2LWPA

The nmr solution structure of the the ubiquitin homology domain of mouse bag-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 1
publication title The NMR solution structure of the ubiquitin homology domain of Bcl-2-associated athanogene 1 (BAG-1-UBH) from Mus musculus.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lwpA00
3IVFA 3QQ8B 2KQ7A 3ML9A 4I6LB 4RM9A 3UQAA 1EUVB 4ANVA 3L13A 2GBKA 2GOWA 1UBIA 4B9KA 3UINB 2IO0B 4GDLA 3QX1A 3VTWA 1YX5B 4PS7A 1V86A 5J18A 1Q0WB 4TQ0A 5DCNA 4EZKA 4GGQA 3VUWA 2I1KA 1VD2A 3DBSA 4FN2A 1NBFC 2MBQA 4K7WA 1KLVA 4K7SA 3T9LA 1OEYA 2K39A 4FHJA 1WIAA 2O2VA 4XZ4A 1Z5SB 3RZFA 2GMIC 2L8JA 2CHXA 4CO7A 5J17A 4KV2A 2KANA 2HJ8A 3MHSD 2WYQA 1WXVA 2PE9A 3ZNGC 2HTHA 2V3SA 3M3JA 3DPDA 2ZPYA 4KIKB 3VVWB 3NZUA 4BOSC 5KHQA 1WYWB 1VCBA 3PRPB 4ZRJA 3K9OB 3PT2B 5CHWA 3ZO5B 4NQLB 3KUZA 2LJ5A 3ZRFA 1M94A 1OQYA 5E6PA 1LQBA 1FXTB 2MBBB 3TJPA 4E3CA 2EKEC 3N3KB 3ZDMC 2KFKB 2NCNA 1E8YA 4A3OA 4KSLC 1WZ3A 1G6JA 4NAWA 1P1AA 3DBHI 2KJ6A 4A20A 2BYVE 3QCAA 3VH4B 2CKHB 3DVNU 1H8CA 1LXDA 2M4NA 3N32A 1GC6A 2DAFA 4HXDA 2G45B 2K8HA 4JIOU 5AZGA 2KLGA 3V60A 2LXAA 2PPHA 3NS8A 2KO3A 2N7EA 1EF1A 2WWZA 1Z2MA 2NS5A 3APFA 3L54A 4GDKA 3CMMB 3GOEA 4BKSD 2KDIA 3ZTDA 2IO2B 2UWQA 1YJ1A 3JSVA 4ANWA 2DAJA 1E8XA 3U30A 3VTVA 2MA9B 4GOCA 4AUQC 4W9HA 2RD0A 4WJOA 2RR9A 4WQOB 2JF5A 4XC2A 2LGDA 2O6VA 5EDSA 2DZMA 4ANUA 4GMVA 2PJHA 4IWOA 1PQSA 2YVCA 4GSWA 3Q3JA 5HKHA 4NNJB 2REXA 1E8WA 1UBQA 2MBOA 2KMCA 2IY0B 1WF9A 2GBRA 2BKFA 1WX8A 2DZJA 3QWZB 2Z59B 3QIJA 3NOBA 1SGHA 4EFOA 3AI5A 3A4SC 3Q3FA 5TR5A 4WWOA 3V6CB 3ENEA 4W9EA 3OJ3A 1UELA 4BBNC 4BKGA 2MP2B 4IG7B 1QZEA 2C9WB 4IUMB 1XT9B 3RT3B 3V6EB 3W1YA 4MEMA 1GNUA 4DDGD 3O65B 3OLMD 3DVNV 3L0WB 3KVFB 4KZCA 3APCA 2XK5B 5FR6A 4FBJB 2YLMA 3P2BA 4F1SA 3WANA 4B6WA 4IM2A 4TV3A 1WR1A 1UH6A 4LDTB 1V5TA 5LXHA 5G55A 2JRIB 3QHTA 2K8CA 4FJZA 4MGZE 2WX0A 4KDIC 1XD3B 2ASQA 3W1SC 2JRHA 1E7VA 3HM6X 3RCZA 4I6NB 3UIPB 3A9KA 4BVUC 1BT0A 4EEWA 2C5LC 3SDLC 2CHWA 3JVZX 3LJ3A 1RLFA 2RPQA 2DYMA 2J7QB 2KOXA 4WJPA 2MQJA 3KUCB 1XQQA 1UGMA 2D3GA 3A4RA 2M17A 1H4RA 2DX5B 1J0GA 3KYDD 1ZW7A 3ZW3A 3DVGY 4JGHB 3PZDA 4PS3A 3I3TB 4DWFA 2NBVB 2ZZPB 4BBNF 2AL3A 1WZ0A 2ZCBA 4ASWC 4B95A 5BO4B 4NJ7A 5AZHA 4EOYA 1X1MA 2KLCA 2L05A 1U4AA 2LI5A 2KC2A 4ZRKA 5G2NA 2LVOA 3U8ZA 2KJHB 3ONSA 1WH3A 3WAMA 1R4MI 1D3ZA 4FJYA 5D7GA 5IAAC 3UF8A 2CHZA 4WAAA 1YD8U 2MWSB 5E6NA 5CTRC 2N1VA 4K81A 2JT4B 2RSUA 3AU5A 3PREA 5CHVC 2D2QA 3V61A 5C1ZA 2KWCA 4EUTA 4RMAA 3NY5A 2G3QB 5AEKB 3DOWA 2MX2A 4WJNA 2I1JA 5D6JB 2R2OA 1YQBA 3A9JA 4HK2A 2DYBA 1WXMA 1WGDA 5AZFA 4JL9A 2KN5A 5E6OA 4JQWC 4LDTD 2N1WA 3PLUA 2CU1A 2L7RA 1IPGA 5DPRA 1WGRA 1V49A 1UD7A 2Z0EB 4HVBA 3EC8A 1WE6A 2L76A 2JZ3B 2KJRA 3H7PB 2BWES 2W9NA 4KZ0A 4MJSB 1WX9A 3UGBB 2EMTA 3WAPA 4HPLB 2ZNVC 2ZVOA 3APDA 2DENB 2KFJA 3H1UA 2MP2A 2BWFA 1YX6B 3VXWA 3DDCB 1CMXB 1WX7A 2D07B 1WMHB 3MJWA 2KTRB 2C7MB 4ICVA 3IHPC 4G50A 5L83A 4HCNB 1A5RA 3ZTCA 3PVLA 1WRDB 3AXCA 1IP9A 2WDTB 4MDKE 4MGIE 3ZLZA 1ZGUB 2B3AA 4EZJA 4KSKC 4PS8A 2KK8A 3JW0X 3VUXA 2KDFB 3QC8B 4W9DA 5GMVA 1E7UA 4M8MA 4GU2A 3A1QB 2MCNB 2NPTA 3ZDTA 4E71A 1WJ6A 5J2RA 2DZKA 1J19A 3RD2A 4ZYNA 2O6VD 1K8RB 1NDDA 4ZRIA 4MSQB 2ZVNA 4P7IA 3T8MA 3PLVA 3QA8A 2IY1B 4F7ZA 1E90A 1P3QU 2GBNA 3EHVA 4G3XB 3SU8X 2NBUA 3L10B 2V4LA 4MGYE 1TGZB 2WX1A 3RYTA 3NHEB 1GJZA 3C0RB 3TMPB 3EECA 4HDQA 4W9JA 4BKSA 4HDOA 2AL6A 2N4FA 2XBBC 2UYZB 4MSMB 3RUIB 4DHJB 1V9JA 2BF8B 4BKTA 1C1YB 2Y5BB 3B1LX 4G11A 1S3SG 2O2VB 1C3TA 4X57B 1WJNA 2KWVB 4HWIB 2BGFA 3KUDB 5D2MB 3ZUNA 4HLEA 4ANXA 2LVPA 3M63B 4G0NB 5C23A 2A4ZA 2IO1B 3ALBA 2V1YA 2KKCA 3ECIA 2GBMA 3DBRI 3NZSA 1UZXB 4IM0A 4DHZE 3VTUA 2MBEA 4KIKA 3VHTC 2KDBA 3R66C 2LRWA 2LASA 3VH3B 1V80A 3PHXB 1TTNA 1Q1OA 4EKUA 1R4NI 2KXJA 4AP4C 3H7PA 1ZKHA 3B08A 4HPMB 3VDZA 2KFKA 3PPAA 2MLBA 4NJ6A 4CYEA 4W9LA 4NAWB 2AEHA 1KJTA 2BKRB 4TKNA 1WGHA 2JVCA 2KMAA 2NR2A 2ZPNA 2LGYA 3RULA 3L17A 2FNJB 3BINA 2FAZA 5L95C 2Z0DB 5CX3A 2L0TA 4II2B 2BYEA 2OJRA 4WWPA 4NQKE 5JHAA 2L0FA 2J0JA 1RAXA 1S1QB 4PYUA 1WE7A 4W9KA 3UIOB 4GDKB 2JY6A 4W9FA 2FCQA 2LXCA 3ZVVA 3SD5A 3AULA 1WGYA 2KHWB 4ICUA 3V62A 2HE7A 2K8BA 2N9EB 3HIZA 3TIXA 5JH5C 1GUAB 3JSVB 2CS4A 1WY8A 1T0YA 2LUEA 3QK0A 1WJ4A 2KWUB 2G4SA 4OVUA 1RFAA 2DYOA 2PE6B 4K7UA 4DHJD 1EO6A 3VAWA 2IO3B 1V2YA 2KZRA 4IWQA 3IFWB 1AARA 2QHOA 3VFKA 4A3PA 3K9PB 1F9JA 2O6VB 4URKA 4OVVA 4DHZB 2VRRB 3ML8A 4IW0A 4J6IA 3ZKJC 2KC1A 4KDLB 2L3ZA 2LD9A 3QJZA 1E5WA 5DPTA 2XEWA 5CHFA 2JXXA 3GZNI 2J0KA 2LVQA 3U7DA 4II3B 4W9CA 3D32A 3PHWB 2FIFA 2JPHA 5IA7A 3DBLI 2KD0A 2DHZA 3VUYA 1SE9A 3WAOA 2L00B 4W9GA 1I42A 4DK5A 1WXAA 2MSED 3L16A 2BPSA 3CSFA 1SIFA 3HHMA 1J8CA 1Y8RC 2JUOA 2ZNVB 1YIWA 3S2AA 2DZIA 5KHOA 3M95A 2LZ6A 2R2QA 4K1RB 4FA6A 3IG3A 2K1FA 1P0RA 3PV1A 3L08A 2XK5A 4FHKA 3R7RA 4N9F4 2ZEQA 3N30A 3OAWA 2N9PC 4FJVB 3R7QA 4GXBA 4LJOB 3X0WA 1KM7A 3A9KB 4HCPB 1L2NA 1V81A 2FCNA 1MG8A 4IC7B 3TCAA 3W1SA 1IYFA 5D94A 1NI2A 2IYDB 3KYCD 4MGKE 4MH0E 4M8NA 5LXIB 4FLHA 4XX5A 2BYFA 2KVRA 1OGWA 4HJKA 5JZEB 4DBGA 2OOBB 1WM3A 4GIVA 3HK0A 3QAQA 4MM3A 1E8ZA 1P9DU 3TL5A 4ZDVA 2EMSA 2MRPA 3MTNB 4CHKA 4GDLB 3AU4A 4W9IA 2LRUA 3WALA 4AJYB 4E74A 3PRMB 1WJUA 3DCGA 3CF6E 2K25A 1OTRB 4AOFA 3CSTA 1WFYA 2AYOB 4IM3A 2N9XA 1P98A 1TBEA 3PRZA 4LJPB 2AWTA 2LWPA 2D10A 3PSEB 2K6DB 1LFDA 5LLIA 3JYUA 5DPWA 2D11A 4TUUA 4FADA 2JWZA 4M0WB 1WR6E 1ISNA 2KX0A 3KW5B 4WWNA 4IWPA 4JLCA 4I6PA 2MBHA 2KX3A 3DQVA 3UQBA 1GG3A 3A9JB 4TQ1A 3X23A 3KH0A 3ZNZB 2FIDA 2ZCCA 2C7NB 3QARA 2FCSA 4F8CB 1I35A 3PS6A 4RM8A 1JRUA 2IBIB 2KQSA 2KTFA 1WXSA 3RZWC 1OEYJ 1Q5WB 4NPNA 2HD5B 2M0XA 1WM2A 3H6NA 4DDID 4MELA 4YL8A 1L7YA 2FUHB 4EZLA 2MW5A 4MJSA 3WIMA 2GBJA 2PEAA 4KVGB 2CR5A 4WJQA 1GC7A 3VQIA 1WI0A 3M62B 4PYZA 3IBEA 2C60A 4AWJA 2NBWB 4NY0A 2KDEB 1RRBA 3PTFC 2G4DB 1EF5A 2K6QA 3EFUA 5DPSA 1WMHA 2IZVB 3OJ4B 1V6EA 2J0MA 2KTRA 3PGEA 4AJWA 1WGGA 3B0AA 2M8SA 3BY4B 4GB9A 2LGXA 5JHBA 3SHQA 2RGFA 4BFRA 2FCMA 3H7SA 3TBLD 3A33B 1KOTA 3WA0A 2A5UA 2N7DA 4LCDE 3ZNID 2ZJDA 3R3MA 1HE8A 2NVUI 3LDZE 3H9DA 2JZZA 2M1MA 2NPTB 3A1QA 4BOZB 3ZIMA 4DXAB 3ZRCA 1LM8B 2KNBA 3ZNHB 4GN1A 3HM3A 1TZ1A 2C7HA 1V5OA 3DVGX 4FULA
chains in the Genus database with same CATH superfamily
