2PKOA

Crystal structure of yeast urm1 at 1.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
b'MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-related modifier 1
publication title The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pkoA00
1JROA 2PKOA 1JRPA 4N58A 4C7ZA 1VJKA 2DBYA 2WDVB 1ZXIA 4C7YA 1TKYA 2K9XA 1YJIA 1OQRA 5G5GA 4JWSC 3SR6A 3W9CB 3AEDB 1SF0A 2M19A 3CIRB 1JW9D 2CJOA 2FBWB 1RWSA 1V97A 3VRAB 1NEKB 1XLPA 4YTPB 1B9RA 2CU3A 2CJNA 3P1MA 4YTNB 2Q5WD 5MPOA 4YT0B 1QLBB 1WWTA 2H89B 2M56B 2N0SB 3ETRA 2OHFA 3HRDD 1PUTA 3PO0A 1DOIA 1CJEA 2WP9B 3EUB2 2L83A 5C2TB 4IDIA 3KWLA 4YSYB 4FXCA 1WRIA 3NS1A 3LXFA 5AUIA 4WQMA 1RFKA 3FAHA 3NVVA 1ZP0B 1V8CA 2KMMA 3AB5A 2MH7A 2E3TA 2W54A 3NVWA 3P4PB 2Y5CA 1E9MA 1L6UA 5GXGB 1E7PB 2HTME 1J7CA 1I7HA 3AE5B 3B2FA 3DWMA 5EE1A 3NRZA 1YJJA 4LTUA 1DOXA 3CWIA 1FRRA 3AN1A 3AECB 2BS2B 1TKGA 5AUKA 4US8A 4P6VF 3SFEB 4ZOHC 1GPXA 2MJDA 2WDQB 1L0VB 1TJEA 3DWGC 1ZOYB 4N59A 1FXAA 1OFFA 1FXIA 1KFYB 2K22A 5EE9A 2KAJA 2QJLA 3B2GA 5H8YE 3W5VB 1F0ZA 5EE3A 2W3SA 2WS3B 3AE6B 3NVZA 4JWUC 3NVYA 5H92C 1CZPA 1OQQA 2WU2B 4US9A 3P4RB 1XLQA 2LEKA 1NI3A 3P4QB 3SFDB 2K5PA 2QIEB 1QF6A 1RM6C 2WU5B 1VDVA 1RYJA 3B9JA 1VLBA 1L5PA 1N5WA 1NVID 1XLOA 1KRHA 2DWQA 1YQ4B 2MJEA 2PVGC 1J7AA 1N5XA 3BIID 5EE0A 1NYQA 4WWMA 2EKIA 4HROA 2BS3B 3AE2B 1QT9A 3P4SB 5C3JB 1JQ4A 3VR8B 2AX5A 2W55A 4C80A 4ZHPA 1AWDA 3AEGB 4N6EB 1N61A 1JWBD 4JX1C 1PDXA 4A9AA 1EWYC 1NENB 2JX5A 1KF6B 3VR9B 1NYRA 1UWMA 2L52A 5G5HA 1FO4A 3AE7B 1FRDA 3AEEB 2ACZB 1J7BA 2MJ3A 2H88B 3AE9B 3L4PA 3W5UB 1QOBA 2JQRB 1FFUA 1N62A 1TYGB 3AEBB 1N60A 1QOGA 3AV8A 4HRSA 4ZHOA 3ZYYX 1WYGA 2WLBA 1AYFA 1SIJA 1N63A 4YTMB 1WXQA 1T3QA 3AE1B 2PIAA 4KX6B 1A70A 2B76B 1SB3C 1XO3A 2W3RA 1GAQB 3WCQA 1ROEA 4YSZB 1DOYA 1R7SA 3ABVB 2PVOD 3LB8C 3AH7A 2WQYB 1FMAD 1IUEA 3P63A 3AE4B 3AEAB 1PFDA 3FC4A 3AM9A 1DGJA 2WDRB 4YXDB 1E0ZA 2G1EA 1TKEA 1YQ3B 1WGKA 3HVZA 2BS4B 2BT6A 3AE8B 3RPFC 3VRBB 1XLNA 1FM0D 3AEFB 1FFVA 1JALA 1QOAA 1L6VA 1QOFA 1E6EB 1FIQA 3HUIA 3AE3B 4USAA 1JWAD 4YSXB 1E10A 3AMZA 4ITKA 1ZUD2
chains in the Genus database with same CATH superfamily
2WXJA 1JWMD 4GLSC 2K9XA 4M02A 2HJ8A 1GG3A 3AEDB 1K8RB 3WAMA 2BGFA 3ZVVA 3VUWA 1BMLC 3BVZA 4HKQA 1TIFA 3ZW3A 2EMTA 4GXBA 3N3KB 3DBHI 3IG3A 3ZJTA 4WQMA 1XXGA 3U4EG 3UINB 2LGYA 1FCCC 1YJJA 4LTUA 3CWIA 2LGIA 2KMCA 3OG5A 1UNSA 1TJEA 3EHVA 4N59A 1FXIA 1T5XD 4NJCA 5BMHA 4PYUA 4W9LA 2Y5PA 1WGYA 2XN9C 5AZFA 2W3SA 2WS3B 3AE6B 2UU7A 1XQQA 4QAYA 3RFZB 2CHWA 3Q3JA 5FK9C 1GB1A 2EKEC 4BZAA 1C3TA 1WX7A 3MHZA 1YQ4B 4L1BA 4N9F4 1KOTA 4GDKB 2KWUB 1AWDA 4N6EB 4IOIE 5HG2A 2KWDA 3W1SA 3K9OB 2DYBA 1WMHA 4NAWA 1QOBA 3HVDA 1QOGA 3AV8A 1I4HA 1WYGA 1ZE3D 4RGNA 2J0JA 2RDHA 4FJVB 3U8ZA 4OZCA 4P16A 5HKHA 3AEAB 2OEDA 3AM9A 5CX3A 2KN5A 1KH0A 1KLVA 2L76A 2FCMA 1SJED 3Q8CA 5AZGA 1FFVA 3LYYA 3K9PB 2LHEA 2KFKB 2QMTA 4H2AA 1HTOA 3TIXA 2MCNB 1I4GA 3Q3MC 2FE8A 3CIRB 4XYCA 2WXRA 1XLPA 3AU5A 4NZLB 2N9KA 4C00A 2DZKA 2L83A 3BVMA 4XX5A 1HEZE 5FKAC 1WRIA 2KTRB 3PLUA 2O2VA 1SE3A 4EUTA 3Q2AC 3ZXVA 5D94A 4LK0M 3I3TB 1GUAB 2QDFA 1ZOYB 1L4DB 4LDTD 4JPSA 1EF5A 3SFDB 2IYDB 3PSEB 1RYJA 1L5PA 1B9RA 2LASA 2DWQA 3Q8FA 1P7EA 1N6ZA 2EKIA 2MLBA 2W55A 3AXCA 4C80A 2JRIB 1GNUA 3NOBA 3AE9B 1SXTA 1D5MC 2K1FA 2XK5B 1MVKA 3W5UB 3A9KA 3MC8A 3KLSX 5LXIB 1P3QU 3A9JB 2BPSA 1YN5A 4NY0A 4YSZB 2BYTA 4MT5A 4RGOS 2WX1A 2G1EA 1IYFA 5L83A 2LWPA 2PMVA 3Q3OC 1QOFA 1GOZA 5LXHA 1TZ1A 3RNBC 2ZJDA 3VH4B 2PKOA 2I2YA 4IM2A 3IXSA 1Q10A 2LGXA 1JW9D 2FBWB 3VDZA 3L54A 1C4AA 4YTNB 1MHHE 5IO9A 4II2B 4MM3B 4KVGB 1H8CA 1EWCA 1CJEA 4MH8A 4K3BA 1BXTA 2SEBD 2ZW0A 1L7YA 3DCGA 1L6UA 1J7CA 4CQNA 4WJNA 4RGMA 3PHWB 3FILB 2N1WA 1WIAA 3U52E 5EE9A 3BYYB 4WAAA 1MG8A 4FHKA 1UZXB 4GGQA 1ZDXA 2MW5A 3DDCB 3JSVB 3N30A 1ET6A 3UIOB 3ZDMC 2G45B 1VLBA 3BIID 1RFAA 2LRWA 4WWMA 1IBXA 1ISNA 2IY1B 1AN8A 2IO2B 4K7WA 2GI9A 1F52A 2JX5A 1HZ6A 1FRDA 2KZRA 3O13A 2D10A 1VD2A 4MJSA 3VUXA 4GDLB 2PIAA 2GB1A 2KC1A 3WCQA 3PS6A 1SGHA 3SU8X 2C7MB 4WIPA 2VH2A 1K53A 2J52A 3HVZA 1WM3A 3GP7A 1UGJA 3HIZA 1C79A 1EM7A 3EGRA 4LJOB 1R4NB 4J3OD 1JROA 2PEAA 1V86A 4M0WA 3SR6A 2FNJB 4AUQC 3H8HA 3TL5A 2UYZB 4DQOC 3VRAB 3ONSA 2WXGA 1T0QC 2JVCA 4RCOA 2KVZA 4FXCA 2BF8B 3NS1A 4FJZA 2QEJC 3JYUA 3RNGC 3Q6BA 3NVWA 3UF8A 2Y5CA 3DWMA 1P0RA 1P98A 1L0VB 3DWGC 1YX6B 1T6BX 1Z2MA 1E90A 1E7UA 3TJPA 3V05A 1VCBA 2D3GA 4W9HA 3L10B 3ZNHB 1NDDA 3JVZX 1SIFA 2ZCCA 1N5XA 3T3NA 2BS3B 1QT9A 1XD3B 2FCSA 3OAWA 4LDTB 2KQSA 3MHSD 5G2NA 2L0TA 2C9WB 3Q8BA 1NYRA 5G5HA 4CYEA 2JT4B 1MHXA 4OVUA 2JYEA 3TEXA 1R4NI 4HPMB 3Q3NC 1XO3A 2X8XX 3QK0A 1GAQB 3NS8A 2PPHA 4AOFA 1WXMA 3ZNID 1IUEA 3T8MA 2DHZA 2K6DB 2KYWA 3VRBB 1WX8A 5I4DA 3KUZA 3ML8A 1KLUD 1VJKA 4ANXA 3URYA 3S2AA 3DVGX 2DAJA 1HA5A 2Q5WD 2BQQA 5MPOA 2LI5A 1XCTL 2OHFA 4IW0A 3ZLZA 4RGTA 3NVVA 2L3ZA 3P4PB 1TZOA 4P1CC 4C4VB 1I42A 4US8A 2BS2B 1XF5L 2IGGA 4I6NB 4ZOHC 3ZRCA 2L8JA 3QARA 2QJLA 1WM2A 2B3AA 4ANUA 1CK1A 5DPRA 1OQQA 1CQVA 1XLQA 3APDA 3N9YC 2ZZPB 1QF6A 4LNKA 2KACA 4W9KA 4JE3B 2J0KA 1XLOA 2KMAA 4HPLB 3DHGC 4IM0A 3ZTDA 5DCNA 4HROA 5T8IA 3JW0X 1XT9B 3I9V1 1N61A 3OLMD 2KO3A 2NTTA 4PT5A 3T9LA 4WURA 1I4QA 2JSVX 2LJ5A 3RCZA 3OWEB 2LMCA 4L23A 2V4LA 1SE4A 3IBEA 2D2QA 4IM3A 2REXA 3L08A 5BMGA 3LB8C 3X0WA 4PK1A 2BBCA 5JHBA 1WXVA 3FC4A 4TKNA 2VRRB 3QQ8B 4JL9A 1AW7A 2YEPF 2WXFA 4II3B 2FIDA 2YVCA 4USAA 1OTRB 1I4XA 4F1SA 1ACCA 2L05A 4CHKA 2GMIC 2INDC 2LD9A 2NPTB 1QLBB 1WWTA 3C0RB 3KUCB 4DHJD 1V80A 1D6EC 3WAPA 2BKRB 4HJGE 1ENFA 1WFYA 1MPEA 3N1YC 2MSED 5EE1A 3MTNB 1P1AA 2KWVB 2JZ3B 1OEYJ 2JZZA 4JQWC 1Z5SB 3ECIA 3ZGZA 4MSMB 4MH0E 1ZXHA 