2PKOA

Crystal structure of yeast urm1 at 1.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-related modifier 1
publication title The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pkoA00
2WDQB 1XLPA 1YJJA 3AB5A 4YTPB 3AE8B 4YSYB 4C80A 2KAJA 1VJKA 1QF6A 1WXQA 1L0VB 1XLNA 3VR8B 1NYQA 2QJLA 3ZYYX 3VRBB 1E0ZA 4WQMA 2JQRB 3B2GA 3BIID 1N5WA 3AE5B 3P4PB 1PUTA 1RM6C 2LEKA 1DGJA 2WDRB 4YTMB 2K22A 1WGKA 4KX6B 4N59A 3DWMA 3AEDB 1FRDA 1NENB 3CWIA 1TKEA 3AECB 5EE3A 4N6EB 1E6EB 1FM0D 1QT9A 1RYJA 3AE3B 4ZHOA 2BS4B 2DBYA 2MJDA 2WQYB 3AM9A 1V97A 4A9AA 4LTUA 1NEKB 3B2FA 1N62A 1E9MA 1N5XA 4YTNB 4FXCA 1ZOYB 1VDVA 1F0ZA 1I7HA 1WYGA 1XLOA 3AEGB 1EWYC 4YSXB 3NRZA 1J7CA 1JW9D 1JWBD 3SR6A 2MH7A 5H92C 3P4RB 5C3JB 3AEFB 3NS1A 2CJOA 1NI3A 3ABVB 3AE4B 5H8YE 3P1MA 4C7YA 2WDVB 3AMZA 1V8CA 1WRIA 4N58A 1SIJA 2AX5A 2EKIA 2KMMA 1QOAA 3AE9B 4P6VF 4US9A 2W54A 1JRPA 1DOXA 3DWGC 1RWSA 2DWQA 2W55A 1TJEA 1DOIA 1JQ4A 4YXDB 1FFUA 5EE1A 4HRSA 2OHFA 5GXGB 5G5GA 2Q5WD 5MPOA 1B9RA 3FAHA 3HUIA 1QOFA 5G5HA 4JWSC 3AE6B 3SFDB 2M19A 2CU3A 1WWTA 3B9JA 1KFYB 3VR9B 2BT6A 2L52A 3P4SB 1ZXIA 2W3SA 1FMAD 1CZPA 1FXIA 2G1EA 1TKYA 3NVYA 1PDXA 4HROA 5EE9A 1ZP0B 2CJNA 1AWDA 1RFKA 4ZOHC 1TYGB 4JWUC 3HRDD 1SB3C 1QLBB 3AEAB 1OQRA 3LB8C 3RPFC 3SFEB 2H89B 2M56B 1XO3A 1KRHA 3NVWA 3CIRB 1YJIA 3W5VB 2WU2B 1GAQB 1L6VA 2PVGC 1GPXA 1ROEA 1YQ3B 1L5PA 3AV8A 3AN1A 4JX1C 2K5PA 3PO0A 3KWLA 1J7AA 1FRRA 1N63A 2Y5CA 1KF6B 3ETRA 3AE2B 2BS2B 1N61A 1UWMA 1JWAD 3WCQA 1NYRA 2HTME 2WS3B 2E3TA 1SF0A 3HVZA 1NVID 2PVOD 3W9CB 1FO4A 3NVVA 1E7PB 3AH7A 3L4PA 1IUEA 2ACZB 1CJEA 1QOBA 1VLBA 5AUKA 4ZHPA 1A70A 1FXAA 2WP9B 3EUB2 3P63A 1FIQA 1JALA 5C2TB 4C7ZA 2WU5B 5EE0A 2H88B 1DOYA 3AE1B 2QIEB 2L83A 3NVZA 2JX5A 4USAA 2BS3B 3VRAB 3AEBB 3P4QB 1ZUD2 2N0SB 2PIAA 1J7BA 5AUIA 2K9XA 4YSZB 1PFDA 4US8A 3AE7B 4YT0B 3W5UB 4WWMA 2B76B 1T3QA 1JROA 1QOGA 2FBWB 1XLQA 2PKOA 4ITKA 2MJEA 1OFFA 1E10A 3AEEB 2MJ3A 3LXFA 2WLBA 1L6UA 1TKGA 2W3RA 4IDIA 1FFVA 3FC4A 1YQ4B 1R7SA 1OQQA 1AYFA 1N60A
chains in the Genus database with same CATH superfamily
2I1JA 3EC8A 1OQYA 3VR8B 4A20A 1ISNA 4EEWA 1K51A 2KTFA 3AE5B 1ZW7A 3X23A 2LGIA 2BYFA 3EFCA 1WJ4A 5LXHA 4PYUA 1E6EB 4P1BC 2WNMA 1WR1A 4JLCA 3B2FA 2VZKD 1ZOYB 5CTRC 2KMCA 2LHEA 1LM8B 2V3SA 4GN1A 5HI1A 1NI3A 3DDCB 4DXGA 1SE2A 3SEBA 1EF1A 3AXCA 2KQSA 4MGIE 2KACA 4URKA 4BZAA 4XWTA 3PHXB 3V05A 1SEBD 4W9CA 2KDMA 4IKGA 3RZWC 4MSMB 3ZXVA 1FXIA 4A90A 1P1AA 1Q0WB 2KDEB 2H89B 1Q10A 1XO3A 2GLSA 4ANXA 3APFA 3AV8A 3N9YC 1PQSA 2C7MB 3D32A 4IWQA 3RN9C 4A3PA 1NYRA 3Q6BA 4LJOB 3Q8BA 3TL5A 4IW0A 4HKZE 4M00A 4OVZA 2MW5A 2DHZA 1C4AA 2LFIA 2J52A 4MJSA 1UWXA 1DOYA 1M4VA 1D5XC 1WH3A 4KV2A 2SEBD 3T8MA 2MBOA 4WWMA 4BOZB 1XT9B 4B0MA 2XEWA 3ZW3A 2JUOA 2XK5B 2KAJA 2K3UA 2IZVB 2DX5B 3ZYYX 2HE7A 3BVMA 1I35A 3L0WB 4FJZA 1WGKA 1WIAA 4M0WB 3VXWA 4NAWA 3URYA 4IM0A 1R4MB 3H1UA 3GZNI 3GE3C 2IGGA 4TQ1A 1RFAA 1GNUA 1NEKB 3AEGB 5DPWA 1WXVA 1FD6A 1MG8A 3DBLB 3MJWA 2LRWA 3AMZA 2GBMA 2KTRA 4HPMB 3AE9B 1JCKB 1NI2A 5DPTA 3PHWB 2PMVA 3IG3A 2KQ7A 1P0RA 1TY2A 4WIPA 1B9RA 3PT2B 3KYCD 4YL8A 4AOFA 4K7SA 1IBXB 3V6EB 5JHAA 1CK1A 1CZPA 2KLCA 4OZCA 3EA6A 2CJNA 2L7RA 2KWCA 3W5VB 2M0XA 5T8IA 4M01A 1PYWD 1PGBA 2LZ6A 3ALBA 1FXTB 4K81A 2MBQA 2MBEA 4JGHB 1K53A 3NZ3A 4B6WA 3OJ4B 3AH7A 1IPGA 5C2TB 1TGZB 1H4RA 2ZEQA 4HLEA 2K9XA 4HPPA 4RH6A 4G0NB 4CHKA 2G9HD 2K39A 2V1YA 1JMLA 4GXBA 1V1PA 4C4VB 2DNFA 2JZZA 2KX3A 5E6NA 3JYUA 1C76A 1RM6C 3NJTA 3WAPA 5D3DA 1YQBA 1PGXA 4LK0M 2EMTA 1HTQA 2BYTA 1V5OA 2LD9A 4GDKA 3VUXA 1WYGA 5HKHA 2DZMA 2IO0B 4RM8A 2CJOA 3IVFA 2ZW1A 1V8CA 2KXJA 3ZGZA 3VFKA 2N9XA 2Z0DB 1DOXA 3V60A 3RFZB 2ZZPB 4OW0A 4FHKA 3QAQA 3AE6B 2MP2A 4LCDE 2QILA 2CKHB 3ZNGC 1B1ZA 2N9LA 1KTKA 2VRRB 5GMVA 3U2SC 2WU2B 2Y5PA 4KIKB 4XC2A 1I4QA 2JZ3B 2WS3B 4G3XB 4ANWA 1GJZA 2WGSA 1V80A 4K7WA 4ZRPA 1BXTA 5CX3A 3VDZA 1KLGD 2GBRA 2WP9B 3Q3JA 2BYEA 5DCNA 1VR9A 2ZW0A 2I38A 5EE0A 4S0RA 3VRAB 3AEBB 3V3XA 2JYTA 3Q8AA 2JYEA 4GU2A 3W5UB 3W2DA 4HDQA 1MHHE 2RDGA 2WLBA 3P2BA 2W3RA 1YQ4B 1V1OA 2LGSA 4II3B 4C80A 1V9JA 3OJ3A 2WXIA 1KOTA 4YTMB 3UIPB 3ENEA 4N59A 4EZKA 3DWMA 2DZJA 2BQQA 1SBBB 4XZ4A 1KLUD 2BS4B 3AM9A 4A9AA 4XE0A 5IP4D 4IWPA 2K6DB 1XLOA 1J7CA 3SR6A 1ZXHA 2C9WB 2NPTB 2WXPA 1WGYA 1YNTE 1V5TA 4HCNB 1WFYA 3RNEC 2W54A 5JH5C 4A3OA 1KM7A 2V4LA 1JQ4A 3TUOA 2OHFA 1I4GA 5KHOA 1EWCA 3OWEB 2D07B 4NJ6A 3ZNZB 4XWWA 3A9KA 4TV3A 2G1EA 2KFKB 1K8RB 4RGOS 2J7QB 1TYGB 1FPYA 3WALA 4XYCA 3H7PB 3Q3OC 1UGJA 2OOBB 2N1VA 2JSVX 4RGNA 3VQIA 2D3GA 4J6IA 2MQJA 2I2YA 5CHWA 4ARIA 3DBHI 1XQQA 4XGAB 2NCNA 3R3MA 4NJCA 2LUMA 1V81A 3GZNB 3P63A 4C56C 1C3TA 4IUMB 1MPEA 1WF9A 4TSSA 1P3QU 3DBLI 1ZUD2 2N0SB 3ZO5B 2L05A 3MTNB 4BKSD 2JU6X 5G2NA 2RD0A 1JROA 4ZYNA 4LNIA 3JSVA 3E9SA 2MJ3A 3LXFA 4IDIA 