2PKOA

Crystal structure of yeast urm1 at 1.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Ubiquitin-related modifier 1
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pkoA00
1FXIA 3DWMA 3L4PA 1JQ4A 1ROEA 2MH7A 3AEEB 4JX1C 4A9AA 1SIJA 4HRSA 5H8YE 3AH7A 5AUKA 1ZUD2 1L6VA 1PFDA 3NRZA 3NVVA 2WU5B 4IDIA 4N59A 1OQQA 1VLBA 4WWMA 1CZPA 2M19A 5H92C 4P6VF 1N61A 3NVWA 2H88B 1L0VB 3P1MA 1V8CA 2K9XA 3AE6B 4C7YA 1GPXA 2G1EA 3W9CB 1J7AA 1NYRA 2W55A 1FFUA 2DBYA 5EE9A 1E7PB 1WYGA 1OQRA 1AYFA 1XLQA 1OFFA 3AECB 1KF6B 1QOAA 1QOGA 1FO4A 2CJOA 1WWTA 2JX5A 1NEKB 2WQYB 4C7ZA 5AUIA 2MJEA 3AE4B 1IUEA 2OHFA 1I7HA 3AE8B 3AEAB 3P4QB 4US9A 3FAHA 3P4SB 5GXGB 1XLNA 2WDVB 4US8A 2CU3A 1GAQB 3LXFA 1E10A 1TKEA 1EWYC 1V97A 3VR9B 3AV8A 1DOXA 3AEGB 3HVZA 3W5VB 1YJJA 3EUB2 1NYQA 1T3QA 1N5XA 1JROA 1KFYB 4ITKA 4YTPB 4C80A 3B2FA 1UWMA 1WRIA 2PVOD 1NENB 2K22A 2WDRB 5MPOA 3B2GA 3KWLA 4FXCA 3SR6A 4YXDB 3AE2B 1B9RA 3RPFC 2E3TA 1RFKA 1QOBA 5C3JB 2QJLA 2K5PA 3AE5B 3SFEB 2WLBA 1WGKA 3AEFB 3CIRB 2B76B 4N58A 2N0SB 1XLPA 4JWSC 1TKYA 1J7CA 2M56B 1TJEA 1RM6C 3P63A 5EE3A 2WP9B 3LB8C 1AWDA 3AN1A 1KRHA 1A70A 1FFVA 2W54A 3VR8B 1E9MA 1L5PA 5EE1A 2BT6A 2FBWB 2L83A 1N63A 1TYGB 1XLOA 4ZOHC 1ZXIA 2L52A 5G5GA 1FRRA 4N6EB 1JWAD 3NS1A 1QT9A 1FMAD 2W3SA 4YTNB 4YTMB 1PUTA 3DWGC 1J7BA 1RYJA 1F0ZA 1PDXA 3AE9B 5EE0A 3HUIA 1NI3A 2AX5A 1DGJA 1RWSA 1FRDA 2MJDA 1L6UA 1SF0A 2PVGC 3ZYYX 3AE3B 3AEBB 2WU2B 3CWIA 2WDQB 3HRDD 4JWUC 1ZOYB 2ACZB 1YJIA 2H89B 3VRBB 3PO0A 1YQ4B 2KMMA 1QOFA 3BIID 1CJEA 3AM9A 1NVID 2W3RA 4YSZB 3P4RB 2BS3B 1FXAA 3P4PB 4LTUA 1FM0D 2KAJA 3AB5A 3ABVB 1VDVA 1JW9D 2LEKA 2PIAA 1N62A 2QIEB 4YT0B 1VJKA 4YSXB 1XO3A 1JRPA 1R7SA 4WQMA 2Y5CA 3ETRA 3SFDB 1N5WA 1TKGA 3AEDB 2MJ3A 2PKOA 1JALA 1WXQA 2HTME 3AE1B 4ZHPA 1SB3C 2DWQA 4KX6B 3NVYA 3W5UB 1QLBB 2Q5WD 4USAA 1DOIA 1ZP0B 2WS3B 5G5HA 1QF6A 1E0ZA 1DOYA 2EKIA 1YQ3B 2BS2B 1N60A 2JQRB 3VRAB 1JWBD 3AMZA 3AE7B 3B9JA 4ZHOA 1E6EB 2BS4B 4HROA 2CJNA 5C2TB 3WCQA 1FIQA 4YSYB 3FC4A 3NVZA
chains in the Genus database with same CATH superfamily
3L4PA 4EFOA 4KKJA 3SHQA 2RPQA 3AULA 2KN5A 2KX0A 2WWZA 2J0JA 3PV1A 3IVFA 2Z8LA 4IWOA 2D5GA 1SSNA 3H7PB 4DHZE 2FAZA 2ZVNA 1GC6A 3WAMA 4RM9A 2KLGA 1Z5SB 1T0YA 4AJWA 2KWVB 1TIFA 5J17A 3W1SA 3FAHA 4KGRA 4MEMA 3LXFA 1KLGD 3R7RA 2V4LA 1NYQA 1SE9A 2QSDA 3N1YC 2BYTA 4ASWC 3DVNV 4HPMB 4YXDB 4W9KA 2MW5A 1SBBB 4HJGE 3CIRB 2K25A 1EU4A 3QQ8B 2RMMA 3LB8C 5D94A 2C60A 1VRAB 3HK0A 3ZTDA 3JW0X 4KV2A 1E8YA 1ET6A 2M4NA 4IUMB 4QAYA 3ECIA 3TEZA 4FJYA 3N1ZC 5EE0A 1I4XA 2JVCA 3PZ8A 1YX6B 4DDGD 2MBBB 1J19A 4GXBA 2WU2B 2CHXA 3BYTB 2KDIA 2KMMA 3TSSA 3HIZA 3MHZA 3P4RB 4DQOC 2D3AA 2WXJA 4LTUA 1FCLA 3PREA 4BZAA 4RGMA 2HTME 3AE1B 2KQ7A 2OJWA 4BVUC 4GIVA 3DBLB 2K8CA 4HPLB 2IY0B 4P7IA 1FEHA 2WXNA 3GE8C 3MFGA 2CJNA 4XX5A 2N7DA 1I4HA 1WM2A 2JXTA 3UGBB 3PGEA 4PT5A 1Q10A 3PRPB 3NVVA 4JIOU 2NMQA 4HDOA 1IGDA 1MJDA 2AQ3B 4NQLB 2H88B 4YL8A 2DYOA 2LFIA 2KO3A 3W9CB 4FJZA 4M8MA 2M8SA 1DYQA 1AYFA 4HDQA 1OFFA 3RULA 2LGDA 1KF6B 3ZNID 1KLUD 2IGHA 2OEDA 3RZWC 3AEAB 1FD6A 2JPHA 2JZ3B 3A33B 3V3XA 1V1OA 2HTHA 5L95C 3PT2B 4AQ7A 4ITKA 3I5JC 1P3QU 1WH3A 3KWLA 2LUEA 2ZNVC 1CK1A 2KWCA 4FA6A 1E8WA 2ZNVB 1P0RA 3IT6B 1KRHA 3SU8X 4BKSD 4MGZE 4W9EA 2BT6A 2L83A 4W9JA 1ZXIA 5G5GA 1F0ZA 3KYCD 3OLMD 4M0WA 3DHIC 1L6UA 1SF0A 3NJTA 2JU6X 1CQVA 3AU4A 4M0WB 2L76A 3PO0A 3A9JB 3RYTA 4YSZB 4X57B 1FCCC 2KAJA 4XWWA 4AOFA 4JE3B 1V86A 4YT0B 3RZFA 1I35A 2IYDB 4WQMA 3AEDB 4OZAA 2LMCA 2IPKD 1EU3A 4RNAA 1QF6A 2FIFA 3DVGX 1MHXA 3PHXB 2ZW1A 3Q8FA 2KNBA 2D07B 2WX0A 4DXAB 3GB1A 1L4ZB 4A9AA 3RNGC 3MTNB 1KJTA 4HCNB 4ANXA 5BMGA 3N20C 3L13A 3AE6B 1UBIA 2BWES 1WJ4A 2V4IB 1ZDVA 1IYFA 1WGHA 2G1EA 2NBWB 1V1PA 2MBHA 1WWTA 2CHWA 4I6LB 2C7NB 2V1YA 1V97A 1D6EC 3V05A 4BFRA 3QCAA 4WWNA 4C80A 4RGTA 1ESFA 4MGIE 4LJOB 2KMCA 5C3JB 4IC7B 1TKYA 4DWFA 4MM3A 1TJEA 2QMTA 4P1CC 3RNCC 2FCQA 5EE1A 4D2KA 1VCBA 1UBQA 4ZOHC 4ARCA 1JWAD 1SE4A 4YTMB 2E6XA 3H1UA 5LNK1 1OEYA 2PVGC 3ZYYX 2FNJB 4PS8A 3ZNHB 1NBFC 3Q69A 3VRBB 3KLSX 2LXCA 5L83A 1WXMA 4MH0E 2BS3B 3JYUA 2IJ0A 2ICIA 3ABVB 4KIKA 2PLPA 2PIAA 2MLBA 4JPSA 4OVVA 1R7SA 3ENEA 3SFDB 3DDCB 2N7EA 2XNAC 1IGCA 2CU1A 3A9JA 4G0NB 3X23A 2C7HA 3FC4A 3OG5A 3FILB 5IO9A 1GB1A 4C4VB 2BTEA 1PQSA 2NPTB 3TJPA 4O1NA 1MG8A 2WU5B 2BQQA 1QILA 2GBKA 4P6VF 5E6NA 1HE8A 1LXDA 2L8JA 4BKSA 4F7ZA 4FBJB 1FFUA 2WXQA 4TKNA 3DHHC 1FPYA 2MA9B 2PEAA 1YX5B 3AECB 2N7JA 1ZE3D 2CJOA 4C7ZA 2CR5A 3WIMA 2X38A 4W9HA 3TMPB 1S3SG 3VR9B 1AARA 2ZW0A 4S0RA 4HCPB 4XYCA 2BWFA 3VTWA 4FLHA 2QHOA 3PLVA 1Q1OA 1J8CA 1V2YA 3NZUA 3U30A 1K52A 4KGTA 4BBNC 3ZW3A 3V62A 2FUHB 3PRMB 3UIOB 1RYJA 4RGOS 1DGJA 5IN7A 3UINB 2AL3A 5HI1A 2ACZB 4F8CB 1CJEA 4AUQC 4ARIA 2DYMA 4NAWA 3ZNZB 3U7DA 3IAS1 1WZ3A 5G2NA 5FKAC 3PS6A 2M1MA 3DBHI 2L1AA 3M95A 4ZYSA 4ZRPA 2V9HA 3AMZA 4WJPA 2BS4B 2K1FA 2LRUA 3HM3A 2XK5B 4L23A 4GDKA 5FR3A 3PLUA 4MJSB 3KVFB 3GZNI 1E8XA 4A55A 3IAM1 2L7RA 3VAWA 1WMHB 1L2NA 1ACCA 4WURA 4MSMB 2LXAA 5BMHA 3Q8CA 3PVLA 2DBYA 2HJ8A 1K50A 2QILA 4AS1A 3OWEB 2C5LC 1WYWB 1NEKB 3VHTC 3JVZX 1IBXA 4LDTB 4US9A 4GOCA 1GAQB 1WI0A 1Q5WB 3Q14C 2G4DB 2DX5B 2IGDA 2LGYA 2BKRB 3H7SA 4EZLA 4MGYE 3T8MA 1NENB 2DNFA 1G6JA 4HPPA 2WXLA 1B9RA 1TS5A 1WGKA 2WXGA 5G55A 1XLPA 4W9LA 4DBGA 1P1AA 1C79A 1V81A 3R8BA 1L5PA 4AJYB 5CHFA 2CKHB 3KYDD 3NUHB 3D32A 3U52E 3DWGC 3AE9B 2K6DB 1NI3A 4OVUA 5JHBA 2KC2A 3AE3B 1ZOYB 3QAQA 1YJIA 2L00B 1MVKA 3K9OB 2KJHB 2N9LA 2IZVB 3AB5A 3A9KA 4GDLB 4WWOA 1N62A 4E74A 4OZBA 1JALA 2KLCA 3W5UB 1QLBB 2J52A 4JQWC 4DK5A 1ZGUB 4J6IA 2Z59B 3V61A 3VH4B 1RAXA 2KMAA 3UI3A 2EELA 2C9WB 2LVPA 