT A;  2V4I B;  4W9H A;  3IG3 A;  5J2R A;  2BF8 B;  5JZE B;  4WWN A;  4TQ0 A;  4ZRQ A;  2W82 A;  4WIP A;  3SHQ A;  4DDI D;  3OWE B;  1AAR A;  2HTH A;  2WGS A;  4EZK A;  4C4V A;  4IWP A;  4RM9 A;  5J17 A;  2MA9 B;  2D11 A;  1L4Z B;  3OLM D;  2KWC A;  1IP9 A;  3ZNZ B;  2C60 A;  2N7J A;  3R3M A;  3V60 A;  4YTN B;  1T5X D;  1MVK A;  2JWZ A;  5BMH A;  5AZF A;  2G4S A;  2W54 A;  5L83 A;  2L7R A;  2KQ4 X;  2XNA C;  1E9M A;  2PTL A;  3APD A;  4MT5 A;  3R8B A;  2RDB C;  5D2M B;  1T0R C;  2PE6 B;  1KF6 B;  3ENE A;  5JHB A;  1D3Z A;  4PS8 A;  1XCQ L;  2FCS A;  1C3T A;  4P16 A;  3Q8A A;  4K81 A;  1PDX A;  4KIK B;  2KMA A;  4GB9 A;  1L6V A;  1TS2 A;  4OVZ A;  2I2Y A;  5LXI B;  4G3X B;  3AI5 A;  3OG5 A;  4DXG A;  4YSY B;  1ZE3 D;  4MJS B;  1R4N I;  3VH4 B;  2AQ1 B;  3C0R B;  3RN9 C;  1DGJ A;  3L16 A;  4C7Z A;  3RZF A;  2ASQ A;  4OVV A;  2QDF A;  2R2Q A;  2ZW1 A;  3WAL A;  3AE8 B;  1S1Q B;  1MG8 A;  2V4L A;  2LWP A;  3IVF A;  4W9C A;  4IM2 A;  1V5T A;  4MDK E;  3W1Y A;  1WF9 A;  4ANV A;  4WJQ A;  2KAN A;  4K3C A;  3KQ4 A;  4YTP B;  1Q1O A;  4DXA B;  1EF1 A;  1JWU D;  1YJJ A;  1EU3 A;  4LCD E;  2LFI A;  5IP4 D;  2PEA A;  5TSS A;  3IXS A;  3WCQ A;  4LLG M;  1SIF A;  1OFF A;  4A55 A;  1EM7 A;  2IBI B;  1GNU A;  1MHH E;  2WQY B;  4GDL B;  4ARC A;  2WXQ A;  4DHZ B;  2O6V A;  1ZGU B;  4GN1 A;  1FD6 A;  1KTK A;  2BYE A;  2JQR B;  2QIL A;  2JRH A;  3NZ3 A;  5D94 A;  2K8H A;  2K22 A;  3WA0 A;  3VUW A;  4A90 A;  3KVF B;  4NAM A;  1JW9 D;  4HCP B;  2L32 A;  2NBU A;  1EU4 A;  4FLH A;  4KZC A;  2UWQ A;  1DYQ A;  1QIL A;  2K6D B;  5HG2 A;  3ZRF A;  4OZA A;  3N3K B;  1U4A A;  2DZJ A;  2FCN A;  2K25 A;  3R66 C;  1L0V B;  1G6J A;  4EE2 A;  2BS2 B;  3AUL A;  1I4X A;  2OOB B;  5LLI A;  2L00 B;  4G0N B;  2L0T A;  2KXJ A;  1I7H A;  2JY6 A;  2LHE A;  4FA6 A;  4EOY A;  2LGS A;  3RPF C;  1ESF A;  4FAD A;  4OZC A;  2LJI A;  3DBL B;  4B6W A;  1FMA D;  1TY0 A;  3DDC B;  1SE4 A;  2M1M A;  3VFK A;  4XDD A;  3DHH C;  2AQ2 B;  2GOW A;  2KVR A;  3BWU D;  2MWS B;  4HVB A;  3TEZ A;  2I38 A;  3Q3O C;  1XF5 L;  3B08 A;  1LGR A;  3IHP C;  3W1S A;  1WE7 A;  2L8J A;  1Y8R C;  1WMH B;  4M8N A;  3H7P B;  2WDT B;  4YT0 B;  5AEK B;  1IUE A;  3QAQ A;  4MGZ E;  2M56 B;  3QC8 B;  1UEL A;  2GBR A;  5HKH A;  1TBE A;  3GZN I;  2FNJ B;  1VJK A;  2K9X A;  1F0Z A;  4HKZ E;  3DBH B;  1WFY A;  1A70 A;  3A9J A;  1XLO A;  4CQN A;  4LTU A;  2NVU I;  3AMZ A;  4HKQ A;  4ZHO A;  2BTE A;  1VR9 A;  1WE6 A;  1N60 A;  5BYS A;  2N9K A;  4MH0 E;  1A5R A;  4BZA A;  1RWS A;  1FIQ A;  2Y5B B;  5G5H A;  2BT6 A;  3RUL A;  3ZXV A;  4KVG B;  4XC2 A;  4G11 A;  4H2A A;  5E6N A;  3ZRC A;  4J6I A;  4MSM B;  1WGY A;  1WI0 A;  3M62 B;  4WJP A;  2GLS A;  3L10 B;  1T0Q C;  2FBW B;  1I4H A;  1V9J A;  2NBV B;  3ZTD A;  2M19 A;  3AEF B;  3UIN B;  5L95 C;  3LB8 C;  3VTV A;  2CHW A;  1BT0 A;  2GRI A;  1I4P A;  1YN4 A;  2MW5 A;  4IOI E;  5DPS A;  1V1O A;  4PS3 A;  3EC8 A;  2K3U A;  3OJ4 B;  4WAF A;  2KQ7 A;  1E8Y A;  3Q8F A;  4N9F 4;  1R4M B;  1MPE A;  3NVY A;  2LEK A;  