3KVFB 1XLNA 4HCPB 2KZRA 2WDRB 2V0GA 2K22A 4OHJA 2IY0B 4MEMA 2NBWB 3KYDD 1YMHE 3ZKJC 3RMKC 3VUYA 4ZYSA 3BVGA 4YSXB 3IAS1 1D5ZC 4BKSA 3I9V1 5BMIA 5BMHA 2O6VB 1SIJA 2KJ6A 4LJPB 3DHIC 1L4DB 1WI0A 2YEPF 1TJEA 2RPQA 5EE1A 1SJED 4WWNA 2MBHA 4D2KA 2JRHA 2KWVB 2Q5WD 4A55A 1RLFA 2CU3A 2GB1A 1WWTA 1E5WA 2L52A 5IA7A 4TMAB 2WX0A 3ZIMA 4W9FA 4HROA 3NVYA 2AQ1B 3GP7A 2D11A 4XDCA 1XEEA 3AEAB 3RPFC 1TS2A 2J53A 1E7VA 4WJOA 3NVWA 3CIRB 2KC1A 2KOXA 1TS4A 3U7DA 1L5PA 3FILA 3GE8C 4LNOA 4JX1C 2K5PA 3KUCB 2LUEA 5JHBA 1C4CA 3TBLD 2JXXA 1T5XD 2ON8A 2PVOD 2J4XA 3NY5A 4XX5A 3PV1A 5AUKA 4M8MA 4C7ZA 2ICIA 3KW5B 1FIQA 3UGBB 2WXLA 2L83A 4HJKA 4FJYA 2O2VB 2V9HA 1WMHB 3BWUD 4EOYA 3SDLC 1L6UA 3L16A 1TBEA 3IHPC 4KX6B 2WYQA 1N60A 5J17A 1H8CA 2QJLA 3U30A 4QAYA 4FN2A 4ANVA 3Q2AC 3Q14C 4K1RB 4GDLB 3AEDB 2BB6A 2JWUA 1M94A 2INDC 3HK0A 2DBYA 1UF0A 2L1AA 4ZRKA 4JL9A 2V3NA 1WE6A 4FXCA 1EWYC 1UH6A 2Z0EB 4MDKE 3ZRCA 2N9EB 3AE4B 3HVDA 2IO1B 2KNBA 2NTTA 5AZHA 1WGGA 1JRPA 4I6LB 2G4SA 4HRSA 2KK8A 4MT5A 2AL6A 4HEA1 1QOFA 3BK2A 4DXFA 1KFYB 1YN4A 5CHVC 3VR9B 3RNBC 1ENFA 4PYZA 3GB1A 1UUPA 2RDHA 1WXSA 3ZJVA 3R7QA 1ZP0B 4BVUC 3CMMB 4KDLB 1MVKA 4YWGG 2DYMA 4NNJB 1TY0A 1GB4A 4MM3B 3N1XC 2JT4B 5L95C 3ML8A 1J7AA 2FCQA 2KHWB 4E3CA 3WCQA 3ZJTA 1SF0A 3RD2A 4M8NA 3L13A 3ZRFA 2YLMA 4A6QA 4DWFA 1VLBA 2N7DA 3A4RA 3C0RB 3DPDA 3Q69A 4USAA 1HQRD 3TIXA 2AQ2B 3QK0A 2IGHA 1TS5A 4WQOB 1YX5B 4WWPA 1VZ8A 4M0WA 2L0TA 2CHWA 4YSYB 3DBRI 1E0ZA 2HTHA 4HK2A 1DGJA 3NS8A 2J0KA 2L76A 2UU7A 3NUHB 3RZFA 3ZLZA 3AECB 1EM7A 3DCGA 3KUZA 1L4ZB 1N5XA 4YTNB 1DYQA 1WGHA 2WXKA 2KVZA 1SIFA 3NRZA 2PEAA 1N6ZA 5H8YE 4C7YA 1KH0A 2M0AA 2CHZA 4R3DA 4P7IA 4DXAB 3GOEA 4OZBA 4WJQA 2R2QA 1IBXA 3VTWA 3DBHB 3CSTA 3LDZE 3PRMB 2KN4A 3P42A 1XCTL 2LHDA 5D3IB 3PZDA 4BAXA 1D6EC 3B9JA 2LVQA 2DYOA 1EUVB 5L83A 4MGYE 1TKYA 2MBBB 2QEJC 4UDUC 1GC7A 2NS5A 4JWUC 3LB8C 4TUUA 1IP9A 3VTVA 2PVGC 5FR6A 3TEZA 1ROEA 2K8BA 3DVGX 4HKQA 2AWTA 4BKGA 1WSPA 2BS2B 2LGDA 3L10B 1E8WA 1RRBA 4JE3B 3PRPB 3HM6X 2AL3A 2EKEC 2KFJA 3PS6A 1IUEA 1YD8U 2V4IB 2LXAA 1FXAA 1JALA 1FCLA 4NQKE 2PPHA 2DLBA 3NVZA 2UWQA 2N1WA 4C4VA 3P4QB 1D3ZA 2OEDA 3N32A 3OAWA 2W9NA 3VHTC 2LJ5A 4NAWB 1BUIC 4GMVA 1Q5WB 2Y5CA 1AYFA 2MSED 4DHZB 3B2GA 1P7EA 2KMAA 1YIWA 2G4DB 1UZXB 3W1SC 2KTRB 5DPSA 2KD0A 5EE3A 2HJ8A 2RDBC 2L3ZA 3PREA 3MHZA 3DHHC 1F0ZA 1JWUD 4AJWA 2NTSA 5H92C 3NS1A 2AYOB 4WAFA 2R61A 3ZDTA 3ZVVA 4YXDB 1FFUA 5JXVA 3X0WA 1C77A 4N9F4 2TSSA 3ZTCA 2LXCA 3NZUA 3N3KB 4CYEA 2IPKD 1AARA 3QQ8B 3PZ8A 5I4DA 3NHEB 4KIKA 1V86A 4H2AA 4PK1A 1YN5A 1AWDA 3L54A 1SB3C 3DHGC 2KJHB 4ZRQA 3RYTA 2B3AA 4ICUA 5BMGA 3BYYB 2PE9A 3QHTA 3N1ZC 4AJYB 3GS2A 3SU8X 2D2QA 1NVID 2G45B 1ZDVA 3FKYA 4RGMA 2I1KA 1SE9A 1A70A 1VZ7A 4IM2A 1WJNA 5HG2A 4GGQA 2VH1A 3ECIA 1OEYJ 1F1HA 2WXOA 4EKUA 3DBSA 4YT0B 3A9JB 2FBWB 3U4EG 3UIOB 3Q3FA 2XNAC 3BZDB 2IBIB 1GOZA 4RCOA 4RMAA 1YJJA 3M3JA 4GDKB 4L1BA 1D4BA 3BIID 1WY8A 2LEKA 3KWVA 3PSEB 4JIOU 4W9DA 2NMQA 2JF5A 2BWES 2K8HA 2ZJDA 3QC8B 4KSKC 2IO2B 3DVGY 3T3NA 3UQBA 3R8BA 1YOVB 3A1QB 3BYTB 1J0GA 5IOIA 1JWSD 3P4RB 5C3JB 2JZPA 1WX7A 2FIFA 1ZGUB 4US9A 2M8SA 4DHJD 1OEYA 1TZOA 1HE8A 1LGRA 4ICVA 1SXTA 1ZPSA 4EFOA 3MC9A 2QMTA 3I3TB 5MPOA 3J9CA 3HUIA 2KFKA 3UF8A 4RFBA 3B08A 3JVZX 2M1MA 2ZPNA 1SE3A 3HIZA 3P4SB 2RGFA 3H7PA 2GBNA 2IYDB 5J2RA 1P7FA 2WHIA 4LNKA 1KRHA 4E71A 2KDFB 3OG5A 1KJTA 2C60A 2RPVA 2PW9A 4W9GA 5AZGA 3TEWA 4HPLB 1KF6B 3DBRB 1QZEA 3V62A 3UQAA 2WDTB 3CF6E 2IGDA 1FO4A 2Z59B 2D3CA 1NDDA 3ZDMC 1Z5SB 2V3PA 2NR2A 1FNVA 2WU5B 4WJPA 5LXIB 2H88B 2WXQA 5E6PA 2BS3B 1C9FA 4S17A 5D2MB 2B76B 4I6PA 1XCQL 1TTNA 1XLQA 1MJDA 1E7UA 1OGWA 2DYBA 3N20C 3RULA 2PLPA 1WYWB 1J19A 1F52A 3KH0A 3Q8EA 1XLPA 4RM9A 1UBIA 3I5JC 3R2TA 2ZNVB 1NYQA 3VTUA 3AU4A 5E6JA 1SGHA 2WXNA 2BWFA 1FRDA 2WXGA 1HZ5A 2QHOA 4MH8A 1QT9A 2BKRB 2LGXA 3QA8A 2INPE 2KN5A 2J0MA 1N62A 1E9MA 3E56A 4DBGA 4OVUA 2ZVNA 3WANA 1JW9D 4DHZE 2FE8A 3N30A 2C5LC 3ML9A 2EKIA 2Y3AA 3ZXRA 1SSNA 2N7EA 2Z8LA 4GB9A 2REXA 1I4HA 2DENB 5CHFA 5GXGB 4MACA 1K52A 2X8XX 1TT5B 3PLUA 3MHSD 4BBNC 2KQ4X 3RCZA 1LFDA 1T6BX 4FLHA 1LXDA 3JW0X 2L00B 2KWUB 2MX2A 4EUTA 5BO4B 1EU3A 3UINB 1GAQB 1E8ZA 2GRIA 3PO0A 1Z2MA 3NOBA 1I4XA 2JY6A 2KKCA 2BVCA 2BGFA 1G6JA 2DZIA 4LNNA 2O2VA 2ACZB 2JWZA 1WMHA 3DOWA 1ZKHA 4X57B 2BYVE 4IOIE 1FNUA 3AE1B 2LVPA 2L0FA 3N1YC 3T9LA 4US8A 1PFDA 3AE7B 4FADA 1QOGA 4KGSA 1JRUA 1UBQA 3VH3B 2GMIC 2HJ1A 2N9KA 2WDQB 3EHVA 5D6JB 2N9PC 3MJ5A 3ONSA 1QF6A 2WXJA 4DK5A 2A5UA 4NJ7A 1S1QB 2ZCCA 2AQ3B 2MRPA 3ZUNA 3RNGC 4B95A 4ZHOA 1UELA 1VCBA 1VRAB 2N7JA 4LTUA 3VVWB 2K6QA 3SHQA 1F2RC 1MFWA 3RUIB 2MH7A 3NZSA 2WDVB 4C00A 1WRIA 2ZNVC 4BOSC 4GIVA 4W9HA 4HXDA 3M62B 4PS3A 2INCC 2LGYA 1MI0A 3FAHA 4EE2A 5AEKB 2WXFA 4IG7B 2IY1B 1WE7A 1EO6A 3FILB 5BYRA 3BY4B 