2PKOA

Crystal structure of yeast urm1 at 1.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-related modifier 1
publication title The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pkoA00
2QIEB 1J7CA 1WRIA 1YQ3B 1ZUD2 2MJDA 1A70A 1N60A 2WU5B 3AE8B 3AE2B 4N59A 2BS4B 1XLOA 3VRAB 1TKYA 1ZXIA 2E3TA 1VDVA 2KAJA 1WXQA 1QT9A 2BS2B 2H89B 2MJEA 3AM9A 3B9JA 4US9A 3B2GA 3ZYYX 3AECB 2MH7A 2K22A 4N58A 3HVZA 2W3SA 3AV8A 3NVYA 5EE3A 3NVZA 3L4PA 3AEEB 4KX6B 1N63A 3AEGB 1CJEA 1XLPA 2KMMA 4IDIA 4USAA 1QOBA 1PFDA 1VJKA 3W9CB 1N5WA 1JRPA 3AEDB 1XO3A 2G1EA 1NYQA 1J7AA 3CWIA 1JQ4A 3DWGC 3W5UB 1B9RA 2H88B 2M56B 2W54A 2WQYB 1L0VB 2N0SB 1TKGA 1PDXA 2WP9B 4HRSA 1KF6B 3NVVA 3RPFC 1JW9D 1R7SA 2EKIA 2M19A 5C2TB 1YJJA 2B76B 1VLBA 4HROA 4YTNB 1RM6C 3ABVB 4US8A 3AE4B 5MPOA 1E9MA 3VR9B 3DWMA 1DOYA 1RWSA 2WU2B 3P4RB 2MJ3A 1FM0D 2Q5WD 4WWMA 3AEFB 3B2FA 1I7HA 3KWLA 3P4PB 3PO0A 2AX5A 2DBYA 2JQRB 3EUB2 3WCQA 2L52A 4P6VF 4YTMB 1QOAA 1T3QA 2WS3B 3AE3B 3NS1A 2HTME 5H8YE 2PVGC 2QJLA 2WDVB 1SIJA 1V8CA 3HUIA 4ZOHC 4YT0B 3SFEB 4N6EB 2K5PA 1YJIA 1FMAD 2CU3A 1NEKB 4YTPB 5EE1A 1E10A 1J7BA 1ZP0B 1FRDA 1SF0A 1F0ZA 5EE0A 3P4SB 2Y5CA 4C80A 2ACZB 3SFDB 3CIRB 1ROEA 3AB5A 5EE9A 1FRRA 2PVOD 4WQMA 4LTUA 1JALA 1N61A 4YSYB 3AEAB 1AWDA 1TYGB 1JROA 3HRDD 1EWYC 1FFUA 1OQQA 5AUKA 2CJOA 1SB3C 1WYGA 3AEBB 4C7YA 1RFKA 3AE6B 4YXDB 5G5HA 2WDRB 1KFYB 3AH7A 3P1MA 1YQ4B 3NVWA 2JX5A 3AN1A 5GXGB 5AUIA 1QOGA 4JX1C 2WDQB 4C7ZA 1E0ZA 1FXIA 1WWTA 3FAHA 5H92C 1FFVA 3AE7B 1KRHA 1V97A 1QOFA 1PUTA 3VR8B 3NRZA 3VRBB 1QLBB 1DOIA 4ITKA 3AE5B 1NVID 1JWAD 1JWBD 2CJNA 5G5GA 4YSXB 3LB8C 1XLNA 1AYFA 4YSZB 1OFFA 2BS3B 2OHFA 2WLBA 1L6UA 3AE9B 3P63A 3W5VB 1NI3A 2W3RA 1N62A 1OQRA 1FIQA 2K9XA 3AE1B 4ZHOA 1E7PB 2BT6A 4FXCA 3SR6A 1IUEA 1FO4A 3LXFA 3AMZA 2PKOA 1FXAA 2L83A 4JWUC 1NYRA 3FC4A 2DWQA 2LEKA 1CZPA 1WGKA 1XLQA 2PIAA 4ZHPA 2W55A 4JWSC 3ETRA 1L5PA 1GPXA 1ZOYB 5C3JB 1DGJA 3BIID 1GAQB 1NENB 1QF6A 3P4QB 1N5XA 1L6VA 4A9AA 1DOXA 1TJEA 1UWMA 1RYJA 1E6EB 2FBWB 1TKEA
chains in the Genus database with same CATH superfamily
1WZ3A 2HDEA 1LM8B 1G6JA 3TEWA 4C4VA 1L4ZB 2Y3AA 2BS2B 2H89B 2RDBC 5C23A 4XGAB 4FHJA 2WXJA 2C60A 4HPMB 4AJYB 1L0XB 2J0JA 2NBVB 1J7AA 1T0QC 2K6DB 4E71A 1K53A 1KF6B 2O2VA 2K8CA 3UQAA 3ML8A 4TV3A 3N1YC 2O2VB 4MEMA 3R2IA 2WS3B 3AE3B 1GB4A 2K25A 2KKCA 5BMGA 3Q2AC 1Q0WB 2LFIA 4YTPB 3MJ5A 4QAYA 1T5XD 5JZEB 3ONSA 3KUZA 1WXVA 3PVLA 3AB5A 1FRRA 2PVOD 1F52A 3IFWB 4UDUC 3V60A 1ISNA 1AWDA 5AUKA 1VZ8A 2CHXA 2N9PC 3AN1A 5GXGB 1EU3A 3JW0X 2AYOB 2MA9B 1J0GA 2PPHA 4KZ0A 4A6QA 1P7FA 4WWPA 3TL5A 3A9KA 2KQ4X 3NRZA 2KACA 2LWPA 3FKYA 1AYFA 2N1WA 2NTSA 4GDLA 1ESFA 4DQOC 1UH6A 3A9KB 1ZGUB 4GLSC 1V5OA 2ZCBA 3QIJA 5DCNA 5DPTA 1WMHA 1FXAA 3T3NA 2E6XA 3ETRA 5FR6A 4GDLB 2L7RA 1UD7A 2IJ0A 2AWTA 1FNVA 1WMHB 2A4ZA 3K9PB 4PS7A 1RYJA 2UU7A 2KMCA 1N60A 3AE2B 5I4DA 4S0RA 2KO3A 2KDBA 3AV8A 3W1SA 1XLPA 2Y5BB 2LASA 4K7UA 5FKAC 4TMAB 4RFBA 1PGAA 1L7YA 3DHGC 3APDA 1TKGA 2DZJA 4O1NA 3TEYA 4K81A 1EO6A 2ZJDA 5MPOA 5E6JA 3RNBC 5CHWA 2MQJA 1GC6A 3P4RB 4IWOA 2L0TA 2FIFA 3PO0A 2L52A 4D2KA 1C4AA 3RNEC 1SIJA 2PMVA 3SFEB 3IXSA 5EE0A 2Y5CA 4C80A 4ARCA 2BBCA 2ZW0A 4W9KA 1IBXA 2NPTA 3Q8AA 3BZDB 1F2RI 2WXHA 1SSNA 4MDKE 1IBXB 2NPTB 3NS8A 4GB9A 4P7IA 3DVGY 4EFOA 1C9FA 4ITKA 1NVID 4RM8A 4BKSD 1WGGA 2FIDA 4W9EA 3PLVA 3TEXA 2NCNA 2NS5A 2X38A 1EF5A 3DQVA 3APFA 4ICUA 1JRUA 2BB6A 3M63B 4WQOB 2AEHA 5G2NA 1WGKA 2G4DB 2QMTA 4HKQA 3BVZA 4A9AA 3RT3B 2K1FA 5HG2A 2KWUB 1WXQA 1MFWA 3WALA 1Z2MA 4A3PA 1N63A 2BQQA 1CJEA 3U8ZA 3DPDA 4WIPA 1B1ZA 4LNOA 4MSQB 2I2YA 2MX2A 2G45B 1HXYD 4OZBA 4OZCA 2C9WB 2RDHA 4WJPA 2UYZB 2WGSA 4B0MA 2KLCA 4RNAA 4HROA 1WM3A 1NBFC 3GZNI 1IGCA 2KDFB 3N1XC 3KWLA 2JF5A 2DBYA 2KDMA 3HM6X 1VRAB 4X57B 2IGDA 1KOTA 1GOZA 2JWUA 3OWEB 4AQ7A 2INDC 4FN2A 1FCCC 4MT5A 5D94A 1GG3A 4CYEA 5L95C 1K52A 5AEKB 1HTQA 1WX9A 2MEKA 2RMMA 5BMHA 1N61A 1SE2A 2BYEA 2MP2A 2N7JA 2O6VA 1YQ4B 3R2TA 5D3DA 3OJ4B 2MP2B 2O6VB 4HCNB 4YSXB 3OAWA 3HM3A 3B1LX 1N62A 2D10A 2DENB 2PW9A 5LLIA 4L1BA 4HJKA 5CHFA 3RFZB 3NOBA 2GBMA 2DWQA 2GBKA 3I5JC 3A4RA 2IZVB 2WHIA 1OEYA 2XK5A 1UWMA 1WGRA 3B08A 3KWVA 2WXGA 1WZ0A 1ZUD2 4E3CA 4EUTA 1A70A 2E3TA 3IAM1 1YQBA 2MJEA 3MTNB 2HD5B 2DYMA 1C79A 5EE3A 3EFUA 2LGIA 1SGHA 2R2OA 2OOBB 1S3SG 3W5UB 1B9RA 1R4MI 2H88B 1L0VB 4PK1A 1Y8RC 2J7QB 5D2MB 3RPFC 4KVGB 2KWCA 3ABVB 4FULA 4US8A 1XQQA 1DOYA 1RWSA 1ZDVA 2WX1A 3H8HA 3WA0A 2N1VA 3ZKJC 3ECIA 3RMKC 3VTUA 4ZYSA 1UNSA 3QX1A 3EHVA 3CF6E 4WAFA 4K3BA 4GIVA 3OG5A 2AQ3B 2YEPB 1C4CA 1D5ZC 2CU3A 4GSWA 2QCZA 3Q8CA 4S17A 3N1ZC 3LYYA 1D5MC 4II3B 4LTUA 3HRDD 3RZFA 3LDZE 3SEBA 4HCPB 4KDIC 4ARIA 4DHJD 1E0ZA 1KRHA 1STEA 2KX0A 1WE6A 2WLBA 1EU4A 3LXFA 1FEHA 2PKOA 4OVVA 2AL3A 3FC4A 1N6ZA 4URKA 2PIAA 2D3CA 2I38A 1R4MB 2KC2A 3MJWA 5C3JB 4KIKA 2BVCA 2KMAA 4L2YA 1YD8U 3V61A 1HQRD 2KAJA 2D2QA 4N59A 1QILA 4I6PA 3PGEA 2MSED 1D5XC 3DDCB 1T0SC 5EDSA 4ANVA 4CHKA 3X0WA 1NI2A 1XCTL 3DOWA 1KLUD 4GU2A 2KMMA 4KX6B 4XX5A 5KHOA 1AARA 2HE7A 4IM0A 3ML9A 1JRPA 3AEDB 2M8SA 2NMQA 4GDKA 5CTRC 1BT0A 1KM7A 1KJTA 3WAPA 1LFDA 3BK2A 3GE8C 3NVVA 4XYCA 2WXNA 1D6EC 2KTFA 1RM6C 4RGMA 3H6NA 5AZFA 4ACFA 4GDKB 3DWMA 2ZVOA 3L0WB 2WU2B 4RH6A 2RSUA 2GBNA 3T8MA 4GN1A 2LRUA 3AEFB 2CR5A 3EUB2 4P6VF 4ANXA 2KC1A 2IO2B 2B3AA 2K5PA 2NVUI 3PLUA 4WAAA 5EE1A 2GOWA 1J7BA 2L00B 3MP9A 2KNBA 1E7VA 3OLMD 1SJHD 2L05A 3D32A 4KKIA 4EE2A 3NZUA 3PT2B 1V1PA 3DBRI 4NPNA 3QQ8B 3WAMA 3QCAA 5G5HA 2INCC 4LDTB 3VH4B 1WSPA 1V1PB 3AE7B 1TZ1A 3VRBB 2K0PA 2FUHB 2C7MB 5G5GA 1OFFA 5DPSA 1HZ5A 2HJ1A 2W3RA 2PE9A 5LXHA 1JWMD 3PREA 2CHZA 2L83A 2FE8A 5IN7A 