5EE1A 4RFBA 2GBKA 1UBIA 3UINB 4GDLA 1DOYA 3QX1A 4YTNB 1YX5B 1FPYA 1V86A 5DCNA 4JE3B 2WLBA 1KLVA 4YXDB 2Q5WD 5EE9A 1Z5SB 5J17A 2WYQA 2XNAC 3PZ8A 2RMMA 1SIJA 3ZNGC 2HTHA 3DPDA 2ZPYA 3NZUA 1VCBA 3PRPB 4C7YA 5CHWA 3KUZA 1M94A 1OQYA 5E6PA 1LQBA 1L4ZB 1K53A 3N3KB 2KYWA 1KRHA 1XF5L 3NVZA 4KSLC 1WZ3A 1G6JA 4NAWA 3DBHI 2KJ6A 3OWEB 1TYGB 1QKZA 1GC6A 5HHDG 5AZGA 1ZXIA 2KO3A 1EF1A 3APFA 1ZOYB 2NS5A 1P7FA 1AWDA 3GOEA 2UWQA 1YMHE 2WXRA 5C2TB 4GOCA 4W9HA 3BZDB 2LGDA 4HEA1 1UUPA 5EDSA 2W3SA 2QEJC 2WXLA 1PQSA 2BB6A 4GSWA 1E6EB 1UBQA 1RYJA 2GBRA 2DZJA 3QWZB 2Z59B 3NOBA 1D5MC 3AI5A 3V6CB 3ENEA 4W9EA 4KGRA 2MP2B 1JRPA 3KVFB 4KZCA 5FR6A 4F1SA 4B6WA 1TS3A 1WR1A 4LDTB 1V5TA 4C4VA 1NYQA 4MGZE 3UIPB 3A9KA 1BT0A 1GPXA 3SDLC 3LJ3A 1F52A 2MQJA 1XQQA 5AUIA 1SJHD 2D3GA 2DX5B 1XCQL 3KWLA 2L32A 2ZZPB 1TY2A 2BS3B 2ZCBA 4ASWC 3LB8C 2KC2A 3U8ZA 3WAMA 1D3ZA 5D7GA 1YD8U 1WSPA 4YTMB 2D2QA 2IGDA 2KWCA 3Q8FA 2WXOA 3TEXA 5AEKB 2MX2A 3EGRA 1QLBB 3EA6A 3BK1A 2KN5A 3AEFB 5E6OA 2KT7A 1C76A 3Q2AC 3EC8A 1F2RI 4YT0B 3H7PB 2E6XA 3Q3OC 4MJSB 1WX9A 5BYRA 4D2KA 2ZVOA 4ZRPA 4XYCA 1ZP0B 2BWFA 4S17A 1CMXB 1WMHB 1DYQA 2C7MB 4G50A 5L83A 3CIRB 2J53A 3Q8AA 3PVLA 4M02A 2WXPA 1IP9A 1ZGUB 3R2IA 4XGAB 3BYTB 4PS8A 2GRIA 4W9DA 1E7UA 4M8MA 4GU2A 3SR6A 2Y3AA 2INPE 3GS2A 1WJ6A 3URYA 4XWWA 1K8RB 1NDDA 4GLSC 1HZ6A 3IAM1 3ETRA 1QQRA 2I2YA 3AEBB 2KQ4X 1AW7A 2IY1B 2EKIA 4G3XB 2NBUA 4MGYE 1VRAB 3NHEB 1GJZA 4BKSA 4PK1A 1FEHA 2UYZB 4MSMB 2BF8B 2Y5BB 1B1ZA 2ZW1A 4ANXA 4LLGM 5C23A 3L4PA 2A4ZA 4JX1C 1I4XA 2V1YA 1Q10A 1XXGA 2CJNA 4IM0A 4TSSA 3VTUA 4KIKA 2V3PA 3RNGC 4RNAA 3MJ5A 1R4NI 2KXJA 2VH1A 1ZKHA 1SJED 1ROEA 4CYEA 2MLBA 1GOZA 3FAHA 4NAWB 2BKRB 2BW2A 1R4MB 3L17A 5L95C 4A9AA 5CX3A 4N6EB 2OJRA 2KACA 4NQKE 5JHAA 1D5ZC 4W9KA 2JY6A 5EE0A 3FKYA 3AULA 1PFDA 2QILA 3V62A 1I4QA 2K8BA 3HIZA 5JH5C 3TIXA 1WY8A 2AQ3B 2G4SA 1P7EA 2N9KA 5T8IA 3DHIC 1FIQA 2KZRA 3IFWB 1JWBD 3SFEB 4BAXA 1AARA 2QHOA 4RGTA 4A3PA 2QC8A 3K9PB 3U7ZA 4OVVA 4DHZB 4IW0A 1FRRA 3AEGB 4KDLB 3RNFC 3DHHC 5CHFA 2JXXA 2J0KA 3IT4B 2R61A 1JROA 3U7DA 4II3B 3DBHB 2JPHA 5IA7A 3DBLI 5IN7A 2ONQA 4YSXB 1WXAA 1Y8RC 4N59A 3Q8EA 2DZIA 2PW9A 3U4EG 3WCQA 1T0QC 3RNAC 4K1RB 3PV1A 4ARCA 4N9F4 2ZEQA 3N30A 3OAWA 2CU3A 3C8YA 5HG2A 4C4VB 1VZ7A 3B2GA 2BS4B 3A9KB 4HCPB 2E3TA 4TMAB 2IYDB 2XN9C 3KYCD 2BBCA 4MH0E 1CJEA 4OZBA 2BYFA 1OGWA 4HJKA 5JZEB 4DBGA 1N6ZA 1IUEA 3HK0A 4MM3A 2HTME 3N1XC 4ZDVA 1TS4A 4CHKA 3AE5B 1TKEA 3WALA 4E74A 1WJUA 3CF6E 4AOFA 4AQ7A 1WFYA 1AN8A 3PRZA 4LJPB 2D10A 4MT5A 2QJLA 1LFDA 1V8CA 2KX0A 4WWNA 4I6PA 3UQBA 3X23A 3I9V1 3ZNZB 1M4VA 2RDGA 5FR3A 5JXVA 2C7NB 2FCSA 1I35A 4RM8A 2IBIB 5BMGA 1WXSA 4L1BA 1WM2A 4DDID 3I5JC 2B76B 4KVGB 4WJQA 1XLQA 3VQIA 2ACZB 1WI0A 3M62B 4NY0A 3AH7A 3AEDB 5DPSA 2IZVB 1UWXA 3OJ4B 2J0MA 2KTRA 1WGGA 1C4AA 4GB9A 2LGXA 1FMAD 1FRDA 3ABVB 3H7SA 3KQ4A 2GI9A 4JPSA 1SF0A 1HE8A 2NVUI 3LDZE 2JZZA 2M1MA 1JWUD 3ZRCA 3HM3A 3DVGX 3NVWA 4XE0A 2KQ7A 3UQAA 1EUVB 4ANVA 3L13A 2LHEA 2MJ3A 1I4PA 2M19A 4HJGE 4NAMA 5J18A 4QAYA 1Q0WB 4GGQA 3VUWA 2I1KA 1VD2A 4K7WA 2MBQA 3T9LA 2GLSA 4ARIA 3SFDB 3NS1A 3RZFA 2GMIC 1C78A 1FFUA 1SXTA 2G1EA 4KV2A 2KANA 3MHSD 5GXGB 2MH7A 1WXVA 1PUTA 4KIKB 1J7CA 3VVWB 2DNFA 4BOSC 4HKQA 3ZO5B 2LJ5A 3ZRFA 3TJPA 4E3CA 2EKEC 2NCNA 1QT9A 4UDUC 3N1YC 3QCAA 2KAJA 3GE8C 4A6QA 2DAFA 4HXDA 2G45B 4JIOU 1RFKA 3V60A 2V9HA 1FFVA 3NG0A 1WYGA 2KDIA 3ZTDA 3KLSX 1TY0A 2IO2B 1F77A 1OQRA 4HRSA 4LNOA 2DAJA 2CJOA 4KGTA 1T0SC 2RR9A 2IPKD 2JF5A 2DZMA 1R4NB 2FE8A 2PJHA 2WXJA 4A8XC 3NZ3A 1JW9D 1T5XD 2WS3B 1OQQA 3AE3B 4LNIA 3Q6BA 4EFOA 3A4SC 1D5XC 3N20C 1UELA 4BBNC 1YJJA 1QZEA 2C9WB 3FC4A 5HFYA 1XT9B 3W1YA 1Y56A 3Q8BA 3APCA 3P2BA 1UH6A 5LXHA 5G55A 3QHTA 2K22A 2K8CA 4FJZA 2EELA 3HM6X 4FXCA 4BVUC 2CHWA 1RLFA 4WJPA 2DYMA 2J7QB 1JWMD 5G5GA 3ZXRA 1NEKB 1H4RA 1J0GA 3KYDD 3MC0B 4JGHB 3PZDA 4PS3A 3I3TB 4MM3B 4DWFA 3DBLB 2AL3A 1WZ0A 1HTQA 4NJ7A 1FNWA 2OJWA 2LI5A 2LVOA 3AM9A 1EWCA 1GB4A 3DWMA 1WH3A 1R4MI 3E9SA 5IAAC 3UF8A 2CHZA 3T3NA 1OFFA 4LNFA 5CTRC 2N1VA 2JT4B 3PREA 5CHVC 5C1ZA 3DWGC 2G3QB 5HI1A 4M0WA 3DOWA 3VR9B 1YQBA 2DYBA 1FD6A 2N1WA 3PLUA 1BXTA 2L7RA 1XEEA 2WDVB 1IPGA 2W54A 4KZ0A 3UGBB 3WAPA 2ZNVC 3APDA 2DENB 3H1UA 3VXWA 1YQ3B 3DDCB 1PGAA 3MJWA 2KTRB 4EE2A 1FCCC 1L6UA 3ZTCA 3AXCA 4LNKA 1GAQB 2KK8A 3QC8B 5GMVA 1ZUD2 4E71A 1C9FA 4O1NA 1QF6A 1J19A 1ZE3D 2K3UA 4ZRIA 1FXIA 2WXIA 3PLVA 2W82A 4IDIA 1DOXA 3SU8X 2GB1A 1HTOA 2WQYB 2V4LA 1SBBB 2WX1A 4OZCA 3C0RB 1VR9A 4W9JA 3B9JA 2XBBC 2FUG1 2QSDA 1V9JA 1QOFA 1C3TA 1S3SG 1VJKA 1F1HA 1WJNA 2KWVB 5H92C 2KDMA 3KUDB 5D2MB 3ZUNA 3M63B 2IO1B 3ALBA 1ENFA 3NZSA 4C80A 1UZXB 5D3DA 4DHZE 1NI3A 1YOVB 2LRWA 4AP4C 3B08A 4NJ6A 4W9LA 2NR2A 2ZPNA 2J52A 3RULA 2FNJB 3BINA 1SE3A 2L0TA 4II2B 2J0JA 1S1QB 5EE3A 1E7PB 3SD5A 2KHWB 2HE7A 1GB1A 2LUEA 3QK0A 2KWUB 3P1MA 2DYOA 2PE6B 2WXMA 4K7UA 2PVGC 4DHJD 4IWQA 3AE1B 2WDRB 3TUOA 4PT5A 3VFKA 1F9JA 4URKA 3LXFA 3ZKJC 3MHZA 2L3ZA 3QJZA 2PLPA 4JWSC 5MPOA 1FNUA 4W9CA 3D32A 2FIFA 3Q14C 2X8XX 2PKOA 2KD0A 4NZLB 2DHZA 3VUYA 3WAOA 2L00B 4W9GA 1I42A 1XLNA 3L16A 1XLPA 2BPSA 4J3OD 4WWMA 5KHOA 3M95A 2R2QA 4FA6A 3IG3A 4FHKA 3AECB 3R7RA 1T3QA 2N9PC 4ZYSA 4FJVB 4GXBA 4LJOB 1UWMA 3PZ7A 1V81A 1XO3A 1BUIC 1MG8A 2FCNA 3TCAA 3W1SA 1IYFA 1MJDA 1MPEA 4M8NA 5LXIB 1CZPA 2KVRA 4GIVA 3HVZA 1E8ZA 1P9DU 3TL5A 2HJ1A 3MTNB 4GDLB 4W9IA 4AJYB 1K51A 1VZ8A 2K25A 3CSTA 1ZDXA 2N9XA 1TBEA 1F0ZA 3JYUA 2JWZA 4M0WB 1ISNA 4JLCA 3DQVA 2KX3A 1GG3A 2ZCCA 3VR8B 3TSSA 2KQSA 2UU7A 1JQ4A 2LJIA 1Q5WB 1QOGA 1EWYC 3H6NA 3RN9C 4EZLA 2GBJA 2PEAA 1GC7A 4OW0A 2C60A 3N1ZC 2NBWB 1RRBA 2M0AA 2G4DB 1EF5A 3ZYYX 1JCKB 4AJWA 4K3CA 2M8SA 3AEAB 2RGFA 1PGXA 3TBLD 1KOTA 3WA0A 4DQOC 4NJCA 2WXHA 1ET6A 3IXSA 2L52A 3A1QA 2KNBA 3ZNHB 4GN1A 4DXFA 2C7HA 1V5OA 4WJOA 1NYRA 3IVFA 4I6LB 4B9KA 1TS2A 2IO0B 3AB5A 3VTWA 4PS7A 2WNMA 2MEKA 3AN1A 4TQ0A 1RM6C 1TKGA 3DBSA 1NBFC 2JWUA 2K39A 4FHJA 2O2VA 5I4DA 2L8JA 2CHXA 5BMHA 2HJ8A 1D4BA 1UGJA 2PE9A 3MC8A 1QILA 3M3JA 2V3SA 1C77A 3VRAB 3I63C 3RFZB 2WXGA 5KHQA 4KX6B 3AE4B 4ZRJA 3K9OB 4NQLB 1FXTB 1XCTL 2MHJA 4A3OA 2K5PA 3AE2B 5C3JB 1P1AA 2BYVE 3DVNU 1H8CA 2M4NA 3N32A 1TZOA 2WGSA 2PPHA 2N7EA 1EU4A 4GDKA 1VDVA 3P4SB 4YWGG 1N62A 1STEA 2MA9B 4AUQC 1UF0A 2RD0A 2FBWB 1L0VB 3HRDD 2JYTA 4XC2A 2O6VA 3AE7B 2ON8A 4IWOA 2YVCA 5HKHA 4NNJB 1L0YB 1E8WA 5E6JA 2IY0B 1WX8A 1KLGD 3QIJA 3P42A 1SGHA 3Q3FA 5TR5A 3AMZA 3P4QB 4C56C 2ICIA 4BKGA 4IG7B 2V0GA 3V6EB 4MEMA 1GNUA 4DDGD 3O65B 3OLMD 1IGCA 2YLMA 3WANA 4IM2A 4TV3A 4ZOHC 2JRIB 1L6VA 2WX0A 1XD3B 3W1SC 1E7VA 2BT6A 3RCZA 2LMCA 4EEWA 3HVDA 1L4DB 2C5LC 2INNE 3JVZX 4US8A 3KUCB 1UGMA 4RGMA 1KF6B 4P16A 3AE9B 1ZW7A 3Q69A 2SEBD 1MHHE 4B95A 5BO4B 2Y5PA 3MP9A 1X1MA 2KLCA 2L05A 1U4AA 3J9CA 2LGSA 4ZRKA 3ONSA 3GP7A 4WAAA 4K81A 2RSUA 3AU5A 3V61A 2D3BA 4EUTA 4RMAA 2VZKB 3BVMA 3Q3MC 1WXMA 2PIAA 4JQWC 4LDTD 1ESFA 4L23A 1I4HA 1KLUD 1WGRA 1V49A 1UD7A 3IAS1 2QCZA 2L83A 2AQ2B 4JWUC 2W9NA 2WXQA 4HPLB 4XWTA 2KFJA 2MP2A 1N61A 1WX7A 2D07B 4ICVA 1E9MA 3NJTA 1PGBA 2AX5A 4MDKE 5BYQA 4EZJA 4KSKC 1QOBA 3JW0X 4YSZB 2KDFB 3Q3NC 3W5UB 3A1QB 4WH4A 3DHGC 5J2RA 3RD2A 4ZYNA 1TKYA 3W9CB 2ZVNA 2K9XA 4P7IA 1N60A 3QA8A 4HROA 1L0XB 4RGNA 4F7ZA 2J4XA 5BMIA 3RYTA 3TMPB 1JALA 3Q8CA 2AL6A 1KFYB 4WAFA 1MG4A 4BKTA 4RF1A 4G11A 2O2VB 4X57B 3N9YC 2BGFA 2LVPA 1JWAD 3SEBA 2GBMA 2D3CA 3DBRI 4AS1A 2LASA 2INDC 1V80A 3PHXB 1Q1OA 1TTNA 4EKUA 3H7PA 2H89B 2KFKA 3U2SC 1KJTA 4TKNA 2JVCA 5FKAC 1IGDA 2LGYA 4RF0A 3E56A 2Z0DB 1I7HA 4WWPA 4REZA 1WE7A 2YEPB 1L5PA 4GDKB 4W9FA 5IO9A 2KWDA 2FCQA 1BMLC 4M01A 3VRBB 2CS4A 1WJ4A 4OVUA 1D6EC 3VAWA 4B0MA 2IO3B 4DXGA 3BK2A 1ACCA 2O6VB 2KVZA 2VRRB 2LEKA 2XEWA 3V3XA 2LVQA 1VLBA 3PHWB 2L1AA 2JX5A 4P1BC 1SB3C 1EM7A 2MSED 3OG5A 2IDYA 3CSFA 1SIFA 3HHMA 1J8CA 2JUOA 2ZNVB 1YIWA 3S2AA 1AYFA 1LO5D 4B0EA 3L08A 2XK5A 2J42A 1T0RC 2AQ1B 3V05A 1K52A 2DLBA 3UI3A 1KM7A 1L2NA 2NTSA 4IC7B 1KTKA 1SEBD 1WXQA 4A55A 4MGKE 1FM0D 3KWVA 3MFGA 4FLHA 1N5WA 2LUMA 2OEDA 1WM3A 2MJDA 3ZXVA 3RNBC 2MRPA 3AU4A 2LRUA 1QOAA 2JU6X 1YN5A 2V4IB 2WU2B 1OTRB 1P98A 4R3DA 2IJ0A 3PSEB 2K6DB 1C79A 4FADA 1R7SA 4WURA 2D3AA 5G5HA 3KH0A 3NVVA 2FIDA 3QARA 3AE8B 3PS6A 1YNTE 1JRUA 3RNCC 1TJEA 3RZWC 3BIID 2M0XA 4MELA 4YL8A 3NVYA 