4O1N A;  3H9D A;  1Q10 A;  4M0W A;  1E8Z A;  2V3P A;  4C7Y A;  4WH4 A;  2W55 A;  1GPX A;  4W9J A;  4RNA A;  3TUO A;  3V61 A;  2WDV B;  2DEN B;  2BKR B;  2JYT A;  2MJE A;  2LAS A;  4OVU A;  1HTO A;  3MC8 A;  2FIF A;  1UBQ A;  3ZVV A;  2IO3 B;  2D3B A;  1FFU A;  3DPD A;  4K7U A;  3ZJU A;  1XLQ A;  2K5P A;  1QF6 A;  4NJC A;  3DVG Y;  1C9F A;  4MSQ B;  4FBJ B;  2KFK B;  2KAJ A;  3TIX A;  1ROE A;  2GBN A;  3L08 A;  2JVC A;  1WGR A;  5HHD G;  4OW0 A;  2DYB A;  2R2O A;  3B9J A;  2MSE D;  4FUL A;  2CKH B;  3QAR A;  2IJ0 A;  2FUH B;  2O2V B;  2WS3 B;  3MJ5 A;  3DVG X;  1V2Y A;  1MG4 A;  4I6N B;  4AJW A;  1LXD A;  2R61 A;  2UU7 A;  4LJO B;  3MP9 A;  3RNF C;  3TCA A;  5EE0 A;  3Q2A C;  1PYW D;  1K52 A;  3TMP B;  4CO7 A;  3BYT B;  3CMM B;  2IGD A;  1XQQ A;  1XLN A;  3R2T A;  3H7S A;  1FNW A;  2G1E A;  4XDC A;  4PT5 A;  4TMA B;  1D5Z C;  1JAL A;  1TZ1 A;  1I4G A;  2BBC A;  2FUG 1;  2D10 A;  2KJH B;  3IBE A;  1GUA B;  1KFY B;  1J19 A;  4DBG A;  3VXW A;  3WIM A;  1WX7 A;  2Y5P A;  2JXX A;  2N1W A;  5TR5 A;  4DHZ E;  3UQB A;  3A1Q A;  4BKS A;  5DCN A;  3P4Q B;  1SE3 A;  4KDL B;  3SR6 A;  2LRU A;  1QOB A;  1OGW A;  4C56 C;  1WR1 A;  2RD0 A;  5J18 A;  2NS5 A;  4M01 A;  1TGZ B;  1WJ4 A;  4PYU A;  1KM7 A;  5BMG A;  5MPO A;  1I42 A;  3AE7 B;  5DPR A;  4BBN F;  3KUD B;  4LNN A;  2MJ3 A;  1QZE A;  3P4R B;  3ZO5 B;  4II2 B;  1C4C A;  4BVU C;  1I4R A;  3BY4 B;  1D5X C;  2KHW B;  2PPH A;  5BYR A;  5GXG B;  3TEX A;  3VDZ A;  1JWM D;  2L52 A;  2PJH A;  3SDL C;  2PKO A;  4K3B A;  2AX5 A;  3DWM A;  3AEE B;  2XEW A;  4PS7 A;  1P7F A;  2KTF A;  3D32 A;  1GOZ A;  2DWQ A;  2KNB A;  1EWC A;  4L1B A;  1F77 A;  4YL8 A;  4ANW A;  4BOZ B;  2L83 A;  4ICU A;  3JSV B;  1FXT B;  3KLS X;  3GOE A;  2LGD A;  3W1S C;  1ZXH A;  1V49 A;  2MBE A;  2KWD A;  2WXO A;  2WU5 B;  4GIV A;  4RGO S;  2MEK A;  4EZJ A;  2XK5 B;  2IND C;  3AE1 B;  1UD7 A;  2G45 B;  3N9Y C;  3P42 A;  3RNA C;  4US9 A;  5JH5 C;  2GBM A;  2LGY A;  1RFA A;  4CHK A;  4WJO A;  3KUC B;  1QOF A;  3L13 A;  1E90 A;  3DHG C;  3T3N A;  3VVW B;  1SF0 A;  5H8Y E;  1L0Y B;  1WYW B;  2IDY A;  3AXC A;  3A9K B;  2JSV X;  2JWU A;  3Q8B A;  1LFD A;  1IPG A;  1L4D B;  3RT3 B;  4LDT D;  5IA7 A;  3U2S C;  1NEK B;  2W3S A;  3M63 B;  3UQA A;  1YOV B;  2ACZ B;  2MQJ A;  3KUZ A;  1NI2 A;  4HPL B;  3AED B;  3FIL A;  3RNE C;  1WJN A;  2JRI B;  1R4N B;  3UF8 A;  2BKF A;  3V05 A;  1ENF A;  4REZ A;  1TY2 A;  4NAW B;  1HZ5 A;  4KIK A;  4AS1 A;  3BII D;  1IYF A;  2Y3A A;  1OEY A;  2Z59 B;  3W5V B;  4E3C A;  3N20 C;  4MJS A;  3X23 A;  2IPK D;  1E7U A;  2YEP F;  1EO6 A;  1VLB A;  1J7C A;  2NTS A;  4IDI A;  1GB1 A;  2ZJD A;  2MH7 A;  2QC8 A;  4DXF A;  1L6U A;  1ZPS A;  4N59 A;  1UF0 A;  2LUM A;  3LXF A;  2J52 A;  2ZVO A;  4ZDV A;  4BKT A;  3QJZ A;  2INP E;  1E6E B;  4I6L B;  1JWA D;  1OQQ A;  3MHS D;  1HA5 A;  4BAX A;  2KWU B;  1PGA A;  1AN8 A;  3RZW C;  3W9C B;  2KYW A;  1WM3 A;  2WXL A;  4W9D A;  4MGK E;  4S17 A;  1SSN A;  4US8 A;  3IFW B;  3NS1 A;  5C1Z A;  4HRS A;  2Y5C A;  3E9S