4MM3A 1R4NI 5EE9A 2VH2A 4ASWC 2MLBA 3KQ4A 4W9JA 1T0SC 4NAMA 1HA5A 3Q3NC 1P9DU 5AZFA 3PRZA 5D94A 2EMSA 3IT4B 2RMMA 4ZDVA 4NY0A 1QILA 3U7ZA 3W1SA 2IO3B 4ZHPA 2DAFA 2PJHA 4K7UA 2BBCA 2GBKA 3L08A 4RGTA 1HTOA 2Y5BB 2MEKA 1J7BA 2L8JA 5BYQA 4ITKA 4II2B 2K1FA 3EECA 1OFFA 2ZPYA 1TKGA 4NZLB 1FNWA 3FC4A 2YVCA 4B9KA 2FUHB 3AB5A 3A33B 4KKIA 1C79A 1L0VB 3RNCC 1IGCA 1NBFC 2JQRB 1C4PA 3DQVA 1IGDA 3QIJA 1PGAA 3RT3B 1NENB 1TKEA 5FKAC 1L2NA 1FM0D 1T0RC 2MA9B 2XK5A 2JPHA 4I6NB 4J3OD 2BW2A 2MWSB 2BPSA 4F7ZA 1T0QC 1JWBD 2MHJA 3AEFB 4WH4A 3ABVB 4FJVB 1AW7A 4LDTB 2OJRA 2D3AA 4WURA 3DWGC 1RWSA 2M17A 2ZVOA 4P1CC 2UYZB 3AI5A 3DVNV 4JWSC 2BT6A 2NVUI 3WAOA 1L7YA 4LNFA 1PDXA 2WXMA 4ZOHC 1F2RI 3HRDD 1GB1A 2R2OA 1HZ6A 3CSFA 2EELA 4F1SA 1XF5L 4KVGB 2FCNA 1QQRA 4BKTA 2VZKB 1WRDB 2LJIA 3RNAC 1E8XA 3R7RA 1BMLC 4K3CA 4WAAA 3L17A 1UWMA 3R66C 2PE6B 1STEA 1S3SG 3NG0A 1WX8A 4LLGM 1CJEA 4AP4C 1AN8A 3WIMA 1WXAA 2QIEB 1XXGA 3TEXA 3C19A 2PIAA 4ANUA 1U4AA 3AULA 1L0YB 4HVBA 4KKJA 4MJSB 3PLVA 1E10A 2SAKA 1WZ0A 1WX9A 1LO5D 2KWDA 2D5GA 3AE8B 3Q3MC 4WJNA 3V6CB 4AQ7A 3BK1A 2QC8A 2LVOA 3CWIA 4FBJB 2BB5A 3AE3B 4OVVA 1V97A 1MHXA 4KGRA 4PS8A 3T3OA 4REZA 1ET6A 4NPNA 1I7HA 1TZ1A 4RNAA 3H7SA 3UI3A 4TKNA 2AX5A 5LLIA 4P6VF 5D7GA 5EDSA 4FHJA 2A4ZA 3I57A 1I42A 1ESFA 5G5HA 1VZ6A 3B0AA 3SFDB 4HDOA 4ACFA 4HJGE 5E6OA 4FA6A 3M95A 4W9KA 2ASQA 1FEHA 2LRUA 3Q8FA 5C1ZA 1WR6E 3MC0B 1RFKA 3VUWA 3KUDB 4TQ0A 1QLBB 2LI5A 2M56B 3H6NA 1TS3A 1BT0A 3M63B 1Y56A 4JQWC 1YQ3B 3K9PB 3HM3A 1WM2A 3KWLA 1FRRA 1N63A 5JZEB 1EF5A 2HTME 4GSWA 3ZTDA 3HVZA 1UGMA 1E7PB 3L4PA 3W1YA 4KGTA 4DQOC 2JRIB 4CQNA 3A9JA 3BINA 2ZCBA 2LWPA 2J42A 3MC8A 4KDIC 4NQLB 2C7NB 3DVNU 1GUAB 5IN7A 4GLSC 3AEEB 1WGRA 3QX1A 1FFVA 3QARA 4RF1A 3MFGA 2KVRA 3HHMA 1F77A 3APCA 4ZRIA 2QDFA 4JPSA 4WQMA 4B0EA 1V1PB 1Y8RC 5C23A 3QWZB 3A1QA 4KZCA 4N6EB 4MELA 1RYJA 3ZJUA 4RF0A 1TIFA 2WQYB 1WM3A 1R4NB 1D5MC 4OZAA 1VDVA 5IO9A 2ONQA 1YN3A 2BKFA 1HEZE 3IXSA 2WWZA 4AWJA 3IT6B 2RR9A 4N58A 1QOAA 4F8CB 1E8YA 2DWQA 2FUG1 2K8CA 4KSLC 3C8YA 1WJ6A 4IWOA 2NPTA 3A4SC 1VD2A 2M19A 1RAXA 2DAJA 1F9JA 1A5RA 1X1MA 3IBEA 3R2IA 3ZQ4A 2L32A 4IM3A 1EU4A 2MP2B 2QSDA 3U8ZA 2WXHA 3IAM1 1CQVA 3QCAA 1I4PA 1OTRB 1YJIA 4AS1A 3TSSA 3H8HA 2FCSA 2GOWA 4M02A 4EZLA 3ETRA 3ZNID 2K0PA 4MSQB 1N61A 1J8CA 1JWAD 2XN9C 4BBNF 3NVVA 1T0YA 3PVLA 1UNSA 1IYFA 2KX0A 5FR3A 5IAAC 4AUQC 4P16A 1P98A 4GOCA 2DZKA 1FCCC 1SJHD 3TJPA 1Q1OA 2FNJB 1R7SA 1OQQA 3B1LX 2OJWA 1LQBA 3VRBB 2KT7A 3P4PB 2W82A 2O6VD 3U52E 1GC6A 4FULA 1SE4A 3KLSX 2KYWA 1V6EA 4W9IA 2MJDA 2MCNB 5KHQA 1WJUA 4W9LA 3VAWA 3EFUA 4G50A 4KZ0A 4WWOA 2FCMA 5TSSA 4Q2JA 1DOIA 3RNFC 2RSUA 4G11A 1L0XB 5G5GA 4CO7A 2C7HA 1K50A 5G55A 2CU1A 1WGDA 4HWIB 2O6VA 1C78A 4A8XC 3EGRA 1R4MI 5HFYA 5LNK1 2W3SA 3H9DA 2GI9A 4DHJB 3S2AA 3SFEB 4IC7B 4DDID 3PTFC 4MH0E 2LMCA 4O1NA 3A9KB 1I4RA 1E90A 2X38A 1GPXA 4EZJA 1KLVA 3BVZA 4BFRA 3AE2B 1YX6B 2KDIA 2E6XA 1C1YB 3SD5A 2E3TA 5HHDG 3WA0A 2CS4A 1QOBA 2YEPB 2N4FA 1V2YA 3Q8CA 3O13A 4L23A 2JXTA 2JX5A 3APDA 2WXRA 2NBVB 5AUIA 2D3BA 1QKZA 4ARCA 2MJEA 2QCZA 1MG4A 2M4NA 1GG3A 4YTPB 1ZDXA 3I63C 1VJKA 3V61A 1WXQA 2BTEA 4PT5A 1N5WA 3JSVB 1PUTA 3RI7C 1YJ1A 2LASA 3TCAA 5J18A 2FIDA 3K9OB 4MGZE 2KC2A 4MGKE 4ZRJA 3TMPB 5BYSA 3P1MA 4GDLA 2KDBA 2CR5A 2KMMA 3AU5A 3OLMD 4DDGD 2KJRA 4W9EA 2W55A 1ACCA 2XBBC 5TR5A 3O65B 2BF8B 4E74A 2PTLA 1WZ3A 3TEYA 3WAMA 1ZXIA 1ET9A 1ZE3D 1FMAD 3IFWB 2HDEA 2K25A 2AEHA 5IKCM 1OQRA 5FK9C 2WX1A 4L2YA 1L6VA 3ZNHB 2KO3A 3AN1A 1XD3B 1V49A 2D10A 3PPAA 2CHXA 2FAZA 3W9CB 2J0JA 2IDYA 1CMXB 2G3QB 4K3BA 1UD7A 2GBJA 3EUB2 4PS7A 2KANA 3QJZA 4LDTD 2HD5B 3LYYA 4XDDA 5DPRA 1JWMD 4YSZB 1HXYD 3LJ3A 3MP9A 1T3QA 2KLGA 2PKOA 3PGEA 2NBUA 3VH4B 2IJ0A 2INNE 1WXMA 3PZ7A 2JVCA
chains in the Genus database with same CATH topology
2KWDA 1YJJA 2D5GA 3AE8B 4GDKB 3VR8B 1XLNA 4L1BA 1D4BA 4AQ7A 3BIID 1K51A 3AE5B 2LEKA 2WDRB 3KWVA 2V0GA 3BK1A 2K22A 2LGIA 4OHJA 2NMQA 3CWIA 2BB5A 1E6EB 2WNMA 3AE3B 1V97A 1MHXA 1YMHE 4KGRA 3T3NA 4ZYSA 4REZA 3B2FA 3R8BA 3T3OA 3BYTB 1ET6A 1ZOYB 2VZKD 3BVGA 1I7HA 2LHEA 4YSXB 4RNAA 3IAS1 3UI3A 1JWSD 3P4RB 5C3JB 1D5ZC 5HI1A 1NI3A 3I9V1 2JZPA 5BMIA 5BMHA 1SIJA 2AX5A 4DXGA 4P6VF 4US9A 1SE2A 3SEBA 1L4DB 1TZOA 2KACA 1SXTA 1TJEA 1ZPSA 2YEPF 5D7GA 5EE1A 1SJED 4XWTA 3I57A 2QMTA 1ESFA 3V05A 4D2KA 2Q5WD 5MPOA 1SEBD 3J9CA 4A55A 3HUIA 5G5HA 1VZ6A 3SFDB 4RFBA 2KDMA 4IKGA 2CU3A 2GB1A 1WWTA 4HJGE 1SE3A 2L52A 4TMAB 3P4SB 1FEHA 1FXIA 3Q8FA 4A90A 4HROA 3NVYA 2AQ1B 3MC0B 1RFKA 3GP7A 4XDCA 1P7FA 4TQ0A 1QLBB 1XEEA 3AEAB 3RPFC 1TS2A 2H89B 2J53A 2M56B 1Q10A 1KRHA 1XO3A 3CIRB 3NVWA 1TS3A 1TS4A 1Y56A 1YQ3B 1L5PA 2RPVA 3AV8A 3FILA 2PW9A 3N9YC 4JX1C 2K5PA 3TEWA 3KWLA 1FRRA 1N63A 1C4CA 1KF6B 1NYRA 2HTME 1T5XD 3HVZA 2ON8A 3Q8BA 2PVOD 2J4XA 