1ROEA 4JX1C 5H8YE 4HVBA 1ZUD2 3W1SC 4IDIA 3NRZA 1LGRA 1SE3A 2NBUA 3Q8BA 2VRRB 3X0WA 3BVMA 4LDTD 2O2VB 4LJPB 1QOGA 2EKEC 5C1ZA 4HK2A 4GMVA 3O65B 1N6ZA 4IWPA 4M01A 4XWTA 5IP4D 5BYQA 5GXGB 4CO7A 3M3JA 3RI7C 1TY2A 2L05A 4K81A 2CU3A 2PMVA 2R61A 3BVZA 4GU2A 3HVZA 2LVOA 4LK0M 2V0GA 3SDLC 4YTPB 2WXOA 3N1XC 1WJ6A 2CHZA 3SFEB 2MBQA 2PTLA 2N0SB 4TSSA 2MSED 3QHTA 3PHWB 2W54A 2YVCA 4C56C 5CX3A 3Q3OC 2PPHA 3GP7A 3NS1A 4WJQA 2KFJA 1V49A 5IKCM 1SJHD 1TZ1A 3DQVA 2KJRA 4JWUC 2JF5A 2H89B 2IGGA 2NCNA 1LFDA 2D3GA 1NVID 3QARA 2N9KA 4LNKA 3L0WB 3J9CA 2DHZA 5D7GA 2Y5CA 4JGHB 3O13A 2M0XA 3AI5A 1EUVB 2BYFA 5T8IA 2DLBA 3ZRCA 3DVNU 1N60A 1YN5A 3VRAB 2K39A 4B9KA 2AEHA 2MCNB 2BYEA 3APFA 4ICVA 4UDUC 4PS7A 2A4ZA 5TSSA 4RH6A 4EZJA 4RGNA 1D5XC 2M19A 1R4MB 4ZRJA 3RCZA 3L17A 1J7AA 1E7PB 2LD9A 2KC1A 3EECA 3DHGC 2EMSA 4NY0A 2OHFA 2HE7A 4K7UA 2FIDA 2GBRA 3RNBC 3VH3B 3ZRFA 2C7MB 2IO2B 3B2FA 3Q8AA 2NVUI 4ZRQA 3SR6A 2XEWA 3W2DA 1RFKA 1T6BX 4XZ4A 2K5PA 5TR5A 2BVCA 4GN1A 2NPTA 3IHPC 1C4AA 2WXIA 1RFAA 1RLFA 2L32A 1C77A 4CQNA 2JYTA 1XLOA 1FRRA 5AZFA 5DPWA 4AP4C 4B6WA 2INPE 1F52A 2R2QA 4ZRKA 4JL9A 1LO5D 5BYSA 1YQ4B 4EEWA 1FXAA 3MC9A 3BK1A 1EF1A 1F9JA 4II2B 2D3BA 3DBLI 1XO3A 4KDIC 2K0PA 3SEBA 3TBLD 2J0MA 1HA5A 2HDEA 2G9HD 2BS2B 1WGRA 3B9JA 4KZCA 2FE8A 1YNTE 4HROA 2MQJA 3A1QB 1R4NI 3BZDB 3UQAA 4BOZB 1EO6A 3APCA 1UUPA 5DPTA 4FHKA 1GJZA 3N9YC 3Q3JA 5FK9C 2LZ6A 3R2TA 3PRZA 1WE7A 3NZ3A 1NDDA 4B0MA 3DBRB 2FCNA 2GI9A 2BF8B 2JX5A 1WY8A 3AE4B 2WDVB 5JHAA 3URYA 1HEZE 4RMAA 3H9DA 1VR9A 2AWTA 2V3PA 1HQRD 1WF9A 1UWMA 2WDRB 3LYYA 2J53A 1SJED 1K8RB 1OQYA 3V60A 1JMLA 1WE6A 4MJSA 1T0QC 4N58A 3RNEC 4JWSC 1HTOA 2M56B 1OGWA 2G4SA 1LQBA 1FFVA 4WWPA 2I38A 4LCDE 1T5XD 2LI5A 5JXVA 1F77A 1A5RA 1QT9A 1VZ7A 3HUIA 2SEBD 2PW9A 1XXGA 3B1LX 3CSTA 3HRDD 2QEJC 2DZMA 1C1YB 2BBCA 4KKIA 4LLGM 2KTRA 3ML8A 1FM0D 5FR6A 1TGZB 1WXVA 3QWZB 1M4VA 1KOTA 3TCAA 1D3ZA 1TKGA 4RF0A 4XDCA 1I4QA 1XEEA 2WGSA 4USAA 3T9LA 2AQ1B 3IG3A 2KXJA 1JWBD 1PGAA 1YN4A 1KLVA 2RR9A 5C2TB 3DWMA 3PTFC 3DBSA 3V6CB 3ZTCA 2QDFA 1OQQA 1CZPA 1R4MI 5H92C 3QC8B 3TEWA 1IPGA 3B0AA 2WDTB 4NZLB 1GUAB 1XF5L 3MJWA 4C7YA 2KTRB 4G50A 2KD0A 1TS4A 2K8HA 1YQBA 1JRUA 1T0SC 2LHDA 1I42A 2ZEQA 4B0EA 4M02A 2LJIA 1SXTA 4MM3B 3VVWB 4NAWB 3AEGB 3EUB2 4URKA 1XCTL 1TY0A 4IM3A 3Q6BA 3BWUD 4MT5A 1WX7A 4TUUA 3T3NA 3NS8A 1P7FA 4MH8A 5HKHA 2QJLA 2WLBA 2B76B 4LNNA 3C19A 4KVGB 3L16A 3DPDA 2Z0EB 2Y3AA 3U4EG 3JSVA 3AXCA 1FMAD 2A5UA 2NBVB 3A9KB 2PE9A 4GDLA 1L7YA 2WXHA 1GG3A 3R7QA 1YMHE 1B1ZA 1P98A 2ZZPB 3BIID 3B08A 4NJ6A 1V5TA 3MC0B 3AM9A 2ASQA 3K9PB 4OZCA 1VDVA 2LEKA 2GBMA 2Y5PA 2KQSA 4DXFA 3NOBA 1D5ZC 2EKIA 4PYUA 2Y5BB 3EFCA 3FKYA 2KZRA 5BO4B 2MX2A 1XQQA 2BGFA 2LGSA 5AUKA 1LM8B 1Y8RC 5HFYA 4N59A 1TT5B 4A20A 1SIFA 2KKCA 5IOIA 3VUWA 3BYYB 2LHEA 4WAAA 1E7VA 1V8CA 2J42A 2K9XA 2IO0B 4L2YA 4P1BC 4RFBA 3DOWA 1V6EA 4LNFA 1HZ5A 5IA7A 3BY4B 1GOZA 1HXYD 3ZO5B 2WXRA 1QZEA 2DENB 1PGBA 1TKEA 3I3TB 4XDDA 1QKZA 3E9SA 3P42A 4GGQA 3JSVB 2MBOA 1FNWA 2MP2B 1KH0A 3RUIB 4MSQB 2AQ2B 1Q0WB 1SE2A 1RM6C 1I4PA 4TQ1A 5KHQA 2KK8A 2HJ1A 2D2QA 1FNUA 1ZKHA 2IBIB 3QA8A 5E6JA 1ET9A 3MJ5A 4FJVB 2AX5A 2XN9C 2N1WA 1FRDA 2VZKB 1WGGA 3M62B 2GLSA 1WX9A 2KDBA 2O6VD 4ANUA 5AZGA 3DBHB 2LASA 5LLIA 1JRPA 3Q3NC 1C9FA 3ZGZA 2MEKA 1E7UA 2MJ3A 3GE3C 1VZ6A 1XCQL 1V5OA 3Q3FA 1JWUD 2JZZA 4DHZB 1P7EA 2JQRB 3RT3B 2GOWA 2BKFA 1TS3A 1M94A 1L0YB 2JWZA 1FXIA 3M63B 3VDZA 2WNMA 2JRHA 1GNUA 1L6VA 4W9FA 3RNAC 4MGKE 2UWQA 1C78A 1TTNA 3UF8A 4A8XC 3KWVA 2X8XX 3WA0A 2GB1A 2D3CA 2GMIC 1KM7A 3IFWB 1MI0A 2O6VB 3P1MA 4MDKE 5C23A 3W1YA 2MRPA 4RCOA 4GSWA 1OQRA 1XLQA 3I9V1 3PZ7A 2WQYB 5AUIA 2MJEA 1D4BA 5AZHA 3AE8B 2B3AA 3P4SB 2NTSA 1TBEA 2GRIA 2D10A 1YJJA 4E71A 3BVGA 4ZDVA 4NAMA 2GBJA 1WRIA 3RMKC 2PVOD 1T0RC 1YD8U 2AYOB 5EDSA 5GMVA 1JWMD 2KFKB 2IO3B 1NI2A 4II3B 4W9GA 1WXAA 1A70A 2LWPA 3VR8B 3ALBA 1UZXB 1I4GA 3HM6X 2EMTA 2RGFA 3U7ZA 1UH6A 3WAOA 4I6NB 2K3UA 3NHEB 4TQ0A 1YJ1A 3KH0A 1OEYJ 1HZ6A 2JZPA 5HHDG 2ZCBA 2BB5A 3IT4B 1VJKA 1N5WA 3ZJTA 1GB4A 3KUZA 1BT0A 3R3MA 4ACFA 1V80A 2BW2A 4KX6B 1E8ZA 1DOIA 2L0FA 4MACA 3NZSA 4CYEA 1WGDA 4TMAB 2DZJA 4NNJB 1UGMA 4EOYA 3OJ4B 3VTUA 4NJCA 3AH7A 4S17A 2FCSA 2K6QA 1QQRA 4WWMA 1TS2A 3APDA 3VUXA 1L0VB 3AU5A 3BK2A 2N4FA 1WYGA 2LUMA 1F1HA 3DCGA 5JH5C 1MPEA 2FCMA 5LXHA 1WRDB 1EWYC 1T3QA 2PJHA 3GZNB 2RSUA 4FXCA 3FILA 2VZKD 2I1JA 3I57A 4C4VA 1WM3A 3DVGY 2IDYA 4RF1A 1I4RA 3H7PA 3KUCB 4AWJA 2L52A 4N6EB 5HG2A 1S1QB 2MWSB 2W3SA 3WANA 2MHJA 2M0AA 4B95A 3H8HA 4K7SA 3ZUNA 4EUTA 1GC7A 2LRWA 5IAAC 3L54A 5D2MB 4PS3A 3P4PB 5CHVC 1IP9A 3C0RB 1ZDXA 2IO1B 3EGRA 2LJ5A 2N1VA 3ETRA 4KZ0A 2PKOA 4ZHPA 5J2RA 3NVYA 2N9EB 3WAPA 1DOYA 4HEA1 3T3OA 1OTRB 2XK5A 4OW0A 4ZHOA 4W9CA 4HKZE 4KIKB 3WCQA 4CHKA 2J4XA 3VUYA 2ZJDA 1SGHA 5JZEB 4IM0A 4IKGA 2VH2A 4REZA 2DAFA 3Q3MC 1VLBA 2RDGA 5KHOA 3MHSD 3NVWA 5DPRA 1YN3A 2JRIB 1P9DU 5EE9A 4DHJB 1Z2MA 1UD7A 3L10B 4EE2A 1FO4A 4N9F4 4M00A 4A3PA 3VFKA 2UYZB 3P2BA 1E10A 2HD5B 1DOXA 3VXWA 2WXMA 1J0GA 1UGJA 1N5XA 2KDFB 4WJNA 1WR6E 2WXPA 2ZPNA 3IXSA 5MPOA 5DCNA 2E3TA 2RD0A 4P16A 3AE5B 4OHJA 5EE3A 4TV3A 2NTTA 3ZQ4A 2QCZA 1BXTA 5LXIB 2ZCCA 3S2AA 4A6QA 1H8CA 4PYZA 4IG7B 1WIAA 1F2RI 2BPSA 3HVDA 3L08A 3Q2AC 4FULA 2CS4A 2XBBC 1XT9B 1D5MC 5D3IB 3R66C 3QX1A 1K51A 3RNFC 2KVRA 2RDBC 3CMMB 1WZ0A 4F1SA 2G45B 2QIEB 4A90A 4W9DA 4YSXB 2INNE 3GOEA 2DZIA 1EWCA 3RFZB 3U2SC 4BBNF 2DWQA 3ML9A 2Q5WD 4H2AA 1E0ZA 1ZP0B 1WJUA 1YOVB 2LVQA 4NJ7A 3QK0A 4YSYB 1BUIC 1E5WA 1JQ4A 2MH7A 1ZW7A 2YEPF 2REXA 2ON8A 3HHMA 1V9JA 3OAWA 2WXKA 1BMLC 4NQKE 1R4NB 4KGSA 4XGAB 3QIJA 4I6PA 4ANWA 4GDKB 1QOAA 3RD2A 