2MW5A 4YSYB 3WIMA 3RPFC 4PYZA 2PTLA 3TEYA 1FXAA 2BQQA 1PYWD 1V6EA 3PGEA 3SHQA 1NVID 4BFRA 3IT6B 1MI0A 3A33B 3RMKC 2A5UA 2N7DA 4LCDE 1FO4A 3ZNID 2ZJDA 3H9DA 4MH8A 4WIPA 1CQVA 2W55A 4BOZB 3ZIMA 1LM8B 2RDBC 2BYTA 3GZNB 1E10A 1TZ1A 2N0SB 1FNVA 4BZAA 1V1PA 4ZRQA 4FULA 1V97A 3QQ8B 3ML9A 4RM9A 4C00A 2NTTA 2GOWA 2DWQA 1UNSA 2D5GA 1N5XA 1C4CA 5IP4D 4HPPA 4OVZA 4EZKA 4ZHPA 1PDXA 1MFWA 4FN2A 2N7JA 4K7SA 1OEYA 1WIAA 4XZ4A 3T3OA 4H2AA 4USAA 4CO7A 3BWUD 2INCC 3EFCA 3HUIA 1V1OA 1WYWB 3PT2B 1YJIA 2MBBB 3W2DA 2Y5CA 1XLOA 3ZDMC 4HKZE 2KFKB 1E8YA 2G9HD 1VZ6A 2HDEA 4A20A 3VH4B 2LFIA 2CKHB 1DGJA 1LXDA 2K8HA 2KLGA 2LXAA 3NS8A 1IBXA 2WWZA 1Z2MA 3L54A 3CMMB 5IKCM 4BKSD 2BTEA 1YJ1A 4LNNA 3JSVA 2NMQA 2BB5A 4ANWA 3U30A 1E8XA 3DBRB 3VTVA 1KH0A 2VZKD 4WQOB 5H8YE 3ZJVA 4ANUA 1JWSD 4GMVA 1ZXHA 4S0RA 5AUKA 3Q3JA 2REXA 2MBOA 4ACFA 2KMCA 1WF9A 2MJEA 2BKFA 2KN4A 5BYSA 4P1CC 2OHFA 3RI7C 2JYEA 2N9LA 4WWOA 3OJ3A 4IUMB 2QDFA 1CK1A 3RT3B 4KKJA 3DVNV 3L0WB 2XK5B 4FBJB 1HEZE 3P4PB 2Z8LA 4WQMA 4KDIC 4XDCA 2ASQA 2JRHA 4I6NB 2H88B 2RPQA 2KOXA 3R8BA 3A4RA 3ZQ4A 2M17A 4RGOS 3ZW3A 3DVGY 3O13A 3NUHB 1YN3A 3RNEC 2NBVB 1N63A 4BBNF 5AZHA 1SSNA 4EOYA 5G2NA 4IKGA 2KJHB 3FILA 4FJYA 3LYYA 4ZHOA 1A70A 2RDHA 1E0ZA 2MWSB 5E6NA 1I4RA 3NY5A 2LGIA 1C4PA 3AEEB 4WJNA 2I1JA 5D6JB 2R2OA 3CWIA 4N58A 1HQRD 2WXFA 3A9JA 4HK2A 1WGDA 5AZFA 3ZJUA 2RPVA 3P4RB 4JL9A 2CU1A 5DPRA 2YEPF 4OHJA 2Z0EB 4HVBA 1WE6A 2L76A 3ZGZA 2JZ3B 2KJRA 2BWES 2EMTA 3NRZA 1YX6B 4C7ZA 3P63A 2SAKA 2ZW0A 1EU3A 3TEWA 3IHPC 4HCNB 1FCLA 1A5RA 1WRDB 2WDTB 4MGIE 3ZLZA 2B3AA 2JSVX 3VUXA 2MCNB 2NPTA 3ZDTA 1WGKA 3TEZA 2DZKA 1V1PB 1HA5A 2M56B 3BYYB 2O6VD 2LHDA 4MSQB 3T8MA 1TS5A 4K3BA 1E90A 1P3QU 2GBNA 3EHVA 3L10B 1TGZB 4MACA 3EECA 4HDQA 1K50A 4HDOA 2N4FA 3RUIB 1TT5B 4DHJB 1C1YB 3B1LX 3C19A 2V3NA 5LNK1 3U52E 4HWIB 3BVZA 4HLEA 1YN4A 4A90A 5IOIA 4G0NB 2VH2A 2KKCA 3EUB2 3ECIA 2BS2B 1RWSA 4M00A 2MBEA 3VHTC 3AE6B 2KDBA 3R66C 1DOIA 3VH3B 4HPMB 3VDZA 2PVOD 3PPAA 1HXYD 2AEHA 2DBYA 1WGHA 1YQ4B 2KMAA 5TSSA 1SE4A 2FAZA 2W3RA 1MVKA 1ET9A 2BYEA 2L0FA 1B9RA 1RAXA 2IGHA 1IBXB 4PYUA 3I57A 3UIOB 2LXCA 4RH6A 3ZVVA 4L2YA 2WU5B 1SE2A 1WGYA 1NENB 4ICUA 2BVCA 2N9EB 1GUAB 3JSVB 1T0YA 1RFAA 1EO6A 1V2YA 2JQRB 1TIFA 3ML8A 1F2RC 2QMTA 2WDQB 4J6IA 2KC1A 3BVGA 5DPTA 2LD9A 1E5WA 3GZNI 2WXNA 1WRIA 2JXTA 4LTUA 1WWTA 2WHIA 3GE3C 1SE9A 2I38A 2TSSA 4DK5A 5FK9C 4KGSA 2X38A 2LZ6A 1T6BX 2WXKA 2K1FA 1P0RA 1LGRA 1HZ5A 3R7QA 3MC9A 3X0WA 3AV8A 4YTPB 3PO0A 5D94A 1NI2A 3GB1A 4XX5A 2WP9B 4IOIE 2OOBB 3QAQA 2EMSA 1I4GA 4P6VF 3PRMB 3DCGA 3FILB 4ITKA 2AYOB 4IM3A 2AWTA 2LWPA 5D3IB 2K0PA 5LLIA 5DPWA 2D11A 2KMMA 4TUUA 2JZPA 1WR6E 4RCOA 3KW5B 4IWPA 2MBHA 4TQ1A 3A9JB 2QIEB 1JMLA 4F8CB 2KTFA 3ZJTA 4XDDA 1J7BA 1OEYJ 4NPNA 3B2FA 3R2TA 1ZPSA 2HD5B 4US9A 1L7YA 2FUHB 2IGGA 3H8HA 4MJSA 2CR5A 3IBEA 1ZDVA 4AWJA 2KDEB 4CQNA 3PTFC 2K6QA 3EFUA 1J7AA 1WMHA 3B0AA 2PMVA 3BY4B 4LK0M 5JHBA 2FCMA 1MHXA 3W5VB 3R3MA 4OZAA 4KKIA 2NPTB 4DXAB 4Q2JA
chains in the Genus database with same CATH topology
3IVFA 3QQ8B 2KQ7A 3ML9A 4I6LB 4RM9A 3UQAA 1EUVB 4ANVA 3L13A 2GBKA 2GOWA 1UBIA 4B9KA 3UINB 2IO0B 4GDLA 3QX1A 3VTWA 1YX5B 4PS7A 1V86A 5J18A 1Q0WB 4TQ0A 5DCNA 4EZKA 4GGQA 3VUWA 2I1KA 1VD2A 3DBSA 4FN2A 1NBFC 2MBQA 4K7WA 1KLVA 4K7SA 3T9LA 1OEYA 2K39A 4FHJA 1WIAA 2O2VA 4XZ4A 1Z5SB 3RZFA 2GMIC 2L8JA 2CHXA 4CO7A 5J17A 4KV2A 2KANA 2HJ8A 3MHSD 2WYQA 1WXVA 2PE9A 3ZNGC 2HTHA 2V3SA 3M3JA 3DPDA 2ZPYA 4KIKB 3VVWB 3NZUA 4BOSC 5KHQA 1WYWB 1VCBA 3PRPB 4ZRJA 3K9OB 3PT2B 5CHWA 3ZO5B 4NQLB 3KUZA 2LJ5A 3ZRFA 1M94A 1OQYA 5E6PA 1LQBA 1FXTB 2MBBB 3TJPA 4E3CA 2EKEC 3N3KB 3ZDMC 2KFKB 2NCNA 1E8YA 4A3OA 4KSLC 1WZ3A 1G6JA 4NAWA 1P1AA 3DBHI 2KJ6A 4A20A 2BYVE 3QCAA 3VH4B 2CKHB 3DVNU 1H8CA 1LXDA 2M4NA 3N32A 1GC6A 2DAFA 4HXDA 2G45B 2K8HA 4JIOU 5AZGA 2KLGA 3V60A 2LXAA 2PPHA 3NS8A 2KO3A 2N7EA 1EF1A 2WWZA 1Z2MA 2NS5A 3APFA 3L54A 4GDKA 3CMMB 3GOEA 4BKSD 2KDIA 3ZTDA 2IO2B 2UWQA 1YJ1A 3JSVA 4ANWA 2DAJA 1E8XA 3U30A 3VTVA 2MA9B 4GOCA 4AUQC 4W9HA 2RD0A 4WJOA 2RR9A 4WQOB 2JF5A 4XC2A 2LGDA 2O6VA 5EDSA 2DZMA 4ANUA 4GMVA 2PJHA 4IWOA 1PQSA 2YVCA 4GSWA 3Q3JA 5HKHA 4NNJB 2REXA 1E8WA 1UBQA 2MBOA 2KMCA 2IY0B 1WF9A 2GBRA 2BKFA 1WX8A 2DZJA 3QWZB 2Z59B 3QIJA 3NOBA 1SGHA 4EFOA 3AI5A 3A4SC 3Q3FA 5TR5A 4WWOA 3V6CB 3ENEA 4W9EA 3OJ3A 1UELA 4BBNC 4BKGA 2MP2B 4IG7B 1QZEA 2C9WB 4IUMB 1XT9B 3RT3B 3V6EB 3W1YA 4MEMA 1GNUA 4DDGD 3O65B 3OLMD 3DVNV 3L0WB 3KVFB 4KZCA 3APCA 2XK5B 5FR6A 4FBJB 2YLMA 3P2BA 4F1SA 3WANA 4B6WA 4IM2A 4TV3A 1WR1A 1UH6A 4LDTB 1V5TA 5LXHA 5G55A 2JRIB 3QHTA 2K8CA 4FJZA 4MGZE 2WX0A 4KDIC 1XD3B 2ASQA 3W1SC 2JRHA 1E7VA 3HM6X 3RCZA 4I6NB 3UIPB 3A9KA 4BVUC 1BT0A 4EEWA 2C5LC 3SDLC 2CHWA 3JVZX 3LJ3A 1RLFA 2RPQA 2DYMA 2J7QB 2KOXA 4WJPA 2MQJA 3KUCB 1XQQA 1UGMA 2D3GA 3A4RA 2M17A 1H4RA 2DX5B 1J0GA 3KYDD 1ZW7A 3ZW3A 3DVGY 4JGHB 3PZDA 4PS3A 3I3TB 4DWFA 2NBVB 2ZZPB 4BBNF 2AL3A 1WZ0A 2ZCBA 4ASWC 4B95A 5BO4B 4NJ7A 5AZHA 4EOYA 1X1MA 2KLCA 2L05A 1U4AA 2LI5A 2KC2A 4ZRKA 5G2NA 2LVOA 3U8ZA 2KJHB 3ONSA 1WH3A 3WAMA 1R4MI 1D3ZA 4FJYA 5D7GA 5IAAC 3UF8A 2CHZA 4WAAA 1YD8U 2MWSB 5E6NA 5CTRC 2N1VA 4K81A 2JT4B 2RSUA 3AU5A 3PREA 5CHVC 2D2QA 3V61A 5C1ZA 2KWCA 4EUTA 4RMAA 3NY5A 2G3QB 5AEKB 3DOWA 2MX2A 4WJNA 2I1JA 5D6JB 2R2OA 1YQBA 3A9JA 4HK2A 2DYBA 1WXMA 1WGDA 5AZFA 4JL9A 2KN5A 5E6OA 4JQWC 4LDTD 2N1WA 3PLUA 2CU1A 2L7RA 1IPGA 5DPRA 1WGRA 1V49A 1UD7A 2Z0EB 4HVBA 3EC8A 1WE6A 2L76A 2JZ3B 2KJRA 3H7PB 2BWES 2W9NA 4KZ0A 4MJSB 1WX9A 3UGBB 2EMTA 3WAPA 4HPLB 2ZNVC 2ZVOA 3APDA 2DENB 2KFJA 3H1UA 2MP2A 2BWFA 1YX6B 3VXWA 3DDCB 1CMXB 1WX7A 2D07B 1WMHB 3MJWA 2KTRB 2C7MB 4ICVA 3IHPC 4G50A 5L83A 4HCNB 1A5RA 3ZTCA 3PVLA 1WRDB 3AXCA 1IP9A 2WDTB 4MDKE 4MGIE 3ZLZA 1ZGUB 2B3AA 4EZJA 4KSKC 4PS8A 2KK8A 3JW0X 3VUXA 2KDFB 3QC8B 4W9DA 5GMVA 1E7UA 4M8MA 4GU2A 3A1QB 2MCNB 2NPTA 3ZDTA 4E71A 1WJ6A 5J2RA 2DZKA 1J19A 3RD2A 4ZYNA 2O6VD 1K8RB 1NDDA 4ZRIA 4MSQB 2ZVNA 4P7IA 3T8MA 3PLVA 3QA8A 2IY1B 4F7ZA 1E90A 1P3QU 2GBNA 3EHVA 4G3XB 3SU8X 2NBUA 3L10B 2V4LA 4MGYE 1TGZB 2WX1A 3RYTA 3NHEB 1GJZA 3C0RB 3TMPB 3EECA 4HDQA 4W9JA 4BKSA 4HDOA 2AL6A 2N4FA 2XBBC 2UYZB 4MSMB 3RUIB 4DHJB 1V9JA 2BF8B 4BKTA 1C1YB 2Y5BB 3B1LX 4G11A 1S3SG 2O2VB 1C3TA 4X57B 1WJNA 2KWVB 4HWIB 2BGFA 3KUDB 5D2MB 3ZUNA 4HLEA 4ANXA 2LVPA 3M63B 4G0NB 5C23A 2A4ZA 2IO1B 3ALBA 2V1YA 2KKCA 3ECIA 2GBMA 3DBRI 3NZSA 1UZXB 4IM0A 4DHZE 3VTUA 2MBEA 4KIKA 3VHTC 2KDBA 3R66C 2LRWA 2LASA 3VH3B 1V80A 3PHXB 1TTNA 1Q1OA 4EKUA 1R4NI 2KXJA 4AP4C 3H7PA 1ZKHA 3B08A 4HPMB 3VDZA 2KFKA 3PPAA 2MLBA 4NJ6A 4CYEA 4W9LA 4NAWB 2AEHA 1KJTA 2BKRB 4TKNA 1WGHA 2JVCA 2KMAA 2NR2A 2ZPNA 2LGYA 3RULA 3L17A 2FNJB 3BINA 2FAZA 5L95C 2Z0DB 5CX3A 2L0TA 4II2B 2BYEA 2OJRA 4WWPA 4NQKE 5JHAA 2L0FA 2J0JA 1RAXA 1S1QB 4PYUA 1WE7A 4W9KA 3UIOB 4GDKB 2JY6A 4W9FA 2FCQA 2LXCA 3ZVVA 3SD5A 3AULA 1WGYA 2KHWB 4ICUA 3V62A 2HE7A 2K8BA 2N9EB 3HIZA 3TIXA 5JH5C 1GUAB 3JSVB 2CS4A 1WY8A 1T0YA 2LUEA 3QK0A 1WJ4A 2KWUB 2G4SA 4OVUA 1RFAA 2DYOA 2PE6B 4K7UA 4DHJD 1EO6A 3VAWA 2IO3B 1V2YA 2KZRA 4IWQA 3IFWB 1AARA 2QHOA 3VFKA 4A3PA 3K9PB 1F9JA 2O6VB 4URKA 4OVVA 4DHZB 2VRRB 3ML8A 4IW0A 4J6IA 3ZKJC 2KC1A 4KDLB 2L3ZA 2LD9A 3QJZA 1E5WA 5DPTA 2XEWA 5CHFA 2JXXA 3GZNI 2J0KA 2LVQA 3U7DA 