2IGDA 1FO4A 1E7PB 3L4PA 4KGTA 4DQOC 4HKZE 5AUKA 4CQNA 4C7ZA 4OVZA 2ICIA 1FIQA 1C4AA 2V3PA 2LFIA 1FNVA 2J52A 2WU5B 2J42A 2H88B 1UWXA 1DOYA 2WXQA 2WXLA 2L83A 1M4VA 1D5XC 2BS3B 2SEBD 1C9FA 3BWUD 4WWMA 2B76B 1XCQL 1XLQA 4GLSC 3AEEB 1L6UA 4B0MA 2PLPA 1FFVA 3Q8EA 4RF1A 3MFGA 4KX6B 1N60A 1F77A 1XLPA 2KAJA 2K3UA 3R2TA 3ZYYX 1NYQA 2QJLA 4JPSA 4WQMA 3BVMA 4B0EA 1V1PB 5E6JA 1WGKA 2WXNA 4GDLB 3AEDB 3URYA 1FRDA 2BB6A 2WXGA 1HZ5A 4MH8A 4N6EB 2JWUA 1QT9A 1RYJA 3ZJUA 4RF0A 2DBYA 2IGGA 2L1AA 2WQYB 4TQ1A 2INPE 2V3NA 1NEKB 3E56A 1D5MC 1E9MA 1N62A 4OZAA 4FXCA 1VDVA 3AEGB 1EWYC 1JW9D 2ONQA 1YN3A 1FD6A 3IXSA 1HEZE 2FE8A 3AE4B 3AMZA 3HVDA 3IT6B 4N58A 3AE9B 2EKIA 1JCKB 1QOAA 2NTTA 2Y3AA 1SSNA 2PMVA 2Z8LA 1JRPA 2DWQA 2FUG1 1TY2A 1I4HA 3C8YA 4HRSA 4WIPA 5GXGB 4MACA 1K52A 4MT5A 4HEA1 1B9RA 1QOFA 3BK2A 4DXFA 2M19A 2KQ4X 1IBXB 1KFYB 1YN4A 3VR9B 1T6BX 1CK1A 1CZPA 1ENFA 4OZCA 3GB1A 1UUPA 3EA6A 2RDHA 3R2IA 3ZQ4A 3ZJVA 2L32A 1ZP0B 1EU4A 2CJNA 2QSDA 2WXHA 1MVKA 1CQVA 3IAM1 4YWGG 1EU3A 1I4PA 2DYMA 1YJIA 1TY0A 3W5VB 5T8IA 4AS1A 1GAQB 3TSSA 1GB4A 2GRIA 1PYWD 4MM3B 1PGBA 3H8HA 3PO0A 1J7AA 3ETRA 1I4XA 2K0PA 1K53A 1N61A 1JWAD 3WCQA 2XN9C 3ZJTA 1SF0A 3NZ3A 3NVVA 1UNSA 3AH7A 4A6QA 2ACZB 1VLBA 5FR3A 5C2TB 4IOIE 1FNUA 3Q69A 3AE1B 4P16A 4USAA 1HQRD 2AQ2B 2K9XA 4RH6A 4US8A 1PFDA 3AE7B 2IGHA 1TS5A 2G9HD 1QOGA 1FCCC 4KGSA 1JMLA 1SJHD 1V1PA 1VZ8A 4M0WA 1R7SA 1OQQA 2N9KA 2WDQB 4YSYB 3MJ5A 1QF6A 1E0ZA 2WXJA 1C76A 3VRBB 3P4PB 1RM6C 1DGJA 2W82A 5D3DA 3U52E 1PGXA 2AQ3B 3NUHB 4LK0M 1SE4A 3KLSX 3AECB 1EM7A 4ZHOA 2BYTA 2MJDA 1VRAB 2N7JA 4LTUA 1L4ZB 1N5XA 4YTNB 1DYQA 1F2RC 2WXKA 1WYGA 3NRZA 2MH7A 2CJOA 5H8YE 2ZW1A 4C7YA 1KH0A 2M0AA 2WDVB 4R3DA 1V8CA 1WRIA 5TSSA 4OZBA 3ZGZA 1DOXA 4Q2JA 1IBXA 1DOIA 3RFZB 4OW0A 1L0XB 2KN4A 5G5GA 3P42A 3FAHA 1MI0A 1XCTL 1K50A 3AE6B 4EE2A 2LHDA 5D3IB 4A8XC 1C78A 2QILA 3EGRA 1D6EC 3B9JA 5HFYA 2WXFA 5LNK1 2DYOA 3FILB 2W3SA 5BYRA 2GI9A 1TKYA 1B1ZA 2N9LA 5EE9A 1KTKA 2QEJC 4UDUC 4JWUC 3KQ4A 3SFEB 3LB8C 4NAMA 3U2SC 4O1NA 2LMCA 2WU2B 1I4RA 2PVGC 1HA5A 3TEZA 2X38A 1GPXA 2Y5PA 1ROEA 4HKQA 3BVZA 1I4QA 3IT4B 2RMMA 1WSPA 3AE2B 2BS2B 2E6XA 2WS3B 1QILA 2E3TA 4JE3B 5HHDG 4ZRPA 3U7ZA 3W1SA 1BXTA 1IUEA 2V4IB 1QOBA 1KLGD 4ZHPA 1FXAA 2WP9B 1JALA 2YEPB 2BBCA 1FCLA 1VR9A 2ZW0A 3Q8CA 3O13A 2I38A 5EE0A 4RGTA 2DLBA 4L23A 3NVZA 2JXTA 2JX5A 3VRAB 3AEBB 3V3XA 2WXRA 3P4QB 2JYTA 2MEKA 3Q8AA 2JYEA 1J7BA 5AUIA 5BYQA 2OEDA 3W5UB 4ITKA 1QKZA 4ARCA 2MJEA 3W2DA 1OFFA 1MHHE 4NAWB 2RDGA 1BUIC 2WLBA 1TKGA 4NZLB 2W3RA 1FNWA 3FC4A 1YQ4B 1V1OA 2Y5CA 1AYFA 3AB5A 4YTPB 1ZDXA 4C80A 4KKIA 1C79A 1VJKA 1WXQA 1L0VB 2BTEA 2WXIA 4PT5A 1IGCA 2JQRB 3B2GA 1N5WA 4YTMB 1PUTA 1C4PA 1P7EA 4N59A 1IGDA 3DWMA 1PGAA 1NENB 1TKEA 5FKAC 5EE3A 1SBBB 1FM0D 1KLUD 2BS4B 3AM9A 4J3OD 2BW2A 4A9AA 4XE0A 3MHZA 1F0ZA 1JWUD 1XLOA 1J7CA 3SR6A 1JWBD 1ZXHA 2NTSA 5H92C 3AEFB 4WH4A 3NS1A 3ABVB 5BYSA 2WXPA 3P1MA 1YNTE 1AW7A 2KMMA 4WURA 2W54A 4WAFA 2R61A 3DWGC 1RWSA 2W55A 1JQ4A 4YXDB 1ACCA 1FFUA 3TUOA 5JXVA 2OHFA 1I4GA 1C77A 1EWCA 2TSSA 3OWEB 4JWSC 2PTLA 2IPKD 3TEYA 2BT6A 3PZ8A 5I4DA 4XWWA 1ZXIA 1ET9A 1ZE3D 1FMAD 2HDEA 2G1EA 1PDXA 2WXMA 4H2AA 1YN5A 1AWDA 4RGOS 4ZOHC 1TYGB 1F2RI 3HRDD 1SB3C 1GB1A 1HZ6A 1OQRA 5FK9C 2EELA 1XF5L 4ZRQA 4L2YA 1L6VA 1QQRA 1UGJA 4RGNA 2JSVX 5BMGA 3VQIA 3BYYB 3AN1A 2VZKB 2I2YA 2LJIA 4ARIA 1BMLC 1UWMA 3GS2A 1NVID 1STEA 4NJCA 2LUMA 3W9CB 2IDYA 1ZDVA 4LLGM 4RGMA 1CJEA 1A70A 3P63A 3EUB2 4C56C 1VZ7A 1AN8A 3LYYA 1MPEA 4TSSA 4XDDA 5HG2A 2QIEB 1XXGA 3TEXA 1JWMD 1ZUD2 2N0SB 2PIAA 2WXOA 4YSZB 1HXYD 4YT0B 2JU6X 1L0YB 3MP9A 1T3QA 1JROA 2FBWB 2PKOA 4KKJA 3U4EG 1E10A 2SAKA 3E9SA 2MJ3A 2IJ0A 2XNAC 3LXFA 3BZDB 2INNE 4IDIA 1GOZA 3PZ7A 4RCOA 1LO5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDQ B;  1XLP A;  1YJJ A;  3AB5 A;  4YTP B;  3AE8 B;  4YSY B;  4C80 A;  2KAJ A;  1VJK A;  1QF6 A;  1WXQ A;  1L0V B;  1XLN A;  3VR8 B;  1NYQ A;  2QJL A;  3ZYY X;  3VRB B;  1E0Z A;  4WQM A;  2JQR B;  3B2G A;  3BII D;  1N5W A;  3AE5 B;  3P4P B;  1PUT A;  1RM6 C;  2LEK A;  1DGJ A;  2WDR B;  4YTM B;  2K22 A;  1WGK A;  4KX6 B;  4N59 A;  3DWM A;  3AED B;  1FRD A;  1NEN B;  3CWI A;  1TKE A;  3AEC B;  5EE3 A;  4N6E B;  1E6E B;  1FM0 D;  1QT9 A;  1RYJ A;  3AE3 B;  4ZHO A;  2BS4 B;  2DBY A;  2MJD A;  2WQY B;  3AM9 A;  1V97 A;  4A9A A;  4LTU A;  1NEK B;  3B2F A;  1N62 A;  1E9M A;  1N5X A;  4YTN B;  4FXC A;  1ZOY B;  1VDV A;  1F0Z A;  1I7H A;  1WYG A;  1XLO A;  3AEG B;  1EWY C;  4YSX B;  3NRZ A;  1J7C A;  1JW9 D;  1JWB D;  3SR6 A;  2MH7 A;  5H92 C;  3P4R B;  5C3J B;  3AEF B;  3NS1 A;  2CJO A;  1NI3 A;  3ABV B;  3AE4 B;  5H8Y E;  3P1M A;  4C7Y A;  2WDV B;  3AMZ A;  1V8C A;  1WRI A;  4N58 A;  1SIJ A;  2AX5 A;  2EKI A;  2KMM A;  