1CZPA 1XLQA 4ZHPA 4REZA 1L5PA 1TS5A 3E9SA 1NENB 2WXMA 2KLGA 1TJEA 1IYFA 2DLBA 2EMSA 4XWWA 1QQRA 4M0WA 2DHZA 1ZXIA 3QJZA 2MW5A 3JVZX 1D3ZA 2ZZPB 1OTRB 4LK0M 2Z8LA 1SBBB 5CX3A 4M0WB 3EC8A 3BINA 4USAA 4DHZB 2LZ6A 3NHEB 3JYUA 2FUG1 2L3ZA 3I9V1 4ZYNA 2Z0DB 2OJWA 2K6QA 4W9FA 3DBRB 2PJHA 2KHWB 1RFAA 3ZDTA 1NDDA 2HTME 5E6PA 1J19A 4C4VB 4DBGA 3URYA 1M94A 2MRPA 3TBLD 2QILA 4P16A 3J9CA 2JYEA 1F1HA 3SFDB 2D11A 2QHOA 1J8CA 2JWZA 4KGTA 1ENFA 2D3GA 2I1JA 4ASWC 5J17A 4II2B 3AEBB 4C7YA 5HFYA 3IT4B 1FPYA 1QOGA 4JX1C 3PZ7A 4TSSA 1EWCA 3KQ4A 2JT4B 1WYWB 3AU5A 3BWUD 1K51A 1XLNA 2ON8A 3VXWA 4Q2JA 3AE1B 1P9DU 3SR6A 3VDZA 1C78A 4HPPA 1JCKB 1C4PA 2L8JA 4KGRA 3RNCC 4JLCA 4JE3B 1QF6A 1L6VA 3L54A 2FBWB 2MWSB 4FHKA 2DZKA 2LJ5A 2VZKB 2BS4B 2JUOA 1V80A 1H8CA 3QARA 4HKZE 1Q1OA 4N58A 2WX0A 4FBJB 3U2SC 5IO9A 1WRDB 2EKEC 4BBNC 1NYQA 1CMXB 1HE8A 4FJVB 1P1AA 2M0XA 5C2TB 1F2RC 2B76B 1P3QU 1LQBA 1FD6A 4ZRIA 3V62A 2JQRB 4WWNA 4P1BC 3UF8A 4MACA 2IY0B 5FR3A 3U7ZA 1WI0A 4AS1A 2ONQA 2EELA 3BVGA 4IWQA 4MSMB 3H7PA 2RR9A 1JALA 3UIPB 1IPGA 3EFCA 1DYQA 2WDRB 1OQYA 1TY2A 4ZRPA 1BUIC 5AUIA 3EGRA 2ASQA 3H7PB 1ET6A 2JRIB 3DBLI 2NBWB 1QLBB 1I35A 4HVBA 5J18A 3LB8C 4YSZB 4KZCA 3WIMA 4F8CB 1AW7A 2D3AA 5IA7A 4JWUC 2KT7A 2KANA 1WJ6A 1X1MA 3KUDB 4PYUA 2LEKA 1ZE3D 4MELA 2W55A 3TCAA 4JL9A 4W9GA 3A9JA 1WIAA 3BK1A 3P42A 1XXGA 2LGXA 1WRIA 4I6LB 4W9LA 2J4XA 3HVDA 1TKYA 3RZWC 2KFKA 1U4AA 2FNJB 4NJ6A 3AECB 1Q10A 2A5UA 2C5LC 4A20A 2DZMA 3GS2A 4W9JA 3NVYA 2OJRA 3PHWB 3TSSA 2AQ1B 3WANA 2D5GA 2KFKB 4K7SA 1TS2A 1XO3A 2D3BA 2L32A 2DX5B 2WDTB 2M56B 2WQYB 4LNFA 3Q3NC 2N0SB 2SEBD 1P7EA 1WE7A 2QEJC 3VR9B 4HPLB 3VAWA 1ET9A 2DAFA 2MJ3A 4M00A 5JHAA 1WGYA 1PGBA 1QOAA 2M17A 1IGDA 1T0RC 4K3CA 2KVRA 3PTFC 2CS4A 4FADA 4ZOHC 3TMPB 1FMAD 2AQ2B 3A4SC 4PT5A 1NEKB 1GC7A 1SF0A 4W9IA 4DWFA 1V9JA 1ROEA 1HEZE 1TYGB 1FFUA 1V86A 4PYZA 2RDGA 3PS6A 2GBRA 3P1MA 1YMHE 3IBEA 2JYTA 4C7ZA 4RGOS 3TJPA 1WWTA 3DVNV 1M4VA 1DOIA 1JWAD 2XNAC 1WY8A 2IBIB 3RN9C 3UI3A 2GRIA 4ZHOA 1RRBA 3Q3JA 2RPVA 1GJZA 1JWUD 4A55A 2MBBB 3AMZA 4XC2A 1TGZB 2M0AA 1GPXA 4HDOA 1DGJA 4LNIA 5BO4B 1WFYA 4GOCA 2WU5B 2BF8B 3CMMB 1WXMA 4HXDA 4OZAA 2BTEA 3GP7A 2JPHA 2MH7A 3ZW3A 2ICIA 3AEGB 4HWIB 5TSSA 5AZHA 4DK5A 3ZTCA 2G1EA 3H7SA 3DWGC 2K39A 4AWJA 4B0EA 1R7SA 2LUMA 1WJUA 2C7NB 5TR5A 3GZNB 4G11A 4N9F4 4I6NB 2XK5B 3R7QA 2V3PA 1WGDA 4B6WA 4ZRKA 4DDID 4WJNA 1WX7A 2BYFA 2I1KA 5G55A 1S1QB 1MJDA 1E10A 3Q3OC 3UIOB 2FCMA 2G3QB 1YNTE 1MG4A 4KKJA 4RF0A 2KWDA 4NNJB 3ZLZA 3JSVA 3KH0A 1ZXHA 4WH4A 4G0NB 3AE6B 4YXDB 2KDEB 2LGDA 3SDLC 2WDQB 2INPE 3JSVB 1HZ6A 1ACCA 2JZPA 3NZ3A 1ZKHA 4K7WA 4TQ1A 4NJ7A 1NI3A 1F77A 3DVNU 2V0GA 2KN4A 5IOIA 3RUIB 3LJ3A 1L4DB 3RI7C 3V6CB 2IO1B 1SXTA 3VH3B 3AU4A 3H9DA 2KX3A 2MBOA 3TUOA 1DOXA 4H2AA 2ZPNA 1VR9A 4DXFA 4OVZA 3AE8B 2MBHA 4EKUA 4HDQA 4EZLA 2FCSA 3L08A 2PEAA 3B2GA 3N20C 3Q69A 5JXVA 5DPRA 1BXTA 1V81A 1Q5WB 2O6VD 1GUAB 5D6JB 4IDIA 1WXAA 1JWSD 3VUXA 3QC8B 3U7DA 4JPSA 3DCGA 1K50A 3ZO5B 3ZXRA 1XF5L 3QA8A 1YJJA 2JZ3B 3U30A 3AE4B 3TEZA 3ZJUA 1UBIA 2UWQA 4KIKB 4RCOA 2J52A 3HIZA 2DAJA 1E90A 1FM0D 3RULA 2KTRA 2IO3B 1UGJA 4AOFA 1WF9A 5H8YE 5JHBA 1MHXA 2WDVB 2INNE 4GGQA 2ZVNA 4KDLB 4RM9A 5D7GA 4A90A 2ZEQA 2KTRB 3T3OA 2V1YA 2GB1A 1IP9A 2REXA 2HTHA 3L16A 4CO7A 1CK1A 2JXTA 2VH2A 3RYTA 1V6EA 2IO0B 4YWGG 2CJOA 2BYTA 1RFKA 2VH1A 2W9NA 2JX5A 3R3MA 5H92C 1UGMA 2G9HD 1PUTA 4NQKE 4LJOB 4NZLB 3KYCD 1SE9A 2Z0EB 4MH0E 4BKTA 3U4EG 3GE3C 1OQRA 4MH8A 3AXCA 4RGNA 4MGIE 1LGRA 1UBQA 1NYRA 1TTNA 3SD5A 3APCA 1VZ7A 2W82A 3ZQ4A 4JWSC 2LVPA 1YN3A 3O13A 1N5XA 2WWZA 5GMVA 1TKEA 1P98A 2V3SA 2MBQA 1C3TA 4DXAB 2LXCA 4PS8A 4B95A 3DHHC 1GB1A 1QT9A 4LNKA 1YX6B 1YN4A 3I3TB 3ZXVA 3HVZA 2LGSA 2LGYA 2IY1B 3ZJVA 1VJKA 4K1RB 1EF1A 4W9CA 2KN5A 1WJNA 1JQ4A 3QAQA 3Q6BA 2LI5A 2WP9B 2WXFA 4HRSA 3ZNZB 1FCLA 4TKNA 3NG0A 2N9LA 2XN9C 1JMLA 2JRHA 4NY0A 2LUEA 4RF1A 1SE4A 4YTMB 2V4LA 3NS1A 2N7EA 1WH3A 2QJLA 3ALBA 2LMCA 5BYQA 1YJIA 2KZRA 2JVCA 1E8WA 3PRMB 3VTVA 2BKRB 3VQIA 1WR6E 3H1UA 5JH5C 3CIRB 1PYWD 2TSSA 1EWYC 3I57A 4BOSC 1FNUA 1UWXA 3GOEA 3ZUNA 2WXLA 2V4IB 2PTLA 1QOFA 1TS3A 2LXAA 3BVMA 3QK0A 3RD2A 5IAAC 1L6UA 4ICVA 5BYRA 1FIQA 1L0YB 4MGYE 4XZ4A 1YN5A 1K8RB 4MGZE 3Q8FA 2PLPA 2JXXA 2ZNVC 1RLFA 1TIFA 1VCBA 2R61A 2L76A 2BWES 3RNGC 1PGXA 3VUWA 3A33B 4ZDVA 2ZW1A 2WNMA 1HA5A 1A5RA 3L10B 4J6IA 3PPAA 2KD0A 4LDTD 1RAXA 1C76A 3ZNGC 3P2BA 1ZDXA 3PHXB 4A3OA 4CQNA 2KOXA 3Q8EA 4FLHA 3VTWA 3IG3A 3ZNID 3MC8A 2K8HA 1TZOA 3L17A 3RCZA 4NAWA 1JW9D 2M19A 3Q14C 2JY6A 4BKSA 1E9MA 4FJZA 1T6BX 4NAWB 1I42A 3HHMA 2JU6X 2N9KA 3FILA 3ZGZA 4MGKE 1V49A 4GMVA 3X23A 3FILB 3P4SB 2NTTA 3S2AA 2WXKA 5EE9A 1MI0A 2FAZA 1LXDA 4YSYB 1E8ZA 1WYGA 2KFJA 2EMTA 4F1SA 4DDGD 1WX8A 3VUYA 1UF0A 3W1YA 1FXIA 5E6NA 1V1OA 2N4FA 1TS4A 1I4QA 2QDFA 3AE5B 4M02A 5C1ZA 2HJ8A 4XE0A 2JSVX 2KQ7A 1EUVB 4M8MA 3NY5A 4W9DA 4FXCA 1WR1A 5BMIA 3PSEB 2CU1A 3M3JA 4G50A 1F9JA 4NAMA 2IYDB 3AULA 2BWFA 4WURA 3UQBA 1BMLC 5AZGA 2MLBA 4KGSA 2IPKD 2ZPYA 4EEWA 1YQ3B 3IT6B 3PRPB 2XEWA 3BYYB 1SJED 4B9KA 3IAS1 5CHVC 2WXOA 4KSLC 1E7UA 3B9JA 3ZYYX 4MM3A 3CSTA 5D3IB 3BYTB 3NVZA 4YL8A 3PZDA 5E6OA 1PFDA 1P0RA 1D4BA 4MM3B 4PS3A 4R3DA 2D07B 1LO5D 1XD3B 1MPEA 2YLMA 3C8YA 1VLBA 3KYDD 2ZNVB 3A9JB 1ZPSA 4WWMA 1OGWA 1PQSA 2VZKD 1KTKA 4EOYA 1XEEA 2LHEA 4DHZE 1VZ6A 2WXRA 4G3XB 1VD2A 1ZP0B 2KYWA 3MC0B 1HTOA 3TIXA 3OJ3A 3Q8BA 1WJ4A 4MJSA 3PRZA 3DBSA 1MVKA 3NZSA 1OQQA 2V9HA 4BKGA 3AH7A 5IP4D 1E8YA 5DPWA 4MJSB 4BZAA 3FAHA 3DBLB 5J2RA 3VR8B 4JGHB 5L83A 3C19A 2OHFA 3W2DA 3N32A 4WWOA 3AE9B 1FO4A 1SEBD 2K3UA 2Z59B 2IDYA 2R2QA 1WXSA 2RPQA 3V05A 2KVZA 2WXIA 