1JWSD 4HWIB 4ZYNA 2O2VA 3EHVA 4DHJD 4BKTA 4US8A 4YWGG 1VZ8A 2R2OA 2M17A 3Q8EA 3CF6E 3AV8A 3PZDA 1FXTB 1JROA 3R2IA 1KFYB 2IY1B 2SAKA 4K3CA 2OOBB 3KW5B 2D11A 4BKGA 1QOBA 3N30A 3AEFB 2DYBA 4KDLB 4OVZA 2FUG1 2KOXA 3P63A 1U4AA 3UQBA 3TEXA 1AWDA 3AN1A 1WJNA 3PPAA 3NG0A 2JXXA 2FBWB 4WJOA 3TUOA 2TSSA 3C8YA 3VTVA 2MP2A 2RPVA 4YTNB 1J7BA 4M8NA 1YIWA 2BYVE 1RWSA 1UF0A 4ANVA 3CWIA 2WYQA 2WDQB 4W9IA 4EKUA 1QOFA 4HJKA 2INDC 4G3XB 2MBEA 2N9PC 3GS2A 3ZLZA 1AN8A 1C76A 1L4DB 1WX8A 2WS3B 1XD3B 1JCKB 2L0TA 3H6NA 1Y56A 1YQ3B 2JUOA 2KVZA 2I1KA 3SD5A 1FIQA 1SEBD 4LNIA 3E56A 4K3BA 5CTRC 4HRSA 2NR2A 1PFDA 2ZPYA 2PE6B 4EZKA 5D6JB 2KWDA 2W9NA 1GPXA 1NYRA 3ZJVA 4FN2A 4C00A 2KX3A 2N9XA 1IUEA 3LJ3A 5E6OA 1F2RC 1STEA 4XE0A 4R3DA 4WH4A 1AW7A 2KDMA 2JSVX 2AL6A 4MELA 3CSFA 2K22A 2L3ZA 3B2GA 1ZPSA 2DAJA 3RPFC 2JWUA 2JY6A 2YLMA 1WSPA 4PK1A 4IM2A 3VQIA 3EA6A 1J7CA 1MHHE 2YEPB 2WP9B 3U8ZA 1E9MA 4L1BA 3KUDB 2KJ6A 1N63A 1TYGB 1WR1A 1UELA 3TEYA 2Z0DB 1PDXA 3A4RA 2G3QB 4GLSC 2MJDA 3TL5A 1TZOA 3AEBB 3V6EB 5BYRA 2KHWB 3ZNGC 4DDID 2LGIA 2W3RA 1H4RA 3DBRI 3EFUA 1MFWA 1C3TA 3ZVVA 3OJ3A 1V1PB 1JW9D 4A3OA 2RDHA 4KSLC 3A4SC 2ONQA 2ZVOA 4G11A 1ZXHA 4IW0A 4HKQA 2KN4A 1SB3C 3MP9A 2V3SA 3EC8A 3MC8A 3PSEB 4IWQA 2WXFA 2KANA 1KTKA 4BAXA 1PYWD 3AE7B 2QC8A 3ONSA 4LNOA 1MG4A 1X1MA 2KFKA 3AEEB 1SIJA 3A1QA 4HXDA 3ZXVA 4RM8A 3N32A 1EF5A 1N61A 5BMIA 4WIPA 1E90A 2VH1A 2NS5A 5D3DA 2W55A 2INCC 2K8BA 2O6VA 2UU7A 2W82A 3TIXA 3UIPB 4HLEA 5DPSA 2LGXA 1IBXB 1PGXA 4FADA 1FNVA 2J7QB 1I7HA 3P4QB 1XLNA 4BOSC 4FHJA 3ZDTA 4XC2A 2KACA 3RN9C 4JLCA 1CMXB 3KQ4A 4IOIE 2J0KA 3W5VB 5CHWA 1RRBA 2GBNA 2KTFA 3ZIMA 2I2YA 2WHIA 4NPNA 3AE2B 2DZKA 4K7WA 3ZKJC 5AEKB 2KQ4X 1UNSA 2KWUB 3N3KB 1C4CA 1VD2A 4ICUA 1UWXA 1ENFA 1WGYA 3I63C 3IBEA 1WMHA 4GB9A 1WFYA 2KT7A 1K53A 2WX1A 2V3NA 1PUTA 3NY5A 1C4PA 3ZDMC 1EM7A 2KYWA 4ZRIA 2KDEB 3WALA 2JT4B 5J18A 4Q2JA 5I4DA 2BB6A 4WAFA 4WQOB 1WXQA 4E3CA 2OJRA 1ISNA 3BINA 4J3OD 4K1RB 1L0XB 5G5HA 1WXSA 3ZXRA 1HTQA 3ZJUA 4KSKC 5E6PA 4DXGA 1E6EB 2JYEA 3QJZA 3LDZE 3NVZA
chains in the Genus database with same CATH topology
3L4PA 3DWMA 5FR3A 4KKJA 4IKGA 4L23A 4REZA 1OQQA 1VLBA 2RDGA 3IAM1 4A55A 1CZPA 5H92C 3TEWA 1ACCA 3NVWA 2Z8LA 4WURA 2D5GA 5BMHA 1SSNA 1YN3A 3Q8CA 4NZLB 1XF5L 4C7YA 2DBYA 5EE9A 1K50A 2QILA 4AS1A 1TS4A 3OWEB 4EE2A 1FO4A 1NEKB 2LHDA 1IBXA 4US9A 4B0EA 3W1SA 3FAHA 4KGRA 2LJIA 1SXTA 4MM3B 1GAQB 3LXFA 1E10A 1KLGD 1DOXA 4NAWB 3AEGB 2WXMA 3EUB2 1XCTL 1NYQA 1TY0A 1UGJA 2QSDA 1N5XA 2IGDA 2BYTA 3BWUD 2WXPA 1NENB 3IXSA 4MT5A 5MPOA 4YXDB 3T3NA 2WXLA 1B9RA 2E3TA 1P7FA 4P16A 4MH8A 1SBBB 2QJLA 3AE5B 4HJGE 1TS5A 1WGKA 2WLBA 2WXGA 2B76B 3CIRB 4OHJA 1EU4A 1XLPA 2RMMA 5EE3A 2NTTA 3LB8C 3ZQ4A 1VRAB 1C79A 3R8BA 1L5PA 1BXTA 1ET6A 3NUHB 2Y3AA 3U4EG 4A6QA 1FMAD 3U52E 3DWGC 3TEZA 1F2RI 2WXHA 3AE9B 5EE0A 3HVDA 1NI3A 1I4XA 3PZ8A 1YMHE 1B1ZA 3AE3B 2WU2B 1D5MC 1ZOYB 5D3IB 1YJIA 3BYTB 3TSSA 2KMMA 3BIID 1K51A 1MVKA 3MC0B 3AM9A 3MHZA 2N9LA 3P4RB 4DQOC 2WXJA 4LTUA 3AB5A 1FCLA 4OZCA 1VDVA 2LEKA 4GDLB 2QIEB 1N62A 4A90A 4YSXB 2INNE 2Y5PA 4OZBA 4RGMA 1EWCA 1JALA 2HTME 3AE1B 3U2SC 3RFZB 2DWQA 3W5UB 1QLBB 2J52A 2Q5WD 4H2AA 4DXFA 1E0ZA 1ZP0B 1D5ZC 2EKIA 3UI3A 1FEHA 2WXNA 2EELA 3MFGA 2CJNA 4YSYB 1BUIC 1I4HA 2JXTA 1ROEA 1JQ4A 2MH7A 4JX1C 4PT5A 1Q10A 5AUKA 5H8YE 1ZUD2 2YEPF 3NRZA 3NVVA 4IDIA 5HFYA 1SE3A 2NMQA 2ON8A 4N59A 1IGDA 2WXKA 1BMLC 3Q8BA 2AQ3B 3BYYB 2H88B 2LHEA 4KGSA 2DYOA 1V8CA 2J42A 2K9XA 2LFIA 4L2YA 4RFBA 3W9CB 4GDKB 1DYQA 3BVMA 1AYFA 1HZ5A 1OFFA 1KF6B 1QOAA 1QOGA 1KLUD 2IGHA 2OEDA 1JWSD 1GOZA 4XWTA 1HXYD 3AEAB 5BYQA 5GXGB 2WXRA 1FD6A 1TY2A 4US8A 2CU3A 1PGBA 4YWGG 1VZ8A 3V3XA 2PMVA 1TKEA 2R61A 3Q8EA 1V1OA 3BVZA 3AV8A 4XDDA 3HVZA 1QKZA 4LK0M 3E9SA 2V0GA 3P42A 1JROA 3R2IA 4AQ7A 1KFYB 4ITKA 4YTPB 2SAKA 1FNWA 2WXOA 3KWLA 1QOBA 3SFEB 1KH0A 1CK1A 3AEFB 2PTLA 2AQ2B 2N0SB 4OVZA 1SE2A 2FUG1 3P63A 4TSSA 1RM6C 3IT6B 3TEXA 1I4PA 1AWDA 3AN1A 1KRHA 2W54A 4TQ1A 2BT6A 2FBWB 2L83A 4C56C 3TUOA 1ZXIA 2TSSA 5G5GA 3C8YA 1FNUA 3GP7A 3NS1A 2RPVA 4YTNB 1F0ZA 1J7BA 5E6JA 1ET9A 3MJ5A 2AX5A 2XN9C 4M0WA 1RWSA 1FRDA 1SJHD 1L6UA 1SF0A 2JU6X 1CQVA 2VZKB 3CWIA 2WDQB 4JWUC 2H89B 2IGGA 3PO0A 1QOFA 1NVID 4YSZB 1FCCC 2N9KA 2KAJA 4XWWA 4JE3B 3J9CA 4YT0B 1JRPA 5D7GA 4WQMA 2Y5CA 3ZGZA 1C9FA 2MEKA 3AEDB 3O13A 2MJ3A 4OZAA 3GS2A 1AN8A 2LMCA 1C76A 1L4DB 1EU3A 2IPKD 1VZ6A 5T8IA 1XCQL 4RNAA 1QF6A 2WS3B 1JCKB 1JWUD 1Y56A 2DLBA 1MHXA 1YQ3B 3NVZA 1N60A 1P7EA 1YN5A 2JQRB 3VRAB 2ZW1A 3Q8FA 1FIQA 1SEBD 1TS3A 4UDUC 1L0YB 3E56A 1FXIA 3GB1A 1L4ZB 5TSSA 2WNMA 4A9AA 4RH6A 4HRSA 1L6VA 1PFDA 4RGNA 1D5XC 1C78A 2M19A 4A8XC 3KWVA 5BMGA 2KWDA 2GB1A 3P1MA 1MI0A 3AE6B 2V4IB 1ZDVA 1GPXA 2G1EA 1J7AA 1NYRA 4RCOA 3ZJVA 1E7PB 1OQRA 1XLQA 1V1PA 3I9V1 3PZ7A 1WWTA 2WQYB 5AUIA 2MJEA 1D4BA 1IUEA 2OHFA 3AE8B 3P4SB 2NTSA 2GRIA 1F2RC 1STEA 1V97A 1D6EC 3V05A 4XE0A 4R3DA 4WH4A 1YJJA 1AW7A 2KDMA 2JSVX 3BVGA 4NAMA 4C80A 3B2FA 1WRIA 3Q8AA 4RGTA 1ESFA 2PVOD 2K22A 3B2GA 4ZRQA 3SR6A 1ZPSA 3RPFC 3W2DA 1RFKA 1JWMD 2JWUA 5C3JB 1T6BX 2K5PA 1WSPA 1C4AA 1TKYA 3VQIA 2WXIA 3EA6A 1J7CA 1MHHE 1TJEA 2L32A 2QMTA 2YEPB 2WP9B 1C77A 1A70A 3VR8B 4CQNA 1E9MA 4L1BA 5EE1A 2JYTA 4D2KA 1N63A 1TYGB 1XLOA 4ZOHC 4ARCA 1FRRA 1I4GA 1JWAD 3TEYA 1SE4A 4YTMB 2E6XA 3U7ZA 1PDXA 2INPE 1LO5D 4GLSC 2MJDA 5BYSA 2K3UA 5LNK1 2PVGC 3ZYYX 4TQ0A 1TZOA 3AEBB 3Q69A 5BYRA 3KLSX 3VRBB 1YQ4B 2LGIA 1HZ6A 2W3RA 2BS3B 2JZPA 2IJ0A 5HHDG 1FXAA 2ICIA 3BK1A 3ABVB 1V1PB 1JW9D 2BB5A 2PLPA 2PIAA 3IT4B 1VJKA 2RDHA 1XO3A 4JPSA 1R7SA 3SFDB 2K0PA 1N5WA 2ONQA 3ZJTA 1GB4A 1ZXHA 3SEBA 4HKQA 2KN4A 1SB3C 