4II3B 4W9CA 3D32A 3PHWB 2FIFA 2JPHA 5IA7A 3DBLI 2KD0A 2DHZA 3VUYA 1SE9A 3WAOA 2L00B 4W9GA 1I42A 4DK5A 1WXAA 2MSED 3L16A 2BPSA 3CSFA 1SIFA 3HHMA 1J8CA 1Y8RC 2JUOA 2ZNVB 1YIWA 3S2AA 2DZIA 5KHOA 3M95A 2LZ6A 2R2QA 4K1RB 4FA6A 3IG3A 2K1FA 1P0RA 3PV1A 3L08A 2XK5A 4FHKA 3R7RA 4N9F4 2ZEQA 3N30A 3OAWA 2N9PC 4FJVB 3R7QA 4GXBA 4LJOB 3X0WA 1KM7A 3A9KB 4HCPB 1L2NA 1V81A 2FCNA 1MG8A 4IC7B 3TCAA 3W1SA 1IYFA 5D94A 1NI2A 2IYDB 3KYCD 4MGKE 4MH0E 4M8NA 5LXIB 4FLHA 4XX5A 2BYFA 2KVRA 1OGWA 4HJKA 5JZEB 4DBGA 2OOBB 1WM3A 4GIVA 3HK0A 3QAQA 4MM3A 1E8ZA 1P9DU 3TL5A 4ZDVA 2EMSA 2MRPA 3MTNB 4CHKA 4GDLB 3AU4A 4W9IA 2LRUA 3WALA 4AJYB 4E74A 3PRMB 1WJUA 3DCGA 3CF6E 2K25A 1OTRB 4AOFA 3CSTA 1WFYA 2AYOB 4IM3A 2N9XA 1P98A 1TBEA 3PRZA 4LJPB 2AWTA 2LWPA 2D10A 3PSEB 2K6DB 1LFDA 5LLIA 3JYUA 5DPWA 2D11A 4TUUA 4FADA 2JWZA 4M0WB 1WR6E 1ISNA 2KX0A 3KW5B 4WWNA 4IWPA 4JLCA 4I6PA 2MBHA 2KX3A 3DQVA 3UQBA 1GG3A 3A9JB 4TQ1A 3X23A 3KH0A 3ZNZB 2FIDA 2ZCCA 2C7NB 3QARA 2FCSA 4F8CB 1I35A 3PS6A 4RM8A 1JRUA 2IBIB 2KQSA 2KTFA 1WXSA 3RZWC 1OEYJ 1Q5WB 4NPNA 2HD5B 2M0XA 1WM2A 3H6NA 4DDID 4MELA 4YL8A 1L7YA 2FUHB 4EZLA 2MW5A 4MJSA 3WIMA 2GBJA 2PEAA 4KVGB 2CR5A 4WJQA 1GC7A 3VQIA 1WI0A 3M62B 4PYZA 3IBEA 2C60A 4AWJA 2NBWB 4NY0A 2KDEB 1RRBA 3PTFC 2G4DB 1EF5A 2K6QA 3EFUA 5DPSA 1WMHA 2IZVB 3OJ4B 1V6EA 2J0MA 2KTRA 3PGEA 4AJWA 1WGGA 3B0AA 2M8SA 3BY4B 4GB9A 2LGXA 5JHBA 3SHQA 2RGFA 4BFRA 2FCMA 3H7SA 3TBLD 3A33B 1KOTA 3WA0A 2A5UA 2N7DA 4LCDE 3ZNID 2ZJDA 3R3MA 1HE8A 2NVUI 3LDZE 3H9DA 2JZZA 2M1MA 2NPTB 3A1QA 4BOZB 3ZIMA 4DXAB 3ZRCA 1LM8B 2KNBA 3ZNHB 4GN1A 3HM3A 1TZ1A 2C7HA 1V5OA 3DVGX 4FULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVF A;  3QQ8 B;  2KQ7 A;  3ML9 A;  4I6L B;  4RM9 A;  3UQA A;  1EUV B;  4ANV A;  3L13 A;  2GBK A;  2GOW A;  1UBI A;  4B9K A;  3UIN B;  2IO0 B;  4GDL A;  3QX1 A;  3VTW A;  1YX5 B;  4PS7 A;  1V86 A;  5J18 A;  1Q0W B;  4TQ0 A;  5DCN A;  4EZK A;  4GGQ A;  3VUW A;  2I1K A;  1VD2 A;  3DBS A;  4FN2 A;  1NBF C;  2MBQ A;  4K7W A;  1KLV A;  4K7S A;  3T9L A;  1OEY A;  2K39 A;  4FHJ A;  1WIA A;  2O2V A;  4XZ4 A;  1Z5S B;  3RZF A;  2GMI C;  2L8J A;  2CHX A;  4CO7 A;  5J17 A;  4KV2 A;  2KAN A;  2HJ8 A;  3MHS D;  2WYQ A;  1WXV A;  2PE9 A;  3ZNG C;  2HTH A;  2V3S A;  3M3J A;  3DPD A;  2ZPY A;  4KIK B;  3VVW B;  3NZU A;  4BOS C;  5KHQ A;  1WYW B;  1VCB A;  3PRP B;  4ZRJ A;  3K9O B;  3PT2 B;  5CHW A;  3ZO5 B;  4NQL B;  3KUZ A;  2LJ5 A;  3ZRF A;  1M94 A;  1OQY A;  5E6P A;  1LQB A;  1FXT B;  2MBB B;  3TJP A;  4E3C A;  2EKE C;  3N3K B;  3ZDM C;  2KFK B;  2NCN A;  1E8Y A;  4A3O A;  4KSL C;  1WZ3 A;  1G6J A;  4NAW A;  1P1A A;  3DBH I;  2KJ6 A;  4A20 A;  2BYV E;  3QCA A;  3VH4 B;  2CKH B;  3DVN U;  1H8C A;  1LXD A;  2M4N A;  3N32 A;  1GC6 A;  2DAF A;  4HXD A;  2G45 B;  2K8H A;  4JIO U;  5AZG A;  2KLG A;  3V60 A;  2LXA A;  2PPH A;  3NS8 A;  2KO3 A;  2N7E A;  1EF1 A;  2WWZ A;  1Z2M A;  2NS5 A;  3APF A;  3L54 A;  4GDK A;  3CMM B;  3GOE A;  4BKS D;  2KDI A;  3ZTD A;  2IO2 B;  2UWQ A;  1YJ1 A;  3JSV A;  4ANW A;  2DAJ A;  1E8X A;  3U30 A;  3VTV A;  2MA9 B;  4GOC A;  4AUQ C;  4W9H A;  2RD0 A;  4WJO A;  2RR9 A;  4WQO B;  2JF5 A;  4XC2 A;  2LGD A;  2O6V A;  5EDS A;  2DZM A;  4ANU A;  4GMV A;  2PJH A;  4IWO A;  1PQS A;  2YVC A;  4GSW A;  3Q3J A;  5HKH A;  4NNJ B;  2REX A;  1E8W A;  1UBQ A;  2MBO A;  2KMC A;  2IY0 B;  1WF9 A;  2GBR A;  2BKF A;  1WX8 A;  2DZJ A;  3QWZ B;  2Z59 B;  3QIJ A;  3NOB A;  1SGH A;  4EFO A;  3AI5 A;  3A4S C;  3Q3F A;  5TR5 A;  4WWO A;  3V6C B;  3ENE A;  4W9E A;  3OJ3 A;  1UEL A;  4BBN C;  4BKG A;  2MP2 B;  4IG7 B;  1QZE A;  2C9W B;  4IUM B;  1XT9 B;  3RT3 B;  3V6E B;  3W1Y A;  4MEM A;  1GNU A;  4DDG D;  3O65 B;  3OLM D;  3DVN V;  3L0W B;  3KVF B;  4KZC A;  3APC A;  2XK5 B;  5FR6 A;  4FBJ B;  2YLM A;  3P2B A;  4F1S A;  3WAN A;  4B6W A;  4IM2 A;  4TV3 A;  1WR1 A;  1UH6 A;  4LDT B;  1V5T A;  5LXH A;  5G55 A;  2JRI B;  3QHT A;  2K8C A;  4FJZ A;  4MGZ E;  2WX0 A;  4KDI C;  1XD3 B;  2ASQ A;  3W1S C;  2JRH A;  1E7V A;  3HM6 X;  3RCZ A;  4I6N B;  3UIP B;  3A9K A;  4BVU C;  1BT0 A;  4EEW A;  2C5L C;  3SDL C;  2CHW A;  3JVZ X;  3LJ3 A;  1RLF A;  2RPQ A;  2DYM A;  2J7Q B;  2KOX A;  4WJP A;  2MQJ A;  3KUC B;  1XQQ A;  1UGM A;  2D3G A;  3A4R A;  2M17 A;  1H4R A;  2DX5 B;  1J0G A;  3KYD D;  1ZW7 A;  3ZW3 A;  3DVG Y;  4JGH B;  3PZD A;  4PS3 A;  3I3T B;  4DWF A;  2NBV B;  2ZZP B;  4BBN F;  2AL3 A;  1WZ0 A;  2ZCB A;  4ASW C;  4B95 A;  5BO4 B;  4NJ7 A;  5AZH A;  4EOY A;  1X1M A;  2KLC A;  2L05 A;  1U4A A;  2LI5 A;  2KC2 A;  4ZRK A;  5G2N A;  2LVO A;  3U8Z A;  2KJH B;  3ONS A;  1WH3 A;  3WAM A;  1R4M I;  1D3Z A;  4FJY A;  5D7G A;  5IAA C;  3UF8 A;  2CHZ A;  4WAA A;  1YD8 U;  2MWS B;  5E6N A;  5CTR C;  2N1V A;  4K81 A;  2JT4 B;  2RSU A;  3AU5 A;  3PRE A;  5CHV C;  2D2Q A;  3V61 A;  5C1Z A;  2KWC A;  4EUT A;  4RMA A;  3NY5 A;  2G3Q B;  5AEK B;  3DOW A;  2MX2 A;  4WJN A;  2I1J A;  5D6J B;  2R2O A;  1YQB A;  3A9J A;  4HK2 A;  2DYB A;  1WXM A;  1WGD A;  5AZF A;  4JL9 A;  2KN5 A;  5E6O A;  4JQW C;  4LDT D;  2N1W A;  3PLU A;  2CU1 A;  2L7R A;  1IPG A;  5DPR A;  1WGR A;  1V49 A;  1UD7 A;  2Z0E B;  4HVB A;  3EC8 A;  1WE6 A;  2L76 A;  2JZ3 B;  2KJR A;  3H7P B;  2BWE S;  2W9N A;  4KZ0 A;  4MJS B;  1WX9 A;  3UGB B;  2EMT A;  3WAP A;  4HPL B;  2ZNV C;  2ZVO A;  3APD A;  2DEN B;  2KFJ A;  3H1U A;  2MP2 A;  2BWF A;  1YX6 B;  3VXW A;  3DDC B;  1CMX B;  1WX7 A;  2D07 B;  1WMH B;  3MJW A;  2KTR B;  2C7M B;  4ICV A;  3IHP C;  4G50 A;  5L83 A;  4HCN B;  1A5R A;  3ZTC A;  3PVL A;  1WRD B;  3AXC A;  1IP9 A;  2WDT B;  4MDK E;  4MGI E;  3ZLZ A;  1ZGU B;  2B3A A;  4EZJ A;  4KSK C;  4PS8 A;  2KK8 A;  3JW0 X;  3VUX A;  2KDF B;  3QC8 B;  4W9D A;  5GMV A;  1E7U A;  4M8M A;  4GU2 A;  3A1Q B;  2MCN B;  2NPT A;  3ZDT A;  4E71 A;  1WJ6 A;  5J2R A;  2DZK A;  1J19 A;  3RD2 A;  4ZYN A;  2O6V D;  1K8R B;  1NDD A;  4ZRI A;  4MSQ B;  2ZVN A;  4P7I A;  3T8M A;  3PLV A;  3QA8 A;  2IY1 B;  4F7Z A;  1E90 A;  1P3Q U;  2GBN A;  3EHV A;  4G3X B;  3SU8 X;  2NBU A;  3L10 B;  2V4L A;  4MGY E;  1TGZ B;  2WX1 A;  3RYT A;  3NHE B;  1GJZ A;  3C0R B;  3TMP B;  3EEC A;  4HDQ A;  4W9J A;  4BKS A;  4HDO A;  2AL6 A;  2N4F A;  2XBB C;  2UYZ B;  4MSM B;  3RUI B;  4DHJ B;  1V9J A;  2BF8 B;  4BKT A;  1C1Y B;  2Y5B B;  3B1L X;  4G11 A;  1S3S G;  2O2V B;  1C3T A;  4X57 B;  1WJN A;  2KWV B;  4HWI B;  2BGF A;  3KUD B;  5D2M B;  3ZUN A;  4HLE A;  4ANX A;  2LVP A;  3M63 B;  4G0N B;  5C23 A;  2A4Z A;  2IO1 B;  3ALB A;  2V1Y A;  2KKC A;  3ECI A;  2GBM A;  3DBR I;  3NZS A;  1UZX B;  4IM0 A;  4DHZ E;  3VTU A;  2MBE A;  4KIK A;  3VHT C;  2KDB A;  3R66 C;  2LRW A;  2LAS A;  3VH3 B;  1V80 A;  3PHX B;  1TTN A;  1Q1O A;  4EKU A;  1R4N I;  2KXJ A;  4AP4 C;  3H7P A;  1ZKH A;  3B08 A;  4HPM B;  3VDZ A;  2KFK A;  3PPA A;  2MLB A;  4NJ6 A;  4CYE A;  4W9L A;  4NAW B;  2AEH A;  1KJT A;  2BKR B;  4TKN A;  1WGH A;  2JVC A;  2KMA A;  2NR2 A;  2ZPN A;  2LGY A;  3RUL A;  3L17 A;  2FNJ B;  3BIN A;  2FAZ A;  5L95 C;  2Z0D B;  5CX3 A;  2L0T A;  4II2 B;  2BYE A;  2OJR A;  4WWP A;  4NQK E;  5JHA A;  2L0F A;  2J0J A;  