4US9A 3P4RB 1NI3A 5J18A 2MBHA 2EELA 1WE6A 2BB6A 3PGEA 1N5WA 1EF1A 1KRHA 1V1PB 2KNBA 3RNAC 4EEWA 5C3JB 2V3SA 4WJQA 1MI0A 4ZRKA 5HFYA 1L0XB 2C7HA 2ONQA 2NBUA 1Q1OA 3N20C 3AEEB 4P7IA 4DBGA 4BBNC 2CHZA 1N60A 3L13A 1FPYA 3PT2B 1SIJA 2JWZA 3UQAA 1BT0A 2VH1A 4ARCA 2KJRA 2KWCA 3I5JC 2KVRA 2LVOA 3PRMB 2D3AA 2ZNVB 1LGRA 2LXAA 5HHDG 3RNEC 3NY5A 2SAKA 1HQRD 1KJTA 4W9JA 1MFWA 2BS4B 3DBLB 2QHOA 1XLNA 2MRPA 3PLVA 1ZPSA 4MGIE 2L00B 4OZBA 1QOAA 3VTUA 5DPWA 1TBEA 4KDLB 4HCNB 2E6XA 2WDVB 1ZXIA 2MWSB 3PTFC 4BKTA 4EZJA 4KIKA 4EZKA 1RWSA 2CJNA 1FEHA 4ZRJA 3BK2A 5BYRA 4IUMB 4BVUC 1L2NA 3ZTCA 4AQ7A 5D3IB 5JHAA 3PREA 3E9SA 2O6VD 3LXFA 2G4SA 5IAAC 1YJ1A 3GZNB 4DDID 2W9NA 1E7PB 1TY2A 4BKGA 1VR9A 3CSFA 1WYWB 5CHFA 1GC7A 1E8YA 1GPXA 4NJ6A 2M1MA 5JXVA 2MA9B 5IOIA 3A4SC 1QILA 4TMAB 3NVZA 4JWUC 1XCQL 3NVYA 1CZPA 2NTSA 5BMIA 2NMQA 3RT3B 2R2QA 4KSKC 2PE6B 3RNFC 1FNVA 4MGZE 3BK1A 2JXTA 1Q5WB 3UI3A 1PDXA 1WMHB 3VR9B 3ZXRA 2MHJA 3DBLI 2HTHA 1JWSD 2XEWA 3ZIMA 4ZRIA 1YNTE 4MDKE 1YN3A 3TEWA 2UWQA 1DOYA 3RZWC 2WQYB 2K8BA 2HE7A 4S0RA 3GE3C 1B1ZA 3VAWA 2KDBA 3SDLC 2N7EA 4L2YA 3EA6A 1JALA 1GB4A 2GLSA 3GZNI 2MBBB 2Z0DB 1E8ZA 4GIVA 1UBIA 1TS4A 2V4IB 2MP2A 3DVNU 2KDMA 2LXCA 5CHWA 3VH3B 2M19A 4EFOA 1EU4A 4LCDE 1RRBA 2BB5A 2ZVNA 3BWUD 2H89B 2M4NA 1V5TA 1EU3A 2JWUA 5C1ZA 3PO0A 4EOYA 3VVWB 4A55A 1J0GA 1V8CA 3U7DA 4A3PA 2IGHA 2MH7A 2W54A 4I6PA 4B6WA 4IWPA 2LUMA 3AE5B 1I7HA 1VZ7A 3B2FA 4K81A 2KX0A 3Q69A 2BWES 5D7GA 2LRUA 2NVUI 3BZDB 4DHJB 4HDQA 2N1VA 3TCAA 4HPPA 5L95C 4ZYSA 3ZRFA 3RZFA 5H92C 4K3CA 2AEHA 2NR2A 3H7PA 1LO5D 2KLGA 2IDYA 1V81A 3APCA 4DXAB 3VTVA 4FBJB 2AL3A 5EE0A 2ASQA 2K39A 4A3OA 1RLFA 4KGTA 3PPAA 2C60A 3W1YA 2YEPB 2J42A 2L52A 3Q8EA 2CR5A 4BAXA 3A9KB 1J7BA 3EECA 3X23A 1N62A 2W82A 4XZ4A 2JYTA 4XDDA 1SSNA 1A70A 2B76B 4YL8A 4MACA 4KKJA 4E71A 3DBRB 3R2TA 3ABVB 2PVOD 4NQKE 3ZNZB 4ICVA 2KDIA 4WWNA 1E8XA 3O65B 4ZRPA 2KXJA 3NZUA 2DZMA 1UWXA 2JY6A 3IAM1 5D6JB 4KKIA 3MP9A 2ZCBA 3W9CB 4HVBA 2M0XA 1WSPA 1NEKB 1KLGD 1D5XC 5TR5A 2WXLA 2DX5B 4HK2A 1Y8RC 2FUG1 2AQ1B 2DNFA 2BKFA 1LXDA 3N32A 2MEKA 3KYDD 4EKUA 3A1QA 1SEBD 2INPE 4RFBA 2LHDA 2XBBC 3NRZA 1UGMA 2LGSA 3QJZA 2MJDA 1TT5B 2IBIB 2QCZA 3C8YA 2KAJA 1HXYD 1C77A 1H4RA 3ZUNA 4NAMA 2O6VB 4JLCA 4KZ0A 2Z0EB 4MEMA 5IP4D 1PGBA 2K25A 3GB1A 4NJ7A 4PYZA 4PS3A 5JZEB 3Q3FA 2FAZA 1Y56A 1IBXB 2V3NA 4HXDA 5IKCM 1WY8A 2DYMA 1WGRA 3VR8B 2WXOA 4W9DA 3APFA 4ANWA 5FR6A 4FJYA 2INCC 1EWYC 1STEA 4TUUA 2KKCA 1FO4A 3L4PA 2MJ3A 4MJSB 1FFUA 4NNJB 2V1YA 3ZYYX 1FNWA 4F8CB 1N63A 4YTMB 1C4CA 3QCAA 4FADA 2IGDA 2HDEA 1E7VA 1WRDB 3KW5B 5DPTA 4M00A 1SE9A 4WJOA 1C4PA 2AWTA 1WGKA 3TUOA 1PYWD 2N9PC 5J17A 3L17A 2KQ7A 4HJKA 2R2OA 4HDOA 5TSSA 4ITKA 2KOXA 1JRPA 4O1NA 2DBYA 4M0WB 2IO1B 2M0AA 2L1AA 3UIPB 2WGSA 4YTPB 3E56A 1TS5A 2KX3A 4MSQB 4TQ1A 3RN9C 2N0SB 2LVPA 4KDIC 4LJPB 2V3PA 1TS2A 3Q8AA 2Z8LA 5DPSA 3HM3A 4IWOA 3M3JA 3QC8B 1OGWA 1HE8A 3AB5A 2JPHA 2N9EB 2FCNA 4OHJA 4TV3A 3AI5A 2FUHB 4R3DA 3FKYA 1LQBA 3SFEB 2WDQB 3U7ZA 3WANA 3KH0A 5G55A 5EE3A 2IO0B 1EUVB 2WU2B 4WH4A 4G11A 3ZKJC 2N7JA 1YMHE 2NS5A 2K0PA 3SD5A 1ZGUB 1F1HA 3QX1A 1NYQA 2KANA 1WJ4A 3L16A 3AEGB 4JX1C 4NQLB 3N1XC 1WX9A 4UDUC 2WHIA 4W9EA 2QC8A 4AJYB 4HRSA 3ZO5B 1WXQA 3AE1B 4B95A 1ROEA 2MQJA 3MC9A 2RPQA 4GN1A 5FR3A 3VQIA 1FM0D 2LVQA 3MJWA 3AE3B 4GOCA 2WNMA 5IN7A 5BYSA 1YJIA 5G5GA 3PVLA 1J8CA 2GBNA 2J7QB 1SJHD 4FN2A 4W9IA 4EZLA 2IJ0A 4B0EA 2I1JA 4X57B 3EUB2 1WR1A 5CHVC 4KGSA 4A8XC 2KD0A 5AUIA 2AQ3B 3RD2A 4DXFA 5D2MB 2E3TA 3BVGA 5GXGB 1AARA 3ZQ4A 3NZ3A 2LUEA 2KHWB 1R4MB 1IP9A 3U30A 2GBMA 3CSTA 3KWVA 3C19A 4XC2A 4W9GA 3R7QA 3B2GA 5H8YE 4RF1A 1L0YB 4A20A 4MELA 4LNOA 1OQYA 4XE0A 3MJ5A 1C1YB 1V2YA 4KGRA 3NG0A 1K50A 1KTKA 2YLMA 4D2KA 2JRHA 2FCQA 2PVGC 1DYQA 2KJ6A 3H9DA 1JRUA 3ENEA 4GDKA 3IFWB 2EMSA 3LJ3A 1UWMA 2LZ6A 4S17A 1ET9A 3IAS1 4XGAB 3A33B 1E5WA 4IWQA 2NBVB 5EDSA 4ANVA 1ZDVA 4KX6B 4WWOA 1SB3C 3UGBB 4G0NB 3V60A 1R7SA 4DWFA 2KTFA 3AH7A 1QZEA 2RMMA 1E0ZA 2KT7A 4RM8A 3CMMB 2RSUA 3AE8B 2IPKD 1P9DU 4BBNF 2I1KA 1FIQA 1WF9A 1WJNA 3V62A 3OJ4B 4OVVA 2KFKA 2BVCA 4N58A 3QHTA 1ZW7A 1K51A 2OJWA 4AJWA 1R4MI 4MGKE 2CU3A 2INNE 4PS8A 4YT0B 3R3MA 2G4DB 1PUTA 2DZIA 3QA8A 4GMVA 1WGGA 5C2TB 1UUPA 2BWFA 2RDGA 4URKA 4HWIB 4BKSA 1IPGA 2KTRA 3VTWA 3ALBA 2DAFA 2RGFA 4WQOB 5LNK1 1I35A 1FRRA 3Q14C 2R61A 5LLIA 1FXAA 1VZ8A 3TSSA 3HK0A 2PLPA 3NUHB 1V6EA 2LFIA 1WH3A 2CU1A 4KSLC 2I38A 3P4QB 4MGYE 2K5PA 2N9LA 1PQSA 2QIEB 3VXWA 2IO3B 4B0MA 2CKHB 2NCNA 2DZJA 5BYQA 3IHPC 1I4RA 1NENB 2V9HA 3KUDB 3QWZB 3H1UA 3AE7B 1WJUA 3DHIC 1M94A 2ACZB 2G9HD 1XEEA 1IGCA 2KC2A 2XK5A 2WXNA 1D5ZC 5E6NA 2Z59B 2HJ1A 2VZKD 3J9CA 3ZJUA 2W3RA 3A9JA 3DHHC 3PZ8A 1S1QB 3PRPB 2WX0A 1FD6A 1F2RI 4DHZB 4HKZE 5AEKB 2TSSA 2KN4A 1V5OA 1RAXA 1YQBA 3WIMA 3I57A 4K1RB 2ON8A 3M62B 2KJHB 4NAWB 3RPFC 1WI0A 1G6JA 1L4ZB 5E6JA 1YN4A 1T0YA 4E74A 1YX5B 2L7RA 2BTEA 1PGXA 2BYVE 1CMXB 4DHZE 4C7YA 2FIFA 5J2RA 4KIKB 3PZ7A 1SF0A 3RUIB 3EC8A 1T0SC 2V0GA 2MBQA 4AP4C 1FCLA 1D3ZA 3GE8C 4MM3A 3WA0A 1J19A 5E6OA 4HEA1 4IDIA 3KWLA 5IA7A 3UQBA 1SBBB 2PTLA 3D32A 3FAHA 3QIJA 1ZP0B 3WALA 4BOZB 2KMMA 4EE2A 4GU2A 4CO7A 1FNUA 3HHMA 3ZNGC 1FXTB 3ZDTA 1DOXA 2JU6X 4TSSA 1TTNA 4W9FA 1OEYA 2J4XA 3FILA 3N1ZC 4E3CA 3BINA 2BW2A 4ICUA 2JXXA 4FULA 4OVZA 3GOEA 4IC7B 3T3OA 3JSVA 4PS7A 1IGDA 4ZRQA 2L32A 4K7UA 3U2SC 2ZEQA 2O2VB 2GBKA 3B9JA 3M95A 3P4SB 1YIWA 2KDFB 2JF5A 1F9JA 1PGAA 2KK8A 3SHQA 1TY0A 1LM8B 2WXIA 1C76A 2KQ4X 2C5LC 1WXSA 4ZHOA 2WLBA 3RI7C 2HD5B 4GDLA 1X1MA 1S3SG 1JWUD 2C7NB 2GOWA 3DOWA 3P2BA 2ZPNA 3AE4B 1PFDA 2M8SA 4YXDB 2MBEA 3B08A 3NHEB 1TKEA 1YQ3B 2WYQA 2WXQA 2L0FA 4ASWC 