2MHJA 1E8XA 2MBEA 3GB1A 3Q3MC 3VVWB 4IUMB 3NUHB 3P4QB 3MHZA 3SHQA 4HJGE 3N3KB 3M95A 1E6EB 5T8IA 2QIEB 1ZW7A 4IWPA 1YJ1A 1I4HA 2GBJA 2W3SA 2WYQA 1SE3A 1AN8A 2XBBC 2MCNB 2K8BA 1EM7A 3NJTA 2J42A 1V2YA 4YTNB 4DXGA 3O65B 1I4GA 4LCDE 3VHTC 2RGFA 2YVCA 4DHJB 4IW0A 3T9LA 3V3XA 4FA6A 1I7HA 2AX5A 2Y5PA 3MC9A 3WCQA 1KLVA 2GMIC 4KSKC 2PVGC 3L13A 3HUIA 3PV1A 4YT0B 4AP4C 1F0ZA 3ZJTA 4BOZB 3ENEA 2ACZB 1R4NI 4WQMA 4OVUA 3V6EB 1I4RA 2OEDA 2KQSA 4IM2A 2AL6A 2BYVE 3NVWA 3MHSD 4W9HA 3EECA 1QKZA 1FFVA 2LHDA 4LNNA 4BBNF 1XT9B 1Z5SB 4XDDA 4LJPB 2IGHA 2L1AA 2BS3B 3DBHI 2BT6A 2KK8A 1T0YA 2KJRA 4BVUC 5FK9C 1UZXB 5HKHA 3MFGA 3SU8X 1YOVB 4HK2A 3IVFA 3IHPC 1UUPA 1Y56A 1TBEA 3VRAB 2M1MA 1UELA 4E74A 1KLGD 3AM9A 3VFKA 3ZDMC 1YX5B 1SIFA 3KVFB 1QOBA 3CSFA 3HK0A 2ZCCA 3W9CB 1KH0A 1N5WA 2LRWA 4ANUA 3CWIA 5LXIB 4ZRJA 4IC7B 3ZIMA 1PDXA 4AJWA 2EKIA 2DYOA 3C0RB 5LNK1 3B0AA 1I4PA 1R4NB 2KXJA 3M62B 3AI5A 4IOIE 3N30A 2Q5WD 2QC8A 3B2FA 2BW2A 1T3QA 4IG7B 2CKHB 5HHDG 4XDCA 2BB5A 3BY4B 2L0FA 3U52E 2J0KA 4TQ0A 4LLGM 2LD9A 2J0MA 2NBUA 2KWVB 2N9XA 2V3NA 3DBHB 1FXTB 4BAXA 4A8XC 4C00A 2DYBA 1JROA 2CHWA 4ZRQA 4KV2A 3ZTDA 4J3OD 3R66C 4EZJA 4RGTA 5IKCM 1V97A 4M8NA 2WXQA 2LVOA 3P63A 2N7DA 3W5VB 1QZEA 2K9XA 2LVQA 4IKGA 1L2NA 1CQVA 1IUEA 4GXBA 4JIOU 2M4NA 2YEPF 4TUUA 3ZNHB 2VRRB 1GAQB 1TY0A 3QWZB 4HLEA 2FCQA 1J7CA 2BGFA 2MJDA 4WJOA 1XLOA 4M01A 2BPSA 2KDIA 3RNFC 1VDVA 3EA6A 3UINB 2C7HA 3KLSX 4US9A 4NQLB 3DHIC 3A1QA 2K22A 2SAKA 5HI1A 2WXPA 3L4PA 3AEEB 1C77A 2KJHB 1MHHE 1OEYJ 4ANWA 3A1QB 3I63C 2BKFA 2W54A 1WM2A 2DZIA 3ZRFA 2QSDA 4XWTA 3Q3FA 4IM3A 4L23A 5BYSA 4FJYA 3E56A 3P4PB 2NR2A 3R7RA 5KHQA 1H4RA 3UGBB 1V8CA 4OHJA 4F7ZA 1C1YB 4N6EB 2PE6B 1V5TA 1FRDA 4WJQA 2LJIA 4OW0A 1YIWA 3R8BA 3ZRCA 1MG8A 4AUQC 3AEAB 3KW5B 1SB3C 2DNFA 2X8XX 4C56C 1KFYB 4EZKA 2G4SA 2GI9A 1TT5B 2J53A 4BFRA 3K9OB 4JQWC 3DVGX 2FCNA 3ZVVA 1I4XA 1JWBD 1XCQL 2CJNA 2N9EB 3N9YC 4RMAA 1E7PB 2KJ6A 2JZZA 3W1SC 4NJCA 3KUCB 1FNWA 1E5WA 3RNAC 1WGHA 2RD0A 2IGGA 3WAOA 2GLSA 3PZ8A 4P1CC 3QHTA 4HEA1 1ZOYB 3BIID 1GNUA
chains in the Genus database with same CATH topology
2WU5B 1YQ3B 3IT6B 2HDEA 4N59A 1QILA 3BYYB 3TEWA 1SJED 4OZAA 3IAS1 2BTEA 1L4ZB 2WXOA 1D5XC 2Y3AA 2BS2B 2H89B 3GP7A 3B9JA 3ZYYX 2MH7A 2WXJA 5D3IB 3BYTB 3NVZA 1XCTL 4KX6B 1KLUD 2ICIA 2KMMA 3AEGB 1PFDA 5TSSA 1L0XB 1JRPA 3AEDB 1D4BA 2G1EA 1J7AA 2NMQA 3DWGC 4MM3B 4R3DA 1K53A 1LO5D 3BK2A 4B0EA 1KF6B 1MPEA 3C8YA 3NVVA 1R7SA 2LUMA 2WXNA 1D6EC 1VLBA 1RM6C 4RGMA 4GDKB 3DWMA 2WU2B 4RH6A 1ZPSA 4WWMA 3AEFB 2V3PA 3EUB2 2VZKD 4P6VF 3R2IA 2WS3B 1KTKA 3AE3B 1XEEA 2LHEA 1VZ6A 1GB4A 2K5PA 5BMGA 2LFIA 2WXRA 4YTPB 3MJ5A 1J7BA 5EE1A 1E10A 1ZP0B 1T5XD 3MP9A 3MC0B 1SJHD 3AB5A 3Q8BA 1FRRA 2PVOD 1YNTE 4KKIA 4KKJA 4RF0A 4EE2A 2KWDA 4UDUC 1V1PA 1MVKA 1AWDA 5AUKA 1VZ8A 1ZXHA 1OQQA 4WH4A 3AE6B 4YXDB 5G5HA 3AH7A 3AN1A 5GXGB 1EU3A 2WDQB 1WSPA 2INPE 1V1PB 3FAHA 4A6QA 1P7FA 3AE7B 1HZ6A 3VR8B 2KQ4X 1ACCA 2K0PA 2JZPA 3NRZA 3VRBB 2KACA 3NZ3A 5G5GA 1AYFA 1OFFA 2OHFA 3W2DA 1HZ5A 1FO4A 3AE9B 4TQ1A 1NI3A 1F77A 1SEBD 2W3RA 2V0GA 2K3UA 2NTSA 1ESFA 2IDYA 1JWMD 2KN4A 4DQOC 4GLSC 1L4DB 3V05A 3T3NA 1FXAA 2L83A 2E6XA 2FE8A 2WXIA 1SXTA 1CZPA 1XLQA 3GB1A 4ZHPA 4REZA 3ETRA 4GDLB 1L5PA 1TS5A 1ZOYB 3E9SA 2IJ0A 1NENB 1FNVA 2WXMA 3NUHB 3P4QB 3TUOA 3MHZA 1DOXA 1TJEA 4HJGE 1RYJA 1E6EB 4H2AA 2DLBA 5T8IA 1VR9A 2QIEB 4OVZA 1QQRA 4DXFA 4XWWA 1N60A 4M0WA 3AE8B 3AE2B 1ZXIA 5I4DA 1I4HA 3B2GA 4LK0M 3Q69A 5JXVA 2Z8LA 2W3SA 3AV8A 1BXTA 1SBBB 3W1SA 4USAA 1SE3A 1XLPA 4IDIA 1AN8A 2FUG1 1JWSD 5FKAC 4TMAB 4RFBA 1PGAA 1EM7A 1TKGA 4JPSA 3I9V1 1K50A 2J42A 1XF5L 1YJJA 4O1NA 4YTNB 3TEYA 4DXGA 3AE4B 3TEZA 5MPOA 1I4GA 5E6JA 3ZJUA 4RCOA 2J52A 3P4RB 1FM0D 3V3XA 1I7HA 3PO0A 2AX5A 2Y5PA 3WCQA 2L52A 4D2KA 1UGJA 1C4AA 2HTME 5H8YE 2PVGC 1MHXA 2WDVB 2INNE 1SIJA 5D7GA 4A90A 3HUIA 2PMVA 3URYA 4YT0B 3SFEB 3IXSA 2QILA 4P16A 3T3OA 3J9CA 2GB1A 1F0ZA 3ZJTA 5EE0A 2JYEA 2Y5CA 4C80A 2ACZB 3SFDB 4ARCA 2BBCA 2ZW0A 4WQMA 1CK1A 2JXTA 1IBXA 4YWGG 4KGTA 1ENFA 1I4RA 2CJOA 2OEDA 3Q8AA 2BYTA 3AEBB 4C7YA 1RFKA 3BZDB 1F2RI 2WXHA 3IT4B 3NVWA 1SSNA 2JX5A 5HFYA 1QOGA 4JX1C 3PZ7A 1QKZA 4TSSA 5H92C 1IBXB 1EWCA 1FFVA 2LHDA 3KQ4A 2G9HD 1PUTA 4XDDA 3BWUD 1K51A 4NZLB 1C9FA 4ITKA 1NVID 2IGHA 2L1AA 1XLNA 2ON8A 2BS3B 3U4EG 1OQRA 4Q2JA 3AE1B 3TEXA 2BT6A 4MH8A 3SR6A 4RGNA 2X38A 1C78A 2BB6A 5FK9C 1JCKB 1NYRA 1C4PA 4KGRA 1VZ7A 3MFGA 1WGKA 2W82A 3ZQ4A 4JWSC 2QMTA 4JE3B 4HKQA 1YN3A 1QF6A 3O13A 3BVZA 1N5XA 1L6VA 4A9AA 5HG2A 2FBWB 1TKEA 1UUPA 1Y56A 2VZKB 2BS4B 3VRAB 1GB1A 1WXQA 1KLGD 1QT9A 3AM9A 1YN4A 4HKZE 4N58A 3HVZA 1N63A 1CJEA 3U2SC 3ZJVA 1QOBA 4WIPA 1VJKA 1B1ZA 3W9CB 1KH0A 2I2YA 1N5WA 1HXYD 4OZBA 4OZCA 1NYQA 3CWIA 2RDHA 1JQ4A 1PDXA 2WP9B 2WXFA 4HRSA 4B0MA 2EKIA 2DYOA 5C2TB 5LNK1 1F2RC 2B76B 4RNAA 4HROA 1FCLA 1I4PA 2N9LA 2XN9C 1IGCA 1FD6A 4IOIE 1JMLA 2Q5WD 3B2FA 3KWLA 4RF1A 2DBYA 2BW2A 2JQRB 2KDMA 1SE4A 4YTMB 1VRAB 1T3QA 3NS1A 5HHDG 2QJLA 2LMCA 4XDCA 2BB5A 2IGDA 4MACA 1GOZA 2JWUA 3OWEB 1YJIA 5BYQA 3U52E 5FR3A 4TQ0A 4LLGM 3U7ZA 4AS1A 2ONQA 4AQ7A 2EELA 3BVGA 1FCCC 2V3NA 4MT5A 3VQIA 3CIRB 4A8XC 1K52A 1PYWD 2MEKA 2RMMA 2TSSA 5BMHA 1JALA 1N61A 1JROA 1EWYC 3I57A 1SE2A 4ZRQA 1FNUA 2N7JA 1DYQA 2WDRB 1YQ4B 1TY2A 4J3OD 4ZRPA 1BUIC 1UWXA 5AUIA 3EGRA 2WXLA 3R2TA 4RGTA 2V4IB 5D3DA 2PTLA 1ET6A 1V97A 1QOFA 1QLBB 1TS3A 3BVMA 2WXQA 4YSXB 3LB8C 4YSZB 3P63A 1L6UA 5BYRA 3W5VB 1N62A 1FIQA 1L0YB 2K9XA 4IKGA 2PW9A 1AW7A 4L1BA 1CQVA 1YN5A 1IUEA 3RFZB 2YEPF 3Q8FA 4JWUC 2DWQA 2PLPA 2LEKA 1ZE3D 2W55A 2R61A 1GAQB 1PGXA 1TY0A 1UWMA 3KWVA 2ZW1A 2WNMA 2WXGA 1HA5A 3BK1A 