1RAX A;  1S1Q B;  4PYU A;  1WE7 A;  4W9K A;  3UIO B;  4GDK B;  2JY6 A;  4W9F A;  2FCQ A;  2LXC A;  3ZVV A;  3SD5 A;  3AUL A;  1WGY A;  2KHW B;  4ICU A;  3V62 A;  2HE7 A;  2K8B A;  2N9E B;  3HIZ A;  3TIX A;  5JH5 C;  1GUA B;  3JSV B;  2CS4 A;  1WY8 A;  1T0Y A;  2LUE A;  3QK0 A;  1WJ4 A;  2KWU B;  2G4S A;  4OVU A;  1RFA A;  2DYO A;  2PE6 B;  4K7U A;  4DHJ D;  1EO6 A;  3VAW A;  2IO3 B;  1V2Y A;  2KZR A;  4IWQ A;  3IFW B;  1AAR A;  2QHO A;  3VFK A;  4A3P A;  3K9P B;  1F9J A;  2O6V B;  4URK A;  4OVV A;  4DHZ B;  2VRR B;  3ML8 A;  4IW0 A;  4J6I A;  3ZKJ C;  2KC1 A;  4KDL B;  2L3Z A;  2LD9 A;  3QJZ A;  1E5W A;  5DPT A;  2XEW A;  5CHF A;  2JXX A;  3GZN I;  2J0K A;  2LVQ A;  3U7D A;  4II3 B;  4W9C A;  3D32 A;  3PHW B;  2FIF A;  2JPH A;  5IA7 A;  3DBL I;  2KD0 A;  2DHZ A;  3VUY A;  1SE9 A;  3WAO A;  2L00 B;  4W9G A;  1I42 A;  4DK5 A;  1WXA A;  2MSE D;  3L16 A;  2BPS A;  3CSF A;  1SIF A;  3HHM A;  1J8C A;  1Y8R C;  2JUO A;  2ZNV B;  1YIW A;  3S2A A;  2DZI A;  5KHO A;  3M95 A;  2LZ6 A;  2R2Q A;  4K1R B;  4FA6 A;  3IG3 A;  2K1F A;  1P0R A;  3PV1 A;  3L08 A;  2XK5 A;  4FHK A;  3R7R A;  4N9F 4;  2ZEQ A;  3N30 A;  3OAW A;  2N9P C;  4FJV B;  3R7Q A;  4GXB A;  4LJO B;  3X0W A;  1KM7 A;  3A9K B;  4HCP B;  1L2N A;  1V81 A;  2FCN A;  1MG8 A;  4IC7 B;  3TCA A;  3W1S A;  1IYF A;  5D94 A;  1NI2 A;  2IYD B;  3KYC D;  4MGK E;  4MH0 E;  4M8N A;  5LXI B;  4FLH A;  4XX5 A;  2BYF A;  2KVR A;  1OGW A;  4HJK A;  5JZE B;  4DBG A;  2OOB B;  1WM3 A;  4GIV A;  3HK0 A;  3QAQ A;  4MM3 A;  1E8Z A;  1P9D U;  3TL5 A;  4ZDV A;  2EMS A;  2MRP A;  3MTN B;  4CHK A;  4GDL B;  3AU4 A;  4W9I A;  2LRU A;  3WAL A;  4AJY B;  4E74 A;  3PRM B;  1WJU A;  3DCG A;  3CF6 E;  2K25 A;  1OTR B;  4AOF A;  3CST A;  1WFY A;  2AYO B;  4IM3 A;  2N9X A;  1P98 A;  1TBE A;  3PRZ A;  4LJP B;  2AWT A;  2LWP A;  2D10 A;  3PSE B;  2K6D B;  1LFD A;  5LLI A;  3JYU A;  5DPW A;  2D11 A;  4TUU A;  4FAD A;  2JWZ A;  4M0W B;  1WR6 E;  1ISN A;  2KX0 A;  3KW5 B;  4WWN A;  4IWP A;  4JLC A;  4I6P A;  2MBH A;  2KX3 A;  3DQV A;  3UQB A;  1GG3 A;  3A9J B;  4TQ1 A;  3X23 A;  3KH0 A;  3ZNZ B;  2FID A;  2ZCC A;  2C7N B;  3QAR A;  2FCS A;  4F8C B;  1I35 A;  3PS6 A;  4RM8 A;  1JRU A;  2IBI B;  2KQS A;  2KTF A;  1WXS A;  3RZW C;  1OEY J;  1Q5W B;  4NPN A;  2HD5 B;  2M0X A;  1WM2 A;  3H6N A;  4DDI D;  4MEL A;  4YL8 A;  1L7Y A;  2FUH B;  4EZL A;  2MW5 A;  4MJS A;  3WIM A;  2GBJ A;  2PEA A;  4KVG B;  2CR5 A;  4WJQ A;  1GC7 A;  3VQI A;  1WI0 A;  3M62 B;  4PYZ A;  3IBE A;  2C60 A;  4AWJ A;  2NBW B;  4NY0 A;  2KDE B;  1RRB A;  3PTF C;  2G4D B;  1EF5 A;  2K6Q A;  3EFU A;  5DPS A;  1WMH A;  2IZV B;  3OJ4 B;  1V6E A;  2J0M A;  2KTR A;  3PGE A;  4AJW A;  1WGG A;  3B0A A;  2M8S A;  3BY4 B;  4GB9 A;  2LGX A;  5JHB A;  3SHQ A;  2RGF A;  4BFR A;  2FCM A;  3H7S A;  3TBL D;  3A33 B;  1KOT A;  3WA0 A;  2A5U A;  2N7D A;  4LCD E;  3ZNI D;  2ZJD A;  3R3M A;  1HE8 A;  2NVU I;  3LDZ E;  3H9D A;  2JZZ A;  2M1M A;  2NPT B;  3A1Q A;  4BOZ B;  3ZIM A;  4DXA B;  3ZRC A;  1LM8 B;  2KNB A;  3ZNH B;  4GN1 A;  3HM3 A;  1TZ1 A;  2C7H A;  1V5O A;  3DVG X;  4FUL A; 
#chains in the Genus database with same CATH topology
 5EE1 A;  4RFB A;  2GBK A;  1UBI A;  3UIN B;  4GDL A;  1DOY A;  3QX1 A;  4YTN B;  1YX5 B;  1FPY A;  1V86 A;  5DCN A;  4JE3 B;  2WLB A;  1KLV A;  4YXD B;  2Q5W D;  5EE9 A;  1Z5S B;  5J17 A;  2WYQ A;  2XNA C;  3PZ8 A;  2RMM A;  1SIJ A;  3ZNG C;  2HTH A;  3DPD A;  2ZPY A;  3NZU A;  1VCB A;  3PRP B;  4C7Y A;  5CHW A;  3KUZ A;  1M94 A;  1OQY A;  5E6P A;  1LQB A;  1L4Z B;  1K53 A;  3N3K B;  2KYW A;  1KRH A;  1XF5 L;  3NVZ A;  4KSL C;  1WZ3 A;  1G6J A;  4NAW A;  3DBH I;  2KJ6 A;  3OWE B;  1TYG B;  1QKZ A;  1GC6 A;  5HHD G;  5AZG A;  1ZXI A;  2KO3 A;  1EF1 A;  3APF A;  1ZOY B;  2NS5 A;  1P7F A;  1AWD A;  3GOE A;  2UWQ A;  1YMH E;  2WXR A;  5C2T B;  4GOC A;  4W9H A;  3BZD B;  2LGD A;  4HEA 1;  1UUP A;  5EDS A;  2W3S A;  2QEJ C;  2WXL A;  1PQS A;  2BB6 A;  4GSW A;  1E6E B;  1UBQ A;  1RYJ A;  2GBR A;  2DZJ A;  3QWZ B;  2Z59 B;  3NOB A;  1D5M C;  3AI5 A;  3V6C B;  3ENE A;  4W9E A;  4KGR A;  2MP2 B;  1JRP A;  3KVF B;  4KZC A;  5FR6 A;  4F1S A;  4B6W A;  1TS3 A;  1WR1 A;  4LDT B;  1V5T A;  4C4V A;  1NYQ A;  4MGZ E;  3UIP B;  3A9K A;  1BT0 A;  1GPX A;  3SDL C;  3LJ3 A;  1F52 A;  2MQJ A;  1XQQ A;  5AUI A;  1SJH D;  2D3G A;  2DX5 B;  1XCQ L;  3KWL A;  2L32 A;  2ZZP B;  1TY2 A;  2BS3 B;  2ZCB A;  4ASW C;  3LB8 C;  2KC2 A;  3U8Z A;  3WAM A;  1D3Z A;  5D7G A;  1YD8 U;  1WSP A;  4YTM B;  2D2Q A;  2IGD A;  2KWC A;  3Q8F A;  2WXO A;  3TEX A;  5AEK B;  2MX2 A;  3EGR A;  1QLB B;  3EA6 A;  3BK1 A;  2KN5 A;  3AEF B;  5E6O A;  2KT7 A;  1C76 A;  3Q2A C;  3EC8 A;  1F2R I;  4YT0 B;  3H7P B;  2E6X A;  3Q3O C;  4MJS B;  1WX9 A;  5BYR A;  4D2K A;  2ZVO A;  4ZRP A;  4XYC A;  1ZP0 B;  2BWF A;  4S17 A;  1CMX B;  1WMH B;  1DYQ A;  2C7M B;  4G50 A;  5L83 A;  3CIR B;  2J53 A;  3Q8A A;  3PVL A;  4M02 A;  2WXP A;  1IP9 A;  1ZGU B;  3R2I A;  4XGA B;  3BYT B;  4PS8 A;  2GRI A;  4W9D A;  1E7U A;  4M8M A;  4GU2 A;  3SR6 A;  2Y3A A;  2INP E;  3GS2 A;  1WJ6 A;  3URY A;  4XWW A;  1K8R B;  1NDD A;  4GLS C;  1HZ6 A;  3IAM 1;  3ETR A;  1QQR A;  2I2Y A;  3AEB B;  2KQ4 X;  1AW7 A;  2IY1 B;  2EKI A;  4G3X B;  2NBU A;  4MGY E;  1VRA B;  3NHE B;  1GJZ A;  4BKS A;  4PK1 A;  1FEH A;  2UYZ B;  4MSM B;  2BF8 B;  2Y5B B;  1B1Z A;  2ZW1 A;  4ANX A;  4LLG M;  5C23 A;  3L4P A;  2A4Z A;  4JX1 C;  1I4X A;  2V1Y A;  1Q10 A;  1XXG A;  2CJN A;  4IM0 A;  4TSS A;  3VTU A;  4KIK A;  2V3P A;  3RNG C;  4RNA A;  3MJ5 A;  1R4N I;  2KXJ A;  2VH1 A;  1ZKH A;  1SJE D;  1ROE A;  4CYE A;  2MLB A;  1GOZ A;  3FAH A;  4NAW B;  2BKR B;  2BW2 A;  1R4M B;  3L17 A;  5L95 C;  4A9A A;  5CX3 A;  4N6E B;  2OJR A;  2KAC A;  4NQK E;  5JHA A;  1D5Z C;  4W9K A;  2JY6 A;  5EE0 A;  3FKY A;  3AUL A;  1PFD A;  2QIL A;  3V62 A;  1I4Q A;  2K8B A;  3HIZ A;  5JH5 C;  3TIX A;  1WY8 A;  2AQ3 B;  2G4S A;  1P7E A;  2N9K A;  5T8I A;  3DHI C;  1FIQ A;  2KZR A;  3IFW B;  1JWB D;  3SFE B;  4BAX A;  1AAR A;  2QHO A;  4RGT A;  4A3P A;  2QC8 A;  3K9P B;  3U7Z A;  4OVV A;  4DHZ B;  4IW0 A;  1FRR A;  3AEG B;  4KDL B;  3RNF C;  3DHH C;  5CHF A;  2JXX A;  2J0K A;  3IT4 B;  2R61 A;  1JRO A;  3U7D A;  4II3 B;  3DBH B;  2JPH A;  5IA7 A;  3DBL I;  5IN7 A;  2ONQ A;  4YSX B;  1WXA A;  1Y8R C;  4N59 A;  3Q8E A;  2DZI A;  2PW9 A;  3U4E G;  3WCQ A;  1T0Q C;  3RNA C;  4K1R B;  3PV1 A;  4ARC A;  4N9F 4;  2ZEQ A;  3N30 A;  3OAW A;  2CU3 A;  3C8Y A;  5HG2 A;  4C4V B;  1VZ7 A;  3B2G A;  2BS4 B;  3A9K B;  4HCP B;  2E3T A;  4TMA B;  2IYD B;  2XN9 C;  3KYC D;  2BBC A;  4MH0 E;  1CJE A;  4OZB A;  2BYF A;  1OGW A;  4HJK A;  5JZE B;  4DBG A;  1N6Z A;  1IUE A;  3HK0 A;  4MM3 A;  2HTM E;  3N1X C;  4ZDV A;  1TS4 A;  4CHK A;  3AE5 B;  1TKE A;  3WAL A;  4E74 A;  1WJU A;  3CF6 E;  4AOF A;  4AQ7 A;  1WFY A;  1AN8 A;  3PRZ A;  4LJP B;  2D10 A;  4MT5 A;  2QJL A;  1LFD A;  1V8C A;  2KX0 A;  4WWN A;  4I6P A;  3UQB A;  3X23 A;  3I9V 1;  3ZNZ B;  1M4V A;  2RDG A;  5FR3 A;  5JXV A;  2C7N B;  2FCS A;  1I35 A;  4RM8 