2PW9A 2D11A 1L6VA 1E8WA 3DVNV 1E6EB 1JWAD 2LJIA 4YSXB 3M63B 2MP2B 3TBLD 1TKYA 2BYEA 1ESFA 1UH6A 2JZPA 2CJOA 3IT4B 3TEYA 3MC0B 4NPNA 4JIOU 3B0AA 5GMVA 2J53A 2WP9B 5JH5C 2O6VA 4YSYB 2GRIA 1WZ0A 1F77A 1V9JA 2AL6A 2Y5BB 3RMKC 2HTME 3R7RA 3AECB 5AUKA 2JUOA 3A4RA 5BO4B 3PRZA 4G3XB 1OFFA 1KFYB 1UELA 3L0WB 3RYTA 4A90A 1F0ZA 5C23A 1WGDA 4Q2JA 4RNAA 1MJDA 3H7PB 2LEKA 2WU5B 4FHJA 4BFRA 1C78A 3ZJVA 3AE2B 2CHXA 1JQ4A 3LDZE 2AX5A 5D3DA 2LGDA 1JWBD 2QSDA 3DPDA 2ZPYA 1T0RC 1VRAB 3R66C 2H88B 2WXPA 3R2IA 1I4PA 1TYGB 2Y3AA 1WGHA 2M17A 1AYFA 3DBSA 3VHTC 4HCPB 1ZKHA 3B1LX 3AU4A 2N7DA 4DXGA 3DBRI 4WWPA 1F2RC 4XDCA 2ZNVC 3TMPB 1QQRA 2CS4A 2WDRB 4ARIA 3EFCA 4REZA 1GC6A 3EFUA 2BT6A 2ZVOA 3PHXB 2D3BA 2MX2A 5HI1A 2VZKB 4WAFA 1LFDA 2IZVB 4RF0A 3V3XA 1UF0A 1NBFC 2N4FA 4C7ZA 4A6QA 1OQRA 4JWSC 2D3CA 4AS1A 2K8CA 1V97A 1P7FA 2KLCA 2WWZA 4RH6A 2DYOA 2N9XA 3PZDA 4DDGD 3CF6E 3HRDD 1DOIA 2AYOB 1EO6A 4AWJA 3RNCC 2RR9A 2RDBC 2DLBA 1TGZB 3VUYA 3A1QB 1RFKA 1QKZA 5KHQA 4ACFA 1E9MA 1WZ3A 2GBRA 4LNIA 4C4VA 4F7ZA 1TKGA 4J6IA 1YD8U 3V6CB 3HM6X 1YOVB 3W5VB 4P1BC 4K7SA 1RM6C 4I6LB 4OW0A 1K52A 1VDVA 1JCKB 4RM9A 3WAOA 1NVID 2MJEA 1J7AA 2A4ZA 3V6EB 3GS2A 4ZHPA 3ML9A 4JGHB 4LNNA 4OZAA 1KF6B 3W1SC 5KHOA 2JQRB 3W2DA 3AEBB 4RMAA 1U4AA 1A5RA 2D5GA 2QILA 1UD7A 3P42A 2G3QB 4FA6A 3TEZA 2XNAC 4DK5A 2WDTB 1FMAD 1JMLA 3KVFB 4C56C 4KZCA 4LNFA 3H7SA 4FLHA 3AEFB 2WXMA 4BKSD 4GB9A 4BOSC 3AMZA 1VZ6A 2K8HA 2ICIA 2K6QA 3DQVA 4ZYNA 4XWTA 3V61A 5CTRC 4LLGM 2X38A 2A5UA 2WXKA 3P1MA 4WJPA 2J0MA 3I63C 2NPTA 2M56B 3ETRA 4TQ0A 5AZHA 4M8NA 2OJRA 4GSWA 5E6PA 1BUIC 1WXAA 4M8MA 4YWGG 3VFKA 2PE9A 2MBOA 2D07B 3AN1A 4P6VF 2ZW1A 2K22A 4IG7B 2BYFA 2GBJA 1SE2A 3OJ3A 3DBHB 3AULA 3KQ4A 1WR6E 3DVGY 4XWWA 1Q0WB 3BY4B 3IVFA 4G50A 1V1PA 1GJZA 3R8BA 2K3UA 3SEBA 3IT6B 4A9AA 2OOBB 2KFJA 2WXHA 3BYTB 4ZDVA 3NJTA 4M01A 2AQ2B 2RPVA 4IKGA 4HLEA 1C9FA 1M4VA 3H6NA 4B9KA 3MFGA 1T3QA 3RULA 1V49A 3NZSA 1D4BA 3KYCD 1HZ5A 1KM7A 1TS3A 3P63A 4KV2A 4W9CA 1DGJA 1WE7A 2PJHA 1UBQA 1WJ6A 2NBWB 2RD0A 1MG4A 1V1OA 2DENB 3QAQA 1HTQA 2IY0B 3HUIA 2KDEB 1E10A 1NI2A 3PV1A 1ZUD2
chains in the Genus database with same CATH topology
2BTEA 1PGXA 3IAM1 2WXJA 1JWMD 1VJKA 4C7YA 4GLSC 2K9XA 4KKIA 3MP9A 3PZ7A 3W9CB 3AEDB 1SF0A 3URYA 1WSPA 1NEKB 1KLGD 2V0GA 1BMLC 1HA5A 1FCLA 3BVZA 1D5XC 2Q5WD 5MPOA 4HKQA 2WXLA 1XCTL 2OHFA 2FUG1 2AQ1B 4HEA1 4IDIA 3KWLA 2MEKA 3ZJTA 4RGTA 4WQMA 1SBBB 2PTLA 3FAHA 3NVVA 1ZP0B 2KMMA 1SEBD 4EE2A 3P4PB 1TZOA 1FNUA 1XXGA 3U4EG 2INPE 4RFBA 2LHDA 3NRZA 1FCCC 1YJJA 4LTUA 3CWIA 1DOXA 4US8A 2BS2B 2LGIA 1XF5L 2JU6X 2IGGA 4TSSA 2MJDA 4ZOHC 1UNSA 1TJEA 4N59A 2J4XA 1FXIA 3FILA 1T5XD 4NJCA 3C8YA 5BMHA 2KAJA 2QJLA 2Y5PA 2XN9C 2W3SA 1HXYD 1C77A 2BW2A 2WS3B 3AE6B 4NAMA 1CK1A 4OVZA 1OQQA 1CQVA 1XLQA 3RFZB 3N9YC 3T3OA 1PGBA 5FK9C 1QF6A 1GB1A 1IGDA 2KACA 4ZRQA 2L32A 3GB1A 4JE3B 3U2SC 3B9JA 3MHZA 1XLOA 1Y56A 1YQ4B 1IBXB 4HROA 5T8IA 3P4SB 2V3NA 4L1BA 3VR8B 2DYMA 4GDKB 2WXOA 1AWDA 3I9V1 4N6EB 4IOIE 1N61A 5HG2A 1PGAA 2KWDA 2NTTA 4PT5A 1EWYC 1STEA 1TY0A 3W1SA 2WXIA 4WURA 1FO4A 1I4QA 2JSVX 3L4PA 2MJ3A 1C76A 2KQ4X 1QOBA 1FFUA 3OWEB 3HVDA 1QOGA 3AV8A 2LMCA 4ZHOA 3ZYYX 1I4HA 1FNWA 1WYGA 1ZE3D 2WLBA 1N63A 4L23A 4YTMB 1C4CA 1SE4A 4RGNA 2RDHA 1JWUD 2IGDA 2HDEA 3LB8C 4OZCA 4P16A 5BMGA 2BBCA 3AE4B 3AEAB 1PFDA 3FC4A 2OEDA 3AM9A 1KH0A 4YXDB 1C4PA 1AW7A 1TKEA 1YQ3B 1WGKA 2YEPF 2WXQA 3TUOA 1PYWD 1SJED 2WXFA 3Q8CA 2PW9A 1FFVA 1L6VA 3LYYA 1E6EB 4USAA 2LHEA 1I4XA 1JWAD 2LJIA 5TSSA 4YSXB 2QMTA 4ITKA 1ACCA 4H2AA 1JRPA 4O1NA 1I4GA 2DBYA 2FE8A 1TKYA 1ESFA 2M0AA 2JZPA 3CIRB 2L1AA 2CJOA 2WXRA 3IT4B 1XLPA 4YTPB 3E56A 3TEYA 3MC0B 1TS5A 4NZLB 2N9KA 1QLBB 1WWTA 4TQ1A 2N0SB 2J53A 2WP9B 2V3PA 1D6EC 1TS2A 3Q8AA 2L83A 2Z8LA 3BVMA 4HJGE 1HEZE 4YSYB 1WRIA 5FKAC 2GRIA 1F77A 3AB5A 1ENFA 1SE3A 1MPEA 2HTME 5EE1A 4LK0M 4OHJA 3AECB 5AUKA 4R3DA 3SFEB 3U7ZA 2WDQB 1ZOYB 1L4DB 1OFFA 1KFYB 4A90A 4JPSA 1F0ZA 5EE3A 4Q2JA 4RNAA 3ZGZA 1ZXHA 2WU2B 4WH4A 4US9A 3P4RB 2LEKA 1NI3A 2N7JA 3SFDB 1YMHE 2EELA 2BB6A 2WU5B 2K0PA 1RYJA 1L5PA 1C78A 1N5WA 1B9RA 1KRHA 2DWQA 3Q8FA 1P7EA 1V1PB 3ZJVA 1NYQA 2EKIA 3AE2B 5C3JB 1JQ4A 1MI0A 2AX5A 2W55A 5HFYA 4C80A 1L0XB 5D3DA 3AEGB 1JWBD 4JX1C 2QSDA 2ONQA 4UDUC 1VRAB 3AEEB 3AE9B 1SXTA 1D5MC 2H88B 2WXPA 1MVKA 3W5UB 3R2IA 1I4PA 1TYGB 2Y3AA 1N60A 3KLSX 4HRSA 1AYFA 1SIJA 1WXQA 4ARCA 3AE1B 1YN5A 1ROEA 4YSZB 2BYTA 4DXGA 4MT5A 1F2RC 5HHDG 4XDCA 4RGOS 2SAKA 1QQRA 1HQRD 2WDRB 4ARIA 4REZA 2G1EA 5FR3A 2BS4B 2BT6A 3VQIA 1XLNA 1FM0D 1ZPSA 4OZBA 2PMVA 1QOAA 5HI1A 1QOFA 1GOZA 2VZKB 3AE3B 4WAFA 4RF0A 3V3XA 2WNMA 2PKOA 4C7ZA 4A6QA 5BYSA 2I2YA 2E6XA 2WDVB 1ZXIA 1YJIA 1OQRA 5G5GA 4JWSC 3IXSA 4AS1A 1Q10A 1JW9D 2FBWB 1RWSA 1V97A 1SJHD 1P7FA 1C4AA 2IJ0A 2CJNA 1MHHE 4RH6A 1FEHA 4YTNB 3BK2A 5BYRA 4MM3B 2DYOA 4B0EA 3HRDD 1EWCA 4AQ7A 1DOIA 5D3IB 1CJEA 3EUB2 4MH8A 4KGSA 3E9SA 4A8XC 2DLBA 5AUIA 2AQ3B 3LXFA 1BXTA 1RFKA 2SEBD 1QKZA 2ZW0A 4DXFA 2E3TA 3BVGA 1E9MA 1L6UA 5GXGB 1E7PB 3ZQ4A 1J7CA 3NZ3A 1TY2A 4CQNA 4RGMA 1VR9A 1TKGA 1GPXA 5JXVA 3FILB 3KWVA 3U52E 5EE9A 3BYYB 3W5VB 3B2GA 1QILA 5H8YE 4RF1A 1L0YB 4TMAB 3NVZA 4JWUC 1XCQL 3NVYA 1ZDXA 1CZPA 4XE0A 2NTSA 3MJ5A 5BMIA 1ET6A 1RM6C 4KGRA 2NMQA 1K50A 1KTKA 4D2KA 4OW0A 1K52A 1VDVA 1JCKB 1VLBA 1NVID 3BIID 2MJEA 2PVGC 1J7AA 1DYQA 4WWMA 1IBXA 3GS2A 1FNVA 4ZHPA 1AN8A 2JXTA 3BK1A 3UI3A 1PDXA 4OZAA 2GI9A 2JX5A 1KF6B 3VR9B 1UWMA 1HZ6A 1FRDA 1ET9A 3IAS1 3O13A 2JQRB 3W2DA 1JWSD 3AEBB 1YNTE 4GDLB 2D5GA 2QILA 1ZDVA 1YN3A 2PIAA 3P42A 4KX6B 2GB1A 3TEWA 1SB3C 3WCQA 3TEZA 1DOYA 2XNAC 1R7SA 3AH7A 2WQYB 1FMAD 1JMLA 1B1ZA 4WIPA 4C56C 