1QOA A;  3AE9 B;  4P6V F;  4US9 A;  2W54 A;  1JRP A;  1DOX A;  3DWG C;  1RWS A;  2DWQ A;  2W55 A;  1TJE A;  1DOI A;  1JQ4 A;  4YXD B;  1FFU A;  5EE1 A;  4HRS A;  2OHF A;  5GXG B;  5G5G A;  2Q5W D;  5MPO A;  1B9R A;  3FAH A;  3HUI A;  1QOF A;  5G5H A;  4JWS C;  3AE6 B;  3SFD B;  2M19 A;  2CU3 A;  1WWT A;  3B9J A;  1KFY B;  3VR9 B;  2BT6 A;  2L52 A;  3P4S B;  1ZXI A;  2W3S A;  1FMA D;  1CZP A;  1FXI A;  2G1E A;  1TKY A;  3NVY A;  1PDX A;  4HRO A;  5EE9 A;  1ZP0 B;  2CJN A;  1AWD A;  1RFK A;  4ZOH C;  1TYG B;  4JWU C;  3HRD D;  1SB3 C;  1QLB B;  3AEA B;  1OQR A;  3LB8 C;  3RPF C;  3SFE B;  2H89 B;  2M56 B;  1XO3 A;  1KRH A;  3NVW A;  3CIR B;  1YJI A;  3W5V B;  2WU2 B;  1GAQ B;  1L6V A;  2PVG C;  1GPX A;  1ROE A;  1YQ3 B;  1L5P A;  3AV8 A;  3AN1 A;  4JX1 C;  2K5P A;  3PO0 A;  3KWL A;  1J7A A;  1FRR A;  1N63 A;  2Y5C A;  1KF6 B;  3ETR A;  3AE2 B;  2BS2 B;  1N61 A;  1UWM A;  1JWA D;  3WCQ A;  1NYR A;  2HTM E;  2WS3 B;  2E3T A;  1SF0 A;  3HVZ A;  1NVI D;  2PVO D;  3W9C B;  1FO4 A;  3NVV A;  1E7P B;  3AH7 A;  3L4P A;  1IUE A;  2ACZ B;  1CJE A;  1QOB A;  1VLB A;  5AUK A;  4ZHP A;  1A70 A;  1FXA A;  2WP9 B;  3EUB 2;  3P63 A;  1FIQ A;  1JAL A;  5C2T B;  4C7Z A;  2WU5 B;  5EE0 A;  2H88 B;  1DOY A;  3AE1 B;  2QIE B;  2L83 A;  3NVZ A;  2JX5 A;  4USA A;  2BS3 B;  3VRA B;  3AEB B;  3P4Q B;  1ZUD 2;  2N0S B;  2PIA A;  1J7B A;  5AUI A;  2K9X A;  4YSZ B;  1PFD A;  4US8 A;  3AE7 B;  4YT0 B;  3W5U B;  4WWM A;  2B76 B;  1T3Q A;  1JRO A;  1QOG A;  2FBW B;  1XLQ A;  2PKO A;  4ITK A;  2MJE A;  1OFF A;  1E10 A;  3AEE B;  2MJ3 A;  3LXF A;  2WLB A;  1L6U A;  1TKG A;  2W3R A;  4IDI A;  1FFV A;  3FC4 A;  1YQ4 B;  1R7S A;  1OQQ A;  1AYF A;  1N60 A; 
#chains in the Genus database with same CATH topology
 2I1J A;  3EC8 A;  1OQY A;  3VR8 B;  4A20 A;  1ISN A;  4EEW A;  1K51 A;  2KTF A;  3AE5 B;  1ZW7 A;  3X23 A;  2LGI A;  2BYF A;  3EFC A;  1WJ4 A;  5LXH A;  4PYU A;  1E6E B;  4P1B C;  2WNM A;  1WR1 A;  4JLC A;  3B2F A;  2VZK D;  1ZOY B;  5CTR C;  2KMC A;  2LHE A;  1LM8 B;  2V3S A;  4GN1 A;  5HI1 A;  1NI3 A;  3DDC B;  4DXG A;  1SE2 A;  3SEB A;  1EF1 A;  3AXC A;  2KQS A;  4MGI E;  2KAC A;  4URK A;  4BZA A;  4XWT A;  3PHX B;  3V05 A;  1SEB D;  4W9C A;  2KDM A;  4IKG A;  3RZW C;  4MSM B;  3ZXV A;  1FXI A;  4A90 A;  1P1A A;  1Q0W B;  2KDE B;  2H89 B;  1Q10 A;  1XO3 A;  2GLS A;  4ANX A;  3APF A;  3AV8 A;  3N9Y C;  1PQS A;  2C7M B;  3D32 A;  4IWQ A;  3RN9 C;  4A3P A;  1NYR A;  3Q6B A;  4LJO B;  3Q8B A;  3TL5 A;  4IW0 A;  4HKZ E;  4M00 A;  4OVZ A;  2MW5 A;  2DHZ A;  1C4A A;  2LFI A;  2J52 A;  4MJS A;  1UWX A;  1DOY A;  1M4V A;  1D5X C;  1WH3 A;  4KV2 A;  2SEB D;  3T8M A;  2MBO A;  4WWM A;  4BOZ B;  1XT9 B;  4B0M A;  2XEW A;  3ZW3 A;  2JUO A;  2XK5 B;  2KAJ A;  2K3U A;  2IZV B;  2DX5 B;  3ZYY X;  2HE7 A;  3BVM A;  1I35 A;  3L0W B;  4FJZ A;  1WGK A;  1WIA A;  4M0W B;  3VXW A;  4NAW A;  3URY A;  4IM0 A;  1R4M B;  3H1U A;  3GZN I;  3GE3 C;  2IGG A;  4TQ1 A;  1RFA A;  1GNU A;  1NEK B;  3AEG B;  5DPW A;  1WXV A;  1FD6 A;  1MG8 A;  3DBL B;  3MJW A;  2LRW A;  3AMZ A;  2GBM A;  2KTR A;  4HPM B;  3AE9 B;  1JCK B;  1NI2 A;  5DPT A;  3PHW B;  2PMV A;  3IG3 A;  2KQ7 A;  1P0R A;  1TY2 A;  4WIP A;  1B9R A;  3PT2 B;  3KYC D;  4YL8 A;  4AOF A;  4K7S A;  1IBX B;  3V6E B;  5JHA A;  1CK1 A;  1CZP A;  2KLC A;  4OZC A;  3EA6 A;  2CJN A;  2L7R A;  2KWC A;  3W5V B;  2M0X A;  5T8I A;  4M01 A;  1PYW D;  1PGB A;  2LZ6 A;  3ALB A;  1FXT B;  4K81 A;  2MBQ A;  2MBE A;  4JGH B;  1K53 A;  3NZ3 A;  4B6W A;  3OJ4 B;  3AH7 A;  1IPG A;  5C2T B;  1TGZ B;  1H4R A;  2ZEQ A;  4HLE A;  2K9X A;  4HPP A;  4RH6 A;  4G0N B;  4CHK A;  2G9H D;  2K39 A;  2V1Y A;  1JML A;  4GXB A;  1V1P A;  4C4V B;  2DNF A;  2JZZ A;  2KX3 A;  5E6N A;  3JYU A;  1C76 A;  1RM6 C;  3NJT A;  3WAP A;  5D3D A;  1YQB A;  1PGX A;  4LK0 M;  2EMT A;  1HTQ A;  2BYT A;  1V5O A;  2LD9 A;  4GDK A;  3VUX A;  1WYG A;  5HKH A;  2DZM A;  2IO0 B;  4RM8 A;  2CJO A;  3IVF A;  2ZW1 A;  1V8C A;  2KXJ A;  3ZGZ A;  3VFK A;  2N9X A;  2Z0D B;  1DOX A;  3V60 A;  3RFZ B;  2ZZP B;  4OW0 A;  4FHK A;  3QAQ A;  3AE6 B;  2MP2 A;  4LCD E;  2QIL A;  2CKH B;  3ZNG C;  1B1Z A;  2N9L A;  1KTK A;  2VRR B;  5GMV A;  3U2S C;  2WU2 B;  2Y5P A;  4KIK B;  4XC2 A;  1I4Q A;  2JZ3 B;  2WS3 B;  4G3X B;  4ANW A;  1GJZ A;  2WGS A;  1V80 A;  4K7W A;  4ZRP A;  1BXT A;  5CX3 A;  3VDZ A;  1KLG D;  2GBR A;  2WP9 B;  3Q3J A;  2BYE A;  5DCN A;  1VR9 A;  2ZW0 A;  2I38 A;  5EE0 A;  4S0R A;  3VRA B;  3AEB B;  3V3X A;  2JYT A;  3Q8A A;  2JYE A;  4GU2 A;  3W5U B;  3W2D A;  4HDQ A;  1MHH E;  2RDG A;  2WLB A;  3P2B A;  2W3R A;  1YQ4 B;  1V1O A;  2LGS A;  4II3 B;  4C80 A;  1V9J