1HA5A 2BW2A 3MP9A 2XNAC 4KX6B 1IGCA 1DOIA 2HDEA 4MACA 2G9HD 2BS2B 2WXFA 1KTKA 4TMAB 1PYWD 3AE7B 3B9JA 2FE8A 1YNTE 4HROA 3FC4A 3FILB 1GB1A 3AEEB 3BZDB 1SIJA 4NJCA 2BTEA 3AH7A 4O1NA 2WU5B 1UUPA 4WWMA 1QQRA 1QILA 4P6VF 3N9YC 1TS2A 1N61A 3R2TA 5FK9C 5BMIA 4WIPA 1L0VB 3NZ3A 4B0MA 5D3DA 3BK2A 2W55A 1FFUA 2WXQA 2W82A 1WYGA 1IBXB 2GI9A 3AECB 2N7JA 1PGXA 2LUMA 1ZE3D 2CJOA 1FNVA 2JX5A 4C7ZA 3AE4B 1I7HA 2X38A 3P4QB 1MPEA 1XLNA 2WDVB 3URYA 1HEZE 1EWYC 2KACA 3VR9B 3KQ4A 4IOIE 3W5VB 1VR9A 1T3QA 2V3PA 1HQRD 2ZW0A 1UWMA 2WDRB 2I2YA 3LYYA 4FXCA 3FILA 2J53A 2VZKD 3AE2B 1SJED 3I57A 1JMLA 2KQ4X 1UNSA 4N58A 4JWSC 1C4CA 2M56B 1UWXA 1ENFA 1FFVA 1K52A 4KGTA 2I38A 2IDYA 4RF1A 1T5XD 1I4RA 2L52A 5JXVA 4N6EB 1F77A 5HG2A 1QT9A 1K53A 2W3SA 2V3NA 1PUTA 1VZ7A 1RYJA 4RGOS 2M0AA 3HUIA 2SEBD 1C4PA 2PW9A 1XXGA 1DGJA 3H8HA 1EM7A 3HRDD 5HI1A 2QEJC 2ACZB 4KKIA 2BBCA 1CJEA 4LLGM 4ARIA 2DYMA 3P4PB 1FM0D 1ZDXA 3EGRA 4Q2JA 5I4DA 3IAS1 2BB6A 1M4VA 5FKAC 3ETRA 4WAFA 1TKGA 2PKOA 4ZHPA 1WXQA 4J3OD 4RF0A 3NVYA 1I4QA 4XDCA 2L1AA 1L0XB 1XEEA 4ZYSA 4USAA 5G5HA 2AQ1B 1DOYA 4HEA1 4ZRPA 3ZJUA 3T3OA 1JWBD 1PGAA 3AMZA 4OW0A 4DXGA 4ZHOA 1E6EB 2JYEA 2BS4B 1YN4A 4HKZE 5C2TB 3WCQA 2J4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXI A;  3DWM A;  3L4P A;  1JQ4 A;  1ROE A;  2MH7 A;  3AEE B;  4JX1 C;  4A9A A;  1SIJ A;  4HRS A;  5H8Y E;  3AH7 A;  5AUK A;  1ZUD 2;  1L6V A;  1PFD A;  3NRZ A;  3NVV A;  2WU5 B;  4IDI A;  4N59 A;  1OQQ A;  1VLB A;  4WWM A;  1CZP A;  2M19 A;  5H92 C;  4P6V F;  1N61 A;  3NVW A;  2H88 B;  1L0V B;  3P1M A;  1V8C A;  2K9X A;  3AE6 B;  4C7Y A;  1GPX A;  2G1E A;  3W9C B;  1J7A A;  1NYR A;  2W55 A;  1FFU A;  2DBY A;  5EE9 A;  1E7P B;  1WYG A;  1OQR A;  1AYF A;  1XLQ A;  1OFF A;  3AEC B;  1KF6 B;  1QOA A;  1QOG A;  1FO4 A;  2CJO A;  1WWT A;  2JX5 A;  1NEK B;  2WQY B;  4C7Z A;  5AUI A;  2MJE A;  3AE4 B;  1IUE A;  2OHF A;  1I7H A;  3AE8 B;  3AEA B;  3P4Q B;  4US9 A;  3FAH A;  3P4S B;  5GXG B;  1XLN A;  2WDV B;  4US8 A;  2CU3 A;  1GAQ B;  3LXF A;  1E10 A;  1TKE A;  1EWY C;  1V97 A;  3VR9 B;  3AV8 A;  1DOX A;  3AEG B;  3HVZ A;  3W5V B;  1YJJ A;  3EUB 2;  1NYQ A;  1T3Q A;  1N5X A;  1JRO A;  1KFY B;  4ITK A;  4YTP B;  4C80 A;  3B2F A;  1UWM A;  1WRI A;  2PVO D;  1NEN B;  2K22 A;  2WDR B;  5MPO A;  3B2G A;  3KWL A;  4FXC A;  3SR6 A;  4YXD B;  3AE2 B;  1B9R A;  3RPF C;  2E3T A;  1RFK A;  1QOB A;  5C3J B;  2QJL A;  2K5P A;  3AE5 B;  3SFE B;  2WLB A;  1WGK A;  3AEF B;  3CIR B;  2B76 B;  4N58 A;  2N0S B;  1XLP A;  4JWS C;  1TKY A;  1J7C A;  2M56 B;  1TJE A;  1RM6 C;  3P63 A;  5EE3 A;  2WP9 B;  3LB8 C;  1AWD A;  3AN1 A;  1KRH A;  1A70 A;  1FFV A;  2W54 A;  3VR8 B;  1E9M A;  1L5P A;  5EE1 A;  2BT6 A;  2FBW B;  2L83 A;  1N63 A;  1TYG B;  1XLO A;  4ZOH C;  1ZXI A;  2L52 A;  5G5G A;  1FRR A;  4N6E B;  1JWA D;  3NS1 A;  1QT9 A;  1FMA D;  2W3S A;  4YTN B;  4YTM B;  1PUT A;  3DWG C;  1J7B A;  1RYJ A;  1F0Z A;  1PDX A;  3AE9 B;  5EE0 A;  3HUI A;  1NI3 A;  2AX5 A;  1DGJ A;  1RWS A;  1FRD A;  2MJD A;  1L6U A;  1SF0 A;  2PVG C;  3ZYY X;  3AE3 B;  3AEB B;  2WU2 B;  3CWI A;  2WDQ B;  3HRD D;  4JWU C;  1ZOY B;  2ACZ B;  1YJI A;  2H89 B;  3VRB B;  3PO0 A;  1YQ4 B;  2KMM A;  1QOF A;  3BII D;  1CJE A;  3AM9 A;  1NVI D;  2W3R A;  4YSZ B;  3P4R B;  2BS3 B;  1FXA A;  3P4P B;  4LTU A;  1FM0 D;  2KAJ A;  3AB5 A;  3ABV B;  1VDV A;  1JW9 D;  2LEK A;  2PIA A;  1N62 A;  2QIE B;  4YT0 B;  1VJK A;  4YSX B;  1XO3 A;  1JRP A;  1R7S A;  4WQM A;  2Y5C A;  3ETR A;  3SFD B;  1N5W A;  1TKG A;  3AED B;  2MJ3 A;  2PKO A;  1JAL A;  1WXQ A;  2HTM E;  3AE1 B;  4ZHP A;  1SB3 C;  2DWQ A;  4KX6 B;  3NVY A;  3W5U B;  1QLB B;  2Q5W D;  4USA A;  1DOI A;  1ZP0 B;  2WS3 B;  5G5H A;  1QF6 A;  1E0Z A;  1DOY A;  2EKI A;  1YQ3 B;  2BS2 B;  1N60 A;  2JQR B;  3VRA B;  1JWB D;  3AMZ A;  3AE7 B;  3B9J A;  4ZHO A;  1E6E B;  2BS4 B;  4HRO A;  2CJN A;  5C2T B;  3WCQ A;  1FIQ A;  4YSY B;  3FC4 A;  3NVZ A; 
#chains in the Genus database with same CATH topology
 3L4P A;  4EFO A;  4KKJ A;  3SHQ A;  2RPQ A;  3AUL A;  2KN5 A;  2KX0 A;  2WWZ A;  2J0J A;  3PV1 A;  3IVF A;  2Z8L A;  4IWO A;  2D5G A;  1SSN A;  3H7P B;  4DHZ E;  2FAZ A;  2ZVN A;  1GC6 A;  3WAM A;  4RM9 A;  2KLG A;  1Z5S B;  1T0Y A;  4AJW A;  2KWV B;  1TIF A;  5J17 A;  3W1S A;  3FAH A;  4KGR A;  4MEM A;  3LXF A;  1KLG D;  3R7R A;  2V4L A;  1NYQ A;  1SE9 A;  2QSD A;  3N1Y C;  2BYT A;  4ASW C;  3DVN V;  4HPM B;  4YXD B;  4W9K A;  2MW5 A;  1SBB B;  4HJG E;  3CIR B;  2K25 A;  1EU4 A;  3QQ8 B;  2RMM A;  3LB8 C;  5D94 A;  2C60 A;  1VRA B;  3HK0 A;  3ZTD A;  3JW0 X;  4KV2 A;  1E8Y A;  1ET6 A;  2M4N A;  4IUM B;  4QAY A;  3ECI A;  3TEZ A;  4FJY A;  3N1Z C;  5EE0 A;  1I4X A;  2JVC A;  3PZ8 A;  1YX6 B;  4DDG D;  2MBB B;  1J19 A;  4GXB A;  2WU2 B;  2CHX A;  3BYT B;  2KDI A;  2KMM A;  3TSS A;  3HIZ A;  3MHZ A;  3P4R B;  4DQO C;  2D3A A;  2WXJ A;  4LTU A;  1FCL A;  3PRE A;  4BZA A;  4RGM A;  2HTM E;  3AE1 B;  2KQ7 A;  2OJW A;  4BVU C;  4GIV A;  3DBL B;  2K8C A;  4HPL B;  2IY0 B;  4P7I A;  1FEH A;  2WXN A;  3GE8 C;  3MFG A;  2CJN A;  4XX5 A;  2N7D A;  1I4H A;  1WM2 A;  2JXT A;  3UGB B;  3PGE A;  4PT5 A;  1Q10 A;  3PRP B;  3NVV A;  4JIO U;  2NMQ A;  4HDO A;  1IGD A;  1MJD A;  2AQ3 B;  4NQL B;  2H88 B;  4YL8 A;  2DYO A;  2LFI A;  2KO3 A;  3W9C B;  4FJZ A;  4M8M A;  2M8S A;  1DYQ A;  1AYF A;  4HDQ A;  1OFF A;  3RUL A;  2LGD A;  1KF6 B;  3ZNI D;  1KLU D;  2IGH A;  2OED A;  3RZW C;  3AEA B;  1FD6 A;  2JPH A;  2JZ3 B;  3A33 B;  3V3X A;  1V1O