2RMMA 1E0ZA 1K53A 2J52A 3HVZA 3GP7A 3AE8B 1UGJA 2IPKD 3AEFB 4L2YA 3EA6A 1JALA 1C79A 1EM7A 2WXMA 1GB4A 3EGRA 1FIQA 1TS4A 3AMZA 4J3OD 1VZ6A 1JROA 2V4IB 4N58A 1K51A 2KDMA 2ICIA 4M0WA 3SR6A 3H8HA 2M19A 4XWTA 4DQOC 1EU4A 4LLGM 2X38A 3VRAB 2BB5A 2CU3A 2WXKA 3P1MA 2INNE 3BWUD 4YT0B 2H89B 2M56B 2WXGA 3ETRA 4RCOA 1EU3A 2JWUA 1PUTA 3PO0A 4TQ0A 5C2TB 1UUPA 2RDGA 4FXCA 3NS1A 4A55A 2QEJC 1BUIC 1V8CA 2IGHA 2MH7A 2W54A 3NVWA 2Y5CA 4YWGG 2LUMA 3AE5B 1I7HA 1VZ7A 3B2FA 3DWMA 5LNK1 1FRRA 3AN1A 4P6VF 3Q69A 2R61A 5D7GA 1L0VB 3DWGC 3BZDB 1FXAA 1VZ8A 3TSSA 2ZW1A 1T6BX 2K22A 2PLPA 3NUHB 2LFIA 1SE2A 3V05A 4ZYSA 5H92C 2I38A 3P4QB 3KQ4A 2K5PA 2N9LA 2QIEB 1LO5D 4XWWA 2IDYA 4B0MA 1N5XA 5EE0A 3T3NA 1V1PA 2BS3B 1QT9A 3R8BA 2K3UA 3SEBA 4KGTA 3IT6B 5BYQA 1I4RA 2YEPB 4A9AA 1NENB 3Q8BA 2J42A 2WXHA 3BYTB 1NYRA 2L52A 5G5HA 3Q8EA 2AQ2B 2RPVA 3AE7B 4IKGA 2ACZB 1J7BA 2G9HD 1MHXA 1XEEA 1IGCA 1N62A 2W82A 2JYEA 2WXNA 2JYTA 1C9FA 1D5ZC 1M4VA 3TEXA 4XDDA 3MFGA 2VZKD 1T3QA 1SSNA 1A70A 2B76B 3J9CA 1XO3A 2W3RA 4MACA 1GAQB 4KKJA 3ZJUA 3PZ8A 3R2TA 3ABVB 2PVOD 1D4BA 1FD6A 1F2RI 1HZ5A 1TS3A 1IUEA 3P63A 4HKZE 2TSSA 1DGJA 2KN4A 3I57A 2ON8A 3RPFC 3VRBB 4NAWB 1V1OA 1L4ZB 4ZRPA 5E6JA 5I4DA 1YN4A 3HUIA 1UWXA 1KLUD 1E10A 1ZUD2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRO A;  2PKO A;  1JRP A;  4N58 A;  4C7Z A;  1VJK A;  2DBY A;  2WDV B;  1ZXI A;  4C7Y A;  1TKY A;  2K9X A;  1YJI A;  1OQR A;  5G5G A;  4JWS C;  3SR6 A;  3W9C B;  3AED B;  1SF0 A;  2M19 A;  3CIR B;  1JW9 D;  2CJO A;  2FBW B;  1RWS A;  1V97 A;  3VRA B;  1NEK B;  1XLP A;  4YTP B;  1B9R A;  2CU3 A;  2CJN A;  3P1M A;  4YTN B;  2Q5W D;  5MPO A;  4YT0 B;  1QLB B;  1WWT A;  2H89 B;  2M56 B;  2N0S B;  3ETR A;  2OHF A;  3HRD D;  1PUT A;  3PO0 A;  1DOI A;  1CJE A;  2WP9 B;  3EUB 2;  2L83 A;  5C2T B;  4IDI A;  3KWL A;  4YSY B;  4FXC A;  1WRI A;  3NS1 A;  3LXF A;  5AUI A;  4WQM A;  1RFK A;  3FAH A;  3NVV A;  1ZP0 B;  1V8C A;  2KMM A;  3AB5 A;  2MH7 A;  2E3T A;  2W54 A;  3NVW A;  3P4P B;  2Y5C A;  1E9M A;  1L6U A;  5GXG B;  1E7P B;  2HTM E;  1J7C A;  1I7H A;  3AE5 B;  3B2F A;  3DWM A;  5EE1 A;  3NRZ A;  1YJJ A;  4LTU A;  1DOX A;  3CWI A;  1FRR A;  3AN1 A;  3AEC B;  2BS2 B;  1TKG A;  5AUK A;  4US8 A;  4P6V F;  3SFE B;  4ZOH C;  1GPX A;  2MJD A;  2WDQ B;  1L0V B;  1TJE A;  3DWG C;  1ZOY B;  4N59 A;  1FXA A;  1OFF A;  1FXI A;  1KFY B;  2K22 A;  5EE9 A;  2KAJ A;  2QJL A;  3B2G A;  5H8Y E;  3W5V B;  1F0Z A;  5EE3 A;  2W3S A;  2WS3 B;  3AE6 B;  3NVZ A;  4JWU C;  3NVY A;  5H92 C;  1CZP A;  1OQQ A;  2WU2 B;  4US9 A;  3P4R B;  1XLQ A;  2LEK A;  1NI3 A;  3P4Q B;  3SFD B;  2K5P A;  2QIE B;  1QF6 A;  1RM6 C;  2WU5 B;  1VDV A;  1RYJ A;  3B9J A;  1VLB A;  1L5P A;  1N5W A;  1NVI D;  1XLO A;  1KRH A;  2DWQ A;  1YQ4 B;  2MJE A;  2PVG C;  1J7A A;  1N5X A;  3BII D;  5EE0 A;  1NYQ A;  4WWM A;  2EKI A;  4HRO A;  2BS3 B;  3AE2 B;  1QT9 A;  3P4S B;  5C3J B;  1JQ4 A;  3VR8 B;  2AX5 A;  2W55 A;  4C80 A;  4ZHP A;  1AWD A;  3AEG B;  4N6E B;  1N61 A;  1JWB D;  4JX1 C;  1PDX A;  4A9A A;  1EWY C;  1NEN B;  2JX5 A;  1KF6 B;  3VR9 B;  1NYR A;  1UWM A;  2L52 A;  5G5H A;  1FO4 A;  3AE7 B;  1FRD A;  3AEE B;  2ACZ B;  1J7B A;  2MJ3 A;  2H88 B;  3AE9 B;  3L4P A;  3W5U B;  1QOB A;  2JQR B;  1FFU A;  1N62 A;  1TYG B;  3AEB B;  1N60 A;  1QOG A;  3AV8 A;  4HRS A;  4ZHO A;  3ZYY X;  1WYG A;  2WLB A;  1AYF A;  1SIJ A;  1N63 A;  4YTM B;  1WXQ A;  1T3Q A;  3AE1 B;  2PIA A;  4KX6 B;  1A70 A;  2B76 B;  1SB3 C;  1XO3 A;  2W3R A;  1GAQ B;  3WCQ A;  1ROE A;  4YSZ B;  1DOY A;  1R7S A;  3ABV B;  2PVO D;  3LB8 C;  3AH7 A;  2WQY B;  1FMA D;  1IUE A;  3P63 A;  3AE4 B;  3AEA B;  1PFD A;  3FC4 A;  3AM9 A;  1DGJ A;  2WDR B;  4YXD B;  1E0Z A;  2G1E A;  1TKE A;  1YQ3 B;  1WGK A;  3HVZ A;  2BS4 B;  2BT6 A;  3AE8 B;  3RPF C;  3VRB B;  1XLN A;  1FM0 D;  3AEF B;  1FFV A;  1JAL A;  1QOA A;  1L6V A;  1QOF A;  1E6E B;  1FIQ A;  3HUI A;  3AE3 B;  4USA A;  1JWA D;  4YSX B;  1E10 A;  3AMZ A;  4ITK A;  1ZUD 2; 
#chains in the Genus database with same CATH topology
 2WXJ A;  1JWM D;  4GLS C;  2K9X A;  4M02 A;  2HJ8 A;  1GG3 A;  3AED B;  1K8R B;  3WAM A;  2BGF A;  3ZVV A;  3VUW A;  1BML C;  3BVZ A;  4HKQ A;  1TIF A;  3ZW3 A;  2EMT A;  4GXB A;  3N3K B;  3DBH I;  3IG3 A;  3ZJT A;  4WQM A;  1XXG A;  3U4E G;  3UIN B;  2LGY A;  1FCC C;  1YJJ A;  4LTU A;  3CWI A;  2LGI A;  2KMC A;  3OG5 A;  1UNS A;  1TJE A;  3EHV A;  4N59 A;  1FXI A;  1T5X D;  4NJC A;  5BMH A;  4PYU A;  4W9L A;  2Y5P A;  1WGY A;  2XN9 C;  5AZF A;  2W3S A;  2WS3 B;  3AE6 B;  2UU7 A;  1XQQ A;  4QAY A;  3RFZ B;  2CHW A;  3Q3J A;  5FK9 C;  1GB1 A;  2EKE C;  4BZA A;  1C3T A;  1WX7 A;  3MHZ A;  1YQ4 B;  4L1B A;  4N9F 4;  1KOT A;  4GDK B;  2KWU B;  1AWD A;  4N6E B;  4IOI E;  5HG2 A;  2KWD A;  3W1S A;  3K9O B;  2DYB A;  1WMH A;  4NAW A;  1QOB A;  3HVD A;  1QOG A;  3AV8 A;  1I4H A;  1WYG A;  1ZE3 D;  4RGN A;  2J0J A;  2RDH A;  4FJV B;  3U8Z A;  4OZC A;  4P16 A;  5HKH A;  3AEA B;  2OED A;  3AM9 A;  5CX3 A;  2KN5 A;  1KH0 A;  1KLV A;  2L76 A;  2FCM A;  1SJE D;  3Q8C A;  5AZG A;  1FFV A;  3LYY A;  3K9P B;  2LHE A;  2KFK B;  2QMT A;  4H2A A;  1HTO A;  3TIX A;  2MCN B;  1I4G A;  3Q3M C;  2FE8 A;  3CIR B;  4XYC A;  2WXR A;  1XLP A;  3AU5 A;  4NZL B;  2N9K A;  4C00 A;  2DZK A;  2L83 A;  3BVM A;  4XX5 A;  1HEZ E;  5FKA C;  1WRI A;  2KTR B;  3PLU A;  2O2V A;  1SE3 A;  4EUT A;  3Q2A C;  3ZXV A;  5D94 A;  4LK0 M;  3I3T B;  1GUA B;  2QDF A;  1ZOY B;  1L4D B;  4LDT D;  4JPS A;  1EF5 A;  3SFD B;  2IYD B;  3PSE B;  