A;  2IBI B;  5BMG A;  1WXS A;  4L1B A;  1WM2 A;  4DDI D;  3I5J C;  2B76 B;  4KVG B;  4WJQ A;  1XLQ A;  3VQI A;  2ACZ B;  1WI0 A;  3M62 B;  4NY0 A;  3AH7 A;  3AED B;  5DPS A;  2IZV B;  1UWX A;  3OJ4 B;  2J0M A;  2KTR A;  1WGG A;  1C4A A;  4GB9 A;  2LGX A;  1FMA D;  1FRD A;  3ABV B;  3H7S A;  3KQ4 A;  2GI9 A;  4JPS A;  1SF0 A;  1HE8 A;  2NVU I;  3LDZ E;  2JZZ A;  2M1M A;  1JWU D;  3ZRC A;  3HM3 A;  3DVG X;  3NVW A;  4XE0 A;  2KQ7 A;  3UQA A;  1EUV B;  4ANV A;  3L13 A;  2LHE A;  2MJ3 A;  1I4P A;  2M19 A;  4HJG E;  4NAM A;  5J18 A;  4QAY A;  1Q0W B;  4GGQ A;  3VUW A;  2I1K A;  1VD2 A;  4K7W A;  2MBQ A;  3T9L A;  2GLS A;  4ARI A;  3SFD B;  3NS1 A;  3RZF A;  2GMI C;  1C78 A;  1FFU A;  1SXT A;  2G1E A;  4KV2 A;  2KAN A;  3MHS D;  5GXG B;  2MH7 A;  1WXV A;  1PUT A;  4KIK B;  1J7C A;  3VVW B;  2DNF A;  4BOS C;  4HKQ A;  3ZO5 B;  2LJ5 A;  3ZRF A;  3TJP A;  4E3C A;  2EKE C;  2NCN A;  1QT9 A;  4UDU C;  3N1Y C;  3QCA A;  2KAJ A;  3GE8 C;  4A6Q A;  2DAF A;  4HXD A;  2G45 B;  4JIO U;  1RFK A;  3V60 A;  2V9H A;  1FFV A;  3NG0 A;  1WYG A;  2KDI A;  3ZTD A;  3KLS X;  1TY0 A;  2IO2 B;  1F77 A;  1OQR A;  4HRS A;  4LNO A;  2DAJ A;  2CJO A;  4KGT A;  1T0S C;  2RR9 A;  2IPK D;  2JF5 A;  2DZM A;  1R4N B;  2FE8 A;  2PJH A;  2WXJ A;  4A8X C;  3NZ3 A;  1JW9 D;  1T5X D;  2WS3 B;  1OQQ A;  3AE3 B;  4LNI A;  3Q6B A;  4EFO A;  3A4S C;  1D5X C;  3N20 C;  1UEL A;  4BBN C;  1YJJ A;  1QZE A;  2C9W B;  3FC4 A;  5HFY A;  1XT9 B;  3W1Y A;  1Y56 A;  3Q8B A;  3APC A;  3P2B A;  1UH6 A;  5LXH A;  5G55 A;  3QHT A;  2K22 A;  2K8C A;  4FJZ A;  2EEL A;  3HM6 X;  4FXC A;  4BVU C;  2CHW A;  1RLF A;  4WJP A;  2DYM A;  2J7Q B;  1JWM D;  5G5G A;  3ZXR A;  1NEK B;  1H4R A;  1J0G A;  3KYD D;  3MC0 B;  4JGH B;  3PZD A;  4PS3 A;  3I3T B;  4MM3 B;  4DWF A;  3DBL B;  2AL3 A;  1WZ0 A;  1HTQ A;  4NJ7 A;  1FNW A;  2OJW A;  2LI5 A;  2LVO A;  3AM9 A;  1EWC A;  1GB4 A;  3DWM A;  1WH3 A;  1R4M I;  3E9S A;  5IAA C;  3UF8 A;  2CHZ A;  3T3N A;  1OFF A;  4LNF A;  5CTR C;  2N1V A;  2JT4 B;  3PRE A;  5CHV C;  5C1Z A;  3DWG C;  2G3Q B;  5HI1 A;  4M0W A;  3DOW A;  3VR9 B;  1YQB A;  2DYB A;  1FD6 A;  2N1W A;  3PLU A;  1BXT A;  2L7R A;  1XEE A;  2WDV B;  1IPG A;  2W54 A;  4KZ0 A;  3UGB B;  3WAP A;  2ZNV C;  3APD A;  2DEN B;  3H1U A;  3VXW A;  1YQ3 B;  3DDC B;  1PGA A;  3MJW A;  2KTR B;  4EE2 A;  1FCC C;  1L6U A;  3ZTC A;  3AXC A;  4LNK A;  1GAQ B;  2KK8 A;  3QC8 B;  5GMV A;  1ZUD 2;  4E71 A;  1C9F A;  4O1N A;  1QF6 A;  1J19 A;  1ZE3 D;  2K3U A;  4ZRI A;  1FXI A;  2WXI A;  3PLV A;  2W82 A;  4IDI A;  1DOX A;  3SU8 X;  2GB1 A;  1HTO A;  2WQY B;  2V4L A;  1SBB B;  2WX1 A;  4OZC A;  3C0R B;  1VR9 A;  4W9J A;  3B9J A;  2XBB C;  2FUG 1;  2QSD A;  1V9J A;  1QOF A;  1C3T A;  1S3S G;  1VJK A;  1F1H A;  1WJN A;  2KWV B;  5H92 C;  2KDM A;  3KUD B;  5D2M B;  3ZUN A;  3M63 B;  2IO1 B;  3ALB A;  1ENF A;  3NZS A;  4C80 A;  1UZX B;  5D3D A;  4DHZ E;  1NI3 A;  1YOV B;  2LRW A;  4AP4 C;  3B08 A;  4NJ6 A;  4W9L A;  2NR2 A;  2ZPN A;  2J52 A;  3RUL A;  2FNJ B;  3BIN A;  1SE3 A;  2L0T A;  4II2 B;  2J0J A;  1S1Q B;  5EE3 A;  1E7P B;  3SD5 A;  2KHW B;  2HE7 A;  1GB1 A;  2LUE A;  3QK0 A;  2KWU B;  3P1M A;  2DYO A;  2PE6 B;  2WXM A;  4K7U A;  2PVG C;  4DHJ D;  4IWQ A;  3AE1 B;  2WDR B;  3TUO A;  4PT5 A;  3VFK A;  1F9J A;  4URK A;  3LXF A;  3ZKJ C;  3MHZ A;  2L3Z A;  3QJZ A;  2PLP A;  4JWS C;  5MPO A;  1FNU A;  4W9C A;  3D32 A;  2FIF A;  3Q14 C;  2X8X X;  2PKO A;  2KD0 A;  4NZL B;  2DHZ A;  3VUY A;  3WAO A;  2L00 B;  4W9G A;  1I42 A;  1XLN A;  3L16 A;  1XLP A;  2BPS A;  4J3O D;  4WWM A;  5KHO A;  3M95 A;  2R2Q A;  4FA6 A;  3IG3 A;  4FHK A;  3AEC B;  3R7R A;  1T3Q A;  2N9P C;  4ZYS A;  4FJV B;  4GXB A;  4LJO B;  1UWM A;  3PZ7 A;  1V81 A;  1XO3 A;  1BUI C;  1MG8 A;  2FCN A;  3TCA A;  3W1S A;  1IYF A;  1MJD A;  1MPE A;  4M8N A;  5LXI B;  1CZP A;  2KVR A;  4GIV A;  3HVZ A;  1E8Z A;  1P9D U;  3TL5 A;  2HJ1 A;  3MTN B;  4GDL B;  4W9I A;  4AJY B;  1K51 A;  1VZ8 A;  2K25 A;  3CST A;  1ZDX A;  2N9X A;  1TBE A;  1F0Z A;  3JYU A;  2JWZ A;  4M0W B;  1ISN A;  4JLC A;  3DQV A;  2KX3 A;  1GG3 A;  2ZCC A;  3VR8 B;  3TSS A;  2KQS A;  2UU7 A;  1JQ4 A;  2LJI A;  1Q5W B;  1QOG A;  1EWY C;  3H6N A;  3RN9 C;  4EZL A;  2GBJ A;  2PEA A;  1GC7 A;  4OW0 A;  2C60 A;  3N1Z C;  2NBW B;  1RRB A;  2M0A A;  2G4D B;  1EF5 A;  3ZYY X;  1JCK B;  4AJW A;  4K3C A;  2M8S A;  3AEA B;  2RGF A;  1PGX A;  3TBL D;  1KOT A;  3WA0 A;  4DQO C;  4NJC A;  2WXH A;  1ET6 A;  3IXS A;  2L52 A;  3A1Q A;  2KNB A;  3ZNH B;  4GN1 A;  4DXF A;  2C7H A;  1V5O A;  4WJO A;  1NYR A;  3IVF A;  4I6L B;  4B9K A;  1TS2 A;  2IO0 B;  3AB5 A;  3VTW A;  4PS7 A;  2WNM A;  2MEK A;  3AN1 A;  4TQ0 A;  1RM6 C;  1TKG A;  3DBS A;  1NBF C;  2JWU A;  2K39 A;  4FHJ A;  2O2V A;  5I4D A;  2L8J A;  2CHX A;  5BMH A;  2HJ8 A;  1D4B A;  1UGJ A;  2PE9 A;  3MC8 A;  1QIL A;  3M3J A;  2V3S A;  1C77 A;  3VRA B;  3I63 C;  3RFZ B;  2WXG A;  5KHQ A;  4KX6 B;  3AE4 B;  4ZRJ A;  3K9O B;  4NQL B;  1FXT B;  1XCT L;  2MHJ A;  4A3O A;  2K5P A;  3AE2 B;  5C3J B;  1P1A A;  2BYV E;  3DVN U;  1H8C A;  2M4N A;  3N32 A;  1TZO A;  2WGS A;  2PPH A;  2N7E A;  1EU4 A;  4GDK A;  1VDV A;  3P4S B;  4YWG G;  1N62 A;  1STE A;  2MA9 B;  4AUQ C;  1UF0 A;  2RD0 A;  2FBW B;  1L0V B;  3HRD D;  2JYT A;  4XC2 A;  2O6V A;  3AE7 B;  2ON8 A;  4IWO A;  2YVC A;  5HKH A;  4NNJ B;  1L0Y B;  1E8W A;  5E6J A;  2IY0 B;  1WX8 A;  1KLG D;  3QIJ A;  3P42 A;  1SGH A;  3Q3F A;  5TR5 A;  3AMZ A;  3P4Q B;  4C56 C;  2ICI A;  4BKG A;  4IG7 B;  2V0G A;  3V6E B;  4MEM A;  1GNU A;  4DDG D;  3O65 B;  3OLM D;  1IGC A;  2YLM A;  3WAN A;  4IM2 A;  4TV3 A;  4ZOH C;  2JRI B;  1L6V A;  2WX0 A;  1XD3 B;  3W1S C;  1E7V A;  2BT6 A;  3RCZ A;  2LMC A;  4EEW A;  3HVD A;  1L4D B;  2C5L C;  2INN E;  3JVZ X;  4US8 A;  3KUC B;  1UGM A;  4RGM A;  1KF6 B;  4P16 A;  3AE9 B;  1ZW7 A;  3Q69 A;  2SEB D;  1MHH E;  4B95 A;  5BO4 B;  2Y5P A;  3MP9 A;  1X1M A;  2KLC A;  2L05 A;  1U4A A;  3J9C A;  2LGS A;  4ZRK A;  3ONS A;  3GP7 A;  4WAA A;  4K81 A;  2RSU A;  3AU5 A;  3V61 A;  2D3B A;  4EUT A;  4RMA A;  2VZK B;  3BVM A;  3Q3M C;  1WXM A;  2PIA A;  4JQW C;  4LDT D;  1ESF A;  4L23 A;  1I4H A;  1KLU D;  1WGR A;  1V49 A;  1UD7 A;  3IAS 1;  2QCZ A;  2L83 A;  2AQ2 B;  4JWU C;  2W9N A;  2WXQ A;  4HPL B;  4XWT A;  2KFJ A;  2MP2 A;  1N61 A;  1WX7 A;  2D07 B;  4ICV A;  1E9M A;  3NJT A;  1PGB A;  2AX5 A;  4MDK E;  5BYQ A;  4EZJ A;  4KSK C;  1QOB A;  3JW0 X;  4YSZ B;  2KDF B;  3Q3N C;  3W5U B;  3A1Q B;  4WH4 A;  3DHG C;  5J2R A;  3RD2 A;  4ZYN A;  1TKY A;  3W9C B;  2ZVN A;  2K9X A;  4P7I A;  1N60 A;  3QA8 A;  4HRO A;  1L0X B;  4RGN A;  4F7Z A;  2J4X A;  5BMI A;  3RYT A;  3TMP B;  1JAL A;  3Q8C A;  2AL6 A;  1KFY B;  4WAF A;  1MG4 A;  4BKT A;  4RF1 A;  4G11 A;  2O2V B;  4X57 B;  3N9Y C;  2BGF A;  2LVP A;  1JWA D;  3SEB A;  2GBM A;  2D3C A;  3DBR I;  4AS1 A;  2LAS A;  2IND C;  1V80 A;  3PHX B;  1Q1O A;  1TTN A;  4EKU A;  3H7P A;  2H89 B;  2KFK A;  3U2S C;  1KJT A;  4TKN A;  2JVC A;  5FKA C;  1IGD A;  2LGY A;  4RF0 A;  3E56 A;  2Z0D B;  