3P42A 1XXGA 1J7CA 1WRIA 1ZUD2 2MJDA 1A70A 2J4XA 3HVDA 1XLOA 1TKYA 2E3TA 3IAM1 1VDVA 3EA6A 2MJEA 3KLSX 4US9A 1C76A 3AECB 1Q10A 2DYMA 2K22A 1C79A 2SAKA 3GS2A 3NVYA 1ZDXA 5EE3A 5HI1A 2WXPA 3L4PA 4CQNA 3AEEB 3Q8EA 2LGIA 3TSSA 1C77A 2AQ1B 2D5GA 1TZOA 1MHHE 1TS2A 1XO3A 2L32A 3W5UB 1B9RA 2H88B 2M56B 2W54A 2WQYB 1L0VB 2N0SB 2SEBD 3RPFC 1P7EA 1JW9D 2M19A 2QSDA 3ABVB 4XWTA 4US8A 2QEJC 4L23A 1E9MA 3VR9B 1T6BX 1DOYA 1RWSA 1ET9A 1ZDVA 3H8HA 5BYSA 2MJ3A 4NAWB 3E56A 3P4PB 2JU6X 4ZYSA 1UNSA 1PGBA 1QOAA 2N9KA 1IGDA 4WAFA 3FILA 3ZGZA 2AQ3B 1V8CA 2YEPB 4OHJA 1C4CA 4ZOHC 4N6EB 1FMAD 1D5ZC 2CU3A 2AQ2B 4PT5A 1NEKB 1FRDA 1SF0A 3FILB 3P4SB 2NTTA 3Q8CA 2WXKA 1ROEA 2LJIA 4OW0A 5EE9A 3LYYA 3R8BA 1D5MC 1MI0A 1HEZE 4LTUA 4YSYB 3AEAB 1TYGB 3HRDD 1FFUA 3SEBA 1SB3C 1WYGA 4C56C 2RDGA 1KFYB 3P1MA 1YMHE 2GI9A 4ARIA 2J53A 2JYTA 4C7ZA 4RGOS 1E0ZA 1FXIA 1WWTA 1V1OA 1M4VA 1KRHA 1STEA 1DOIA 1TS4A 1I4QA 3AE5B 1I4XA 1JWAD 1JWBD 1XCQL 2CJNA 2XNAC 2JSVX 4XE0A 3UI3A 2WLBA 2GRIA 4ZHOA 3N9YC 1E7PB 1EU4A 4FXCA 2RPVA 1JWUD 4A55A 5BMIA 4NJCA 3LXFA 1FEHA 3AMZA 2PKOA 1FNWA 4NAMA 3FC4A 4WURA 2PIAA 2IGGA 1BMLC 2I38A 2M0AA 1GPXA 5C3JB 1DGJA 3PZ8A 4L2YA 4HEA1 4KGSA 2IPKD 1HQRD 2KAJA 3BIID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIE B;  1J7C A;  1WRI A;  1YQ3 B;  1ZUD 2;  2MJD A;  1A70 A;  1N60 A;  2WU5 B;  3AE8 B;  3AE2 B;  4N59 A;  2BS4 B;  1XLO A;  3VRA B;  1TKY A;  1ZXI A;  2E3T A;  1VDV A;  2KAJ A;  1WXQ A;  1QT9 A;  2BS2 B;  2H89 B;  2MJE A;  3AM9 A;  3B9J A;  4US9 A;  3B2G A;  3ZYY X;  3AEC B;  2MH7 A;  2K22 A;  4N58 A;  3HVZ A;  2W3S A;  3AV8 A;  3NVY A;  5EE3 A;  3NVZ A;  3L4P A;  3AEE B;  4KX6 B;  1N63 A;  3AEG B;  1CJE A;  1XLP A;  2KMM A;  4IDI A;  4USA A;  1QOB A;  1PFD A;  1VJK A;  3W9C B;  1N5W A;  1JRP A;  3AED B;  1XO3 A;  2G1E A;  1NYQ A;  1J7A A;  3CWI A;  1JQ4 A;  3DWG C;  3W5U B;  1B9R A;  2H88 B;  2M56 B;  2W54 A;  2WQY B;  1L0V B;  2N0S B;  1TKG A;  1PDX A;  2WP9 B;  4HRS A;  1KF6 B;  3NVV A;  3RPF C;  1JW9 D;  1R7S A;  2EKI A;  2M19 A;  5C2T B;  1YJJ A;  2B76 B;  1VLB A;  4HRO A;  4YTN B;  1RM6 C;  3ABV B;  4US8 A;  3AE4 B;  5MPO A;  1E9M A;  3VR9 B;  3DWM A;  1DOY A;  1RWS A;  2WU2 B;  3P4R B;  2MJ3 A;  1FM0 D;  2Q5W D;  4WWM A;  3AEF B;  3B2F A;  1I7H A;  3KWL A;  3P4P B;  3PO0 A;  2AX5 A;  2DBY A;  2JQR B;  3EUB 2;  3WCQ A;  2L52 A;  4P6V F;  4YTM B;  1QOA A;  1T3Q A;  2WS3 B;  3AE3 B;  3NS1 A;  2HTM E;  5H8Y E;  2PVG C;  2QJL A;  2WDV B;  1SIJ A;  1V8C A;  3HUI A;  4ZOH C;  4YT0 B;  3SFE B;  4N6E B;  2K5P A;  1YJI A;  1FMA D;  2CU3 A;  1NEK B;  4YTP B;  5EE1 A;  1E10 A;  1J7B A;  1ZP0 B;  1FRD A;  1SF0 A;  1F0Z A;  5EE0 A;  3P4S B;  2Y5C A;  4C80 A;  2ACZ B;  3SFD B;  3CIR B;  1ROE A;  3AB5 A;  5EE9 A;  1FRR A;  2PVO D;  4WQM A;  4LTU A;  1JAL A;  1N61 A;  4YSY B;  3AEA B;  1AWD A;  1TYG B;  1JRO A;  3HRD D;  1EWY C;  1FFU A;  1OQQ A;  5AUK A;  2CJO A;  1SB3 C;  1WYG A;  3AEB B;  4C7Y A;  1RFK A;  3AE6 B;  4YXD B;  5G5H A;  2WDR B;  1KFY B;  3AH7 A;  3P1M A;  1YQ4 B;  3NVW A;  2JX5 A;  3AN1 A;  5GXG B;  5AUI A;  1QOG A;  4JX1 C;  2WDQ B;  4C7Z A;  1E0Z A;  1FXI A;  1WWT A;  3FAH A;  5H92 C;  1FFV A;  3AE7 B;  1KRH A;  1V97 A;  1QOF A;  1PUT A;  3VR8 B;  3NRZ A;  3VRB B;  1QLB B;  1DOI A;  4ITK A;  3AE5 B;  1NVI D;  1JWA D;  1JWB D;  2CJN A;  5G5G A;  4YSX B;  3LB8 C;  1XLN A;  1AYF A;  4YSZ B;  1OFF A;  2BS3 B;  2OHF A;  2WLB A;  1L6U A;  3AE9 B;  3P63 A;  3W5V B;  1NI3 A;  2W3R A;  1N62 A;  1OQR A;  1FIQ A;  2K9X A;  3AE1 B;  4ZHO A;  1E7P B;  2BT6 A;  4FXC A;  3SR6 A;  1IUE A;  1FO4 A;  3LXF A;  3AMZ A;  2PKO A;  1FXA A;  2L83 A;  4JWU C;  1NYR A;  3FC4 A;  2DWQ A;  2LEK A;  1CZP A;  1WGK A;  1XLQ A;  2PIA A;  4ZHP A;  2W55 A;  4JWS C;  3ETR A;  1L5P A;  1GPX A;  1ZOY B;  5C3J B;  1DGJ A;  3BII D;  1GAQ B;  1NEN B;  1QF6 A;  3P4Q B;  1N5X A;  1L6V A;  4A9A A;  1DOX A;  1TJE A;  1UWM A;  1RYJ A;  1E6E B;  2FBW B;  1TKE A; 
#chains in the Genus database with same CATH topology
 1WZ3 A;  2HDE A;  1LM8 B;  1G6J A;  3TEW A;  4C4V A;  1L4Z B;  2Y3A A;  2BS2 B;  2H89 B;  2RDB C;  5C23 A;  4XGA B;  4FHJ A;  2WXJ A;  2C60 A;  4HPM B;  4AJY B;  1L0X B;  2J0J A;  2NBV B;  1J7A A;  1T0Q C;  2K6D B;  4E71 A;  1K53 A;  1KF6 B;  2O2V A;  2K8C A;  3UQA A;  3ML8 A;  4TV3 A;  3N1Y C;  2O2V B;  4MEM A;  3R2I A;  2WS3 B;  3AE3 B;  1GB4 A;  2K25 A;  2KKC A;  5BMG A;  3Q2A C;  1Q0W B;  2LFI A;  4YTP B;  3MJ5 A;  4QAY A;  1T5X D;  5JZE B;  3ONS A;  3KUZ A;  1WXV A;  3PVL A;  3AB5 A;  1FRR A;  2PVO D;  1F52 A;  3IFW B;  4UDU C;  3V60 A;  1ISN A;  1AWD A;  5AUK A;  1VZ8 A;  2CHX A;  2N9P C;  3AN1 A;  5GXG B;  1EU3 A;  3JW0 X;  2AYO B;  2MA9 B;  1J0G A;  2PPH A;  4KZ0 A;  4A6Q A;  1P7F A;  4WWP A;  3TL5 A;  3A9K A;  2KQ4 X;  3NRZ A;  2KAC A;  2LWP A;  3FKY A;  1AYF A;  2N1W A;  2NTS A;  4GDL A;  1ESF A;  4DQO C;  1UH6 A;  3A9K B;  1ZGU B;  4GLS C;  1V5O A;  2ZCB A;  3QIJ A;  5DCN A;  5DPT A;  1WMH A;  1FXA A;  3T3N A;  2E6X A;  3ETR A;  5FR6 A;  4GDL B;  2L7R A;  1UD7 A;  2IJ0 A;  2AWT A;  1FNV A;  1WMH B;  2A4Z A;  3K9P B;  4PS7 A;  1RYJ A;  2UU7 A;  2KMC A;  1N60 A;  3AE2 B;  5I4D A;  4S0R A;  2KO3 A;  2KDB A;  3AV8 A;  3W1S A;  1XLP A;  2Y5B B;  2LAS A;  4K7U A;  5FKA C;  4TMA B;  4RFB A;  1PGA A;  1L7Y A;  3DHG C;  3APD A;  1TKG A;  2DZJ A;  4O1N A;  3TEY A;  4K81 A;  1EO6 A;  2ZJD A;  5MPO A;  5E6J A;  3RNB C;  5CHW A;  2MQJ A;  1GC6 A;  3P4R B;  4IWO A;  2L0T A;  2FIF A;  3PO0 A;  2L52 A;  4D2K A;  1C4A A;  