A;  2HTH A;  5L95 C;  3PT2 B;  4AQ7 A;  4ITK A;  3I5J C;  1P3Q U;  1WH3 A;  3KWL A;  2LUE A;  2ZNV C;  1CK1 A;  2KWC A;  4FA6 A;  1E8W A;  2ZNV B;  1P0R A;  3IT6 B;  1KRH A;  3SU8 X;  4BKS D;  4MGZ E;  4W9E A;  2BT6 A;  2L83 A;  4W9J A;  1ZXI A;  5G5G A;  1F0Z A;  3KYC D;  3OLM D;  4M0W A;  3DHI C;  1L6U A;  1SF0 A;  3NJT A;  2JU6 X;  1CQV A;  3AU4 A;  4M0W B;  2L76 A;  3PO0 A;  3A9J B;  3RYT A;  4YSZ B;  4X57 B;  1FCC C;  2KAJ A;  4XWW A;  4AOF A;  4JE3 B;  1V86 A;  4YT0 B;  3RZF A;  1I35 A;  2IYD B;  4WQM A;  3AED B;  4OZA A;  2LMC A;  2IPK D;  1EU3 A;  4RNA A;  1QF6 A;  2FIF A;  3DVG X;  1MHX A;  3PHX B;  2ZW1 A;  3Q8F A;  2KNB A;  2D07 B;  2WX0 A;  4DXA B;  3GB1 A;  1L4Z B;  4A9A A;  3RNG C;  3MTN B;  1KJT A;  4HCN B;  4ANX A;  5BMG A;  3N20 C;  3L13 A;  3AE6 B;  1UBI A;  2BWE S;  1WJ4 A;  2V4I B;  1ZDV A;  1IYF A;  1WGH A;  2G1E A;  2NBW B;  1V1P A;  2MBH A;  1WWT A;  2CHW A;  4I6L B;  2C7N B;  2V1Y A;  1V97 A;  1D6E C;  3V05 A;  4BFR A;  3QCA A;  4WWN A;  4C80 A;  4RGT A;  1ESF A;  4MGI E;  4LJO B;  2KMC A;  5C3J B;  4IC7 B;  1TKY A;  4DWF A;  4MM3 A;  1TJE A;  2QMT A;  4P1C C;  3RNC C;  2FCQ A;  5EE1 A;  4D2K A;  1VCB A;  1UBQ A;  4ZOH C;  4ARC A;  1JWA D;  1SE4 A;  4YTM B;  2E6X A;  3H1U A;  5LNK 1;  1OEY A;  2PVG C;  3ZYY X;  2FNJ B;  4PS8 A;  3ZNH B;  1NBF C;  3Q69 A;  3VRB B;  3KLS X;  2LXC A;  5L83 A;  1WXM A;  4MH0 E;  2BS3 B;  3JYU A;  2IJ0 A;  2ICI A;  3ABV B;  4KIK A;  2PLP A;  2PIA A;  2MLB A;  4JPS A;  4OVV A;  1R7S A;  3ENE A;  3SFD B;  3DDC B;  2N7E A;  2XNA C;  1IGC A;  2CU1 A;  3A9J A;  4G0N B;  3X23 A;  2C7H A;  3FC4 A;  3OG5 A;  3FIL B;  5IO9 A;  1GB1 A;  4C4V B;  2BTE A;  1PQS A;  2NPT B;  3TJP A;  4O1N A;  1MG8 A;  2WU5 B;  2BQQ A;  1QIL A;  2GBK A;  4P6V F;  5E6N A;  1HE8 A;  1LXD A;  2L8J A;  4BKS A;  4F7Z A;  4FBJ B;  1FFU A;  2WXQ A;  4TKN A;  3DHH C;  1FPY A;  2MA9 B;  2PEA A;  1YX5 B;  3AEC B;  2N7J A;  1ZE3 D;  2CJO A;  4C7Z A;  2CR5 A;  3WIM A;  2X38 A;  4W9H A;  3TMP B;  1S3S G;  3VR9 B;  1AAR A;  2ZW0 A;  4S0R A;  4HCP B;  4XYC A;  2BWF A;  3VTW A;  4FLH A;  2QHO A;  3PLV A;  1Q1O A;  1J8C A;  1V2Y A;  3NZU A;  3U30 A;  1K52 A;  4KGT A;  4BBN C;  3ZW3 A;  3V62 A;  2FUH B;  3PRM B;  3UIO B;  1RYJ A;  4RGO S;  1DGJ A;  5IN7 A;  3UIN B;  2AL3 A;  5HI1 A;  2ACZ B;  4F8C B;  1CJE A;  4AUQ C;  4ARI A;  2DYM A;  4NAW A;  3ZNZ B;  3U7D A;  3IAS 1;  1WZ3 A;  5G2N A;  5FKA C;  3PS6 A;  2M1M A;  3DBH I;  2L1A A;  3M95 A;  4ZYS A;  4ZRP A;  2V9H A;  3AMZ A;  4WJP A;  2BS4 B;  2K1F A;  2LRU A;  3HM3 A;  2XK5 B;  4L23 A;  4GDK A;  5FR3 A;  3PLU A;  4MJS B;  3KVF B;  3GZN I;  1E8X A;  4A55 A;  3IAM 1;  2L7R A;  3VAW A;  1WMH B;  1L2N A;  1ACC A;  4WUR A;  4MSM B;  2LXA A;  5BMH A;  3Q8C A;  3PVL A;  2DBY A;  2HJ8 A;  1K50 A;  2QIL A;  4AS1 A;  3OWE B;  2C5L C;  1WYW B;  1NEK B;  3VHT C;  3JVZ X;  1IBX A;  4LDT B;  4US9 A;  4GOC A;  1GAQ B;  1WI0 A;  1Q5W B;  3Q14 C;  2G4D B;  2DX5 B;  2IGD A;  2LGY A;  2BKR B;  3H7S A;  4EZL A;  4MGY E;  3T8M A;  1NEN B;  2DNF A;  1G6J A;  4HPP A;  2WXL A;  1B9R A;  1TS5 A;  1WGK A;  2WXG A;  5G55 A;  1XLP A;  4W9L A;  4DBG A;  1P1A A;  1C79 A;  1V81 A;  3R8B A;  1L5P A;  4AJY B;  5CHF A;  2CKH B;  3KYD D;  3NUH B;  3D32 A;  3U52 E;  3DWG C;  3AE9 B;  2K6D B;  1NI3 A;  4OVU A;  5JHB A;  2KC2 A;  3AE3 B;  1ZOY B;  3QAQ A;  1YJI A;  2L00 B;  1MVK A;  3K9O B;  2KJH B;  2N9L A;  2IZV B;  3AB5 A;  3A9K A;  4GDL B;  4WWO A;  1N62 A;  4E74 A;  4OZB A;  1JAL A;  2KLC A;  3W5U B;  1QLB B;  2J52 A;  4JQW C;  4DK5 A;  1ZGU B;  4J6I A;  2Z59 B;  3V61 A;  3VH4 B;  1RAX A;  2KMA A;  3UI3 A;  2EEL A;  2C9W B;  2LVP A;  1ROE A;  4JX1 C;  5H8Y E;  4HVB A;  1ZUD 2;  3W1S C;  4IDI A;  3NRZ A;  1LGR A;  1SE3 A;  2NBU A;  3Q8B A;  2VRR B;  3X0W A;  3BVM A;  4LDT D;  2O2V B;  4LJP B;  1QOG A;  2EKE C;  5C1Z A;  4HK2 A;  4GMV A;  3O65 B;  1N6Z A;  4IWP A;  4M01 A;  4XWT A;  5IP4 D;  5BYQ A;  5GXG B;  4CO7 A;  3M3J A;  3RI7 C;  1TY2 A;  2L05 A;  4K81 A;  2CU3 A;  2PMV A;  2R61 A;  3BVZ A;  4GU2 A;  3HVZ A;  2LVO A;  4LK0 M;  2V0G A;  3SDL C;  4YTP B;  2WXO A;  3N1X C;  1WJ6 A;  2CHZ A;  3SFE B;  2MBQ A;  2PTL A;  2N0S B;  4TSS A;  2MSE D;  3QHT A;  3PHW B;  2W54 A;  2YVC A;  4C56 C;  5CX3 A;  3Q3O C;  2PPH A;  3GP7 A;  3NS1 A;  4WJQ A;  2KFJ A;  1V49 A;  5IKC M;  1SJH D;  1TZ1 A;  3DQV A;  2KJR A;  4JWU C;  2JF5 A;  2H89 B;  2IGG A;  2NCN A;  1LFD A;  2D3G A;  1NVI D;  3QAR A;  2N9K A;  4LNK A;  3L0W B;  3J9C A;  2DHZ A;  5D7G A;  2Y5C A;  4JGH B;  3O13 A;  2M0X A;  3AI5 A;  1EUV B;  2BYF A;  5T8I A;  2DLB A;  3ZRC A;  3DVN U;  1N60 A;  1YN5 A;  3VRA B;  2K39 A;  4B9K A;  2AEH A;  2MCN B;  2BYE A;  3APF A;  4ICV A;  4UDU C;  4PS7 A;  2A4Z A;  5TSS A;  4RH6 A;  4EZJ A;  4RGN A;  1D5X C;  2M19 A;  1R4M B;  4ZRJ A;  3RCZ A;  3L17 A;  1J7A A;  1E7P B;  2LD9 A;  2KC1 A;  3EEC A;  3DHG C;  2EMS A;  4NY0 A;  2OHF A;  2HE7 A;  4K7U A;  2FID A;  2GBR A;  3RNB C;  3VH3 B;  3ZRF A;  2C7M B;  2IO2 B;  3B2F A;  3Q8A A;  2NVU I;  4ZRQ A;  3SR6 A;  2XEW A;  3W2D A;  1RFK A;  1T6B X;  4XZ4 A;  2K5P A;  5TR5 A;  2BVC A;  4GN1 A;  2NPT A;  3IHP C;  1C4A A;  2WXI A;  1RFA A;  1RLF A;  2L32 A;  1C77 A;  4CQN A;  2JYT A;  1XLO A;  1FRR A;  5AZF A;  5DPW A;  4AP4 C;  4B6W A;  2INP E;  1F52 A;  2R2Q A;  4ZRK A;  4JL9 A;  1LO5 D;  5BYS A;  1YQ4 B;  4EEW A;  1FXA A;  3MC9 A;  3BK1 A;  1EF1 A;  1F9J A;  4II2 B;  2D3B A;  3DBL I;  1XO3 A;  4KDI C;  2K0P A;  3SEB A;  3TBL