A;  3OJ3 A;  2WXI A;  1KOT A;  4YTM B;  3UIP B;  3ENE A;  4N59 A;  4EZK A;  3DWM A;  2DZJ A;  2BQQ A;  1SBB B;  4XZ4 A;  1KLU D;  2BS4 B;  3AM9 A;  4A9A A;  4XE0 A;  5IP4 D;  4IWP A;  2K6D B;  1XLO A;  1J7C A;  3SR6 A;  1ZXH A;  2C9W B;  2NPT B;  2WXP A;  1WGY A;  1YNT E;  1V5T A;  4HCN B;  1WFY A;  3RNE C;  2W54 A;  5JH5 C;  4A3O A;  1KM7 A;  2V4L A;  1JQ4 A;  3TUO A;  2OHF A;  1I4G A;  5KHO A;  1EWC A;  3OWE B;  2D07 B;  4NJ6 A;  3ZNZ B;  4XWW A;  3A9K A;  4TV3 A;  2G1E A;  2KFK B;  1K8R B;  4RGO S;  2J7Q B;  1TYG B;  1FPY A;  3WAL A;  4XYC A;  3H7P B;  3Q3O C;  1UGJ A;  2OOB B;  2N1V A;  2JSV X;  4RGN A;  3VQI A;  2D3G A;  4J6I A;  2MQJ A;  2I2Y A;  5CHW A;  4ARI A;  3DBH I;  1XQQ A;  4XGA B;  2NCN A;  3R3M A;  4NJC A;  2LUM A;  1V81 A;  3GZN B;  3P63 A;  4C56 C;  1C3T A;  4IUM B;  1MPE A;  1WF9 A;  4TSS A;  1P3Q U;  3DBL I;  1ZUD 2;  2N0S B;  3ZO5 B;  2L05 A;  3MTN B;  4BKS D;  2JU6 X;  5G2N A;  2RD0 A;  1JRO A;  4ZYN A;  4LNI A;  3JSV A;  3E9S A;  2MJ3 A;  3LXF A;  4IDI A;  3KVF B;  1XLN A;  4HCP B;  2KZR A;  2WDR B;  2V0G A;  2K22 A;  4OHJ A;  2IY0 B;  4MEM A;  2NBW B;  3KYD D;  1YMH E;  3ZKJ C;  3RMK C;  3VUY A;  4ZYS A;  3BVG A;  4YSX B;  3IAS 1;  1D5Z C;  4BKS A;  3I9V 1;  5BMI A;  5BMH A;  2O6V B;  1SIJ A;  2KJ6 A;  4LJP B;  3DHI C;  1L4D B;  1WI0 A;  2YEP F;  1TJE A;  2RPQ A;  5EE1 A;  1SJE D;  4WWN A;  2MBH A;  4D2K A;  2JRH A;  2KWV B;  2Q5W D;  4A55 A;  1RLF A;  2CU3 A;  2GB1 A;  1WWT A;  1E5W A;  2L52 A;  5IA7 A;  4TMA B;  2WX0 A;  3ZIM A;  4W9F A;  4HRO A;  3NVY A;  2AQ1 B;  3GP7 A;  2D11 A;  4XDC A;  1XEE A;  3AEA B;  3RPF C;  1TS2 A;  2J53 A;  1E7V A;  4WJO A;  3NVW A;  3CIR B;  2KC1 A;  2KOX A;  1TS4 A;  3U7D A;  1L5P A;  3FIL A;  3GE8 C;  4LNO A;  4JX1 C;  2K5P A;  3KUC B;  2LUE A;  5JHB A;  1C4C A;  3TBL D;  2JXX A;  1T5X D;  2ON8 A;  2PVO D;  2J4X A;  3NY5 A;  4XX5 A;  3PV1 A;  5AUK A;  4M8M A;  4C7Z A;  2ICI A;  3KW5 B;  1FIQ A;  3UGB B;  2WXL A;  2L83 A;  4HJK A;  4FJY A;  2O2V B;  2V9H A;  1WMH B;  3BWU D;  4EOY A;  3SDL C;  1L6U A;  3L16 A;  1TBE A;  3IHP C;  4KX6 B;  2WYQ A;  1N60 A;  5J17 A;  1H8C A;  2QJL A;  3U30 A;  4QAY A;  4FN2 A;  4ANV A;  3Q2A C;  3Q14 C;  4K1R B;  4GDL B;  3AED B;  2BB6 A;  2JWU A;  1M94 A;  2IND C;  3HK0 A;  2DBY A;  1UF0 A;  2L1A A;  4ZRK A;  4JL9 A;  2V3N A;  1WE6 A;  4FXC A;  1EWY C;  1UH6 A;  2Z0E B;  4MDK E;  3ZRC A;  2N9E B;  3AE4 B;  3HVD A;  2IO1 B;  2KNB A;  2NTT A;  5AZH A;  1WGG A;  1JRP A;  4I6L B;  2G4S A;  4HRS A;  2KK8 A;  4MT5 A;  2AL6 A;  4HEA 1;  1QOF A;  3BK2 A;  4DXF A;  1KFY B;  1YN4 A;  5CHV C;  3VR9 B;  3RNB C;  1ENF A;  4PYZ A;  3GB1 A;  1UUP A;  2RDH A;  1WXS A;  3ZJV A;  3R7Q A;  1ZP0 B;  4BVU C;  3CMM B;  4KDL B;  1MVK A;  4YWG G;  2DYM A;  4NNJ B;  1TY0 A;  1GB4 A;  4MM3 B;  3N1X C;  2JT4 B;  5L95 C;  3ML8 A;  1J7A A;  2FCQ A;  2KHW B;  4E3C A;  3WCQ A;  3ZJT A;  1SF0 A;  3RD2 A;  4M8N A;  3L13 A;  3ZRF A;  2YLM A;  4A6Q A;  4DWF A;  1VLB A;  2N7D A;  3A4R A;  3C0R B;  3DPD A;  3Q69 A;  4USA A;  1HQR D;  3TIX A;  2AQ2 B;  3QK0 A;  2IGH A;  1TS5 A;  4WQO B;  1YX5 B;  4WWP A;  1VZ8 A;  4M0W A;  2L0T A;  2CHW A;  4YSY B;  3DBR I;  1E0Z A;  2HTH A;  4HK2 A;  1DGJ A;  3NS8 A;  2J0K A;  2L76 A;  2UU7 A;  3NUH B;  3RZF A;  3ZLZ A;  3AEC B;  1EM7 A;  3DCG A;  3KUZ A;  1L4Z B;  1N5X A;  4YTN B;  1DYQ A;  1WGH A;  2WXK A;  2KVZ A;  1SIF A;  3NRZ A;  2PEA A;  1N6Z A;  5H8Y E;  4C7Y A;  1KH0 A;  2M0A A;  2CHZ A;  4R3D A;  4P7I A;  4DXA B;  3GOE A;  4OZB A;  4WJQ A;  2R2Q A;  1IBX A;  3VTW A;  3DBH B;  3CST A;  3LDZ E;  3PRM B;  2KN4 A;  3P42 A;  1XCT L;  2LHD A;  5D3I B;  3PZD A;  4BAX A;  1D6E C;  3B9J A;  2LVQ A;  2DYO A;  1EUV B;  5L83 A;  4MGY E;  1TKY A;  2MBB B;  2QEJ C;  4UDU C;  1GC7 A;  2NS5 A;  4JWU C;  3LB8 C;  4TUU A;  1IP9 A;  3VTV A;  2PVG C;  5FR6 A;  3TEZ A;  1ROE A;  2K8B A;  3DVG X;  4HKQ A;  2AWT A;  4BKG A;  1WSP A;  2BS2 B;  2LGD A;  3L10 B;  1E8W A;  1RRB A;  4JE3 B;  3PRP B;  3HM6 X;  2AL3 A;  2EKE C;  2KFJ A;  3PS6 A;  1IUE A;  1YD8 U;  2V4I B;  2LXA A;  1FXA A;  1JAL A;  1FCL A;  4NQK E;  2PPH A;  2DLB A;  3NVZ A;  2UWQ A;  2N1W A;  4C4V A;  3P4Q B;  1D3Z A;  2OED A;  3N32 A;  3OAW A;  2W9N A;  3VHT C;  2LJ5 A;  4NAW B;  1BUI C;  4GMV A;  1Q5W B;  2Y5C A;  1AYF A;  2MSE D;  4DHZ B;  3B2G A;  1P7E A;  2KMA A;  1YIW A;  2G4D B;  1UZX B;  3W1S C;  2KTR B;  5DPS A;  2KD0 A;  5EE3 A;  2HJ8 A;  2RDB C;  2L3Z A;  3PRE A;  3MHZ A;  3DHH C;  1F0Z A;  1JWU D;  4AJW A;  2NTS A;  5H92 C;  3NS1 A;  2AYO B;  4WAF A;  2R61 A;  3ZDT A;  3ZVV A;  4YXD B;  1FFU A;  5JXV A;  3X0W A;  1C77 A;  4N9F 4;  2TSS A;  3ZTC A;  2LXC A;  