1RYJ A;  1L5P A;  1B9R A;  2LAS A;  2DWQ A;  3Q8F A;  1P7E A;  1N6Z A;  2EKI A;  2MLB A;  2W55 A;  3AXC A;  4C80 A;  2JRI B;  1GNU A;  3NOB A;  3AE9 B;  1SXT A;  1D5M C;  2K1F A;  2XK5 B;  1MVK A;  3W5U B;  3A9K A;  3MC8 A;  3KLS X;  5LXI B;  1P3Q U;  3A9J B;  2BPS A;  1YN5 A;  4NY0 A;  4YSZ B;  2BYT A;  4MT5 A;  4RGO S;  2WX1 A;  2G1E A;  1IYF A;  5L83 A;  2LWP A;  2PMV A;  3Q3O C;  1QOF A;  1GOZ A;  5LXH A;  1TZ1 A;  3RNB C;  2ZJD A;  3VH4 B;  2PKO A;  2I2Y A;  4IM2 A;  3IXS A;  1Q10 A;  2LGX A;  1JW9 D;  2FBW B;  3VDZ A;  3L54 A;  1C4A A;  4YTN B;  1MHH E;  5IO9 A;  4II2 B;  4MM3 B;  4KVG B;  1H8C A;  1EWC A;  1CJE A;  4MH8 A;  4K3B A;  1BXT A;  2SEB D;  2ZW0 A;  1L7Y A;  3DCG A;  1L6U A;  1J7C A;  4CQN A;  4WJN A;  4RGM A;  3PHW B;  3FIL B;  2N1W A;  1WIA A;  3U52 E;  5EE9 A;  3BYY B;  4WAA A;  1MG8 A;  4FHK A;  1UZX B;  4GGQ A;  1ZDX A;  2MW5 A;  3DDC B;  3JSV B;  3N30 A;  1ET6 A;  3UIO B;  3ZDM C;  2G45 B;  1VLB A;  3BII D;  1RFA A;  2LRW A;  4WWM A;  1IBX A;  1ISN A;  2IY1 B;  1AN8 A;  2IO2 B;  4K7W A;  2GI9 A;  1F52 A;  2JX5 A;  1HZ6 A;  1FRD A;  2KZR A;  3O13 A;  2D10 A;  1VD2 A;  4MJS A;  3VUX A;  4GDL B;  2PIA A;  2GB1 A;  2KC1 A;  3WCQ A;  3PS6 A;  1SGH A;  3SU8 X;  2C7M B;  4WIP A;  2VH2 A;  1K53 A;  2J52 A;  3HVZ A;  1WM3 A;  3GP7 A;  1UGJ A;  3HIZ A;  1C79 A;  1EM7 A;  3EGR A;  4LJO B;  1R4N B;  4J3O D;  1JRO A;  2PEA A;  1V86 A;  4M0W A;  3SR6 A;  2FNJ B;  4AUQ C;  3H8H A;  3TL5 A;  2UYZ B;  4DQO C;  3VRA B;  3ONS A;  2WXG A;  1T0Q C;  2JVC A;  4RCO A;  2KVZ A;  4FXC A;  2BF8 B;  3NS1 A;  4FJZ A;  2QEJ C;  3JYU A;  3RNG C;  3Q6B A;  3NVW A;  3UF8 A;  2Y5C A;  3DWM A;  1P0R A;  1P98 A;  1L0V B;  3DWG C;  1YX6 B;  1T6B X;  1Z2M A;  1E90 A;  1E7U A;  3TJP A;  3V05 A;  1VCB A;  2D3G A;  4W9H A;  3L10 B;  3ZNH B;  1NDD A;  3JVZ X;  1SIF A;  2ZCC A;  1N5X A;  3T3N A;  2BS3 B;  1QT9 A;  1XD3 B;  2FCS A;  3OAW A;  4LDT B;  2KQS A;  3MHS D;  5G2N A;  2L0T A;  2C9W B;  3Q8B A;  1NYR A;  5G5H A;  4CYE A;  2JT4 B;  1MHX A;  4OVU A;  2JYE A;  3TEX A;  1R4N I;  4HPM B;  3Q3N C;  1XO3 A;  2X8X X;  3QK0 A;  1GAQ B;  3NS8 A;  2PPH A;  4AOF A;  1WXM A;  3ZNI D;  1IUE A;  3T8M A;  2DHZ A;  2K6D B;  2KYW A;  3VRB B;  1WX8 A;  5I4D A;  3KUZ A;  3ML8 A;  1KLU D;  1VJK A;  4ANX A;  3URY A;  3S2A A;  3DVG X;  2DAJ A;  1HA5 A;  2Q5W D;  2BQQ A;  5MPO A;  2LI5 A;  1XCT L;  2OHF A;  4IW0 A;  3ZLZ A;  4RGT A;  3NVV A;  2L3Z A;  3P4P B;  1TZO A;  4P1C C;  4C4V B;  1I42 A;  4US8 A;  2BS2 B;  1XF5 L;  2IGG A;  4I6N B;  4ZOH C;  3ZRC A;  2L8J A;  3QAR A;  2QJL A;  1WM2 A;  2B3A A;  4ANU A;  1CK1 A;  5DPR A;  1OQQ A;  1CQV A;  1XLQ A;  3APD A;  3N9Y C;  2ZZP B;  1QF6 A;  4LNK A;  2KAC A;  4W9K A;  4JE3 B;  2J0K A;  1XLO A;  2KMA A;  4HPL B;  3DHG C;  4IM0 A;  3ZTD A;  5DCN A;  4HRO A;  5T8I A;  3JW0 X;  1XT9 B;  3I9V 1;  1N61 A;  3OLM D;  2KO3 A;  2NTT A;  4PT5 A;  3T9L A;  4WUR A;  1I4Q A;  2JSV X;  2LJ5 A;  3RCZ A;  3OWE B;  2LMC A;  4L23 A;  2V4L A;  1SE4 A;  3IBE A;  2D2Q A;  4IM3 A;  2REX A;  3L08 A;  5BMG A;  3LB8 C;  3X0W A;  4PK1 A;  2BBC A;  5JHB A;  1WXV A;  3FC4 A;  4TKN A;  2VRR B;  3QQ8 B;  4JL9 A;  1AW7 A;  2YEP F;  2WXF A;  4II3 B;  2FID A;  2YVC A;  4USA A;  1OTR B;  1I4X A;  4F1S A;  1ACC A;  2L05 A;  4CHK A;  2GMI C;  2IND C;  2LD9 A;  2NPT B;  1QLB B;  1WWT A;  3C0R B;  3KUC B;  4DHJ D;  1V80 A;  1D6E C;  3WAP A;  2BKR B;  4HJG E;  1ENF A;  1WFY A;  1MPE A;  3N1Y C;  2MSE D;  5EE1 A;  3MTN B;  1P1A A;  2KWV B;  2JZ3 B;  1OEY J;  2JZZ A;  4JQW C;  1Z5S B;  3ECI A;  3ZGZ A;  4MSM B;  4MH0 E;  1ZXH A;  4US9 A;  3P4R B;  1NI3 A;  5J18 A;  2MBH A;  2EEL A;  1WE6 A;  2BB6 A;  3PGE A;  1N5W A;  1EF1 A;  1KRH A;  1V1P B;  2KNB A;  3RNA C;  4EEW A;  5C3J B;  2V3S A;  4WJQ A;  1MI0 A;  4ZRK A;  5HFY A;  1L0X B;  2C7H A;  2ONQ A;  2NBU A;  1Q1O A;  3N20 C;  3AEE B;  4P7I A;  4DBG A;  4BBN C;  2CHZ A;  1N60 A;  3L13 A;  1FPY A;  3PT2 B;  1SIJ A;  2JWZ A;  3UQA A;  1BT0 A;  2VH1 A;  4ARC A;  2KJR A;  2KWC A;  3I5J C;  2KVR A;  2LVO A;  3PRM B;  2D3A A;  2ZNV B;  1LGR A;  2LXA A;  5HHD G;  3RNE C;  3NY5 A;  2SAK A;  1HQR D;  1KJT A;  4W9J A;  1MFW A;  2BS4 B;  3DBL B;  2QHO A;  1XLN A;  2MRP A;  3PLV A;  1ZPS A;  4MGI E;  2L00 B;  4OZB A;  1QOA A;  3VTU A;  5DPW A;  1TBE A;  4KDL B;  4HCN B;  2E6X A;  2WDV B;  1ZXI A;  2MWS B;  3PTF C;  4BKT A;  4EZJ A;  4KIK A;  4EZK A;  1RWS A;  2CJN A;  1FEH A;  4ZRJ A;  3BK2 A;  5BYR A;  4IUM B;  4BVU C;  1L2N A;  3ZTC A;  4AQ7 A;  5D3I B;  5JHA A;  3PRE A;  3E9S A;  2O6V D;  3LXF A;  2G4S A;  5IAA C;  1YJ1 A;  3GZN B;  4DDI D;  2W9N A;  1E7P B;  1TY2 A;  4BKG A;  1VR9 A;  3CSF A;  1WYW B;  5CHF A;  1GC7 A;  1E8Y A;  1GPX A;  4NJ6 A;  2M1M A;  5JXV A;  2MA9 B;  5IOI A;  3A4S C;  1QIL A;  4TMA B;  3NVZ A;  4JWU C;  1XCQ L;  3NVY A;  1CZP A;  2NTS A;  5BMI A;  2NMQ A;  3RT3 B;  2R2Q A;  4KSK C;  2PE6 B;  3RNF C;  1FNV A;  4MGZ E;  3BK1 A;  2JXT A;  1Q5W B;  3UI3 A;  1PDX A;  1WMH B;  3VR9 B;  3ZXR A;  2MHJ A;  3DBL I;  2HTH A;  1JWS D;  2XEW A;  3ZIM A;  4ZRI A;  1YNT E;  4MDK E;  1YN3 A;  3TEW A;  2UWQ A;  1DOY A;  3RZW C;  2WQY B;  2K8B A;  2HE7 A;  4S0R A;  3GE3 C;  1B1Z A;  3VAW A;  2KDB A;  3SDL C;  2N7E A;  4L2Y A;  3EA6 A;  1JAL A;  1GB4 A;  2GLS A;  3GZN I;  2MBB B;  2Z0D B;  1E8Z A;  4GIV A;  1UBI A;  1TS4 A;  2V4I B;  2MP2 A;  3DVN U;  2KDM A;  2LXC A;  5CHW A;  3VH3 B;  2M19 A;  4EFO A;  1EU4 A;  4LCD E;  1RRB A;  2BB5 A;  2ZVN A;  3BWU D;  2H89 