D;  2J0M A;  1HA5 A;  2HDE A;  2G9H D;  2BS2 B;  1WGR A;  3B9J A;  4KZC A;  2FE8 A;  1YNT E;  4HRO A;  2MQJ A;  3A1Q B;  1R4N I;  3BZD B;  3UQA A;  4BOZ B;  1EO6 A;  3APC A;  1UUP A;  5DPT A;  4FHK A;  1GJZ A;  3N9Y C;  3Q3J A;  5FK9 C;  2LZ6 A;  3R2T A;  3PRZ A;  1WE7 A;  3NZ3 A;  1NDD A;  4B0M A;  3DBR B;  2FCN A;  2GI9 A;  2BF8 B;  2JX5 A;  1WY8 A;  3AE4 B;  2WDV B;  5JHA A;  3URY A;  1HEZ E;  4RMA A;  3H9D A;  1VR9 A;  2AWT A;  2V3P A;  1HQR D;  1WF9 A;  1UWM A;  2WDR B;  3LYY A;  2J53 A;  1SJE D;  1K8R B;  1OQY A;  3V60 A;  1JML A;  1WE6 A;  4MJS A;  1T0Q C;  4N58 A;  3RNE C;  4JWS C;  1HTO A;  2M56 B;  1OGW A;  2G4S A;  1LQB A;  1FFV A;  4WWP A;  2I38 A;  4LCD E;  1T5X D;  2LI5 A;  5JXV A;  1F77 A;  1A5R A;  1QT9 A;  1VZ7 A;  3HUI A;  2SEB D;  2PW9 A;  1XXG A;  3B1L X;  3CST A;  3HRD D;  2QEJ C;  2DZM A;  1C1Y B;  2BBC A;  4KKI A;  4LLG M;  2KTR A;  3ML8 A;  1FM0 D;  5FR6 A;  1TGZ B;  1WXV A;  3QWZ B;  1M4V A;  1KOT A;  3TCA A;  1D3Z A;  1TKG A;  4RF0 A;  4XDC A;  1I4Q A;  1XEE A;  2WGS A;  4USA A;  3T9L A;  2AQ1 B;  3IG3 A;  2KXJ A;  1JWB D;  1PGA A;  1YN4 A;  1KLV A;  2RR9 A;  5C2T B;  3DWM A;  3PTF C;  3DBS A;  3V6C B;  3ZTC A;  2QDF A;  1OQQ A;  1CZP A;  1R4M I;  5H92 C;  3QC8 B;  3TEW A;  1IPG A;  3B0A A;  2WDT B;  4NZL B;  1GUA B;  1XF5 L;  3MJW A;  4C7Y A;  2KTR B;  4G50 A;  2KD0 A;  1TS4 A;  2K8H A;  1YQB A;  1JRU A;  1T0S C;  2LHD A;  1I42 A;  2ZEQ A;  4B0E A;  4M02 A;  2LJI A;  1SXT A;  4MM3 B;  3VVW B;  4NAW B;  3AEG B;  3EUB 2;  4URK A;  1XCT L;  1TY0 A;  4IM3 A;  3Q6B A;  3BWU D;  4MT5 A;  1WX7 A;  4TUU A;  3T3N A;  3NS8 A;  1P7F A;  4MH8 A;  5HKH A;  2QJL A;  2WLB A;  2B76 B;  4LNN A;  3C19 A;  4KVG B;  3L16 A;  3DPD A;  2Z0E B;  2Y3A A;  3U4E G;  3JSV A;  3AXC A;  1FMA D;  2A5U A;  2NBV B;  3A9K B;  2PE9 A;  4GDL A;  1L7Y A;  2WXH A;  1GG3 A;  3R7Q A;  1YMH E;  1B1Z A;  1P98 A;  2ZZP B;  3BII D;  3B08 A;  4NJ6 A;  1V5T A;  3MC0 B;  3AM9 A;  2ASQ A;  3K9P B;  4OZC A;  1VDV A;  2LEK A;  2GBM A;  2Y5P A;  2KQS A;  4DXF A;  3NOB A;  1D5Z C;  2EKI A;  4PYU A;  2Y5B B;  3EFC A;  3FKY A;  2KZR A;  5BO4 B;  2MX2 A;  1XQQ A;  2BGF A;  2LGS A;  5AUK A;  1LM8 B;  1Y8R C;  5HFY A;  4N59 A;  1TT5 B;  4A20 A;  1SIF A;  2KKC A;  5IOI A;  3VUW A;  3BYY B;  2LHE A;  4WAA A;  1E7V A;  1V8C A;  2J42 A;  2K9X A;  2IO0 B;  4L2Y A;  4P1B C;  4RFB A;  3DOW A;  1V6E A;  4LNF A;  1HZ5 A;  5IA7 A;  3BY4 B;  1GOZ A;  1HXY D;  3ZO5 B;  2WXR A;  1QZE A;  2DEN B;  1PGB A;  1TKE A;  3I3T B;  4XDD A;  1QKZ A;  3E9S A;  3P42 A;  4GGQ A;  3JSV B;  2MBO A;  1FNW A;  2MP2 B;  1KH0 A;  3RUI B;  4MSQ B;  2AQ2 B;  1Q0W B;  1SE2 A;  1RM6 C;  1I4P A;  4TQ1 A;  5KHQ A;  2KK8 A;  2HJ1 A;  2D2Q A;  1FNU A;  1ZKH A;  2IBI B;  3QA8 A;  5E6J A;  1ET9 A;  3MJ5 A;  4FJV B;  2AX5 A;  2XN9 C;  2N1W A;  1FRD A;  2VZK B;  1WGG A;  3M62 B;  2GLS A;  1WX9 A;  2KDB A;  2O6V D;  4ANU A;  5AZG A;  3DBH B;  2LAS A;  5LLI A;  1JRP A;  3Q3N C;  1C9F A;  3ZGZ A;  2MEK A;  1E7U A;  2MJ3 A;  3GE3 C;  1VZ6 A;  1XCQ L;  1V5O A;  3Q3F A;  1JWU D;  2JZZ A;  4DHZ B;  1P7E A;  2JQR B;  3RT3 B;  2GOW A;  2BKF A;  1TS3 A;  1M94 A;  1L0Y B;  2JWZ A;  1FXI A;  3M63 B;  3VDZ A;  2WNM A;  2JRH A;  1GNU A;  1L6V A;  4W9F A;  3RNA C;  4MGK E;  2UWQ A;  1C78 A;  1TTN A;  3UF8 A;  4A8X C;  3KWV A;  2X8X X;  3WA0 A;  2GB1 A;  2D3C A;  2GMI C;  1KM7 A;  3IFW B;  1MI0 A;  2O6V B;  3P1M A;  4MDK E;  5C23 A;  3W1Y A;  2MRP A;  4RCO A;  4GSW A;  1OQR A;  1XLQ A;  3I9V 1;  3PZ7 A;  2WQY B;  5AUI A;  2MJE A;  1D4B A;  5AZH A;  3AE8 B;  2B3A A;  3P4S B;  2NTS A;  1TBE A;  2GRI A;  2D10 A;  1YJJ A;  4E71 A;  3BVG A;  4ZDV A;  4NAM A;  2GBJ A;  1WRI A;  3RMK C;  2PVO D;  1T0R C;  1YD8 U;  2AYO B;  5EDS A;  5GMV A;  1JWM D;  2KFK B;  2IO3 B;  1NI2 A;  4II3 B;  4W9G A;  1WXA A;  1A70 A;  2LWP A;  3VR8 B;  3ALB A;  1UZX B;  1I4G A;  3HM6 X;  2EMT A;  2RGF A;  3U7Z A;  1UH6 A;  3WAO A;  4I6N B;  2K3U A;  3NHE B;  4TQ0 A;  1YJ1 A;  3KH0 A;  1OEY J;  1HZ6 A;  2JZP A;  5HHD G;  2ZCB A;  2BB5 A;  3IT4 B;  1VJK A;  1N5W A;  3ZJT A;  1GB4 A;  3KUZ A;  1BT0 A;  3R3M A;  4ACF A;  1V80 A;  2BW2 A;  4KX6 B;  1E8Z A;  1DOI A;  2L0F A;  4MAC A;  3NZS A;  4CYE A;  1WGD A;  4TMA B;  2DZJ A;  4NNJ B;  1UGM A;  4EOY A;  3OJ4 B;  3VTU A;  4NJC A;  3AH7 A;  4S17 A;  2FCS A;  2K6Q A;  1QQR A;  4WWM A;  1TS2 A;  3APD A;  3VUX A;  1L0V B;  3AU5 A;  3BK2 A;  2N4F A;  1WYG A;  2LUM A;  1F1H A;  3DCG A;  5JH5 C;  1MPE A;  2FCM A;  5LXH A;  1WRD B;  1EWY C;  1T3Q A;  2PJH A;  3GZN B;  2RSU A;  4FXC A;  3FIL A;  2VZK D;  2I1J A;  3I57 A;  4C4V A;  1WM3 A;  3DVG Y;  2IDY A;  4RF1 A;  1I4R A;  3H7P A;  3KUC B;  4AWJ A;  2L52 A;  4N6E B;  5HG2 A;  1S1Q B;  2MWS B;  2W3S A;  3WAN A;  2MHJ A;  2M0A A;  4B95 A;  3H8H A;  4K7S A;  3ZUN A;  4EUT A;  1GC7 A;  2LRW A;  5IAA C;  3L54 A;  5D2M B;  4PS3 A;  3P4P B;  5CHV C;  1IP9 A;  3C0R B;  1ZDX A;  2IO1 B;  3EGR A;  2LJ5 A;  2N1V A;  3ETR A;  4KZ0 A;  2PKO A;  4ZHP A;  5J2R A;  3NVY A;  2N9E B;  3WAP A;  1DOY A;  4HEA 1;  3T3O A;  1OTR B;  2XK5 A;  4OW0 A;  4ZHO A;  4W9C A;  4HKZ E;  4KIK B;  3WCQ A;  4CHK A;  2J4X A;  3VUY A;  2ZJD A;  1SGH A;  5JZE B;  4IM0 A;  4IKG A;  2VH2 A;  4REZ A;  2DAF A;  3Q3M C;  1VLB A;  2RDG A;  5KHO A;  3MHS D;  3NVW A;  5DPR A;  1YN3 A;  2JRI B;  1P9D U;  5EE9 A;  4DHJ B;  1Z2M A;  1UD7 A;  3L10 B;  4EE2 A;  1FO4 A;  4N9F 4;  4M00 A;  4A3P A;  3VFK A;  2UYZ B;  3P2B A;  1E10 A;  2HD5 B;  1DOX A;  