3NZU A;  3N3K B;  4CYE A;  2IPK D;  1AAR A;  3QQ8 B;  3PZ8 A;  5I4D A;  3NHE B;  4KIK A;  1V86 A;  4H2A A;  4PK1 A;  1YN5 A;  1AWD A;  3L54 A;  1SB3 C;  3DHG C;  2KJH B;  4ZRQ A;  3RYT A;  2B3A A;  4ICU A;  5BMG A;  3BYY B;  2PE9 A;  3QHT A;  3N1Z C;  4AJY B;  3GS2 A;  3SU8 X;  2D2Q A;  1NVI D;  2G45 B;  1ZDV A;  3FKY A;  4RGM A;  2I1K A;  1SE9 A;  1A70 A;  1VZ7 A;  4IM2 A;  1WJN A;  5HG2 A;  4GGQ A;  2VH1 A;  3ECI A;  1OEY J;  1F1H A;  2WXO A;  4EKU A;  3DBS A;  4YT0 B;  3A9J B;  2FBW B;  3U4E G;  3UIO B;  3Q3F A;  2XNA C;  3BZD B;  2IBI B;  1GOZ A;  4RCO A;  4RMA A;  1YJJ A;  3M3J A;  4GDK B;  4L1B A;  1D4B A;  3BII D;  1WY8 A;  2LEK A;  3KWV A;  3PSE B;  4JIO U;  4W9D A;  2NMQ A;  2JF5 A;  2BWE S;  2K8H A;  2ZJD A;  3QC8 B;  4KSK C;  2IO2 B;  3DVG Y;  3T3N A;  3UQB A;  3R8B A;  1YOV B;  3A1Q B;  3BYT B;  1J0G A;  5IOI A;  1JWS D;  3P4R B;  5C3J B;  2JZP A;  1WX7 A;  2FIF A;  1ZGU B;  4US9 A;  2M8S A;  4DHJ D;  1OEY A;  1TZO A;  1HE8 A;  1LGR A;  4ICV A;  1SXT A;  1ZPS A;  4EFO A;  3MC9 A;  2QMT A;  3I3T B;  5MPO A;  3J9C A;  3HUI A;  2KFK A;  3UF8 A;  4RFB A;  3B08 A;  3JVZ X;  2M1M A;  2ZPN A;  1SE3 A;  3HIZ A;  3P4S B;  2RGF A;  3H7P A;  2GBN A;  2IYD B;  5J2R A;  1P7F A;  2WHI A;  4LNK A;  1KRH A;  4E71 A;  2KDF B;  3OG5 A;  1KJT A;  2C60 A;  2RPV A;  2PW9 A;  4W9G A;  5AZG A;  3TEW A;  4HPL B;  1KF6 B;  3DBR B;  1QZE A;  3V62 A;  3UQA A;  2WDT B;  3CF6 E;  2IGD A;  1FO4 A;  2Z59 B;  2D3C A;  1NDD A;  3ZDM C;  1Z5S B;  2V3P A;  2NR2 A;  1FNV A;  2WU5 B;  4WJP A;  5LXI B;  2H88 B;  2WXQ A;  5E6P A;  2BS3 B;  1C9F A;  4S17 A;  5D2M B;  2B76 B;  4I6P A;  1XCQ L;  1TTN A;  1XLQ A;  1MJD A;  1E7U A;  1OGW A;  2DYB A;  3N20 C;  3RUL A;  2PLP A;  1WYW B;  1J19 A;  1F52 A;  3KH0 A;  3Q8E A;  1XLP A;  4RM9 A;  1UBI A;  3I5J C;  3R2T A;  2ZNV B;  1NYQ A;  3VTU A;  3AU4 A;  5E6J A;  1SGH A;  2WXN A;  2BWF A;  1FRD A;  2WXG A;  1HZ5 A;  2QHO A;  4MH8 A;  1QT9 A;  2BKR B;  2LGX A;  3QA8 A;  2INP E;  2KN5 A;  2J0M A;  1N62 A;  1E9M A;  3E56 A;  4DBG A;  4OVU A;  2ZVN A;  3WAN A;  1JW9 D;  4DHZ E;  2FE8 A;  3N30 A;  2C5L C;  3ML9 A;  2EKI A;  2Y3A A;  3ZXR A;  1SSN A;  2N7E A;  2Z8L A;  4GB9 A;  2REX A;  1I4H A;  2DEN B;  5CHF A;  5GXG B;  4MAC A;  1K52 A;  2X8X X;  1TT5 B;  3PLU A;  3MHS D;  4BBN C;  2KQ4 X;  3RCZ A;  1LFD A;  1T6B X;  4FLH A;  1LXD A;  3JW0 X;  2L00 B;  2KWU B;  2MX2 A;  4EUT A;  5BO4 B;  1EU3 A;  3UIN B;  1GAQ B;  1E8Z A;  2GRI A;  3PO0 A;  1Z2M A;  3NOB A;  1I4X A;  2JY6 A;  2KKC A;  2BVC A;  2BGF A;  1G6J A;  2DZI A;  4LNN A;  2O2V A;  2ACZ B;  2JWZ A;  1WMH A;  3DOW A;  1ZKH A;  4X57 B;  2BYV E;  4IOI E;  1FNU A;  3AE1 B;  2LVP A;  2L0F A;  3N1Y C;  3T9L A;  4US8 A;  1PFD A;  3AE7 B;  4FAD A;  1QOG A;  4KGS A;  1JRU A;  1UBQ A;  3VH3 B;  2GMI C;  2HJ1 A;  2N9K A;  2WDQ B;  3EHV A;  5D6J B;  2N9P C;  3MJ5 A;  3ONS A;  1QF6 A;  2WXJ A;  4DK5 A;  2A5U A;  4NJ7 A;  1S1Q B;  2ZCC A;  2AQ3 B;  2MRP A;  3ZUN A;  3RNG C;  4B95 A;  4ZHO A;  1UEL A;  1VCB A;  1VRA B;  2N7J A;  4LTU A;  3VVW B;  2K6Q A;  3SHQ A;  1F2R C;  1MFW A;  3RUI B;  2MH7 A;  3NZS A;  2WDV B;  4C00 A;  1WRI A;  2ZNV C;  4BOS C;  4GIV A;  4W9H A;  4HXD A;  3M62 B;  4PS3 A;  2INC C;  2LGY A;  1MI0 A;  3FAH A;  4EE2 A;  5AEK B;  2WXF A;  4IG7 B;  2IY1 B;  1WE7 A;  1EO6 A;  3FIL B;  5BYR A;  3BY4 B;  4MM3 A;  1R4N I;  5EE9 A;  2VH2 A;  4ASW C;  2MLB A;  3KQ4 A;  4W9J A;  1T0S C;  4NAM A;  1HA5 A;  3Q3N C;  1P9D U;  5AZF A;  3PRZ A;  5D94 A;  2EMS A;  3IT4 B;  2RMM A;  4ZDV A;  4NY0 A;  1QIL A;  3U7Z A;  3W1S A;  2IO3 B;  4ZHP A;  2DAF A;  2PJH A;  4K7U A;  2BBC A;  2GBK A;  3L08 A;  4RGT A;  1HTO A;  2Y5B B;  2MEK A;  1J7B A;  2L8J A;  5BYQ A;  4ITK A;  4II2 B;  2K1F A;  3EEC A;  1OFF A;  2ZPY A;  1TKG A;  4NZL B;  1FNW A;  3FC4 A;  2YVC A;  4B9K A;  2FUH B;  3AB5 A;  3A33 B;  4KKI A;  1C79 A;  1L0V B;  3RNC C;  1IGC A;  1NBF C;  2JQR B;  1C4P A;  3DQV A;  1IGD A;  3QIJ A;  1PGA A;  3RT3 B;  1NEN B;  1TKE A;  5FKA C;  1L2N A;  1FM0 D;  1T0R C;  2MA9 B;  2XK5 A;  2JPH A;  4I6N B;  4J3O D;  2BW2 A;  2MWS B;  2BPS A;  4F7Z A;  1T0Q C;  1JWB D;  2MHJ A;  3AEF B;  4WH4 A;  3ABV B;  4FJV B;  1AW7 A;  4LDT B;  2OJR A;  2D3A A;  4WUR A;  3DWG C;  1RWS A;  2M17 A;  2ZVO A;  4P1C C;  2UYZ B;  3AI5 A;  3DVN V;  4JWS C;  2BT6 A;  2NVU I;  3WAO A;  1L7Y A;  4LNF A;  1PDX A;  2WXM A;  4ZOH C;  1F2R I;  3HRD D;  1GB1 A;  2R2O A;  1HZ6 A;  3CSF A;  2EEL A;  4F1S A;  1XF5 L;  4KVG B;  2FCN A;  1QQR A;  4BKT A;  2VZK B;  1WRD B;  2LJI A;  3RNA C;  1E8X A;  3R7R A;  1BML C;  4K3C A;  4WAA A;  3L17 A;  1UWM A;  3R66 C;  2PE6 B;  1STE A;  1S3S G;  3NG0 