B;  2M4N A;  1V5T A;  1EU3 A;  2JWU A;  5C1Z A;  3PO0 A;  4EOY A;  3VVW B;  4A55 A;  1J0G A;  1V8C A;  3U7D A;  4A3P A;  2IGH A;  2MH7 A;  2W54 A;  4I6P A;  4B6W A;  4IWP A;  2LUM A;  3AE5 B;  1I7H A;  1VZ7 A;  3B2F A;  4K81 A;  2KX0 A;  3Q69 A;  2BWE S;  5D7G A;  2LRU A;  2NVU I;  3BZD B;  4DHJ B;  4HDQ A;  2N1V A;  3TCA A;  4HPP A;  5L95 C;  4ZYS A;  3ZRF A;  3RZF A;  5H92 C;  4K3C A;  2AEH A;  2NR2 A;  3H7P A;  1LO5 D;  2KLG A;  2IDY A;  1V81 A;  3APC A;  4DXA B;  3VTV A;  4FBJ B;  2AL3 A;  5EE0 A;  2ASQ A;  2K39 A;  4A3O A;  1RLF A;  4KGT A;  3PPA A;  2C60 A;  3W1Y A;  2YEP B;  2J42 A;  2L52 A;  3Q8E A;  2CR5 A;  4BAX A;  3A9K B;  1J7B A;  3EEC A;  3X23 A;  1N62 A;  2W82 A;  4XZ4 A;  2JYT A;  4XDD A;  1SSN A;  1A70 A;  2B76 B;  4YL8 A;  4MAC A;  4KKJ A;  4E71 A;  3DBR B;  3R2T A;  3ABV B;  2PVO D;  4NQK E;  3ZNZ B;  4ICV A;  2KDI A;  4WWN A;  1E8X A;  3O65 B;  4ZRP A;  2KXJ A;  3NZU A;  2DZM A;  1UWX A;  2JY6 A;  3IAM 1;  5D6J B;  4KKI A;  3MP9 A;  2ZCB A;  3W9C B;  4HVB A;  2M0X A;  1WSP A;  1NEK B;  1KLG D;  1D5X C;  5TR5 A;  2WXL A;  2DX5 B;  4HK2 A;  1Y8R C;  2FUG 1;  2AQ1 B;  2DNF A;  2BKF A;  1LXD A;  3N32 A;  2MEK A;  3KYD D;  4EKU A;  3A1Q A;  1SEB D;  2INP E;  4RFB A;  2LHD A;  2XBB C;  3NRZ A;  1UGM A;  2LGS A;  3QJZ A;  2MJD A;  1TT5 B;  2IBI B;  2QCZ A;  3C8Y A;  2KAJ A;  1HXY D;  1C77 A;  1H4R A;  3ZUN A;  4NAM A;  2O6V B;  4JLC A;  4KZ0 A;  2Z0E B;  4MEM A;  5IP4 D;  1PGB A;  2K25 A;  3GB1 A;  4NJ7 A;  4PYZ A;  4PS3 A;  5JZE B;  3Q3F A;  2FAZ A;  1Y56 A;  1IBX B;  2V3N A;  4HXD A;  5IKC M;  1WY8 A;  2DYM A;  1WGR A;  3VR8 B;  2WXO A;  4W9D A;  3APF A;  4ANW A;  5FR6 A;  4FJY A;  2INC C;  1EWY C;  1STE A;  4TUU A;  2KKC A;  1FO4 A;  3L4P A;  2MJ3 A;  4MJS B;  1FFU A;  4NNJ B;  2V1Y A;  3ZYY X;  1FNW A;  4F8C B;  1N63 A;  4YTM B;  1C4C A;  3QCA A;  4FAD A;  2IGD A;  2HDE A;  1E7V A;  1WRD B;  3KW5 B;  5DPT A;  4M00 A;  1SE9 A;  4WJO A;  1C4P A;  2AWT A;  1WGK A;  3TUO A;  1PYW D;  2N9P C;  5J17 A;  3L17 A;  2KQ7 A;  4HJK A;  2R2O A;  4HDO A;  5TSS A;  4ITK A;  2KOX A;  1JRP A;  4O1N A;  2DBY A;  4M0W B;  2IO1 B;  2M0A A;  2L1A A;  3UIP B;  2WGS A;  4YTP B;  3E56 A;  1TS5 A;  2KX3 A;  4MSQ B;  4TQ1 A;  3RN9 C;  2N0S B;  2LVP A;  4KDI C;  4LJP B;  2V3P A;  1TS2 A;  3Q8A A;  2Z8L A;  5DPS A;  3HM3 A;  4IWO A;  3M3J A;  3QC8 B;  1OGW A;  1HE8 A;  3AB5 A;  2JPH A;  2N9E B;  2FCN A;  4OHJ A;  4TV3 A;  3AI5 A;  2FUH B;  4R3D A;  3FKY A;  1LQB A;  3SFE B;  2WDQ B;  3U7Z A;  3WAN A;  3KH0 A;  5G55 A;  5EE3 A;  2IO0 B;  1EUV B;  2WU2 B;  4WH4 A;  4G11 A;  3ZKJ C;  2N7J A;  1YMH E;  2NS5 A;  2K0P A;  3SD5 A;  1ZGU B;  1F1H A;  3QX1 A;  1NYQ A;  2KAN A;  1WJ4 A;  3L16 A;  3AEG B;  4JX1 C;  4NQL B;  3N1X C;  1WX9 A;  4UDU C;  2WHI A;  4W9E A;  2QC8 A;  4AJY B;  4HRS A;  3ZO5 B;  1WXQ A;  3AE1 B;  4B95 A;  1ROE A;  2MQJ A;  3MC9 A;  2RPQ A;  4GN1 A;  5FR3 A;  3VQI A;  1FM0 D;  2LVQ A;  3MJW A;  3AE3 B;  4GOC A;  2WNM A;  5IN7 A;  5BYS A;  1YJI A;  5G5G A;  3PVL A;  1J8C A;  2GBN A;  2J7Q B;  1SJH D;  4FN2 A;  4W9I A;  4EZL A;  2IJ0 A;  4B0E A;  2I1J A;  4X57 B;  3EUB 2;  1WR1 A;  5CHV C;  4KGS A;  4A8X C;  2KD0 A;  5AUI A;  2AQ3 B;  3RD2 A;  4DXF A;  5D2M B;  2E3T A;  3BVG A;  5GXG B;  1AAR A;  3ZQ4 A;  3NZ3 A;  2LUE A;  2KHW B;  1R4M B;  1IP9 A;  3U30 A;  2GBM A;  3CST A;  3KWV A;  3C19 A;  4XC2 A;  4W9G A;  3R7Q A;  3B2G A;  5H8Y E;  4RF1 A;  1L0Y B;  4A20 A;  4MEL A;  4LNO A;  1OQY A;  4XE0 A;  3MJ5 A;  1C1Y B;  1V2Y A;  4KGR A;  3NG0 A;  1K50 A;  1KTK A;  2YLM A;  4D2K A;  2JRH A;  2FCQ A;  2PVG C;  1DYQ A;  2KJ6 A;  3H9D A;  1JRU A;  3ENE A;  4GDK A;  3IFW B;  2EMS A;  3LJ3 A;  1UWM A;  2LZ6 A;  4S17 A;  1ET9 A;  3IAS 1;  4XGA B;  3A33 B;  1E5W A;  4IWQ A;  2NBV B;  5EDS A;  4ANV A;  1ZDV A;  4KX6 B;  4WWO A;  1SB3 C;  3UGB B;  4G0N B;  3V60 A;  1R7S A;  4DWF A;  2KTF A;  3AH7 A;  1QZE A;  2RMM A;  1E0Z A;  2KT7 A;  4RM8 A;  3CMM B;  2RSU A;  3AE8 B;  2IPK D;  1P9D U;  4BBN F;  2I1K A;  1FIQ A;  1WF9 A;  1WJN A;  3V62 A;  3OJ4 B;  4OVV A;  2KFK A;  2BVC A;  4N58 A;  3QHT A;  1ZW7 A;  1K51 A;  2OJW A;  4AJW A;  1R4M I;  4MGK E;  2CU3 A;  2INN E;  4PS8 A;  4YT0 B;  3R3M A;  2G4D B;  1PUT A;  2DZI A;  3QA8 A;  4GMV A;  1WGG A;  5C2T B;  1UUP A;  2BWF A;  2RDG A;  4URK A;  4HWI B;  4BKS A;  1IPG A;  2KTR A;  3VTW A;  3ALB A;  2DAF A;  2RGF A;  4WQO B;  5LNK 1;  1I35 A;  1FRR A;  3Q14 C;  2R61 A;  5LLI A;  1FXA A;  1VZ8 A;  3TSS A;  3HK0 A;  2PLP A;  3NUH B;  1V6E A;  2LFI A;  1WH3 A;  2CU1 A;  4KSL C;  2I38 A;  3P4Q B;  4MGY E;  2K5P A;  2N9L A;  1PQS A;  2QIE B;  3VXW A;  2IO3 B;  4B0M A;  2CKH B;  2NCN A;  2DZJ A;  5BYQ A;  3IHP C;  1I4R A;  1NEN B;  2V9H A;  3KUD B;  3QWZ B;  3H1U A;  3AE7 B;  1WJU A;  3DHI C;  1M94 A;  2ACZ B;  2G9H D;  1XEE A;  1IGC A;  2KC2 A;  2XK5 A;  2WXN A;  1D5Z C;  5E6N A;  2Z59 B;  2HJ1 A;  2VZK D;  3J9C A;  3ZJU A;  2W3R A;  3A9J A;  3DHH C;  3PZ8 A;  1S1Q B;  3PRP B;  2WX0 A;  1FD6 A;  1F2R I;  4DHZ B;  4HKZ E;  5AEK B;  2TSS A;  2KN4 A;  1V5O A;  1RAX A;  1YQB A;  3WIM A;  3I57 A;  4K1R B;  2ON8 A;  3M62 B;  2KJH B;  4NAW B;  3RPF C;  1WI0 A;  1G6J A;  1L4Z B;  5E6J A;  1YN4 A;  1T0Y A;  4E74 A;  1YX5 B;  2L7R A;  2BTE A;  1PGX A;  2BYV E;  1CMX B;  4DHZ E;  4C7Y A;  2FIF A;  5J2R A;  4KIK B;  3PZ7 A;  1SF0 A;  3RUI B;  3EC8 A;  1T0S C;  2V0G A;  2MBQ A;  4AP4 C;  1FCL A;  1D3Z A;  3GE8 C;  4MM3 A;  3WA0 A;  1J19 A;  5E6O A;  4HEA 1;  4IDI A;  3KWL