3RNE C;  1SIJ A;  2PMV A;  3SFE B;  3IXS A;  5EE0 A;  2Y5C A;  4C80 A;  4ARC A;  2BBC A;  2ZW0 A;  4W9K A;  1IBX A;  2NPT A;  3Q8A A;  3BZD B;  1F2R I;  2WXH A;  1SSN A;  4MDK E;  1IBX B;  2NPT B;  3NS8 A;  4GB9 A;  4P7I A;  3DVG Y;  4EFO A;  1C9F A;  4ITK A;  1NVI D;  4RM8 A;  4BKS D;  1WGG A;  2FID A;  4W9E A;  3PLV A;  3TEX A;  2NCN A;  2NS5 A;  2X38 A;  1EF5 A;  3DQV A;  3APF A;  4ICU A;  1JRU A;  2BB6 A;  3M63 B;  4WQO B;  2AEH A;  5G2N A;  1WGK A;  2G4D B;  2QMT A;  4HKQ A;  3BVZ A;  4A9A A;  3RT3 B;  2K1F A;  5HG2 A;  2KWU B;  1WXQ A;  1MFW A;  3WAL A;  1Z2M A;  4A3P A;  1N63 A;  2BQQ A;  1CJE A;  3U8Z A;  3DPD A;  4WIP A;  1B1Z A;  4LNO A;  4MSQ B;  2I2Y A;  2MX2 A;  2G45 B;  1HXY D;  4OZB A;  4OZC A;  2C9W B;  2RDH A;  4WJP A;  2UYZ B;  2WGS A;  4B0M A;  2KLC A;  4RNA A;  4HRO A;  1WM3 A;  1NBF C;  3GZN I;  1IGC A;  2KDF B;  3N1X C;  3KWL A;  2JF5 A;  2DBY A;  2KDM A;  3HM6 X;  1VRA B;  4X57 B;  2IGD A;  1KOT A;  1GOZ A;  2JWU A;  3OWE B;  4AQ7 A;  2IND C;  4FN2 A;  1FCC C;  4MT5 A;  5D94 A;  1GG3 A;  4CYE A;  5L95 C;  1K52 A;  5AEK B;  1HTQ A;  1WX9 A;  2MEK A;  2RMM A;  5BMH A;  1N61 A;  1SE2 A;  2BYE A;  2MP2 A;  2N7J A;  2O6V A;  1YQ4 B;  3R2T A;  5D3D A;  3OJ4 B;  2MP2 B;  2O6V B;  4HCN B;  4YSX B;  3OAW A;  3HM3 A;  3B1L X;  1N62 A;  2D10 A;  2DEN B;  2PW9 A;  5LLI A;  4L1B A;  4HJK A;  5CHF A;  3RFZ B;  3NOB A;  2GBM A;  2DWQ A;  2GBK A;  3I5J C;  3A4R A;  2IZV B;  2WHI A;  1OEY A;  2XK5 A;  1UWM A;  1WGR A;  3B08 A;  3KWV A;  2WXG A;  1WZ0 A;  1ZUD 2;  4E3C A;  4EUT A;  1A70 A;  2E3T A;  3IAM 1;  1YQB A;  2MJE A;  3MTN B;  2HD5 B;  2DYM A;  1C79 A;  5EE3 A;  3EFU A;  2LGI A;  1SGH A;  2R2O A;  2OOB B;  1S3S G;  3W5U B;  1B9R A;  1R4M I;  2H88 B;  1L0V B;  4PK1 A;  1Y8R C;  2J7Q B;  5D2M B;  3RPF C;  4KVG B;  2KWC A;  3ABV B;  4FUL A;  4US8 A;  1XQQ A;  1DOY A;  1RWS A;  1ZDV A;  2WX1 A;  3H8H A;  3WA0 A;  2N1V A;  3ZKJ C;  3ECI A;  3RMK C;  3VTU A;  4ZYS A;  1UNS A;  3QX1 A;  3EHV A;  3CF6 E;  4WAF A;  4K3B A;  4GIV A;  3OG5 A;  2AQ3 B;  2YEP B;  1C4C A;  1D5Z C;  2CU3 A;  4GSW A;  2QCZ A;  3Q8C A;  4S17 A;  3N1Z C;  3LYY A;  1D5M C;  4II3 B;  4LTU A;  3HRD D;  3RZF A;  3LDZ E;  3SEB A;  4HCP B;  4KDI C;  4ARI A;  4DHJ D;  1E0Z A;  1KRH A;  1STE A;  2KX0 A;  1WE6 A;  2WLB A;  1EU4 A;  3LXF A;  1FEH A;  2PKO A;  4OVV A;  2AL3 A;  3FC4 A;  1N6Z A;  4URK A;  2PIA A;  2D3C A;  2I38 A;  1R4M B;  2KC2 A;  3MJW A;  5C3J B;  4KIK A;  2BVC A;  2KMA A;  4L2Y A;  1YD8 U;  3V61 A;  1HQR D;  2KAJ A;  2D2Q A;  4N59 A;  1QIL A;  4I6P A;  3PGE A;  2MSE D;  1D5X C;  3DDC B;  1T0S C;  5EDS A;  4ANV A;  4CHK A;  3X0W A;  1NI2 A;  1XCT L;  3DOW A;  1KLU D;  4GU2 A;  2KMM A;  4KX6 B;  4XX5 A;  5KHO A;  1AAR A;  2HE7 A;  4IM0 A;  3ML9 A;  1JRP A;  3AED B;  2M8S A;  2NMQ A;  4GDK A;  5CTR C;  1BT0 A;  1KM7 A;  1KJT A;  3WAP A;  1LFD A;  3BK2 A;  3GE8 C;  3NVV A;  4XYC A;  2WXN A;  1D6E C;  2KTF A;  1RM6 C;  4RGM A;  3H6N A;  5AZF A;  4ACF A;  4GDK B;  3DWM A;  2ZVO A;  3L0W B;  2WU2 B;  4RH6 A;  2RSU A;  2GBN A;  3T8M A;  4GN1 A;  2LRU A;  3AEF B;  2CR5 A;  3EUB 2;  4P6V F;  4ANX A;  2KC1 A;  2IO2 B;  2B3A A;  2K5P A;  2NVU I;  3PLU A;  4WAA A;  5EE1 A;  2GOW A;  1J7B A;  2L00 B;  3MP9 A;  2KNB A;  1E7V A;  3OLM D;  1SJH D;  2L05 A;  3D32 A;  4KKI A;  4EE2 A;  3NZU A;  3PT2 B;  1V1P A;  3DBR I;  4NPN A;  3QQ8 B;  3WAM A;  3QCA A;  5G5H A;  2INC C;  4LDT B;  3VH4 B;  1WSP A;  1V1P B;  3AE7 B;  1TZ1 A;  3VRB B;  2K0P A;  2FUH B;  2C7M B;  5G5G A;  1OFF A;  5DPS A;  1HZ5 A;  2HJ1 A;  2W3R A;  2PE9 A;  5LXH A;  1JWM D;  3PRE A;  2CHZ A;  2L83 A;  2FE8 A;  5IN7 A;  1CZP A;  1XLQ A;  4ZHP A;  4REZ A;  1L5P A;  1TS5 A;  3E9S A;  1NEN B;  2WXM A;  2KLG A;  1TJE A;  1IYF A;  2DLB A;  2EMS A;  4XWW A;  1QQR A;  4M0W A;  2DHZ A;  1ZXI A;  3QJZ A;  2MW5 A;  3JVZ X;  1D3Z A;  2ZZP B;  1OTR B;  4LK0 M;  2Z8L A;  1SBB B;  5CX3 A;  4M0W B;  3EC8 A;  3BIN A;  4USA A;  4DHZ B;  2LZ6 A;  3NHE B;  3JYU A;  2FUG 1;  2L3Z A;  3I9V 1;  4ZYN A;  2Z0D B;  2OJW A;  2K6Q A;  4W9F A;  3DBR B;  2PJH A;  2KHW B;  1RFA A;  3ZDT A;  1NDD A;  2HTM E;  5E6P A;  1J19 A;  4C4V B;  4DBG A;  3URY A;  1M94 A;  2MRP A;  3TBL D;  2QIL A;  4P16 A;  3J9C A;  2JYE A;  1F1H A;  3SFD B;  2D11 A;  2QHO A;  1J8C A;  2JWZ A;  4KGT A;  1ENF A;  2D3G A;  2I1J A;  4ASW C;  5J17 A;  4II2 B;  3AEB B;  4C7Y A;  5HFY A;  3IT4 B;  1FPY A;  1QOG A;  4JX1 C;  3PZ7 A;  4TSS A;  1EWC A;  3KQ4 A;  2JT4 B;  1WYW B;  3AU5 A;  3BWU D;  1K51 A;  1XLN A;  2ON8 A;  3VXW A;  4Q2J A;  3AE1 B;  1P9D U;  3SR6 A;  3VDZ A;  1C78 A;  4HPP A;  1JCK B;  1C4P A;  2L8J A;  4KGR A;  3RNC C;  4JLC A;  4JE3 B;  1QF6 A;  1L6V A;  3L54 A;  2FBW B;  2MWS B;  4FHK A;  2DZK A;  2LJ5 A;  2VZK B;  2BS4 B;  2JUO A;  1V80 A;  1H8C A;  3QAR A;  4HKZ E;  1Q1O A;  4N58 A;  2WX0 A;  4FBJ B;  3U2S C;  5IO9 A;  1WRD B;  2EKE C;  4BBN C;  1NYQ A;  1CMX B;  1HE8 A;  4FJV B;  1P1A A;  2M0X A;  5C2T B;  1F2R C;  2B76 B;  1P3Q U;  1LQB A;  1FD6 A;  4ZRI A;  3V62 A;  2JQR B;  4WWN A;  4P1B C;  3UF8 A;  4MAC A;  2IY0 B;  5FR3 A;  3U7Z A;  1WI0 A;  4AS1 A;  2ONQ A;  2EEL A;  3BVG A;  4IWQ A;  4MSM B;  3H7P A;  2RR9 A;  1JAL A;  3UIP B;  1IPG A;  3EFC A;  1DYQ A;  2WDR B;  1OQY A;  1TY2 A;  4ZRP A;  1BUI C;  5AUI A;  3EGR A;  2ASQ A;  3H7P B;  1ET6 A;  2JRI B;  3DBL I;  2NBW B;  1QLB B;  1I35 A;  4HVB A;  5J18 A;  3LB8 C;  4YSZ B;  4KZC A;  3WIM A;  4F8C B;  1AW7 A;  2D3A A;  5IA7 A;  