1I7H A;  4WWP A;  4REZ A;  1WE7 A;  2YEP B;  1L5P A;  4GDK B;  4W9F A;  5IO9 A;  2KWD A;  2FCQ A;  1BML C;  4M01 A;  3VRB B;  2CS4 A;  1WJ4 A;  4OVU A;  1D6E C;  3VAW A;  4B0M A;  2IO3 B;  4DXG A;  3BK2 A;  1ACC A;  2O6V B;  2KVZ A;  2VRR B;  2LEK A;  2XEW A;  3V3X A;  2LVQ A;  1VLB A;  3PHW B;  2L1A A;  2JX5 A;  4P1B C;  1SB3 C;  1EM7 A;  2MSE D;  3OG5 A;  2IDY A;  3CSF A;  1SIF A;  3HHM A;  1J8C A;  2JUO A;  2ZNV B;  1YIW A;  3S2A A;  1AYF A;  1LO5 D;  4B0E A;  3L08 A;  2XK5 A;  2J42 A;  1T0R C;  2AQ1 B;  3V05 A;  1K52 A;  2DLB A;  3UI3 A;  1KM7 A;  1L2N A;  2NTS A;  4IC7 B;  1KTK A;  1SEB D;  1WXQ A;  4A55 A;  4MGK E;  1FM0 D;  3KWV A;  3MFG A;  4FLH A;  1N5W A;  2LUM A;  2OED A;  1WM3 A;  2MJD A;  3ZXV A;  3RNB C;  2MRP A;  3AU4 A;  2LRU A;  1QOA A;  2JU6 X;  1YN5 A;  2V4I B;  2WU2 B;  1OTR B;  1P98 A;  4R3D A;  2IJ0 A;  3PSE B;  2K6D B;  1C79 A;  4FAD A;  1R7S A;  4WUR A;  2D3A A;  5G5H A;  3KH0 A;  3NVV A;  2FID A;  3QAR A;  3AE8 B;  3PS6 A;  1YNT E;  1JRU A;  3RNC C;  1TJE A;  3RZW C;  3BII D;  2M0X A;  4MEL A;  4YL8 A;  3NVY A;  2MW5 A;  4YSY B;  3WIM A;  3RPF C;  4PYZ A;  2PTL A;  3TEY A;  1FXA A;  2BQQ A;  1PYW D;  1V6E A;  3PGE A;  3SHQ A;  1NVI D;  4BFR A;  3IT6 B;  1MI0 A;  3A33 B;  3RMK C;  2A5U A;  2N7D A;  4LCD E;  1FO4 A;  3ZNI D;  2ZJD A;  3H9D A;  4MH8 A;  4WIP A;  1CQV A;  2W55 A;  4BOZ B;  3ZIM A;  1LM8 B;  2RDB C;  2BYT A;  3GZN B;  1E10 A;  1TZ1 A;  2N0S B;  1FNV A;  4BZA A;  1V1P A;  4ZRQ A;  4FUL A;  1V97 A;  3QQ8 B;  3ML9 A;  4RM9 A;  4C00 A;  2NTT A;  2GOW A;  2DWQ A;  1UNS A;  2D5G A;  1N5X A;  1C4C A;  5IP4 D;  4HPP A;  4OVZ A;  4EZK A;  4ZHP A;  1PDX A;  1MFW A;  4FN2 A;  2N7J A;  4K7S A;  1OEY A;  1WIA A;  4XZ4 A;  3T3O A;  4H2A A;  4USA A;  4CO7 A;  3BWU D;  2INC C;  3EFC A;  3HUI A;  1V1O A;  1WYW B;  3PT2 B;  1YJI A;  2MBB B;  3W2D A;  2Y5C A;  1XLO A;  3ZDM C;  4HKZ E;  2KFK B;  1E8Y A;  2G9H D;  1VZ6 A;  2HDE A;  4A20 A;  3VH4 B;  2LFI A;  2CKH B;  1DGJ A;  1LXD A;  2K8H A;  2KLG A;  2LXA A;  3NS8 A;  1IBX A;  2WWZ A;  1Z2M A;  3L54 A;  3CMM B;  5IKC M;  4BKS D;  2BTE A;  1YJ1 A;  4LNN A;  3JSV A;  2NMQ A;  2BB5 A;  4ANW A;  3U30 A;  1E8X A;  3DBR B;  3VTV A;  1KH0 A;  2VZK D;  4WQO B;  5H8Y E;  3ZJV A;  4ANU A;  1JWS D;  4GMV A;  1ZXH A;  4S0R A;  5AUK A;  3Q3J A;  2REX A;  2MBO A;  4ACF A;  2KMC A;  1WF9 A;  2MJE A;  2BKF A;  2KN4 A;  5BYS A;  4P1C C;  2OHF A;  3RI7 C;  2JYE A;  2N9L A;  4WWO A;  3OJ3 A;  4IUM B;  2QDF A;  1CK1 A;  3RT3 B;  4KKJ A;  3DVN V;  3L0W B;  2XK5 B;  4FBJ B;  1HEZ E;  3P4P B;  2Z8L A;  4WQM A;  4KDI C;  4XDC A;  2ASQ A;  2JRH A;  4I6N B;  2H88 B;  2RPQ A;  2KOX A;  3R8B A;  3A4R A;  3ZQ4 A;  2M17 A;  4RGO S;  3ZW3 A;  3DVG Y;  3O13 A;  3NUH B;  1YN3 A;  3RNE C;  2NBV B;  1N63 A;  4BBN F;  5AZH A;  1SSN A;  4EOY A;  5G2N A;  4IKG A;  2KJH B;  3FIL A;  4FJY A;  3LYY A;  4ZHO A;  1A70 A;  2RDH A;  1E0Z A;  2MWS B;  5E6N A;  1I4R A;  3NY5 A;  2LGI A;  1C4P A;  3AEE B;  4WJN A;  2I1J A;  5D6J B;  2R2O A;  3CWI A;  4N58 A;  1HQR D;  2WXF A;  3A9J A;  4HK2 A;  1WGD A;  5AZF A;  3ZJU A;  2RPV A;  3P4R B;  4JL9 A;  2CU1 A;  5DPR A;  2YEP F;  4OHJ A;  2Z0E B;  4HVB A;  1WE6 A;  2L76 A;  3ZGZ A;  2JZ3 B;  2KJR A;  2BWE S;  2EMT A;  3NRZ A;  1YX6 B;  4C7Z A;  3P63 A;  2SAK A;  2ZW0 A;  1EU3 A;  3TEW A;  3IHP C;  4HCN B;  1FCL A;  1A5R A;  1WRD B;  2WDT B;  4MGI E;  3ZLZ A;  2B3A A;  2JSV X;  3VUX A;  2MCN B;  2NPT A;  3ZDT A;  1WGK A;  3TEZ A;  2DZK A;  1V1P B;  1HA5 A;  2M56 B;  3BYY B;  2O6V D;  2LHD A;  4MSQ B;  3T8M A;  1TS5 A;  4K3B A;  1E90 A;  1P3Q U;  2GBN A;  3EHV A;  3L10 B;  1TGZ B;  4MAC A;  3EEC A;  4HDQ A;  1K50 A;  4HDO A;  2N4F A;  3RUI B;  1TT5 B;  4DHJ B;  1C1Y B;  3B1L X;  3C19 A;  2V3N A;  5LNK 1;  3U52 E;  4HWI B;  3BVZ A;  4HLE A;  1YN4 A;  4A90 A;  5IOI A;  4G0N B;  2VH2 A;  2KKC A;  3EUB 2;  3ECI A;  2BS2 B;  1RWS A;  4M00 A;  2MBE A;  3VHT C;  3AE6 B;  2KDB A;  3R66 C;  1DOI A;  3VH3 B;  4HPM B;  3VDZ A;  2PVO D;  3PPA A;  1HXY D;  2AEH A;  2DBY A;  1WGH A;  1YQ4 B;  2KMA A;  5TSS A;  1SE4 A;  2FAZ A;  2W3R A;  1MVK A;  1ET9 A;  2BYE A;  2L0F A;  1B9R A;  1RAX A;  2IGH A;  1IBX B;  4PYU A;  3I57 A;  3UIO B;  2LXC A;  4RH6 A;  3ZVV A;  4L2Y A;  2WU5 B;  1SE2 A;  1WGY A;  1NEN B;  4ICU A;  2BVC A;  2N9E B;  1GUA B;  3JSV B;  1T0Y A;  1RFA A;  1EO6 A;  1V2Y A;  2JQR B;  1TIF A;  3ML8 A;  1F2R C;  2QMT A;  2WDQ B;  4J6I A;  2KC1 A;  3BVG A;  5DPT A;  2LD9 A;  1E5W A;  3GZN I;  2WXN A;  1WRI A;  2JXT A;  4LTU A;  1WWT A;  2WHI A;  3GE3 C;  1SE9 A;  2I38 A;  2TSS A;  4DK5 A;  5FK9 C;  4KGS A;  2X38 A;  2LZ6 A;  1T6B X;  2WXK A;  2K1F A;  1P0R A;  1LGR A;  1HZ5 A;  3R7Q A;  3MC9 A;  3X0W A;  3AV8 A;  4YTP B;  3PO0 A;  5D94 A;  1NI2 A;  3GB1 A;  4XX5 A;  2WP9 B;  4IOI E;  2OOB B;  3QAQ A;  2EMS A;  1I4G A;  4P6V F;  3PRM B;  3DCG A;  3FIL B;  4ITK A;  2AYO B;  4IM3 A;  2AWT A;  2LWP A;  5D3I B;  2K0P A;  5LLI A;  5DPW A;  2D11 A;  2KMM A;  4TUU A;  2JZP A;  1WR6 E;  4RCO A;  3KW5 B;  4IWP A;  2MBH A;  4TQ1 A;  3A9J B;  2QIE B;  1JML A;  4F8C B;  2KTF A;  3ZJT A;  4XDD A;  1J7B A;  1OEY J;  4NPN A;  3B2F A;  3R2T A;  1ZPS A;  2HD5 B;  4US9 A;  1L7Y A;  2FUH B;  2IGG A;  3H8H A;  4MJS A;  2CR5 A;  3IBE A;  1ZDV A;  4AWJ A;  2KDE B;  4CQN A;  3PTF C;  2K6Q A;  3EFU A;  1J7A A;  1WMH A;  3B0A A;  2PMV A;  3BY4 B;  4LK0 M;  5JHB A;  2FCM A;  1MHX A;  3W5V B;  3R3M A;  4OZA A;  4KKI A;  2NPT B;  4DXA B;  4Q2J A; 
#chains in the Genus database with same CATH homology
 3IVF A;  3QQ8 B;  2KQ7 A;  3ML9 A;  4I6L B;  4RM9 A;  3UQA A;  1EUV B;  4ANV A;  3L13 A;  2GBK A;  2GOW A;  1UBI A;  4B9K A;  3UIN B;  2IO0 B;  4GDL A;  3QX1 A;  3VTW A;  1YX5 B;  4PS7 A;  1V86 A;  5J18 A;  1Q0W B;  4TQ0 A;  5DCN A;  4EZK A;  4GGQ A;  3VUW A;  2I1K A;  1VD2 A;  3DBS A;  4FN2 A;  1NBF C;  2MBQ A;  4K7W A;  1KLV A;  4K7S A;  3T9L A;  1OEY A;  2K39 A;  4FHJ A;  1WIA A;  2O2V A;  4XZ4 A;  1Z5S B;  3RZF A;  2GMI C;  2L8J A;  2CHX A;  4CO7 A;  5J17 A;  4KV2 A;  2KAN A;  2HJ8 A;  3MHS D;  2WYQ A;  1WXV A;  2PE9 A;  3ZNG C;  2HTH A;  2V3S A;  3M3J A;  3DPD A;  2ZPY A;  4KIK B;  3VVW B;  3NZU A;  4BOS C;  5KHQ A;  1WYW B;  1VCB A;  3PRP B;  4ZRJ A;  3K9O B;  3PT2 B;  5CHW A;  3ZO5 B;  4NQL B;  3KUZ A;  2LJ5 A;  3ZRF A;  1M94 A;  1OQY A;  5E6P A;  1LQB A;  1FXT B;  2MBB B;  3TJP A;  4E3C A;  2EKE C;  3N3K B;  3ZDM C;  2KFK B;  2NCN A;  1E8Y A;  4A3O A;  4KSL C;  1WZ3 A;  1G6J A;  4NAW A;  1P1A A;  3DBH I;  2KJ6 A;  4A20 A;  2BYV E;  3QCA A;  3VH4 B;  2CKH B;  3DVN U;  1H8C A;  1LXD A;  2M4N A;  3N32 A;  1GC6 A;  2DAF A;  4HXD A;  2G45 B;  2K8H A;  4JIO U;  5AZG A;  2KLG A;  3V60 A;  2LXA A;  2PPH A;  3NS8 A;  2KO3 A;  2N7E A;  1EF1 A;  2WWZ A;  1Z2M A;  2NS5 A;  3APF A;  3L54 A;  4GDK A;  3CMM B;  3GOE A;  4BKS D;  2KDI A;  3ZTD A;  2IO2 B;  2UWQ A;  1YJ1 A;  3JSV A;  4ANW A;  2DAJ A;  1E8X A;  3U30 A;  3VTV A;  2MA9 B;  4GOC A;  4AUQ C;  4W9H A;  2RD0 A;  4WJO A;  2RR9 A;  4WQO B;  2JF5 A;  4XC2 A;  2LGD A;  2O6V A;  5EDS A;  