3VXW A;  2WXM A;  1J0G A;  1UGJ A;  1N5X A;  2KDF B;  4WJN A;  1WR6 E;  2WXP A;  2ZPN A;  3IXS A;  5MPO A;  5DCN A;  2E3T A;  2RD0 A;  4P16 A;  3AE5 B;  4OHJ A;  5EE3 A;  4TV3 A;  2NTT A;  3ZQ4 A;  2QCZ A;  1BXT A;  5LXI B;  2ZCC A;  3S2A A;  4A6Q A;  1H8C A;  4PYZ A;  4IG7 B;  1WIA A;  1F2R I;  2BPS A;  3HVD A;  3L08 A;  3Q2A C;  4FUL A;  2CS4 A;  2XBB C;  1XT9 B;  1D5M C;  5D3I B;  3R66 C;  3QX1 A;  1K51 A;  3RNF C;  2KVR A;  2RDB C;  3CMM B;  1WZ0 A;  4F1S A;  2G45 B;  2QIE B;  4A90 A;  4W9D A;  4YSX B;  2INN E;  3GOE A;  2DZI A;  1EWC A;  3RFZ B;  3U2S C;  4BBN F;  2DWQ A;  3ML9 A;  2Q5W D;  4H2A A;  1E0Z A;  1ZP0 B;  1WJU A;  1YOV B;  2LVQ A;  4NJ7 A;  3QK0 A;  4YSY B;  1BUI C;  1E5W A;  1JQ4 A;  2MH7 A;  1ZW7 A;  2YEP F;  2REX A;  2ON8 A;  3HHM A;  1V9J A;  3OAW A;  2WXK A;  1BML C;  4NQK E;  1R4N B;  4KGS A;  4XGA B;  3QIJ A;  4I6P A;  4ANW A;  4GDK B;  1QOA A;  3RD2 A;  1JWS D;  4HWI B;  4ZYN A;  2O2V A;  3EHV A;  4DHJ D;  4BKT A;  4US8 A;  4YWG G;  1VZ8 A;  2R2O A;  2M17 A;  3Q8E A;  3CF6 E;  3AV8 A;  3PZD A;  1FXT B;  1JRO A;  3R2I A;  1KFY B;  2IY1 B;  2SAK A;  4K3C A;  2OOB B;  3KW5 B;  2D11 A;  4BKG A;  1QOB A;  3N30 A;  3AEF B;  2DYB A;  4KDL B;  4OVZ A;  2FUG 1;  2KOX A;  3P63 A;  1U4A A;  3UQB A;  3TEX A;  1AWD A;  3AN1 A;  1WJN A;  3PPA A;  3NG0 A;  2JXX A;  2FBW B;  4WJO A;  3TUO A;  2TSS A;  3C8Y A;  3VTV A;  2MP2 A;  2RPV A;  4YTN B;  1J7B A;  4M8N A;  1YIW A;  2BYV E;  1RWS A;  1UF0 A;  4ANV A;  3CWI A;  2WYQ A;  2WDQ B;  4W9I A;  4EKU A;  1QOF A;  4HJK A;  2IND C;  4G3X B;  2MBE A;  2N9P C;  3GS2 A;  3ZLZ A;  1AN8 A;  1C76 A;  1L4D B;  1WX8 A;  2WS3 B;  1XD3 B;  1JCK B;  2L0T A;  3H6N A;  1Y56 A;  1YQ3 B;  2JUO A;  2KVZ A;  2I1K A;  3SD5 A;  1FIQ A;  1SEB D;  4LNI A;  3E56 A;  4K3B A;  5CTR C;  4HRS A;  2NR2 A;  1PFD A;  2ZPY A;  2PE6 B;  4EZK A;  5D6J B;  2KWD A;  2W9N A;  1GPX A;  1NYR A;  3ZJV A;  4FN2 A;  4C00 A;  2KX3 A;  2N9X A;  1IUE A;  3LJ3 A;  5E6O A;  1F2R C;  1STE A;  4XE0 A;  4R3D A;  4WH4 A;  1AW7 A;  2KDM A;  2JSV X;  2AL6 A;  4MEL A;  3CSF A;  2K22 A;  2L3Z A;  3B2G A;  1ZPS A;  2DAJ A;  3RPF C;  2JWU A;  2JY6 A;  2YLM A;  1WSP A;  4PK1 A;  4IM2 A;  3VQI A;  3EA6 A;  1J7C A;  1MHH E;  2YEP B;  2WP9 B;  3U8Z A;  1E9M A;  4L1B A;  3KUD B;  2KJ6 A;  1N63 A;  1TYG B;  1WR1 A;  1UEL A;  3TEY A;  2Z0D B;  1PDX A;  3A4R A;  2G3Q B;  4GLS C;  2MJD A;  3TL5 A;  1TZO A;  3AEB B;  3V6E B;  5BYR A;  2KHW B;  3ZNG C;  4DDI D;  2LGI A;  2W3R A;  1H4R A;  3DBR I;  3EFU A;  1MFW A;  1C3T A;  3ZVV A;  3OJ3 A;  1V1P B;  1JW9 D;  4A3O A;  2RDH A;  4KSL C;  3A4S C;  2ONQ A;  2ZVO A;  4G11 A;  1ZXH A;  4IW0 A;  4HKQ A;  2KN4 A;  1SB3 C;  3MP9 A;  2V3S A;  3EC8 A;  3MC8 A;  3PSE B;  4IWQ A;  2WXF A;  2KAN A;  1KTK A;  4BAX A;  1PYW D;  3AE7 B;  2QC8 A;  3ONS A;  4LNO A;  1MG4 A;  1X1M A;  2KFK A;  3AEE B;  1SIJ A;  3A1Q A;  4HXD A;  3ZXV A;  4RM8 A;  3N32 A;  1EF5 A;  1N61 A;  5BMI A;  4WIP A;  1E90 A;  2VH1 A;  2NS5 A;  5D3D A;  2W55 A;  2INC C;  2K8B A;  2O6V A;  2UU7 A;  2W82 A;  3TIX A;  3UIP B;  4HLE A;  5DPS A;  2LGX A;  1IBX B;  1PGX A;  4FAD A;  1FNV A;  2J7Q B;  1I7H A;  3P4Q B;  1XLN A;  4BOS C;  4FHJ A;  3ZDT A;  4XC2 A;  2KAC A;  3RN9 C;  4JLC A;  1CMX B;  3KQ4 A;  4IOI E;  2J0K A;  3W5V B;  5CHW A;  1RRB A;  2GBN A;  2KTF A;  3ZIM A;  2I2Y A;  2WHI A;  4NPN A;  3AE2 B;  2DZK A;  4K7W A;  3ZKJ C;  5AEK B;  2KQ4 X;  1UNS A;  2KWU B;  3N3K B;  1C4C A;  1VD2 A;  4ICU A;  1UWX A;  1ENF A;  1WGY A;  3I63 C;  3IBE A;  1WMH A;  4GB9 A;  1WFY A;  2KT7 A;  1K53 A;  2WX1 A;  2V3N A;  1PUT A;  3NY5 A;  1C4P A;  3ZDM C;  1EM7 A;  2KYW A;  4ZRI A;  2KDE B;  3WAL A;  2JT4 B;  5J18 A;  4Q2J A;  5I4D A;  2BB6 A;  4WAF A;  4WQO B;  1WXQ A;  4E3C A;  2OJR A;  1ISN A;  3BIN A;  4J3O D;  4K1R B;  1L0X B;  5G5H A;  1WXS A;  3ZXR A;  1HTQ A;  3ZJU A;  4KSK C;  5E6P A;  4DXG A;  1E6E B;  2JYE A;  3QJZ A;  3LDZ E;  3NVZ A; 
#chains in the Genus database with same CATH homology
 3L4P A;  3DWM A;  5FR3 A;  4KKJ A;  4IKG A;  4L23 A;  4REZ A;  1OQQ A;  1VLB A;  2RDG A;  3IAM 1;  4A55 A;  1CZP A;  5H92 C;  3TEW A;  1ACC A;  3NVW A;  2Z8L A;  4WUR A;  2D5G A;  5BMH A;  1SSN A;  1YN3 A;  3Q8C A;  4NZL B;  1XF5 L;  4C7Y A;  2DBY A;  5EE9 A;  1K50 A;  2QIL A;  4AS1 A;  1TS4 A;  3OWE B;  4EE2 A;  1FO4 A;  1NEK B;  2LHD A;  1IBX A;  4US9 A;  4B0E A;  3W1S A;  3FAH A;  4KGR A;  2LJI A;  1SXT A;  4MM3 B;  1GAQ B;  3LXF A;  1E10 A;  1KLG D;  1DOX A;  4NAW B;  3AEG B;  2WXM A;  3EUB 2;  1XCT L;  1NYQ A;  1TY0 A;  1UGJ A;  2QSD A;  1N5X A;  2IGD A;  2BYT A;  3BWU D;  2WXP A;  1NEN B;  3IXS A;  4MT5 A;  5MPO A;  4YXD B;  3T3N A;  2WXL A;  1B9R A;  2E3T A;  1P7F A;  4P16 A;  4MH8 A;  1SBB B;  2QJL A;  3AE5 B;  4HJG E;  1TS5 A;  1WGK A;  2WLB A;  2WXG A;  2B76 B;  3CIR B;  4OHJ A;  1EU4 A;  1XLP A;  2RMM A;  5EE3 A;  2NTT A;  3LB8 C;  3ZQ4 A;  1VRA B;  1C79 A;  3R8B A;  1L5P A;  1BXT A;  1ET6 A;  3NUH B;  2Y3A A;  3U4E G;  4A6Q A;  1FMA D;  3U52 E;  3DWG C;  3TEZ A;  1F2R I;  2WXH A;  3AE9 B;  5EE0 A;  3HVD A;  1NI3 A;  1I4X A;  3PZ8 A;  1YMH E;  1B1Z A;  3AE3 B;  2WU2 B;  1D5M C;  1ZOY B;  5D3I B;  1YJI A;  3BYT B;  3TSS A;  2KMM A;  3BII D;  1K51 A;  1MVK A;  3MC0 B;  3AM9 A;  3MHZ A;  2N9L A;  3P4R B;  4DQO C;  2WXJ A;  4LTU A;  3AB5 A;  1FCL A;  4OZC A;  1VDV A;  2LEK A;  4GDL B;  2QIE B;  1N62 A;  4A90 A;  4YSX B;  2INN E;  2Y5P A;  4OZB A;  4RGM A;  1EWC A;  1JAL A;  2HTM E;  3AE1 B;  