4JWU C;  2KT7 A;  2KAN A;  1WJ6 A;  1X1M A;  3KUD B;  4PYU A;  2LEK A;  1ZE3 D;  4MEL A;  2W55 A;  3TCA A;  4JL9 A;  4W9G A;  3A9J A;  1WIA A;  3BK1 A;  3P42 A;  1XXG A;  2LGX A;  1WRI A;  4I6L B;  4W9L A;  2J4X A;  3HVD A;  1TKY A;  3RZW C;  2KFK A;  1U4A A;  2FNJ B;  4NJ6 A;  3AEC B;  1Q10 A;  2A5U A;  2C5L C;  4A20 A;  2DZM A;  3GS2 A;  4W9J A;  3NVY A;  2OJR A;  3PHW B;  3TSS A;  2AQ1 B;  3WAN A;  2D5G A;  2KFK B;  4K7S A;  1TS2 A;  1XO3 A;  2D3B A;  2L32 A;  2DX5 B;  2WDT B;  2M56 B;  2WQY B;  4LNF A;  3Q3N C;  2N0S B;  2SEB D;  1P7E A;  1WE7 A;  2QEJ C;  3VR9 B;  4HPL B;  3VAW A;  1ET9 A;  2DAF A;  2MJ3 A;  4M00 A;  5JHA A;  1WGY A;  1PGB A;  1QOA A;  2M17 A;  1IGD A;  1T0R C;  4K3C A;  2KVR A;  3PTF C;  2CS4 A;  4FAD A;  4ZOH C;  3TMP B;  1FMA D;  2AQ2 B;  3A4S C;  4PT5 A;  1NEK B;  1GC7 A;  1SF0 A;  4W9I A;  4DWF A;  1V9J A;  1ROE A;  1HEZ E;  1TYG B;  1FFU A;  1V86 A;  4PYZ A;  2RDG A;  3PS6 A;  2GBR A;  3P1M A;  1YMH E;  3IBE A;  2JYT A;  4C7Z A;  4RGO S;  3TJP A;  1WWT A;  3DVN V;  1M4V A;  1DOI A;  1JWA D;  2XNA C;  1WY8 A;  2IBI B;  3RN9 C;  3UI3 A;  2GRI A;  4ZHO A;  1RRB A;  3Q3J A;  2RPV A;  1GJZ A;  1JWU D;  4A55 A;  2MBB B;  3AMZ A;  4XC2 A;  1TGZ B;  2M0A A;  1GPX A;  4HDO A;  1DGJ A;  4LNI A;  5BO4 B;  1WFY A;  4GOC A;  2WU5 B;  2BF8 B;  3CMM B;  1WXM A;  4HXD A;  4OZA A;  2BTE A;  3GP7 A;  2JPH A;  2MH7 A;  3ZW3 A;  2ICI A;  3AEG B;  4HWI B;  5TSS A;  5AZH A;  4DK5 A;  3ZTC A;  2G1E A;  3H7S A;  3DWG C;  2K39 A;  4AWJ A;  4B0E A;  1R7S A;  2LUM A;  1WJU A;  2C7N B;  5TR5 A;  3GZN B;  4G11 A;  4N9F 4;  4I6N B;  2XK5 B;  3R7Q A;  2V3P A;  1WGD A;  4B6W A;  4ZRK A;  4DDI D;  4WJN A;  1WX7 A;  2BYF A;  2I1K A;  5G55 A;  1S1Q B;  1MJD A;  1E10 A;  3Q3O C;  3UIO B;  2FCM A;  2G3Q B;  1YNT E;  1MG4 A;  4KKJ A;  4RF0 A;  2KWD A;  4NNJ B;  3ZLZ A;  3JSV A;  3KH0 A;  1ZXH A;  4WH4 A;  4G0N B;  3AE6 B;  4YXD B;  2KDE B;  2LGD A;  3SDL C;  2WDQ B;  2INP E;  3JSV B;  1HZ6 A;  1ACC A;  2JZP A;  3NZ3 A;  1ZKH A;  4K7W A;  4TQ1 A;  4NJ7 A;  1NI3 A;  1F77 A;  3DVN U;  2V0G A;  2KN4 A;  5IOI A;  3RUI B;  3LJ3 A;  1L4D B;  3RI7 C;  3V6C B;  2IO1 B;  1SXT A;  3VH3 B;  3AU4 A;  3H9D A;  2KX3 A;  2MBO A;  3TUO A;  1DOX A;  4H2A A;  2ZPN A;  1VR9 A;  4DXF A;  4OVZ A;  3AE8 B;  2MBH A;  4EKU A;  4HDQ A;  4EZL A;  2FCS A;  3L08 A;  2PEA A;  3B2G A;  3N20 C;  3Q69 A;  5JXV A;  5DPR A;  1BXT A;  1V81 A;  1Q5W B;  2O6V D;  1GUA B;  5D6J B;  4IDI A;  1WXA A;  1JWS D;  3VUX A;  3QC8 B;  3U7D A;  4JPS A;  3DCG A;  1K50 A;  3ZO5 B;  3ZXR A;  1XF5 L;  3QA8 A;  1YJJ A;  2JZ3 B;  3U30 A;  3AE4 B;  3TEZ A;  3ZJU A;  1UBI A;  2UWQ A;  4KIK B;  4RCO A;  2J52 A;  3HIZ A;  2DAJ A;  1E90 A;  1FM0 D;  3RUL A;  2KTR A;  2IO3 B;  1UGJ A;  4AOF A;  1WF9 A;  5H8Y E;  5JHB A;  1MHX A;  2WDV B;  2INN E;  4GGQ A;  2ZVN A;  4KDL B;  4RM9 A;  5D7G A;  4A90 A;  2ZEQ A;  2KTR B;  3T3O A;  2V1Y A;  2GB1 A;  1IP9 A;  2REX A;  2HTH A;  3L16 A;  4CO7 A;  1CK1 A;  2JXT A;  2VH2 A;  3RYT A;  1V6E A;  2IO0 B;  4YWG G;  2CJO A;  2BYT A;  1RFK A;  2VH1 A;  2W9N A;  2JX5 A;  3R3M A;  5H92 C;  1UGM A;  2G9H D;  1PUT A;  4NQK E;  4LJO B;  4NZL B;  3KYC D;  1SE9 A;  2Z0E B;  4MH0 E;  4BKT A;  3U4E G;  3GE3 C;  1OQR A;  4MH8 A;  3AXC A;  4RGN A;  4MGI E;  1LGR A;  1UBQ A;  1NYR A;  1TTN A;  3SD5 A;  3APC A;  1VZ7 A;  2W82 A;  3ZQ4 A;  4JWS C;  2LVP A;  1YN3 A;  3O13 A;  1N5X A;  2WWZ A;  5GMV A;  1TKE A;  1P98 A;  2V3S A;  2MBQ A;  1C3T A;  4DXA B;  2LXC A;  4PS8 A;  4B95 A;  3DHH C;  1GB1 A;  1QT9 A;  4LNK A;  1YX6 B;  1YN4 A;  3I3T B;  3ZXV A;  3HVZ A;  2LGS A;  2LGY A;  2IY1 B;  3ZJV A;  1VJK A;  4K1R B;  1EF1 A;  4W9C A;  2KN5 A;  1WJN A;  1JQ4 A;  3QAQ A;  3Q6B A;  2LI5 A;  2WP9 B;  2WXF A;  4HRS A;  3ZNZ B;  1FCL A;  4TKN A;  3NG0 A;  2N9L A;  2XN9 C;  1JML A;  2JRH A;  4NY0 A;  2LUE A;  4RF1 A;  1SE4 A;  4YTM B;  2V4L A;  3NS1 A;  2N7E A;  1WH3 A;  2QJL A;  3ALB A;  2LMC A;  5BYQ A;  1YJI A;  2KZR A;  2JVC A;  1E8W A;  3PRM B;  3VTV A;  2BKR B;  3VQI A;  1WR6 E;  3H1U A;  5JH5 C;  3CIR B;  1PYW D;  2TSS A;  1EWY C;  3I57 A;  4BOS C;  1FNU A;  1UWX A;  3GOE A;  3ZUN A;  2WXL A;  2V4I B;  2PTL A;  1QOF A;  1TS3 A;  2LXA A;  3BVM A;  3QK0 A;  3RD2 A;  5IAA C;  1L6U A;  4ICV A;  5BYR A;  1FIQ A;  1L0Y B;  4MGY E;  4XZ4 A;  1YN5 A;  1K8R B;  4MGZ E;  3Q8F A;  2PLP A;  2JXX A;  2ZNV C;  1RLF A;  1TIF A;  1VCB A;  2R61 A;  2L76 A;  2BWE S;  3RNG C;  1PGX A;  3VUW A;  3A33 B;  4ZDV A;  2ZW1 A;  2WNM A;  1HA5 A;  1A5R A;  3L10 B;  4J6I A;  3PPA A;  2KD0 A;  4LDT D;  1RAX A;  1C76 A;  3ZNG C;  3P2B A;  1ZDX A;  3PHX B;  4A3O A;  4CQN A;  2KOX A;  3Q8E A;  4FLH A;  3VTW A;  3IG3 A;  3ZNI D;  3MC8 A;  2K8H A;  1TZO A;  3L17 A;  3RCZ A;  4NAW A;  1JW9 D;  2M19 A;  3Q14 C;  2JY6 A;  4BKS A;  1E9M A;  4FJZ A;  1T6B X;  4NAW B;  1I42 A;  3HHM A;  2JU6 X;  2N9K A;  3FIL A;  3ZGZ A;  4MGK E;  1V49 A;  4GMV A;  3X23 A;  3FIL B;  3P4S B;  2NTT A;  3S2A A;  2WXK A;  5EE9 A;  1MI0 A;  2FAZ A;  1LXD A;  4YSY B;  1E8Z A;  1WYG A;  2KFJ A;  2EMT A;  4F1S A;  4DDG D;  1WX8 A;  3VUY A;  1UF0 A;  3W1Y A;  1FXI A;  5E6N A;  1V1O A;  2N4F A;  1TS4 A;  1I4Q A;  2QDF A;  3AE5 B;  4M02 A;  5C1Z A;  2HJ8 A;  4XE0 A;  2JSV X;  2KQ7 A;  1EUV B;  4M8M A;  3NY5 A;  4W9D A;  4FXC A;  1WR1 A;  5BMI A;  3PSE B;  2CU1 A;  3M3J A;  4G50 A;  1F9J A;  4NAM A;  2IYD B;  3AUL A;  2BWF A;  4WUR A;  3UQB A;  1BML C;  5AZG A;  2MLB A;  4KGS A;  2IPK D;  2ZPY A;  