A;  3UGB B;  1YNT E;  1OQR A;  1B1Z A;  1BUI C;  1S3S G;  4GDK B;  3Q3M C;  1ET9 A;  3HM3 A;  1IBX A;  4JWU C;  3VRB B;  3QWZ B;  4W9E A;  2PVO D;  3E56 A;  2C7N B;  3P2B A;  2ZW0 A;  3B0A A;  2MP2 B;  5T8I A;  1FXI A;  4GDL A;  4YSX B;  1KLU D;  2WX1 A;  2BYT A;  3MC0 B;  5I4D A;  2M4N A;  3VAW A;  4GMV A;  1FNV A;  4GLS C;  4HEA 1;  4MGY E;  2OHF A;  3Q3F A;  2X38 A;  3SU8 X;  3UIO B;  5FK9 C;  1NYR A;  4JE3 B;  4RMA A;  4ANX A;  2MBO A;  3L0W B;  3MC9 A;  4BFR A;  5JXV A;  5G55 A;  5LNK 1;  3CF6 E;  4IC7 B;  1ZKH A;  2DZK A;  3AE4 B;  4RFB A;  3SD5 A;  3RCZ A;  5CHW A;  4WQO B;  1KH0 A;  1B9R A;  2KLG A;  1CJE A;  3P1M A;  3ZNG C;  4B0E A;  4ZOH C;  3DCG A;  4LNI A;  2IZV B;  4DWF A;  2WXK A;  1QQR A;  4ASW C;  4JGH B;  4NJ6 A;  1OQY A;  2KJ6 A;  3KW5 B;  4AQ7 A;  1PGB A;  5CHF A;  4F1S A;  1C1Y B;  2KC1 A;  3EEC A;  3HM6 X;  1VD2 A;  3SEB A;  3AE3 B;  2RR9 A;  4IUM B;  3KYD D;  4B95 A;  2MRP A;  1XLP A;  3BZD B;  1YQ4 B;  2C7H A;  1V80 A;  1HE8 A;  3DVN V;  3U52 E;  1C4P A;  3ALB A;  3N1Z C;  4FN2 A;  5CTR C;  2QEJ C;  5IOI A;  4BKS D;  1JWB D;  2MHJ A;  4WAA A;  2WDR B;  2B76 B;  3LDZ E;  2MJD A;  2KK8 A;  4KV2 A;  1QLB B;  3PRM B;  1L5P A;  3L4P A;  2J0M A;  3CSF A;  4IG7 B;  3R2I A;  1WXS A;  2RPV A;  4BBN C;  1F2R I;  3T9L A;  2HTM E;  4A6Q A;  4HJG E;  2KDI A;  2CU1 A;  5BMI A;  3ABV B;  2QHO A;  1YD8 U;  3NG0 A;  1JQ4 A;  1ZXI A;  4TSS A;  3H1U A;  3PRE A;  4S0R A;  4YXD B;  2W9N A;  4II3 B;  3PGE A;  4K7S A;  3AU5 A;  1V8C A;  3TSS A;  1V1P B;  4AWJ A;  3MJW A;  2ZPN A;  1V86 A;  2KJR A;  2PW9 A;  2SEB D;  2JZP A;  2REX A;  3BYY B;  3WAM A;  4K7W A;  1WM2 A;  4ACF A;  2L1A A;  1SB3 C;  2EMT A;  2D3C A;  4NNJ B;  4JL9 A;  2DNF A;  4HK2 A;  4L23 A;  4HJK A;  4DK5 A;  2IGH A;  2WWZ A;  1TYG B;  4BKG A;  2N9L A;  3VTW A;  3B2F A;  3EFC A;  3MTN B;  1YN5 A;  2WP9 B;  1E7P B;  4DDG D;  5AZG A;  3RNG C;  3DHI C;  3AEB B;  2AL3 A;  2QMT A;  5IN7 A;  3Q8C A;  2BS3 B;  1KRH A;  2Q5W D;  2CS4 A;  2Z0E B;  3EA6 A;  1FO4 A;  1EUV B;  5FKA C;  2C5L C;  2XBB C;  1KLV A;  4B0M A;  4FHK A;  1ZOY B;  2IO0 B;  4F7Z A;  1KLG D;  2WX0 A;  2LMC A;  3GE3 C;  1VRA B;  1GJZ A;  3BIN A;  2KMC A;  3RI7 C;  4M00 A;  3NS8 A;  2JU6 X;  3A4S C;  4RF0 A;  1L2N A;  1RRB A;  3V3X A;  1C77 A;  1XEE A;  1F2R C;  2N9X A;  3BVZ A;  4P6V F;  3RNB C;  4KZ0 A;  4NZL B;  3BK2 A;  3HRD D;  3APC A;  2KVZ A;  4LDT B;  2ZCB A;  2RPQ A;  1WJU A;  3RMK C;  1JWS D;  2V3S A;  2KLC A;  3AH7 A;  2BWE S;  3I9V 1;  4AOF A;  3H8H A;  1VDV A;  3L54 A;  3QQ8 B;  4ZYS A;  3BVM A;  5EE3 A;  3ML9 A;  1TJE A;  1CK1 A;  4KDI C;  1WRI A;  2MBH A;  2V0G A;  2LI5 A;  3A9J B;  1ZDV A;  3V62 A;  2A5U A;  1V81 A;  1LO5 D;  2DAJ A;  2LJ5 A;  4L2Y A;  2XN9 C;  3LJ3 A;  4USA A;  2UYZ B;  5EE9 A;  2ICI A;  2JXT A;  3DBH I;  3ZKJ C;  4HDQ A;  3AE9 B;  4NQK E;  2V3N A;  4XWW A;  4WWM A;  1ZUD 2;  4A3P A;  1PFD A;  3P63 A;  4E71 A;  2DBY A;  4GXB A;  4AJY B;  5H92 C;  1E8W A;  1UGJ A;  2KOX A;  3L17 A;  5CHV C;  1ZP0 B;  1FCC C;  