3U2S C;  3RFZ B;  2DWQ A;  3W5U B;  1QLB B;  2J52 A;  2Q5W D;  4H2A A;  4DXF A;  1E0Z A;  1ZP0 B;  1D5Z C;  2EKI A;  3UI3 A;  1FEH A;  2WXN A;  2EEL A;  3MFG A;  2CJN A;  4YSY B;  1BUI C;  1I4H A;  2JXT A;  1ROE A;  1JQ4 A;  2MH7 A;  4JX1 C;  4PT5 A;  1Q10 A;  5AUK A;  5H8Y E;  1ZUD 2;  2YEP F;  3NRZ A;  3NVV A;  4IDI A;  5HFY A;  1SE3 A;  2NMQ A;  2ON8 A;  4N59 A;  1IGD A;  2WXK A;  1BML C;  3Q8B A;  2AQ3 B;  3BYY B;  2H88 B;  2LHE A;  4KGS A;  2DYO A;  1V8C A;  2J42 A;  2K9X A;  2LFI A;  4L2Y A;  4RFB A;  3W9C B;  4GDK B;  1DYQ A;  3BVM A;  1AYF A;  1HZ5 A;  1OFF A;  1KF6 B;  1QOA A;  1QOG A;  1KLU D;  2IGH A;  2OED A;  1JWS D;  1GOZ A;  4XWT A;  1HXY D;  3AEA B;  5BYQ A;  5GXG B;  2WXR A;  1FD6 A;  1TY2 A;  4US8 A;  2CU3 A;  1PGB A;  4YWG G;  1VZ8 A;  3V3X A;  2PMV A;  1TKE A;  2R61 A;  3Q8E A;  1V1O A;  3BVZ A;  3AV8 A;  4XDD A;  3HVZ A;  1QKZ A;  4LK0 M;  3E9S A;  2V0G A;  3P42 A;  1JRO A;  3R2I A;  4AQ7 A;  1KFY B;  4ITK A;  4YTP B;  2SAK A;  1FNW A;  2WXO A;  3KWL A;  1QOB A;  3SFE B;  1KH0 A;  1CK1 A;  3AEF B;  2PTL A;  2AQ2 B;  2N0S B;  4OVZ A;  1SE2 A;  2FUG 1;  3P63 A;  4TSS A;  1RM6 C;  3IT6 B;  3TEX A;  1I4P A;  1AWD A;  3AN1 A;  1KRH A;  2W54 A;  4TQ1 A;  2BT6 A;  2FBW B;  2L83 A;  4C56 C;  3TUO A;  1ZXI A;  2TSS A;  5G5G A;  3C8Y A;  1FNU A;  3GP7 A;  3NS1 A;  2RPV A;  4YTN B;  1F0Z A;  1J7B A;  5E6J A;  1ET9 A;  3MJ5 A;  2AX5 A;  2XN9 C;  4M0W A;  1RWS A;  1FRD A;  1SJH D;  1L6U A;  1SF0 A;  2JU6 X;  1CQV A;  2VZK B;  3CWI A;  2WDQ B;  4JWU C;  2H89 B;  2IGG A;  3PO0 A;  1QOF A;  1NVI D;  4YSZ B;  1FCC C;  2N9K A;  2KAJ A;  4XWW A;  4JE3 B;  3J9C A;  4YT0 B;  1JRP A;  5D7G A;  4WQM A;  2Y5C A;  3ZGZ A;  1C9F A;  2MEK A;  3AED B;  3O13 A;  2MJ3 A;  4OZA A;  3GS2 A;  1AN8 A;  2LMC A;  1C76 A;  1L4D B;  1EU3 A;  2IPK D;  1VZ6 A;  5T8I A;  1XCQ L;  4RNA A;  1QF6 A;  2WS3 B;  1JCK B;  1JWU D;  1Y56 A;  2DLB A;  1MHX A;  1YQ3 B;  3NVZ A;  1N60 A;  1P7E A;  1YN5 A;  2JQR B;  3VRA B;  2ZW1 A;  3Q8F A;  1FIQ A;  1SEB D;  1TS3 A;  4UDU C;  1L0Y B;  3E56 A;  1FXI A;  3GB1 A;  1L4Z B;  5TSS A;  2WNM A;  4A9A A;  4RH6 A;  4HRS A;  1L6V A;  1PFD A;  4RGN A;  1D5X C;  1C78 A;  2M19 A;  4A8X C;  3KWV A;  5BMG A;  2KWD A;  2GB1 A;  3P1M A;  1MI0 A;  3AE6 B;  2V4I B;  1ZDV A;  1GPX A;  2G1E A;  1J7A A;  1NYR A;  4RCO A;  3ZJV A;  1E7P B;  1OQR A;  1XLQ A;  1V1P A;  3I9V 1;  3PZ7 A;  1WWT A;  2WQY B;  5AUI A;  2MJE A;  1D4B A;  1IUE A;  2OHF A;  3AE8 B;  3P4S B;  2NTS A;  2GRI A;  1F2R C;  1STE A;  1V97 A;  1D6E C;  3V05 A;  4XE0 A;  4R3D A;  4WH4 A;  1YJJ A;  1AW7 A;  2KDM A;  2JSV X;  3BVG A;  4NAM A;  4C80 A;  3B2F A;  1WRI A;  3Q8A A;  4RGT A;  1ESF A;  2PVO D;  2K22 A;  3B2G A;  4ZRQ A;  3SR6 A;  1ZPS A;  3RPF C;  3W2D A;  1RFK A;  1JWM D;  2JWU A;  5C3J B;  1T6B X;  2K5P A;  1WSP A;  1C4A A;  1TKY A;  3VQI A;  2WXI A;  3EA6 A;  1J7C A;  1MHH E;  1TJE A;  2L32 A;  2QMT A;  2YEP B;  2WP9 B;  1C77 A;  1A70 A;  3VR8 B;  4CQN A;  1E9M A;  4L1B A;  5EE1 A;  2JYT A;  4D2K A;  1N63 A;  1TYG B;  1XLO A;  4ZOH C;  4ARC A;  1FRR A;  1I4G A;  1JWA D;  3TEY A;  1SE4 A;  4YTM B;  2E6X A;  3U7Z A;  1PDX A;  2INP E;  1LO5 D;  4GLS C;  2MJD A;  5BYS A;  2K3U A;  5LNK 1;  2PVG C;  3ZYY X;  4TQ0 A;  1TZO A;  3AEB B;  3Q69 A;  5BYR A;  3KLS X;  3VRB B;  1YQ4 B;  2LGI A;  1HZ6 A;  2W3R A;  2BS3 B;  2JZP A;  2IJ0 A;  5HHD G;  1FXA A;  2ICI A;  3BK1 A;  3ABV B;  1V1P B;  1JW9 D;  2BB5 A;  2PLP A;  2PIA A;  3IT4 B;  1VJK A;  2RDH A;  1XO3 A;  4JPS A;  1R7S A;  3SFD B;  2K0P A;  1N5W A;  2ONQ A;  3ZJT A;  1GB4 A;  1ZXH A;  3SEB A;  4HKQ A;  2KN4 A;  1SB3 C;  1HA5 A;  2BW2 A;  3MP9 A;  2XNA C;  4KX6 B;  1IGC A;  1DOI A;  2HDE A;  4MAC A;  2G9H D;  2BS2 B;  2WXF A;  1KTK A;  4TMA B;  1PYW D;  3AE7 B;  3B9J A;  2FE8 A;  1YNT E;  4HRO A;  3FC4 A;  3FIL B;  1GB1 A;  3AEE B;  3BZD B;  1SIJ A;  4NJC A;  2BTE A;  3AH7 A;  4O1N A;  2WU5 B;  1UUP A;  4WWM A;  1QQR A;  1QIL A;  4P6V F;  3N9Y C;  1TS2 A;  1N61 A;  3R2T A;  5FK9 C;  5BMI A;  4WIP A;  1L0V B;  3NZ3 A;  4B0M A;  5D3D A;  3BK2 A;  2W55 A;  1FFU A;  2WXQ A;  2W82 A;  1WYG A;  1IBX B;  2GI9 A;  3AEC B;  2N7J A;  1PGX A;  2LUM A;  1ZE3 D;  2CJO A;  1FNV A;  2JX5 A;  4C7Z A;  3AE4 B;  1I7H A;  2X38 A;  3P4Q B;  1MPE A;  1XLN A;  2WDV B;  3URY A;  1HEZ E;  1EWY C;  2KAC A;  3VR9 B;  3KQ4 A;  4IOI E;  3W5V B;  1VR9 A;  1T3Q A;  2V3P A;  1HQR D;  2ZW0 A;  1UWM A;  2WDR B;  2I2Y A;  3LYY A;  4FXC A;  3FIL A;  2J53 A;  2VZK D;  3AE2 B;  1SJE D;  3I57 A;  1JML A;  2KQ4 X;  1UNS A;  4N58 A;  4JWS C;  1C4C A;  2M56 B;  1UWX A;  1ENF A;  1FFV A;  1K52 A;  4KGT A;  2I38 A;  2IDY A;  4RF1 A;  1T5X D;  1I4R A;  2L52 A;  5JXV A;  4N6E B;  1F77 A;  5HG2 A;  1QT9 A;  1K53 A;  2W3S A;  2V3N A;  1PUT A;  1VZ7 A;  1RYJ A;  4RGO S;  2M0A A;  3HUI A;  2SEB D;  1C4P A;  2PW9 A;  1XXG A;  1DGJ A;  3H8H A;  1EM7 A;  3HRD D;  5HI1 A;  2QEJ C;  2ACZ B;  4KKI A;  2BBC A;  1CJE A;  4LLG M;  4ARI A;  2DYM A;  3P4P B;  1FM0 D;  1ZDX A;  3EGR A;  4Q2J A;  5I4D A;  3IAS 1;  2BB6 A;  1M4V A;  5FKA C;  3ETR A;  4WAF A;  1TKG A;  2PKO A;  4ZHP A;  1WXQ A;  4J3O D;  4RF0 A;  3NVY A;  1I4Q A;  4XDC A;  2L1A A;  1L0X B;  1XEE A;  4ZYS A;  4USA A;  5G5H A;  2AQ1 B;  1DOY A;  4HEA 1;  4ZRP A;  3ZJU A;  3T3O A;  1JWB D;  1PGA A;  3AMZ A;  4OW0 A;  4DXG A;  4ZHO A;  1E6E B;  2JYE A;  2BS4 B;  1YN4 A;  4HKZ E;  5C2T B;  3WCQ A;  2J4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...