A;  5IA7 A;  3UQB A;  1SBB B;  2PTL A;  3D32 A;  3FAH A;  3QIJ A;  1ZP0 B;  3WAL A;  4BOZ B;  2KMM A;  4EE2 A;  4GU2 A;  4CO7 A;  1FNU A;  3HHM A;  3ZNG C;  1FXT B;  3ZDT A;  1DOX A;  2JU6 X;  4TSS A;  1TTN A;  4W9F A;  1OEY A;  2J4X A;  3FIL A;  3N1Z C;  4E3C A;  3BIN A;  2BW2 A;  4ICU A;  2JXX A;  4FUL A;  4OVZ A;  3GOE A;  4IC7 B;  3T3O A;  3JSV A;  4PS7 A;  1IGD A;  4ZRQ A;  2L32 A;  4K7U A;  3U2S C;  2ZEQ A;  2O2V B;  2GBK A;  3B9J A;  3M95 A;  3P4S B;  1YIW A;  2KDF B;  2JF5 A;  1F9J A;  1PGA A;  2KK8 A;  3SHQ A;  1TY0 A;  1LM8 B;  2WXI A;  1C76 A;  2KQ4 X;  2C5L C;  1WXS A;  4ZHO A;  2WLB A;  3RI7 C;  2HD5 B;  4GDL A;  1X1M A;  1S3S G;  1JWU D;  2C7N B;  2GOW A;  3DOW A;  3P2B A;  2ZPN A;  3AE4 B;  1PFD A;  2M8S A;  4YXD B;  2MBE A;  3B08 A;  3NHE B;  1TKE A;  1YQ3 B;  2WYQ A;  2WXQ A;  2L0F A;  4ASW C;  2PW9 A;  2D11 A;  1L6V A;  1E8W A;  3DVN V;  1E6E B;  1JWA D;  2LJI A;  4YSX B;  3M63 B;  2MP2 B;  3TBL D;  1TKY A;  2BYE A;  1ESF A;  1UH6 A;  2JZP A;  2CJO A;  3IT4 B;  3TEY A;  3MC0 B;  4NPN A;  4JIO U;  3B0A A;  5GMV A;  2J53 A;  2WP9 B;  5JH5 C;  2O6V A;  4YSY B;  2GRI A;  1WZ0 A;  1F77 A;  1V9J A;  2AL6 A;  2Y5B B;  3RMK C;  2HTM E;  3R7R A;  3AEC B;  5AUK A;  2JUO A;  3A4R A;  5BO4 B;  3PRZ A;  4G3X B;  1OFF A;  1KFY B;  1UEL A;  3L0W B;  3RYT A;  4A90 A;  1F0Z A;  5C23 A;  1WGD A;  4Q2J A;  4RNA A;  1MJD A;  3H7P B;  2LEK A;  2WU5 B;  4FHJ A;  4BFR A;  1C78 A;  3ZJV A;  3AE2 B;  2CHX A;  1JQ4 A;  3LDZ E;  2AX5 A;  5D3D A;  2LGD A;  1JWB D;  2QSD A;  3DPD A;  2ZPY A;  1T0R C;  1VRA B;  3R66 C;  2H88 B;  2WXP A;  3R2I A;  1I4P A;  1TYG B;  2Y3A A;  1WGH A;  2M17 A;  1AYF A;  3DBS A;  3VHT C;  4HCP B;  1ZKH A;  3B1L X;  3AU4 A;  2N7D A;  4DXG A;  3DBR I;  4WWP A;  1F2R C;  4XDC A;  2ZNV C;  3TMP B;  1QQR A;  2CS4 A;  2WDR B;  4ARI A;  3EFC A;  4REZ A;  1GC6 A;  3EFU A;  2BT6 A;  2ZVO A;  3PHX B;  2D3B A;  2MX2 A;  5HI1 A;  2VZK B;  4WAF A;  1LFD A;  2IZV B;  4RF0 A;  3V3X A;  1UF0 A;  1NBF C;  2N4F A;  4C7Z A;  4A6Q A;  1OQR A;  4JWS C;  2D3C A;  4AS1 A;  2K8C A;  1V97 A;  1P7F A;  2KLC A;  2WWZ A;  4RH6 A;  2DYO A;  2N9X A;  3PZD A;  4DDG D;  3CF6 E;  3HRD D;  1DOI A;  2AYO B;  1EO6 A;  4AWJ A;  3RNC C;  2RR9 A;  2RDB C;  2DLB A;  1TGZ B;  3VUY A;  3A1Q B;  1RFK A;  1QKZ A;  5KHQ A;  4ACF A;  1E9M A;  1WZ3 A;  2GBR A;  4LNI A;  4C4V A;  4F7Z A;  1TKG A;  4J6I A;  1YD8 U;  3V6C B;  3HM6 X;  1YOV B;  3W5V B;  4P1B C;  4K7S A;  1RM6 C;  4I6L B;  4OW0 A;  1K52 A;  1VDV A;  1JCK B;  4RM9 A;  3WAO A;  1NVI D;  2MJE A;  1J7A A;  2A4Z A;  3V6E B;  3GS2 A;  4ZHP A;  3ML9 A;  4JGH B;  4LNN A;  4OZA A;  1KF6 B;  3W1S C;  5KHO A;  2JQR B;  3W2D A;  3AEB B;  4RMA A;  1U4A A;  1A5R A;  2D5G A;  2QIL A;  1UD7 A;  3P42 A;  2G3Q B;  4FA6 A;  3TEZ A;  2XNA C;  4DK5 A;  2WDT B;  1FMA D;  1JML A;  3KVF B;  4C56 C;  4KZC A;  4LNF A;  3H7S A;  4FLH A;  3AEF B;  2WXM A;  4BKS D;  4GB9 A;  4BOS C;  3AMZ A;  1VZ6 A;  2K8H A;  2ICI A;  2K6Q A;  3DQV A;  4ZYN A;  4XWT A;  3V61 A;  5CTR C;  4LLG M;  2X38 A;  2A5U A;  2WXK A;  3P1M A;  4WJP A;  2J0M A;  3I63 C;  2NPT A;  2M56 B;  3ETR A;  4TQ0 A;  5AZH A;  4M8N A;  2OJR A;  4GSW A;  5E6P A;  1BUI C;  1WXA A;  4M8M A;  4YWG G;  3VFK A;  2PE9 A;  2MBO A;  2D07 B;  3AN1 A;  4P6V F;  2ZW1 A;  2K22 A;  4IG7 B;  2BYF A;  2GBJ A;  1SE2 A;  3OJ3 A;  3DBH B;  3AUL A;  3KQ4 A;  1WR6 E;  3DVG Y;  4XWW A;  1Q0W B;  3BY4 B;  3IVF A;  4G50 A;  1V1P A;  1GJZ A;  3R8B A;  2K3U A;  3SEB A;  3IT6 B;  4A9A A;  2OOB B;  2KFJ A;  2WXH A;  3BYT B;  4ZDV A;  3NJT A;  4M01 A;  2AQ2 B;  2RPV A;  4IKG A;  4HLE A;  1C9F A;  1M4V A;  3H6N A;  4B9K A;  3MFG A;  1T3Q A;  3RUL A;  1V49 A;  3NZS A;  1D4B A;  3KYC D;  1HZ5 A;  1KM7 A;  1TS3 A;  3P63 A;  4KV2 A;  4W9C A;  1DGJ A;  1WE7 A;  2PJH A;  1UBQ A;  1WJ6 A;  2NBW B;  2RD0 A;  1MG4 A;  1V1O A;  2DEN B;  3QAQ A;  1HTQ A;  2IY0 B;  3HUI A;  2KDE B;  1E10 A;  1NI2 A;  3PV1 A;  1ZUD 2; 
#chains in the Genus database with same CATH homology
 2BTE A;  1PGX A;  3IAM 1;  2WXJ A;  1JWM D;  1VJK A;  4C7Y A;  4GLS C;  2K9X A;  4KKI A;  3MP9 A;  3PZ7 A;  3W9C B;  3AED B;  1SF0 A;  3URY A;  1WSP A;  1NEK B;  1KLG D;  2V0G A;  1BML C;  1HA5 A;  1FCL A;  3BVZ A;  1D5X C;  2Q5W D;  5MPO A;  4HKQ A;  2WXL A;  1XCT L;  2OHF A;  2FUG 1;  2AQ1 B;  4HEA 1;  4IDI A;  3KWL A;  2MEK A;  3ZJT A;  4RGT A;  4WQM A;  1SBB B;  2PTL A;  3FAH A;  3NVV A;  1ZP0 B;  2KMM A;  1SEB D;  4EE2 A;  3P4P B;  1TZO A;  1FNU A;  1XXG A;  3U4E G;  2INP E;  4RFB A;  2LHD A;  3NRZ A;  1FCC C;  1YJJ A;  4LTU A;  3CWI A;  1DOX A;  4US8 A;  2BS2 B;  2LGI A;  1XF5 L;  2JU6 X;  2IGG A;  4TSS A;  2MJD A;  4ZOH C;  1UNS A;  1TJE A;  4N59 A;  2J4X A;  1FXI A;  3FIL A;  1T5X D;  4NJC A;  3C8Y A;  5BMH A;  2KAJ A;  2QJL A;  2Y5P A;  2XN9 C;  2W3S A;  1HXY D;  1C77 A;  2BW2 A;  2WS3 B;  3AE6 B;  4NAM A;  1CK1 A;  4OVZ A;  1OQQ A;  1CQV A;  1XLQ A;  3RFZ B;  3N9Y C;  3T3O A;  1PGB A;  5FK9 C;  1QF6 A;  1GB1 A;  1IGD A;  2KAC A;  4ZRQ A;  2L32 A;  3GB1 A;  4JE3 B;  3U2S C;  3B9J A;  3MHZ A;  1XLO A;  1Y56 A;  1YQ4 B;  1IBX B;  4HRO A;  5T8I A;  3P4S B;  2V3N A;  4L1B A;  3VR8 B;  2DYM A;  4GDK B;  2WXO A;  1AWD A;  3I9V 1;  4N6E B;  4IOI E;  1N61 A;  5HG2 A;  1PGA A;  2KWD A;  2NTT A;  4PT5 A;  1EWY C;  1STE A;  1TY0 A;  3W1S A;  2WXI A;  4WUR A;  1FO4 A;  1I4Q A;  2JSV X;  3L4P A;  2MJ3 A;  1C76 A;  2KQ4 X;  1QOB A;  1FFU A;  3OWE B;  3HVD A;  1QOG A;  3AV8 A;  2LMC A;  4ZHO A;  