2EKI A;  3O13 A;  1HZ6 A;  2K39 A;  1N63 A;  3VUX A;  4DQO C;  3DBR I;  2BB5 A;  2LGI A;  1P0R A;  4RH6 A;  4YTM B;  4HPM B;  4JPS A;  2NBW B;  1SGH A;  4M0W B;  3PS6 A;  2LUE A;  2WXN A;  4NJ7 A;  1NYQ A;  3EGR A;  4IWQ A;  3U4E G;  3VUY A;  2DYM A;  3SFD B;  4ZHP A;  3RFZ B;  2CU3 A;  3HVD A;  3QA8 A;  1K53 A;  1TS5 A;  1GG3 A;  4P7I A;  1FPY A;  2J42 A;  3DBS A;  1RFK A;  1BML C;  2JZZ A;  3A4R A;  5IO9 A;  3JSV A;  3T3O A;  1N5X A;  5BO4 B;  2DAF A;  1D4B A;  1PQS A;  4JLC A;  2KTR B;  2KX0 A;  1NI3 A;  3B1L X;  3PZ7 A;  2J53 A;  1C4A A;  2KDM A;  2RGF A;  3AM9 A;  1NEN B;  2L05 A;  5LXH A;  2FAZ A;  3IT4 B;  2IYD B;  1JML A;  2HJ8 A;  1WH3 A;  3LYY A;  1H4R A;  2XK5 A;  1WZ0 A;  3I63 C;  3OAW A;  4GU2 A;  1L0X B;  4ZRI A;  1UGM A;  3K9P B;  2CJO A;  2O6V D;  1STE A;  1WXV A;  2AL6 A;  4A3O A;  3RNC C;  1F9J A;  2N7E A;  2JT4 B;  3PLU A;  3I5J C;  1FCL A;  4M8M A;  2B3A A;  1T3Q A;  2BVC A;  3NVW A;  2BGF A;  2FE8 A;  3AE2 B;  3R7Q A;  1FNU A;  1SJH D;  3ZGZ A;  2KZR A;  4KGR A;  3JVZ X;  3DWG C;  2IGG A;  4AUQ C;  1VZ7 A;  2K1F A;  3IAM 1;  2OJR A;  1WXA A;  3A1Q B;  1WGK A;  2GB1 A;  2CHX A;  2QIE B;  3P4S B;  1TS3 A;  3ZUN A;  3IT6 B;  4RGN A;  3PRZ A;  5KHQ A;  3UIP B;  1C78 A;  3NRZ A;  3UI3 A;  1TZO A;  1TTN A;  4A20 A;  1WRD B;  4A9A A;  4WWP A;  3APF A;  1RM6 C;  2M0A A;  1ISN A;  1FFV A;  1SXT A;  2J7Q B;  1Q5W B;  2YVC A;  3AE5 B;  2FID A;  3PRP B;  4IW0 A;  3QK0 A;  4OHJ A;  1XCT L;  4ICV A;  5CX3 A;  3NUH B;  1V97 A;  2C7M B;  3ZLZ A;  1BXT A;  1K51 A;  4I6P A;  1IGD A;  2VH2 A;  1E8X A;  3C19 A;  4WWO A;  2D3G A;  3Q69 A;  2J4X A;  3Q3J A;  4N58 A;  4IM3 A;  4MH8 A;  1R7S A;  3PTF C;  2WXP A;  2J0J A;  3V6E B;  3U8Z A;  4J3O D;  4GGQ A;  3VR8 B;  4MGI E;  3Q8E A;  4TQ1 A;  3ZJV A;  2CR5 A;  2K0P A;  2N9P C;  3ZNI D;  4IKG A;  2KDF B;  2MBB B;  1J7B A;  4MEL A;  1I35 A;  4WQM A;  1YQ3 B;  1WGD A;  1K8R B;  1N5W A;  2PMV A;  1JCK B;  2MP2 A;  2RDH A;  4XYC A;  3HIZ A;  1E5W A;  1AW7 A;  1YQB A;  3NZU A;  2L76 A;  5FR3 A;  4RCO A;  2E6X A;  3MFG A;  1DOI A;  4MM3 B;  2LHD A;  1WXQ A;  1WX9 A;  3VH3 B;  1HTQ A;  5FR6 A;  2INC C;  3BK1 A;  3VHT C;  4RF1 A;  1FRR A;  3NZS A;  1J0G A;  1P1A A;  2G9H D;  2GI9 A;  3HUI A;  4FJV B;  5DPW A;  2M17 A;  1XXG A;  1P7E A;  2KN4 A;  2K8B A;  2NR2 A;  2PIA A;  5HI1 A;  3A33 B;  2WNM A;  1D5M C;  4TKN A;  2VH1 A;  1YN3 A;  2DLB A;  1F52 A;  4JX1 C;  2LVQ A;  1TKY A;  1HQR D;  2DZM A;  5G5G A;  1UBI A;  3Q14 C;  2X8X X;  2OED A;  1GC7 A;  3QX1 A;  3IAS 1;  4IWO A;  4P1C C;  3FIL B;  5JHA A;  2VRR B;  4GOC A;  4EZL A;  5G2N A;  2D3A A;  4MEM A;  4E74 A;  2A4Z A;  1P9D U;  2NPT B;  3S2A A;  4DHJ D;  1N6Z A;  2WXI A;  3HVZ A;  3AE6 B;  1VZ6 A;  4FJY A;  2K8C A;  2HJ1 A;  1YJ1 A;  2ZCC A;  1IGC A;  2FCM A;  3ZJT A;  1MI0 A;  5EE1 A;  1RYJ A;  4RGT A;  4ZRJ A;  2WHI A;  4XE0 A;  1J8C A;  2PE9 A;  1T6B X;  4LNF A;  3TJP A;  4C4V B;  1KJT A;  4G50 A;  4M02 A;  4AP4 C;  3ZW3 A;  3GB1 A;  2DHZ A;  4W9G A;  1DOY A;  1WX8 A;  2DX5 