2DZM A;  4ANU A;  4GMV A;  2PJH A;  4IWO A;  1PQS A;  2YVC A;  4GSW A;  3Q3J A;  5HKH A;  4NNJ B;  2REX A;  1E8W A;  1UBQ A;  2MBO A;  2KMC A;  2IY0 B;  1WF9 A;  2GBR A;  2BKF A;  1WX8 A;  2DZJ A;  3QWZ B;  2Z59 B;  3QIJ A;  3NOB A;  1SGH A;  4EFO A;  3AI5 A;  3A4S C;  3Q3F A;  5TR5 A;  4WWO A;  3V6C B;  3ENE A;  4W9E A;  3OJ3 A;  1UEL A;  4BBN C;  4BKG A;  2MP2 B;  4IG7 B;  1QZE A;  2C9W B;  4IUM B;  1XT9 B;  3RT3 B;  3V6E B;  3W1Y A;  4MEM A;  1GNU A;  4DDG D;  3O65 B;  3OLM D;  3DVN V;  3L0W B;  3KVF B;  4KZC A;  3APC A;  2XK5 B;  5FR6 A;  4FBJ B;  2YLM A;  3P2B A;  4F1S A;  3WAN A;  4B6W A;  4IM2 A;  4TV3 A;  1WR1 A;  1UH6 A;  4LDT B;  1V5T A;  5LXH A;  5G55 A;  2JRI B;  3QHT A;  2K8C A;  4FJZ A;  4MGZ E;  2WX0 A;  4KDI C;  1XD3 B;  2ASQ A;  3W1S C;  2JRH A;  1E7V A;  3HM6 X;  3RCZ A;  4I6N B;  3UIP B;  3A9K A;  4BVU C;  1BT0 A;  4EEW A;  2C5L C;  3SDL C;  2CHW A;  3JVZ X;  3LJ3 A;  1RLF A;  2RPQ A;  2DYM A;  2J7Q B;  2KOX A;  4WJP A;  2MQJ A;  3KUC B;  1XQQ A;  1UGM A;  2D3G A;  3A4R A;  2M17 A;  1H4R A;  2DX5 B;  1J0G A;  3KYD D;  1ZW7 A;  3ZW3 A;  3DVG Y;  4JGH B;  3PZD A;  4PS3 A;  3I3T B;  4DWF A;  2NBV B;  2ZZP B;  4BBN F;  2AL3 A;  1WZ0 A;  2ZCB A;  4ASW C;  4B95 A;  5BO4 B;  4NJ7 A;  5AZH A;  4EOY A;  1X1M A;  2KLC A;  2L05 A;  1U4A A;  2LI5 A;  2KC2 A;  4ZRK A;  5G2N A;  2LVO A;  3U8Z A;  2KJH B;  3ONS A;  1WH3 A;  3WAM A;  1R4M I;  1D3Z A;  4FJY A;  5D7G A;  5IAA C;  3UF8 A;  2CHZ A;  4WAA A;  1YD8 U;  2MWS B;  5E6N A;  5CTR C;  2N1V A;  4K81 A;  2JT4 B;  2RSU A;  3AU5 A;  3PRE A;  5CHV C;  2D2Q A;  3V61 A;  5C1Z A;  2KWC A;  4EUT A;  4RMA A;  3NY5 A;  2G3Q B;  5AEK B;  3DOW A;  2MX2 A;  4WJN A;  2I1J A;  5D6J B;  2R2O A;  1YQB A;  3A9J A;  4HK2 A;  2DYB A;  1WXM A;  1WGD A;  5AZF A;  4JL9 A;  2KN5 A;  5E6O A;  4JQW C;  4LDT D;  2N1W A;  3PLU A;  2CU1 A;  2L7R A;  1IPG A;  5DPR A;  1WGR A;  1V49 A;  1UD7 A;  2Z0E B;  4HVB A;  3EC8 A;  1WE6 A;  2L76 A;  2JZ3 B;  2KJR A;  3H7P B;  2BWE S;  2W9N A;  4KZ0 A;  4MJS B;  1WX9 A;  3UGB B;  2EMT A;  3WAP A;  4HPL B;  2ZNV C;  2ZVO A;  3APD A;  2DEN B;  2KFJ A;  3H1U A;  2MP2 A;  2BWF A;  1YX6 B;  3VXW A;  3DDC B;  1CMX B;  1WX7 A;  2D07 B;  1WMH B;  3MJW A;  2KTR B;  2C7M B;  4ICV A;  3IHP C;  4G50 A;  5L83 A;  4HCN B;  1A5R A;  3ZTC A;  3PVL A;  1WRD B;  3AXC A;  1IP9 A;  2WDT B;  4MDK E;  4MGI E;  3ZLZ A;  1ZGU B;  2B3A A;  4EZJ A;  4KSK C;  4PS8 A;  2KK8 A;  3JW0 X;  3VUX A;  2KDF B;  3QC8 B;  4W9D A;  5GMV A;  1E7U A;  4M8M A;  4GU2 A;  3A1Q B;  2MCN B;  2NPT A;  3ZDT A;  4E71 A;  1WJ6 A;  5J2R A;  2DZK A;  1J19 A;  3RD2 A;  4ZYN A;  2O6V D;  1K8R B;  1NDD A;  4ZRI A;  4MSQ B;  2ZVN A;  4P7I A;  3T8M A;  3PLV A;  3QA8 A;  2IY1 B;  4F7Z A;  1E90 A;  1P3Q U;  2GBN A;  3EHV A;  4G3X B;  3SU8 X;  2NBU A;  3L10 B;  2V4L A;  4MGY E;  1TGZ B;  2WX1 A;  3RYT A;  3NHE B;  1GJZ A;  3C0R B;  3TMP B;  3EEC A;  4HDQ A;  4W9J A;  4BKS A;  4HDO A;  2AL6 A;  2N4F A;  2XBB C;  2UYZ B;  4MSM B;  3RUI B;  4DHJ B;  1V9J A;  2BF8 B;  4BKT A;  1C1Y B;  2Y5B B;  3B1L X;  4G11 A;  1S3S G;  2O2V B;  1C3T A;  4X57 B;  1WJN A;  2KWV B;  4HWI B;  2BGF A;  3KUD B;  5D2M B;  3ZUN A;  4HLE A;  4ANX A;  2LVP A;  3M63 B;  4G0N B;  5C23 A;  2A4Z A;  2IO1 B;  3ALB A;  2V1Y A;  2KKC A;  3ECI A;  2GBM A;  3DBR I;  3NZS A;  1UZX B;  4IM0 A;  4DHZ E;  3VTU A;  2MBE A;  4KIK A;  3VHT C;  2KDB A;  3R66 C;  2LRW A;  2LAS A;  3VH3 B;  1V80 A;  3PHX B;  1TTN A;  1Q1O A;  4EKU A;  1R4N I;  2KXJ A;  4AP4 C;  3H7P A;  1ZKH A;  3B08 A;  4HPM B;  3VDZ A;  2KFK A;  3PPA A;  2MLB A;  4NJ6 A;  4CYE A;  4W9L A;  4NAW B;  2AEH A;  1KJT A;  2BKR B;  4TKN A;  1WGH A;  2JVC A;  2KMA A;  2NR2 A;  2ZPN A;  2LGY A;  3RUL A;  3L17 A;  2FNJ B;  3BIN A;  2FAZ A;  5L95 C;  2Z0D B;  5CX3 A;  2L0T A;  4II2 B;  2BYE A;  2OJR A;  4WWP A;  4NQK E;  5JHA A;  2L0F A;  2J0J A;  1RAX A;  1S1Q B;  4PYU A;  1WE7 A;  4W9K A;  3UIO B;  4GDK B;  2JY6 A;  4W9F A;  2FCQ A;  2LXC A;  3ZVV A;  3SD5 A;  3AUL A;  1WGY A;  2KHW B;  4ICU A;  3V62 A;  2HE7 A;  2K8B A;  2N9E B;  3HIZ A;  3TIX A;  5JH5 C;  1GUA B;  3JSV B;  2CS4 A;  1WY8 A;  1T0Y A;  2LUE A;  3QK0 A;  1WJ4 A;  2KWU B;  2G4S A;  4OVU A;  1RFA A;  2DYO A;  2PE6 B;  4K7U A;  4DHJ D;  1EO6 A;  3VAW A;  2IO3 B;  1V2Y A;  2KZR A;  4IWQ A;  3IFW B;  1AAR A;  2QHO A;  3VFK A;  4A3P A;  3K9P B;  1F9J A;  2O6V B;  4URK A;  4OVV A;  4DHZ B;  2VRR B;  3ML8 A;  4IW0 A;  4J6I A;  3ZKJ C;  2KC1 A;  4KDL B;  2L3Z A;  2LD9 A;  3QJZ A;  1E5W A;  5DPT A;  2XEW A;  5CHF A;  2JXX A;  3GZN I;  2J0K A;  2LVQ A;  3U7D A;  4II3 B;  4W9C A;  3D32 A;  3PHW B;  2FIF A;  2JPH A;  5IA7 A;  3DBL I;  2KD0 A;  2DHZ A;  3VUY A;  1SE9 A;  3WAO A;  2L00 B;  4W9G A;  1I42 A;  4DK5 A;  1WXA A;  2MSE D;  3L16 A;  2BPS A;  3CSF A;  1SIF A;  3HHM A;  1J8C A;  1Y8R C;  2JUO A;  2ZNV B;  1YIW A;  3S2A A;  2DZI A;  5KHO A;  3M95 A;  2LZ6 A;  2R2Q A;  4K1R B;  4FA6 A;  3IG3 A;  2K1F A;  1P0R A;  3PV1 A;  3L08 A;  2XK5 A;  4FHK A;  3R7R A;  4N9F 4;  2ZEQ A;  3N30 A;  3OAW A;  2N9P C;  4FJV B;  3R7Q A;  4GXB A;  4LJO B;  3X0W A;  1KM7 A;  3A9K B;  4HCP B;  1L2N A;  1V81 A;  2FCN A;  1MG8 A;  4IC7 B;  3TCA A;  3W1S A;  1IYF A;  5D94 A;  1NI2 A;  2IYD B;  3KYC D;  4MGK E;  4MH0 E;  4M8N A;  5LXI B;  4FLH A;  4XX5 A;  2BYF A;  2KVR A;  1OGW A;  4HJK A;  5JZE B;  4DBG A;  2OOB B;  1WM3 A;  4GIV A;  3HK0 A;  3QAQ A;  4MM3 A;  1E8Z A;  1P9D U;  3TL5 A;  4ZDV A;  2EMS A;  2MRP A;  3MTN B;  4CHK A;  4GDL B;  3AU4 A;  4W9I A;  2LRU A;  3WAL A;  4AJY B;  4E74 A;  3PRM B;  1WJU A;  3DCG A;  3CF6 E;  2K25 A;  1OTR B;  4AOF A;  3CST A;  1WFY A;  2AYO B;  4IM3 A;  2N9X A;  1P98 A;  1TBE A;  3PRZ A;  4LJP B;  2AWT A;  2LWP A;  2D10 A;  3PSE B;  2K6D B;  1LFD A;  5LLI A;  3JYU A;  5DPW A;  2D11 A;  4TUU A;  4FAD A;  2JWZ A;  4M0W B;  1WR6 E;  1ISN A;  2KX0 A;  3KW5 B;  4WWN A;  4IWP A;  4JLC A;  4I6P A;  2MBH A;  2KX3 A;  3DQV A;  3UQB A;  1GG3 A;  3A9J B;  4TQ1 A;  3X23 A;  3KH0 A;  3ZNZ B;  2FID A;  2ZCC A;  2C7N B;  3QAR A;  2FCS A;  4F8C B;  1I35 A;  3PS6 A;  4RM8 A;  1JRU A;  2IBI B;  2KQS A;  2KTF A;  1WXS A;  3RZW C;  1OEY J;  1Q5W B;  4NPN A;  2HD5 B;  2M0X A;  1WM2 A;  3H6N A;  4DDI D;  4MEL A;  4YL8 A;  1L7Y A;  2FUH B;  4EZL A;  2MW5 A;  4MJS A;  3WIM A;  2GBJ A;  2PEA A;  4KVG B;  2CR5 A;  4WJQ A;  1GC7 A;  3VQI A;  1WI0 A;  3M62 B;  4PYZ A;  3IBE A;  2C60 A;  4AWJ A;  2NBW B;  4NY0 A;  2KDE B;  1RRB A;  3PTF C;  2G4D B;  1EF5 A;  2K6Q A;  3EFU A;  5DPS A;  1WMH A;  2IZV B;  3OJ4 B;  1V6E A;  2J0M A;  2KTR A;  3PGE A;  4AJW A;  1WGG A;  3B0A A;  2M8S A;  3BY4 B;  4GB9 A;  2LGX A;  5JHB A;  3SHQ A;  2RGF A;  4BFR A;  2FCM A;  3H7S A;  3TBL D;  3A33 B;  1KOT A;  3WA0 A;  2A5U A;  2N7D A;  4LCD E;  3ZNI D;  2ZJD A;  3R3M A;  1HE8 A;  2NVU I;  3LDZ E;  3H9D A;  2JZZ A;  2M1M A;  2NPT B;  3A1Q A;  4BOZ B;  3ZIM A;  4DXA B;  3ZRC A;  1LM8 B;  2KNB A;  3ZNH B;  4GN1 A;  3HM3 A;  1TZ1 A;  2C7H A;  1V5O A;  3DVG X;  4FUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...