3ZYY X;  1I4H A;  1FNW A;  1WYG A;  1ZE3 D;  2WLB A;  1N63 A;  4L23 A;  4YTM B;  1C4C A;  1SE4 A;  4RGN A;  2RDH A;  1JWU D;  2IGD A;  2HDE A;  3LB8 C;  4OZC A;  4P16 A;  5BMG A;  2BBC A;  3AE4 B;  3AEA B;  1PFD A;  3FC4 A;  2OED A;  3AM9 A;  1KH0 A;  4YXD B;  1C4P A;  1AW7 A;  1TKE A;  1YQ3 B;  1WGK A;  2YEP F;  2WXQ A;  3TUO A;  1PYW D;  1SJE D;  2WXF A;  3Q8C A;  2PW9 A;  1FFV A;  1L6V A;  3LYY A;  1E6E B;  4USA A;  2LHE A;  1I4X A;  1JWA D;  2LJI A;  5TSS A;  4YSX B;  2QMT A;  4ITK A;  1ACC A;  4H2A A;  1JRP A;  4O1N A;  1I4G A;  2DBY A;  2FE8 A;  1TKY A;  1ESF A;  2M0A A;  2JZP A;  3CIR B;  2L1A A;  2CJO A;  2WXR A;  3IT4 B;  1XLP A;  4YTP B;  3E56 A;  3TEY A;  3MC0 B;  1TS5 A;  4NZL B;  2N9K A;  1QLB B;  1WWT A;  4TQ1 A;  2N0S B;  2J53 A;  2WP9 B;  2V3P A;  1D6E C;  1TS2 A;  3Q8A A;  2L83 A;  2Z8L A;  3BVM A;  4HJG E;  1HEZ E;  4YSY B;  1WRI A;  5FKA C;  2GRI A;  1F77 A;  3AB5 A;  1ENF A;  1SE3 A;  1MPE A;  2HTM E;  5EE1 A;  4LK0 M;  4OHJ A;  3AEC B;  5AUK A;  4R3D A;  3SFE B;  3U7Z A;  2WDQ B;  1ZOY B;  1L4D B;  1OFF A;  1KFY B;  4A90 A;  4JPS A;  1F0Z A;  5EE3 A;  4Q2J A;  4RNA A;  3ZGZ A;  1ZXH A;  2WU2 B;  4WH4 A;  4US9 A;  3P4R B;  2LEK A;  1NI3 A;  2N7J A;  3SFD B;  1YMH E;  2EEL A;  2BB6 A;  2WU5 B;  2K0P A;  1RYJ A;  1L5P A;  1C78 A;  1N5W A;  1B9R A;  1KRH A;  2DWQ A;  3Q8F A;  1P7E A;  1V1P B;  3ZJV A;  1NYQ A;  2EKI A;  3AE2 B;  5C3J B;  1JQ4 A;  1MI0 A;  2AX5 A;  2W55 A;  5HFY A;  4C80 A;  1L0X B;  5D3D A;  3AEG B;  1JWB D;  4JX1 C;  2QSD A;  2ONQ A;  4UDU C;  1VRA B;  3AEE B;  3AE9 B;  1SXT A;  1D5M C;  2H88 B;  2WXP A;  1MVK A;  3W5U B;  3R2I A;  1I4P A;  1TYG B;  2Y3A A;  1N60 A;  3KLS X;  4HRS A;  1AYF A;  1SIJ A;  1WXQ A;  4ARC A;  3AE1 B;  1YN5 A;  1ROE A;  4YSZ B;  2BYT A;  4DXG A;  4MT5 A;  1F2R C;  5HHD G;  4XDC A;  4RGO S;  2SAK A;  1QQR A;  1HQR D;  2WDR B;  4ARI A;  4REZ A;  2G1E A;  5FR3 A;  2BS4 B;  2BT6 A;  3VQI A;  1XLN A;  1FM0 D;  1ZPS A;  4OZB A;  2PMV A;  1QOA A;  5HI1 A;  1QOF A;  1GOZ A;  2VZK B;  3AE3 B;  4WAF A;  4RF0 A;  3V3X A;  2WNM A;  2PKO A;  4C7Z A;  4A6Q A;  5BYS A;  2I2Y A;  2E6X A;  2WDV B;  1ZXI A;  1YJI A;  1OQR A;  5G5G A;  4JWS C;  3IXS A;  4AS1 A;  1Q10 A;  1JW9 D;  2FBW B;  1RWS A;  1V97 A;  1SJH D;  1P7F A;  1C4A A;  2IJ0 A;  2CJN A;  1MHH E;  4RH6 A;  1FEH A;  4YTN B;  3BK2 A;  5BYR A;  4MM3 B;  2DYO A;  4B0E A;  3HRD D;  1EWC A;  4AQ7 A;  1DOI A;  5D3I B;  1CJE A;  3EUB 2;  4MH8 A;  4KGS A;  3E9S A;  4A8X C;  2DLB A;  5AUI A;  2AQ3 B;  3LXF A;  1BXT A;  1RFK A;  2SEB D;  1QKZ A;  2ZW0 A;  4DXF A;  2E3T A;  3BVG A;  1E9M A;  1L6U A;  5GXG B;  1E7P B;  3ZQ4 A;  1J7C A;  3NZ3 A;  1TY2 A;  4CQN A;  4RGM A;  1VR9 A;  1TKG A;  1GPX A;  5JXV A;  3FIL B;  3KWV A;  3U52 E;  5EE9 A;  3BYY B;  3W5V B;  3B2G A;  1QIL A;  5H8Y E;  4RF1 A;  1L0Y B;  4TMA B;  3NVZ A;  4JWU C;  1XCQ L;  3NVY A;  1ZDX A;  1CZP A;  4XE0 A;  2NTS A;  3MJ5 A;  5BMI A;  1ET6 A;  1RM6 C;  4KGR A;  2NMQ A;  1K50 A;  1KTK A;  4D2K A;  4OW0 A;  1K52 A;  1VDV A;  1JCK B;  1VLB A;  1NVI D;  3BII D;  2MJE A;  2PVG C;  1J7A A;  1DYQ A;  4WWM A;  1IBX A;  3GS2 A;  1FNV A;  4ZHP A;  1AN8 A;  2JXT A;  3BK1 A;  3UI3 A;  1PDX A;  4OZA A;  2GI9 A;  2JX5 A;  1KF6 B;  3VR9 B;  1UWM A;  1HZ6 A;  1FRD A;  1ET9 A;  3IAS 1;  3O13 A;  2JQR B;  3W2D A;  1JWS D;  3AEB B;  1YNT E;  4GDL B;  2D5G A;  2QIL A;  1ZDV A;  1YN3 A;  2PIA A;  3P42 A;  4KX6 B;  2GB1 A;  3TEW A;  1SB3 C;  3WCQ A;  3TEZ A;  1DOY A;  2XNA C;  1R7S A;  3AH7 A;  2WQY B;  1FMA D;  1JML A;  1B1Z A;  4WIP A;  4C56 C;  2RMM A;  1E0Z A;  1K53 A;  2J52 A;  3HVZ A;  3GP7 A;  3AE8 B;  1UGJ A;  2IPK D;  3AEF B;  4L2Y A;  3EA6 A;  1JAL A;  1C79 A;  1EM7 A;  2WXM A;  1GB4 A;  3EGR A;  1FIQ A;  1TS4 A;  3AMZ A;  4J3O D;  1VZ6 A;  1JRO A;  2V4I B;  4N58 A;  1K51 A;  2KDM A;  2ICI A;  4M0W A;  3SR6 A;  3H8H A;  2M19 A;  4XWT A;  4DQO C;  1EU4 A;  4LLG M;  2X38 A;  3VRA B;  2BB5 A;  2CU3 A;  2WXK A;  3P1M A;  2INN E;  3BWU D;  4YT0 B;  2H89 B;  2M56 B;  2WXG A;  3ETR A;  4RCO A;  1EU3 A;  2JWU A;  1PUT A;  3PO0 A;  4TQ0 A;  5C2T B;  1UUP A;  2RDG A;  4FXC A;  3NS1 A;  4A55 A;  2QEJ C;  1BUI C;  1V8C A;  2IGH A;  2MH7 A;  2W54 A;  3NVW A;  2Y5C A;  4YWG G;  2LUM A;  3AE5 B;  1I7H A;  1VZ7 A;  3B2F A;  3DWM A;  5LNK 1;  1FRR A;  3AN1 A;  4P6V F;  3Q69 A;  2R61 A;  5D7G A;  1L0V B;  3DWG C;  3BZD B;  1FXA A;  1VZ8 A;  3TSS A;  2ZW1 A;  1T6B X;  2K22 A;  2PLP A;  3NUH B;  2LFI A;  1SE2 A;  3V05 A;  4ZYS A;  5H92 C;  2I38 A;  3P4Q B;  3KQ4 A;  2K5P A;  2N9L A;  2QIE B;  1LO5 D;  4XWW A;  2IDY A;  4B0M A;  1N5X A;  5EE0 A;  3T3N A;  1V1P A;  2BS3 B;  1QT9 A;  3R8B A;  2K3U A;  3SEB A;  4KGT A;  3IT6 B;  5BYQ A;  1I4R A;  2YEP B;  4A9A A;  1NEN B;  3Q8B A;  2J42 A;  2WXH A;  3BYT B;  1NYR A;  2L52 A;  5G5H A;  3Q8E A;  2AQ2 B;  2RPV A;  3AE7 B;  4IKG A;  2ACZ B;  1J7B A;  2G9H D;  1MHX A;  1XEE A;  1IGC A;  1N62 A;  2W82 A;  2JYE A;  2WXN A;  2JYT A;  1C9F A;  1D5Z C;  1M4V A;  3TEX A;  4XDD A;  3MFG A;  2VZK D;  1T3Q A;  1SSN A;  1A70 A;  2B76 B;  3J9C A;  1XO3 A;  2W3R A;  4MAC A;  1GAQ B;  4KKJ A;  3ZJU A;  3PZ8 A;  3R2T A;  3ABV B;  2PVO D;  1D4B A;  1FD6 A;  1F2R I;  1HZ5 A;  1TS3 A;  1IUE A;  3P63 A;  4HKZ E;  2TSS A;  1DGJ A;  2KN4 A;  3I57 A;  2ON8 A;  3RPF C;  3VRB B;  4NAW B;  1V1O A;  1L4Z B;  4ZRP A;  5E6J A;  5I4D A;  1YN4 A;  3HUI A;  1UWX A;  1KLU D;  1E10 A;  1ZUD 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...