B;  3RUI B;  3FKY A;  1V5O A;  4W9F A;  3PHW B;  5E6J A;  1N61 A;  2M0X A;  4HXD A;  2ZNV C;  2NTT A;  2IY0 B;  1FXA A;  4EEW A;  3URY A;  4JQW C;  1UH6 A;  2LD9 A;  1F1H A;  2IY1 B;  1IBX B;  2BYF A;  3C8Y A;  1V1P A;  1YJI A;  2YEP B;  3NOB A;  2WXG A;  5IKC M;  1WSP A;  3O65 B;  3PPA A;  4GSW A;  3GZN B;  1WXM A;  2HDE A;  3M3J A;  1PGX A;  5AUK A;  2ONQ A;  5C3J B;  5D6J B;  3AU4 A;  3TEY A;  4RM8 A;  1EWY C;  2DZI A;  1SE2 A;  3TL5 A;  1WMH A;  2D2Q A;  3CST A;  3H7P A;  4QAY A;  2VZK B;  2JPH A;  4XZ4 A;  1X1M A;  2EEL A;  2M8S A;  5C2T B;  1CQV A;  4KKJ A;  4YSZ B;  4W9L A;  3Q3N C;  1ET6 A;  2HE7 A;  3I3T B;  1L7Y A;  4XWT A;  4IM0 A;  2WXF A;  1UWX A;  2BYV E;  3W2D A;  1SE9 A;  3AEA B;  3Q6B A;  2PLP A;  2Z0D B;  2SAK A;  3OJ3 A;  3NVV A;  1NBF C;  5IAA C;  2O6V B;  3AEG B;  2LGX A;  2JF5 A;  1FRD A;  4HDO A;  4TUU A;  2G3Q B;  2BQQ A;  5AZH A;  2WU2 B;  4HLE A;  5GMV A;  1YX5 B;  5KHO A;  4ARI A;  3PT2 B;  5E6O A;  3EHV A;  1TS4 A;  2N1V A;  1T0S C;  1SJE D;  2EKE C;  2KN5 A;  4W9I A;  3ECI A;  4EFO A;  1H8C A;  1QKZ A;  4F8C B;  2BB6 A;  2KO3 A;  3ZTC A;  1J7A A;  1GB4 A;  2KC2 A;  1CMX B;  1C79 A;  2L0F A;  1WGH A;  1JRP A;  3QHT A;  2WYQ A;  2QSD A;  4WUR A;  4HRO A;  3PSE B;  3EUB 2;  3QIJ A;  2JZ3 B;  1WR6 E;  1P98 A;  2JYE A;  3AN1 A;  2MBQ A;  1HXY D;  2KFK A;  2LVO A;  1E7V A;  1P3Q U;  1Z5S B;  2WXJ A;  4OZB A;  4ANU A;  1XD3 B;  2LVP A;  2NMQ A;  1SBB B;  2O2V A;  2N9E B;  2KT7 A;  3JYU A;  3NVZ A;  3DBR B;  2BWF A;  2WXM A;  4ZYN A;  1JRU A;  3CWI A;  1EF5 A;  1ACC A;  3U30 A;  3DBL I;  4Q2J A;  2K6Q A;  1N62 A;  2KX3 A;  4RGM A;  1WYG A;  3VTU A;  2CHZ A;  2ZZP B;  1CZP A;  1WWT A;  2Z8L A;  2BW2 A;  1GC6 A;  3ZQ4 A;  3KWV A;  2LXA A;  5EDS A;  3WAP A;  4C80 A;  2PVG C;  3ML8 A;  3PZD A;  3N1Y C;  3N1X C;  3PLV A;  1UNS A;  3NHE B;  4A8X C;  4FHJ A;  2V9H A;  1E10 A;  2WLB A;  1SEB D;  3CIR B;  1AWD A;  1WGG A;  3FC4 A;  1VZ8 A;  1HEZ E;  2INN E;  1OEY J;  2HD5 B;  2CJN A;  3VR9 B;  2H88 B;  2J0K A;  3HHM A;  1QT9 A;  3ONS A;  3ETR A;  1C76 A;  2D5G A;  4HPP A;  4JIO U;  2NCN A;  3GE8 C;  4C00 A;  2KTR A;  1SIJ A;  1FEH A;  4KX6 B;  4XGA B;  3V6C B;  3K9O B;  2KMM A;  1YX6 B;  5HFY A;  1OTR B;  2I1J A;  1XO3 A;  3TBL D;  3ZXR A;  3ZIM A;  1E0Z A;  1YIW A;  2G4D B;  2MLB A;  1JRO A;  4XX5 A;  1MJD A;  4W9K A;  3WAN A;  4K1R B;  3W5U B;  2GBJ A;  2RDG A;  1LQB A;  1WJ6 A;  3WAO A;  5D3D A;  4FJZ A;  4LJP B;  2W3R A;  1UZX B;  4ITK A;  2V1Y A;  3U7Z A;  2AWT A;  2BS4 B;  2VZK D;  3AV8 A;  2MX2 A;  4DHJ B;  3U7D A;  1R4M I;  1T0Y A;  5D3I B;  3EFU A;  4UDU C;  2KFJ A;  4NQL B;  2WXH A;  1AYF A;  3DVN U;  3BVG A;  1ZW7 A;  2RSU A;  2MCN B;  4KGS A;  1NDD A;  1TKE A;  2KQS A;  2L3Z A;  3VRA B;  2KDB A;  3HK0 A;  4HWI B;  3PO0 A;  4B9K A;  3B2G A;  1VCB A;  3AEC B;  2EMS A;  4N6E B;  4LNK A;  1MHX A;  3DOW A;  1DOX A;  2N4F A;  1XT9 B;  2DYO A;  4P1B C;  1TKG A;  4NPN A;  4MAC A;  1D6E C;  2ZEQ A;  1FM0 D;  3GP7 A;  2RMM A;  2I1K A;  3JW0 X;  2C9W B;  