4EEW A;  1YQ3 B;  3IT6 B;  3PRP B;  2XEW A;  3BYY B;  1SJE D;  4B9K A;  3IAS 1;  5CHV C;  2WXO A;  4KSL C;  1E7U A;  3B9J A;  3ZYY X;  4MM3 A;  3CST A;  5D3I B;  3BYT B;  3NVZ A;  4YL8 A;  3PZD A;  5E6O A;  1PFD A;  1P0R A;  1D4B A;  4MM3 B;  4PS3 A;  4R3D A;  2D07 B;  1LO5 D;  1XD3 B;  1MPE A;  2YLM A;  3C8Y A;  1VLB A;  3KYD D;  2ZNV B;  3A9J B;  1ZPS A;  4WWM A;  1OGW A;  1PQS A;  2VZK D;  1KTK A;  4EOY A;  1XEE A;  2LHE A;  4DHZ E;  1VZ6 A;  2WXR A;  4G3X B;  1VD2 A;  1ZP0 B;  2KYW A;  3MC0 B;  1HTO A;  3TIX A;  3OJ3 A;  3Q8B A;  1WJ4 A;  4MJS A;  3PRZ A;  3DBS A;  1MVK A;  3NZS A;  1OQQ A;  2V9H A;  4BKG A;  3AH7 A;  5IP4 D;  1E8Y A;  5DPW A;  4MJS B;  4BZA A;  3FAH A;  3DBL B;  5J2R A;  3VR8 B;  4JGH B;  5L83 A;  3C19 A;  2OHF A;  3W2D A;  3N32 A;  4WWO A;  3AE9 B;  1FO4 A;  1SEB D;  2K3U A;  2Z59 B;  2IDY A;  2R2Q A;  1WXS A;  2RPQ A;  3V05 A;  2KVZ A;  2WXI A;  2MHJ A;  1E8X A;  2MBE A;  3GB1 A;  3Q3M C;  3VVW B;  4IUM B;  3NUH B;  3P4Q B;  3MHZ A;  3SHQ A;  4HJG E;  3N3K B;  3M95 A;  1E6E B;  5T8I A;  2QIE B;  1ZW7 A;  4IWP A;  1YJ1 A;  1I4H A;  2GBJ A;  2W3S A;  2WYQ A;  1SE3 A;  1AN8 A;  2XBB C;  2MCN B;  2K8B A;  1EM7 A;  3NJT A;  2J42 A;  1V2Y A;  4YTN B;  4DXG A;  3O65 B;  1I4G A;  4LCD E;  3VHT C;  2RGF A;  2YVC A;  4DHJ B;  4IW0 A;  3T9L A;  3V3X A;  4FA6 A;  1I7H A;  2AX5 A;  2Y5P A;  3MC9 A;  3WCQ A;  1KLV A;  2GMI C;  4KSK C;  2PVG C;  3L13 A;  3HUI A;  3PV1 A;  4YT0 B;  4AP4 C;  1F0Z A;  3ZJT A;  4BOZ B;  3ENE A;  2ACZ B;  1R4N I;  4WQM A;  4OVU A;  3V6E B;  1I4R A;  2OED A;  2KQS A;  4IM2 A;  2AL6 A;  2BYV E;  3NVW A;  3MHS D;  4W9H A;  3EEC A;  1QKZ A;  1FFV A;  2LHD A;  4LNN A;  4BBN F;  1XT9 B;  1Z5S B;  4XDD A;  4LJP B;  2IGH A;  2L1A A;  2BS3 B;  3DBH I;  2BT6 A;  2KK8 A;  1T0Y A;  2KJR A;  4BVU C;  5FK9 C;  1UZX B;  5HKH A;  3MFG A;  3SU8 X;  1YOV B;  4HK2 A;  3IVF A;  3IHP C;  1UUP A;  1Y56 A;  1TBE A;  3VRA B;  2M1M A;  1UEL A;  4E74 A;  1KLG D;  3AM9 A;  3VFK A;  3ZDM C;  1YX5 B;  1SIF A;  3KVF B;  1QOB A;  3CSF A;  3HK0 A;  2ZCC A;  3W9C B;  1KH0 A;  1N5W A;  2LRW A;  4ANU A;  3CWI A;  5LXI B;  4ZRJ A;  4IC7 B;  3ZIM A;  1PDX A;  4AJW A;  2EKI A;  2DYO A;  3C0R B;  5LNK 1;  3B0A A;  1I4P A;  1R4N B;  2KXJ A;  3M62 B;  3AI5 A;  4IOI E;  3N30 A;  2Q5W D;  2QC8 A;  3B2F A;  2BW2 A;  1T3Q A;  4IG7 B;  2CKH B;  5HHD G;  4XDC A;  2BB5 A;  3BY4 B;  2L0F A;  3U52 E;  2J0K A;  4TQ0 A;  4LLG M;  2LD9 A;  2J0M A;  2NBU A;  2KWV B;  2N9X A;  2V3N A;  3DBH B;  1FXT B;  4BAX A;  4A8X C;  4C00 A;  2DYB A;  1JRO A;  2CHW A;  4ZRQ A;  4KV2 A;  3ZTD A;  4J3O D;  3R66 C;  4EZJ A;  4RGT A;  5IKC M;  1V97 A;  4M8N A;  2WXQ A;  2LVO A;  3P63 A;  2N7D A;  3W5V B;  1QZE A;  2K9X A;  2LVQ A;  4IKG A;  1L2N A;  1CQV A;  1IUE A;  4GXB A;  4JIO U;  2M4N A;  2YEP F;  4TUU A;  3ZNH B;  2VRR B;  1GAQ B;  1TY0 A;  3QWZ B;  4HLE A;  2FCQ A;  1J7C A;  2BGF A;  2MJD A;  4WJO A;  1XLO A;  4M01 A;  2BPS A;  2KDI A;  3RNF C;  1VDV A;  3EA6 A;  3UIN B;  2C7H A;  3KLS X;  4US9 A;  4NQL B;  3DHI C;  3A1Q A;  2K22 A;  2SAK A;  5HI1 A;  2WXP A;  3L4P A;  3AEE B;  1C77 A;  2KJH B;  1MHH E;  1OEY J;  4ANW A;  3A1Q B;  3I63 C;  2BKF A;  2W54 A;  1WM2 A;  2DZI A;  3ZRF A;  2QSD A;  4XWT A;  3Q3F A;  4IM3 A;  4L23 A;  5BYS A;  4FJY A;  3E56 A;  3P4P B;  2NR2 A;  3R7R A;  5KHQ A;  1H4R A;  3UGB B;  1V8C A;  4OHJ A;  4F7Z A;  1C1Y B;  4N6E B;  2PE6 B;  1V5T A;  1FRD A;  4WJQ A;  2LJI A;  4OW0 A;  1YIW A;  3R8B A;  3ZRC A;  1MG8 A;  4AUQ C;  3AEA B;  3KW5 B;  1SB3 C;  2DNF A;  2X8X X;  4C56 C;  1KFY B;  4EZK A;  2G4S A;  2GI9 A;  1TT5 B;  2J53 A;  4BFR A;  3K9O B;  4JQW C;  3DVG X;  2FCN A;  3ZVV A;  1I4X A;  1JWB D;  1XCQ L;  2CJN A;  2N9E B;  3N9Y C;  4RMA A;  1E7P B;  2KJ6 A;  2JZZ A;  3W1S C;  4NJC A;  3KUC B;  1FNW A;  1E5W A;  3RNA C;  1WGH A;  2RD0 A;  2IGG A;  3WAO A;  2GLS A;  3PZ8 A;  4P1C C;  3QHT A;  4HEA 1;  1ZOY B;  3BII D;  1GNU A; 
#chains in the Genus database with same CATH homology
 2WU5 B;  1YQ3 B;  3IT6 B;  2HDE A;  4N59 A;  1QIL A;  3BYY B;  3TEW A;  1SJE D;  4OZA A;  3IAS 1;  2BTE A;  1L4Z B;  2WXO A;  1D5X C;  2Y3A A;  2BS2 B;  2H89 B;  3GP7 A;  3B9J A;  3ZYY X;  2MH7 A;  2WXJ A;  5D3I B;  3BYT B;  3NVZ A;  1XCT L;  4KX6 B;  1KLU D;  2ICI A;  2KMM A;  3AEG B;  1PFD A;  5TSS A;  1L0X B;  1JRP A;  3AED B;  1D4B A;  2G1E A;  1J7A A;  2NMQ A;  3DWG C;  4MM3 B;  4R3D A;  1K53 A;  1LO5 D;  3BK2 A;  4B0E A;  1KF6 B;  1MPE A;  3C8Y A;  3NVV A;  1R7S A;  2LUM A;  2WXN A;  1D6E C;  1VLB A;  1RM6 C;  4RGM A;  4GDK B;  3DWM A;  2WU2 B;  4RH6 A;  1ZPS A;  4WWM A;  3AEF B;  2V3P A;  3EUB 2;  2VZK D;  4P6V F;  3R2I A;  2WS3 B;  1KTK A;  3AE3 B;  1XEE A;  2LHE A;  1VZ6 A;  1GB4 A;  2K5P A;  5BMG A;  2LFI A;  2WXR A;  4YTP B;  3MJ5 A;  1J7B A;  5EE1 A;  1E10 A;  1ZP0 B;  1T5X D;  3MP9 A;  3MC0 B;  1SJH D;  3AB5 A;  3Q8B A;  1FRR A;  2PVO D;  1YNT E;  4KKI A;  4KKJ A;  4RF0 A;  4EE2 A;  2KWD A;  4UDU C;  1V1P A;  1MVK A;  1AWD A;  5AUK A;  1VZ8 A;  1ZXH A;  1OQQ A;  4WH4 A;  3AE6 B;  4YXD B;  5G5H A;  3AH7 A;  3AN1 A;  5GXG B;  1EU3 A;  2WDQ B;  1WSP A;  2INP E;  1V1P B;  3FAH A;  4A6Q A;  1P7F A;  3AE7 B;  1HZ6 A;  3VR8 B;  2KQ4 X;  1ACC A;  2K0P A;  2JZP A;  3NRZ A;  3VRB B;  2KAC A;  3NZ3 A;  5G5G A;  1AYF A;  1OFF A;  2OHF A;  3W2D A;  1HZ5 A;  1FO4 A;  3AE9 B;  4TQ1 A;  1NI3 A;  1F77 A;  1SEB D;  2W3R A;  2V0G A;  2K3U A;  2NTS A;  1ESF A;  2IDY A;  1JWM D;  2KN4 A;  4DQO C;  4GLS C;  