4CYE A;  3H6N A;  1TIF A;  3GS2 A;  3QCA A;  3RD2 A;  4KKI A;  3KH0 A;  1KOT A;  4R3D A;  2JUO A;  2AQ3 B;  2GMI C;  3ZNH B;  3A9K A;  2KDE B;  2KAC A;  2QJL A;  4TV3 A;  4URK A;  1PUT A;  2N7D A;  4WJN A;  3R7R A;  1RAX A;  2KKC A;  1GAQ B;  2LZ6 A;  4ZRK A;  2KWV B;  3VQI A;  2WXR A;  1QOA A;  4X57 B;  1Q0W B;  4LK0 M;  1Z2M A;  2AYO B;  3DQV A;  3J9C A;  4ZRP A;  3T8M A;  3FAH A;  4BOS C;  2BPS A;  4NAW A;  4PYZ A;  1V6E A;  4KSK C;  2ZNV B;  5D7G A;  1I4Q A; 
#chains in the Genus database with same CATH homology
 2FUH B;  2O2V B;  3KYC D;  4K7W A;  1WM2 A;  4FJY A;  3ZDT A;  3DVG X;  1V2Y A;  2K8C A;  1YJ1 A;  2AEH A;  5E6P A;  2ZCC A;  4I6N B;  4AJW A;  2EMT A;  1LXD A;  1LM8 B;  4NNJ B;  4JL9 A;  2FCM A;  4LJO B;  4HK2 A;  1WY8 A;  3M95 A;  3TCA A;  3ZDM C;  4HJK A;  4DK5 A;  2WWZ A;  4BKG A;  3TMP B;  4CO7 A;  3VTW A;  4MM3 A;  3CMM B;  4ZRJ A;  3MTN B;  1J8C A;  1XQQ A;  2PE9 A;  5DPT A;  4DDG D;  1M94 A;  1RLF A;  5AZG A;  3TJP A;  5C23 A;  1KJT A;  2AL3 A;  4G50 A;  2D07 B;  3H7S A;  3ZW3 A;  4AP4 C;  4NY0 A;  2DHZ A;  4W9G A;  1WX8 A;  2CS4 A;  2DX5 B;  2Z0E B;  3N30 A;  3RUI B;  2IO2 B;  2GBK A;  2ZPY A;  1TZ1 A;  1V5O A;  4W9F A;  3PHW B;  1EUV B;  2LRW A;  4EUT A;  2C5L C;  2XBB C;  2D10 A;  2M0X A;  4HXD A;  2KJH B;  1KLV A;  2ZNV C;  1GUA B;  3IBE A;  1J19 A;  4DBG A;  4FHK A;  4GDK A;  2IO0 B;  4F7Z A;  3VXW A;  2IY0 B;  3WIM A;  1WX7 A;  3PHX B;  4EEW A;  2WX0 A;  2JXX A;  2N1W A;  4JQW C;  4KSL C;  5TR5 A;  1UH6 A;  2LD9 A;  4DHZ E;  3PV1 A;  3UQB A;  2LXC A;  3A1Q A;  4BKS A;  5DCN A;  1GJZ A;  3BIN A;  2IY1 B;  2KMC A;  4HCN B;  2BYF A;  2FCQ A;  2YLM A;  2LRU A;  3NY5 A;  1OGW A;  4KDL B;  3X0W A;  1WIA A;  3NS8 A;  2ZVN A;  3A4S C;  3PVL A;  1WR1 A;  2RD0 A;  3N32 A;  5J18 A;  2NS5 A;  1L2N A;  3NOB A;  1RRB A;  1TGZ B;  4EKU A;  1WJ4 A;  2NPT A;  2N9X A;  3O65 B;  3PPA A;  4GSW A;  4PYU A;  1KM7 A;  1WXM A;  3M3J A;  1I42 A;  2KD0 A;  2IO1 B;  1WZ3 A;  4KZ0 A;  5DPR A;  5D6J B;  3RYT A;  3AU4 A;  4BBN F;  4RM8 A;  4W9H A;  3APC A;  3IG3 A;  3KUD B;  4LDT B;  5J2R A;  2DZI A;  3TL5 A;  1WMH A;  2ZCB A;  2BF8 B;  1QZE A;  2D2Q A;  2RPQ A;  1WJU A;  3CST A;  3H7P A;  4WWN A;  3ZO5 B;  4TQ0 A;  5JZE B;  4II2 B;  2V3S A;  2KLC A;  4BVU C;  2JPH A;  3SHQ A;  4DDI D;  2BWE S;  3BY4 B;  1X1M A;  4XZ4 A;  1AAR A;  4AOF A;  2M8S A;  2KHW B;  2HTH A;  2PPH A;  3L54 A;  3QQ8 B;  4EZK A;  4W9L A;  3VDZ A;  3ML9 A;  4IWP A;  2PJH A;  4KDI C;  4RM9 A;  3SDL C;  5J17 A;  2MBH A;  2MA9 B;  2LI5 A;  2D11 A;  3OLM D;  2KWC A;  3A9J B;  2HE7 A;  3I3T B;  3V62 A;  2A5U A;  1V81 A;  2DAJ A;  2XEW A;  3ZNZ B;  1L7Y A;  2C60 A;  2LJ5 A;  1IP9 A;  4IM0 A;  4PS7 A;  3R3M A;  2KTF A;  3D32 A;  3V60 A;  2KNB A;  2JWZ A;  3LJ3 A;  5AZF A;  4YL8 A;  4ANW A;  2G4S A;  2BYV E;  2L7R A;  5L83 A;  4BOZ B;  2UYZ B;  3APD A;  1SE9 A;  5D2M B;  2PE6 B;  4ICU A;  3ENE A;  3JSV B;  3DBH I;  5JHB A;  1D3Z A;  2Z0D B;  1FXT B;  4PS8 A;  2FCS A;  1C3T A;  3ZKJ C;  4HDQ A;  3GOE A;  2LGD A;  3OJ3 A;  4NQK E;  4K81 A;  3W1S C;  1NBF C;  5IAA C;  4KIK B;  2KMA A;  4GB9 A;  2O6V B;  2LGX A;  4A3P A;  2JF5 A;  5LXI B;  1V49 A;  3AI5 A;  4G3X B;  4HDO A;  4TUU A;  2MBE A;  4E71 A;  4GXB A;  4AJY B;  4GIV A;  2G3Q B;  4MJS B;  1R4N I;  1E8W A;  3VH4 B;  2KOX A;  5AZH A;  3L17 A;  5CHV C;  4EZJ A;  4HLE A;  5GMV A;  3C0R B;  1YX5 B;  5KHO A;  3PT2 B;  5E6O A;  3EHV A;  2XK5 B;  1UD7 A;  2N1V A;  2K39 A;  2EKE C;  2KN5 A;  4W9I A;  3L16 A;  2G45 B;  3VUX A;  3ECI A;  3RZF A;  2ASQ A;  4OVV A;  2R2Q A;  3WAL A;  4EFO A;  1H8C A;  1S1Q B;  3DBR I;  2GBM A;  5JH5 C;  4F8C B;  2KO3 A;  2LGY A;  1RFA A;  1P0R A;  4CHK A;  4WJO A;  3ZTC A;  1MG8 A;  2V4L A;  3KUC B;  2LWP A;  2KC2 A;  3IVF A;  3L13 A;  4HPM B;  1E90 A;  4W9C A;  1CMX B;  2NBW B;  1SGH A;  4IM2 A;  1V5T A;  4M0W B;  3PS6 A;  2L0F A;  4MDK E;  3VVW B;  1WGH A;  1WF9 A;  3W1Y A;  4ANV A;  2LUE A;  1WYW B;  4WJQ A;  3AXC A;  3A9K B;  1LFD A;  4NJ7 A;  3QHT A;  2WYQ A;  1IPG A;  2KAN A;  3PSE B;  3RT3 B;  4LDT D;  4IWQ A;  5IA7 A;  3M63 B;  3QIJ A;  2JZ3 B;  1WR6 E;  1P98 A;  3UQA A;  3VUY A;  2MQJ A;  1Q1O A;  2DYM A;  4DXA B;  3KUZ A;  1EF1 A;  2MBQ A;  1NI2 A;  4HPL B;  3QA8 A;  1GG3 A;  4P7I A;  4LCD E;  2KFK A;  3DBS A;  2LVO A;  2PEA A;  1WJN A;  1E7V A;  2JRI B;  2JZZ A;  3A4R A;  1SIF A;  1P3Q U;  3JSV A;  3UF8 A;  1Z5S B;  2IBI B;  1GNU A;  2BKF A;  5BO4 B;  2DAF A;  4ANU A;  1XD3 B;  1PQS A;  4GDL B;  2LVP A;  4JLC A;  2KTR B;  4NAW B;  2O2V A;  4KIK A;  4DHZ B;  2KX0 A;  2N9E B;  2O6V A;  3JYU A;  1ZGU B;  4GN1 A;  1IYF A;  3B1L X;  1OEY A;  2BYE A;  2Z59 B;  2BWF A;  2RGF A;  4ZYN A;  1JRU A;  1EF5 A;  2L05 A;  2FAZ A;  2JRH A;  5LXH A;  4E3C A;  3U30 A;  3DBL I;  4MJS A;  5D94 A;  3X23 A;  2IYD B;  2K8H A;  1E7U A;  3WA0 A;  1EO6 A;  2K6Q A;  2HJ8 A;  1WH3 A;  2ZJD A;  3VUW A;  1H4R A;  2XK5 A;  1WZ0 A;  2KX3 A;  3KVF B;  4HCP B;  3OAW A;  3VTU A;  2CHZ A;  4GU2 A;  2ZZP B;  2NBU A;  2ZVO A;  4ZDV A;  4ZRI A;  1UGM A;  4BKT A;  1GC6 A;  3QJZ A;  3K9P B;  4I6L B;  2O6V D;  2LXA A;  5EDS A;  3WAP A;  1WXV A;  2AL6 A;  4FLH A;  4A3O A;  3MHS D;  4KZC A;  1F9J A;  2N7E A;  2UWQ A;  2JT4 B;  3PLU A;  2KWU B;  3ML8 A;  2K6D B;  3PZD A;  3RZW C;  3ZRF A;  4M8M A;  3PLV A;  1WM3 A;  2B3A A;  3NHE B;  4W9D A;  3N3K B;  4FHJ A;  1U4A A;  4MGK E;  2BGF A;  2DZJ A;  2FCN A;  3IFW B;  2K25 A;  3R66 C;  1G6J A;  5C1Z A;  3R7Q A;  3AUL A;  3UGB B;  2OOB B;  5LLI A;  2KZR A;  2L00 B;  2L0T A;  4G0N B;  1S3S G;  2KXJ A;  4GDK B;  1WGG A;  3HM3 A;  3JVZ X;  2JY6 A;  4FA6 A;  4EOY A;  4AUQ C;  2K1F A;  4FAD A;  3QWZ B;  4W9E A;  2OJR A;  1WXA A;  3A1Q B;  1OEY J;  4B6W A;  3DDC B;  2C7N B;  2CHX A;  2HD5 B;  3P2B A;  2M1M A;  2J0K A;  3VFK A;  3HHM A;  3B0A A;  3ZUN A;  2MP2 B;  3ONS A;  3PRZ A;  5KHQ A;  3UIP B;  2NCN A;  4GDL A;  4JIO U;  2GOW A;  2KVR A;  1TTN A;  2KTR A;  4A20 A;  1WRD B;  2WX1 A;  2MWS B;  4WWP A;  3APF A;  4HVB A;  2M4N A;  3VAW A;  4GMV A;  3V6C B;  1ISN A;  3K9O B;  1YX6 B;  3B08 A;  