1L4D B;  3V05 A;  3T3N A;  1FXA A;  2L83 A;  2E6X A;  2FE8 A;  2WXI A;  1SXT A;  1CZP A;  1XLQ A;  3GB1 A;  4ZHP A;  4REZ A;  3ETR A;  4GDL B;  1L5P A;  1TS5 A;  1ZOY B;  3E9S A;  2IJ0 A;  1NEN B;  1FNV A;  2WXM A;  3NUH B;  3P4Q B;  3TUO A;  3MHZ A;  1DOX A;  1TJE A;  4HJG E;  1RYJ A;  1E6E B;  4H2A A;  2DLB A;  5T8I A;  1VR9 A;  2QIE B;  4OVZ A;  1QQR A;  4DXF A;  4XWW A;  1N60 A;  4M0W A;  3AE8 B;  3AE2 B;  1ZXI A;  5I4D A;  1I4H A;  3B2G A;  4LK0 M;  3Q69 A;  5JXV A;  2Z8L A;  2W3S A;  3AV8 A;  1BXT A;  1SBB B;  3W1S A;  4USA A;  1SE3 A;  1XLP A;  4IDI A;  1AN8 A;  2FUG 1;  1JWS D;  5FKA C;  4TMA B;  4RFB A;  1PGA A;  1EM7 A;  1TKG A;  4JPS A;  3I9V 1;  1K50 A;  2J42 A;  1XF5 L;  1YJJ A;  4O1N A;  4YTN B;  3TEY A;  4DXG A;  3AE4 B;  3TEZ A;  5MPO A;  1I4G A;  5E6J A;  3ZJU A;  4RCO A;  2J52 A;  3P4R B;  1FM0 D;  3V3X A;  1I7H A;  3PO0 A;  2AX5 A;  2Y5P A;  3WCQ A;  2L52 A;  4D2K A;  1UGJ A;  1C4A A;  2HTM E;  5H8Y E;  2PVG C;  1MHX A;  2WDV B;  2INN E;  1SIJ A;  5D7G A;  4A90 A;  3HUI A;  2PMV A;  3URY A;  4YT0 B;  3SFE B;  3IXS A;  2QIL A;  4P16 A;  3T3O A;  3J9C A;  2GB1 A;  1F0Z A;  3ZJT A;  5EE0 A;  2JYE A;  2Y5C A;  4C80 A;  2ACZ B;  3SFD B;  4ARC A;  2BBC A;  2ZW0 A;  4WQM A;  1CK1 A;  2JXT A;  1IBX A;  4YWG G;  4KGT A;  1ENF A;  1I4R A;  2CJO A;  2OED A;  3Q8A A;  2BYT A;  3AEB B;  4C7Y A;  1RFK A;  3BZD B;  1F2R I;  2WXH A;  3IT4 B;  3NVW A;  1SSN A;  2JX5 A;  5HFY A;  1QOG A;  4JX1 C;  3PZ7 A;  1QKZ A;  4TSS A;  5H92 C;  1IBX B;  1EWC A;  1FFV A;  2LHD A;  3KQ4 A;  2G9H D;  1PUT A;  4XDD A;  3BWU D;  1K51 A;  4NZL B;  1C9F A;  4ITK A;  1NVI D;  2IGH A;  2L1A A;  1XLN A;  2ON8 A;  2BS3 B;  3U4E G;  1OQR A;  4Q2J A;  3AE1 B;  3TEX A;  2BT6 A;  4MH8 A;  3SR6 A;  4RGN A;  2X38 A;  1C78 A;  2BB6 A;  5FK9 C;  1JCK B;  1NYR A;  1C4P A;  4KGR A;  1VZ7 A;  3MFG A;  1WGK A;  2W82 A;  3ZQ4 A;  4JWS C;  2QMT A;  4JE3 B;  4HKQ A;  1YN3 A;  1QF6 A;  3O13 A;  3BVZ A;  1N5X A;  1L6V A;  4A9A A;  5HG2 A;  2FBW B;  1TKE A;  1UUP A;  1Y56 A;  2VZK B;  2BS4 B;  3VRA B;  1GB1 A;  1WXQ A;  1KLG D;  1QT9 A;  3AM9 A;  1YN4 A;  4HKZ E;  4N58 A;  3HVZ A;  1N63 A;  1CJE A;  3U2S C;  3ZJV A;  1QOB A;  4WIP A;  1VJK A;  1B1Z A;  3W9C B;  1KH0 A;  2I2Y A;  1N5W A;  1HXY D;  4OZB A;  4OZC A;  1NYQ A;  3CWI A;  2RDH A;  1JQ4 A;  1PDX A;  2WP9 B;  2WXF A;  4HRS A;  4B0M A;  2EKI A;  2DYO A;  5C2T B;  5LNK 1;  1F2R C;  2B76 B;  4RNA A;  4HRO A;  1FCL A;  1I4P A;  2N9L A;  2XN9 C;  1IGC A;  1FD6 A;  4IOI E;  1JML A;  2Q5W D;  3B2F A;  3KWL A;  4RF1 A;  2DBY A;  2BW2 A;  2JQR B;  2KDM A;  1SE4 A;  4YTM B;  1VRA B;  1T3Q A;  3NS1 A;  5HHD G;  2QJL A;  2LMC A;  4XDC A;  2BB5 A;  2IGD A;  4MAC A;  1GOZ A;  2JWU A;  3OWE B;  1YJI A;  5BYQ A;  3U52 E;  5FR3 A;  4TQ0 A;  4LLG M;  3U7Z A;  4AS1 A;  2ONQ A;  4AQ7 A;  2EEL A;  3BVG A;  1FCC C;  2V3N A;  4MT5 A;  3VQI A;  3CIR B;  4A8X C;  1K52 A;  1PYW D;  2MEK A;  2RMM A;  2TSS A;  5BMH A;  1JAL A;  1N61 A;  1JRO A;  1EWY C;  3I57 A;  1SE2 A;  4ZRQ A;  1FNU A;  2N7J A;  1DYQ A;  2WDR B;  1YQ4 B;  1TY2 A;  4J3O D;  4ZRP A;  1BUI C;  1UWX A;  5AUI A;  3EGR A;  2WXL A;  3R2T A;  4RGT A;  2V4I B;  5D3D A;  2PTL A;  1ET6 A;  1V97 A;  1QOF A;  1QLB B;  1TS3 A;  3BVM A;  2WXQ A;  4YSX B;  3LB8 C;  4YSZ B;  3P63 A;  1L6U A;  5BYR A;  3W5V B;  1N62 A;  1FIQ A;  1L0Y B;  2K9X A;  4IKG A;  2PW9 A;  1AW7 A;  4L1B A;  1CQV A;  1YN5 A;  1IUE A;  3RFZ B;  2YEP F;  3Q8F A;  4JWU C;  2DWQ A;  2PLP A;  2LEK A;  1ZE3 D;  2W55 A;  2R61 A;  1GAQ B;  1PGX A;  1TY0 A;  1UWM A;  3KWV A;  2ZW1 A;  2WNM A;  2WXG A;  1HA5 A;  3BK1 A;  3P42 A;  1XXG A;  1J7C A;  1WRI A;  1ZUD 2;  2MJD A;  1A70 A;  2J4X A;  3HVD A;  1XLO A;  1TKY A;  2E3T A;  3IAM 1;  1VDV A;  3EA6 A;  2MJE A;  3KLS X;  4US9 A;  1C76 A;  3AEC B;  1Q10 A;  2DYM A;  2K22 A;  1C79 A;  2SAK A;  3GS2 A;  3NVY A;  1ZDX A;  5EE3 A;  5HI1 A;  2WXP A;  3L4P A;  4CQN A;  3AEE B;  3Q8E A;  2LGI A;  3TSS A;  1C77 A;  2AQ1 B;  2D5G A;  1TZO A;  1MHH E;  1TS2 A;  1XO3 A;  2L32 A;  3W5U B;  1B9R A;  2H88 B;  2M56 B;  2W54 A;  2WQY B;  1L0V B;  2N0S B;  2SEB D;  3RPF C;  1P7E A;  1JW9 D;  2M19 A;  2QSD A;  3ABV B;  4XWT A;  4US8 A;  2QEJ C;  4L23 A;  1E9M A;  3VR9 B;  1T6B X;  1DOY A;  1RWS A;  1ET9 A;  1ZDV A;  3H8H A;  5BYS A;  2MJ3 A;  4NAW B;  3E56 A;  3P4P B;  2JU6 X;  4ZYS A;  1UNS A;  1PGB A;  1QOA A;  2N9K A;  1IGD A;  4WAF A;  3FIL A;  3ZGZ A;  2AQ3 B;  1V8C A;  2YEP B;  4OHJ A;  1C4C A;  4ZOH C;  4N6E B;  1FMA D;  1D5Z C;  2CU3 A;  2AQ2 B;  4PT5 A;  1NEK B;  1FRD A;  1SF0 A;  3FIL B;  3P4S B;  2NTT A;  3Q8C A;  2WXK A;  1ROE A;  2LJI A;  4OW0 A;  5EE9 A;  3LYY A;  3R8B A;  1D5M C;  1MI0 A;  1HEZ E;  4LTU A;  4YSY B;  3AEA B;  1TYG B;  3HRD D;  1FFU A;  3SEB A;  1SB3 C;  1WYG A;  4C56 C;  2RDG A;  1KFY B;  3P1M A;  1YMH E;  2GI9 A;  4ARI A;  2J53 A;  2JYT A;  4C7Z A;  4RGO S;  1E0Z A;  1FXI A;  1WWT A;  1V1O A;  1M4V A;  1KRH A;  1STE A;  1DOI A;  1TS4 A;  1I4Q A;  3AE5 B;  1I4X A;  1JWA D;  1JWB D;  1XCQ L;  2CJN A;  2XNA C;  2JSV X;  4XE0 A;  3UI3 A;  2WLB A;  2GRI A;  4ZHO A;  3N9Y C;  1E7P B;  1EU4 A;  4FXC A;  2RPV A;  1JWU D;  4A55 A;  5BMI A;  4NJC A;  3LXF A;  1FEH A;  3AMZ A;  2PKO A;  1FNW A;  4NAM A;  3FC4 A;  4WUR A;  2PIA A;  2IGG A;  1BML C;  2I38 A;  2M0A A;  1GPX A;  5C3J B;  1DGJ A;  3PZ8 A;  4L2Y A;  4HEA 1;  4KGS A;  2IPK D;  1HQR D;  2KAJ A;  3BII D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...