4MGY E;  3IHP C;  1OTR B;  1WE7 A;  2I1J A;  3W1S A;  2J7Q B;  1Y8R C;  2L8J A;  3Q3F A;  3SU8 X;  3TBL D;  1Q5W B;  3UIO B;  3ZIM A;  1WMH B;  1YIW A;  2YVC A;  4M8N A;  2G4D B;  2FID A;  3H7P B;  2MBO A;  2MLB A;  4RMA A;  4XX5 A;  4W9K A;  4ANX A;  3PRP B;  2WDT B;  3L0W B;  5AEK B;  3WAN A;  4IW0 A;  4K1R B;  3QAQ A;  3QK0 A;  4BFR A;  4MGZ E;  4ICV A;  2GBJ A;  3QC8 B;  3CF6 E;  5CX3 A;  5G55 A;  2GBR A;  1UEL A;  1ZKH A;  4IC7 B;  1LQB A;  2DZK A;  1WJ6 A;  1TBE A;  3GZN I;  2FNJ B;  3SD5 A;  2C7M B;  3WAO A;  3RCZ A;  5HKH A;  4FJZ A;  5CHW A;  3ZLZ A;  4LJP B;  4WQO B;  1WFY A;  1UZX B;  3A9J A;  2V1Y A;  4I6P A;  4WWO A;  2KLG A;  1E8X A;  2D3G A;  2AWT A;  2NVU I;  3Q3J A;  3ZNG C;  2MX2 A;  4DHJ B;  3U7D A;  1WE6 A;  3DCG A;  1R4M I;  1T0Y A;  3EFU A;  2IZV B;  1A5R A;  4MH0 E;  4IM3 A;  2KFJ A;  4DWF A;  4NQL B;  4ASW C;  4JGH B;  3DVN U;  3PTF C;  4NJ6 A;  1ZW7 A;  2RSU A;  2Y5B B;  2MCN B;  2J0J A;  3V6E B;  3U8Z A;  1OQY A;  4GGQ A;  2KJ6 A;  1NDD A;  4MGI E;  3RUL A;  3KW5 B;  2KQS A;  4TQ1 A;  2L3Z A;  4KVG B;  2KDB A;  3HK0 A;  4XC2 A;  1C1Y B;  5CHF A;  4HWI B;  2CR5 A;  2N9P C;  4G11 A;  4B9K A;  2KC1 A;  3EEC A;  3HM6 X;  1VD2 A;  3ZNI D;  5E6N A;  2KDF B;  2MBB B;  3ZRC A;  4MEL A;  1VCB A;  1I35 A;  2RR9 A;  2EMS A;  4IUM B;  4J6I A;  1WGD A;  1K8R B;  4MSM B;  1WGY A;  1WI0 A;  3M62 B;  4WJP A;  3DOW A;  3KYD D;  2MP2 A;  4B95 A;  2MRP A;  3L10 B;  2N4F A;  1V9J A;  1XT9 B;  2NBV B;  2DYO A;  3HIZ A;  3ZTD A;  2C7H A;  1E5W A;  3UIN B;  1YQB A;  5L95 C;  3NZU A;  1V80 A;  3VTV A;  2CHW A;  1HE8 A;  3DVN V;  1BT0 A;  4NPN A;  2ZEQ A;  4FN2 A;  3ALB A;  2MW5 A;  5CTR C;  2L76 A;  5DPS A;  4PS3 A;  2I1K A;  3EC8 A;  3JW0 X;  2C9W B;  4BKS D;  4CYE A;  3H6N A;  1WX9 A;  3OJ4 B;  3VH3 B;  3QCA A;  2KQ7 A;  1E8Y A;  5FR6 A;  3VHT C;  3RD2 A;  4N9F 4;  4WAA A;  3NZS A;  3KH0 A;  1KOT A;  1J0G A;  1P1A A;  3LDZ E;  3H9D A;  4FJV B;  2JUO A;  1E8Z A;  2KK8 A;  4KV2 A;  5DPW A;  2M17 A;  2GMI C;  3ZNH B;  2KDE B;  2K8B A;  2NR2 A;  3A9K A;  3PRM B;  2J0M A;  3A33 B;  3CSF A;  4IG7 B;  4TV3 A;  4W9J A;  3V61 A;  1WXS A;  4TKN A;  4URK A;  2DEN B;  2N7D A;  4WJN A;  4BBN C;  2BKR B;  3R7R A;  1RAX A;  2KKC A;  2LVQ A;  3T9L A;  2DZM A;  2LAS A;  4OVU A;  1UBI A;  2LZ6 A;  2KDI A;  2CU1 A;  4ZRK A;  2KWV B;  1UBQ A;  1YD8 U;  2IO3 B;  2FIF A;  2QHO A;  3VQI A;  3ZVV A;  4F1S A;  3H1U A;  3PRE A;  4X57 B;  1GC7 A;  1Q0W B;  3QX1 A;  3DPD A;  1Z2M A;  4K7U A;  2AYO B;  2W9N A;  3DQV A;  4II3 B;  4IWO A;  3PGE A;  4K7S A;  3AU5 A;  3DVG Y;  3T8M A;  4MSQ B;  4FBJ B;  2KFK B;  5JHA A;  4AWJ A;  2VRR B;  4GOC A;  4EZL A;  5G2N A;  3MJW A;  2ZPN A;  3TIX A;  1V86 A;  2KJR A;  2GBN A;  3L08 A;  2JVC A;  1WGR A;  4BOS C;  2BPS A;  4MEM A;  4E74 A;  2A4Z A;  2DYB A;  1P9D U;  4NAW A;  4PYZ A;  1V6E A;  2R2O A;  2MSE D;  4FUL A;  4KSK C;  2CKH B;  2NPT B;  3QAR A;  2ZNV B;  2REX A;  5D7G A;  3S2A A;  3WAM A;  4DHJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...