A;  1WX8 A;  4LLG M;  1CJE A;  4AP4 C;  1AN8 A;  3WIM A;  1WXA A;  2QIE B;  1XXG A;  3TEX A;  3C19 A;  2PIA A;  4ANU A;  1U4A A;  3AUL A;  1L0Y B;  4HVB A;  4KKJ A;  4MJS B;  3PLV A;  1E10 A;  2SAK A;  1WZ0 A;  1WX9 A;  1LO5 D;  2KWD A;  2D5G A;  3AE8 B;  3Q3M C;  4WJN A;  3V6C B;  4AQ7 A;  3BK1 A;  2QC8 A;  2LVO A;  3CWI A;  4FBJ B;  2BB5 A;  3AE3 B;  4OVV A;  1V97 A;  1MHX A;  4KGR A;  4PS8 A;  3T3O A;  4REZ A;  1ET6 A;  4NPN A;  1I7H A;  1TZ1 A;  4RNA A;  3H7S A;  3UI3 A;  4TKN A;  2AX5 A;  5LLI A;  4P6V F;  5D7G A;  5EDS A;  4FHJ A;  2A4Z A;  3I57 A;  1I42 A;  1ESF A;  5G5H A;  1VZ6 A;  3B0A A;  3SFD B;  4HDO A;  4ACF A;  4HJG E;  5E6O A;  4FA6 A;  3M95 A;  4W9K A;  2ASQ A;  1FEH A;  2LRU A;  3Q8F A;  5C1Z A;  1WR6 E;  3MC0 B;  1RFK A;  3VUW A;  3KUD B;  4TQ0 A;  1QLB B;  2LI5 A;  2M56 B;  3H6N A;  1TS3 A;  1BT0 A;  3M63 B;  1Y56 A;  4JQW C;  1YQ3 B;  3K9P B;  3HM3 A;  1WM2 A;  3KWL A;  1FRR A;  1N63 A;  5JZE B;  1EF5 A;  2HTM E;  4GSW A;  3ZTD A;  3HVZ A;  1UGM A;  1E7P B;  3L4P A;  3W1Y A;  4KGT A;  4DQO C;  2JRI B;  4CQN A;  3A9J A;  3BIN A;  2ZCB A;  2LWP A;  2J42 A;  3MC8 A;  4KDI C;  4NQL B;  2C7N B;  3DVN U;  1GUA B;  5IN7 A;  4GLS C;  3AEE B;  1WGR A;  3QX1 A;  1FFV A;  3QAR A;  4RF1 A;  3MFG A;  2KVR A;  3HHM A;  1F77 A;  3APC A;  4ZRI A;  2QDF A;  4JPS A;  4WQM A;  4B0E A;  1V1P B;  1Y8R C;  5C23 A;  3QWZ B;  3A1Q A;  4KZC A;  4N6E B;  4MEL A;  1RYJ A;  3ZJU A;  4RF0 A;  1TIF A;  2WQY B;  1WM3 A;  1R4N B;  1D5M C;  4OZA A;  1VDV A;  5IO9 A;  2ONQ A;  1YN3 A;  2BKF A;  1HEZ E;  3IXS A;  2WWZ A;  4AWJ A;  3IT6 B;  2RR9 A;  4N58 A;  1QOA A;  4F8C B;  1E8Y A;  2DWQ A;  2FUG 1;  2K8C A;  4KSL C;  3C8Y A;  1WJ6 A;  4IWO A;  2NPT A;  3A4S C;  1VD2 A;  2M19 A;  1RAX A;  2DAJ A;  1F9J A;  1A5R A;  1X1M A;  3IBE A;  3R2I A;  3ZQ4 A;  2L32 A;  4IM3 A;  1EU4 A;  2MP2 B;  2QSD A;  3U8Z A;  2WXH A;  3IAM 1;  1CQV A;  3QCA A;  1I4P A;  1OTR B;  1YJI A;  4AS1 A;  3TSS A;  3H8H A;  2FCS A;  2GOW A;  4M02 A;  4EZL A;  3ETR A;  3ZNI D;  2K0P A;  4MSQ B;  1N61 A;  1J8C A;  1JWA D;  2XN9 C;  4BBN F;  3NVV A;  1T0Y A;  3PVL A;  1UNS A;  1IYF A;  2KX0 A;  5FR3 A;  5IAA C;  4AUQ C;  4P16 A;  1P98 A;  4GOC A;  2DZK A;  1FCC C;  1SJH D;  3TJP A;  1Q1O A;  2FNJ B;  1R7S A;  1OQQ A;  3B1L X;  2OJW A;  1LQB A;  3VRB B;  2KT7 A;  3P4P B;  2W82 A;  2O6V D;  3U52 E;  1GC6 A;  4FUL A;  1SE4 A;  3KLS X;  2KYW A;  1V6E A;  4W9I A;  2MJD A;  2MCN B;  5KHQ A;  1WJU A;  4W9L A;  3VAW A;  3EFU A;  4G50 A;  4KZ0 A;  4WWO A;  2FCM A;  5TSS A;  4Q2J A;  1DOI A;  3RNF C;  2RSU A;  4G11 A;  1L0X B;  5G5G A;  4CO7 A;  2C7H A;  1K50 A;  5G55 A;  2CU1 A;  1WGD A;  4HWI B;  2O6V A;  1C78 A;  4A8X C;  3EGR A;  1R4M I;  5HFY A;  5LNK 1;  2W3S A;  3H9D A;  2GI9 A;  4DHJ B;  3S2A A;  3SFE B;  4IC7 B;  4DDI D;  3PTF C;  4MH0 E;  2LMC A;  4O1N A;  3A9K B;  1I4R A;  1E90 A;  2X38 A;  1GPX A;  4EZJ A;  1KLV A;  3BVZ A;  4BFR A;  3AE2 B;  1YX6 B;  2KDI A;  2E6X A;  1C1Y B;  3SD5 A;  2E3T A;  5HHD G;  3WA0 A;  2CS4 A;  1QOB A;  2YEP B;  2N4F A;  1V2Y A;  3Q8C A;  3O13 A;  4L23 A;  2JXT A;  2JX5 A;  3APD A;  2WXR A;  2NBV B;  5AUI A;  2D3B A;  1QKZ A;  4ARC A;  2MJE A;  2QCZ A;  1MG4 A;  2M4N A;  1GG3 A;  4YTP B;  1ZDX A;  3I63 C;  1VJK A;  3V61 A;  1WXQ A;  2BTE A;  4PT5 A;  1N5W A;  3JSV B;  1PUT A;  3RI7 C;  1YJ1 A;  2LAS A;  3TCA A;  5J18 A;  2FID A;  3K9O B;  4MGZ E;  2KC2 A;  4MGK E;  4ZRJ A;  3TMP B;  5BYS A;  3P1M A;  4GDL A;  2KDB A;  2CR5 A;  2KMM A;  3AU5 A;  3OLM D;  4DDG D;  2KJR A;  4W9E A;  2W55 A;  1ACC A;  2XBB C;  5TR5 A;  3O65 B;  2BF8 B;  4E74 A;  2PTL A;  1WZ3 A;  3TEY A;  3WAM A;  1ZXI A;  1ET9 A;  1ZE3 D;  1FMA D;  3IFW B;  2HDE A;  2K25 A;  2AEH A;  5IKC M;  1OQR A;  5FK9 C;  2WX1 A;  4L2Y A;  1L6V A;  3ZNH B;  2KO3 A;  3AN1 A;  1XD3 B;  1V49 A;  2D10 A;  3PPA A;  2CHX A;  2FAZ A;  3W9C B;  2J0J A;  2IDY A;  1CMX B;  2G3Q B;  4K3B A;  1UD7 A;  2GBJ A;  3EUB 2;  4PS7 A;  2KAN A;  3QJZ A;  4LDT D;  2HD5 B;  3LYY A;  4XDD A;  5DPR A;  1JWM D;  4YSZ B;  1HXY D;  3LJ3 A;  3MP9 A;  1T3Q A;  2KLG A;  2PKO A;  3PGE A;  2NBU A;  3VH4 B;  2IJ0 A;  2INN E;  1WXM A;  3PZ7 A;  2JVC A; 
#chains in the Genus database with same CATH homology
 2KWD A;  1YJJ A;  2D5G A;  3AE8 B;  4GDK B;  3VR8 B;  1XLN A;  4L1B A;  1D4B A;  4AQ7 A;  3BII D;  1K51 A;  3AE5 B;  2LEK A;  2WDR B;  3KWV A;  2V0G A;  3BK1 A;  2K22 A;  2LGI A;  4OHJ A;  2NMQ A;  3CWI A;  2BB5 A;  1E6E B;  2WNM A;  3AE3 B;  1V97 A;  1MHX A;  1YMH E;  4KGR A;  3T3N A;  4ZYS A;  4REZ A;  3B2F A;  3R8B A;  3T3O A;  3BYT B;  1ET6 A;  1ZOY B;  2VZK D;  3BVG A;  1I7H A;  2LHE A;  4YSX B;  4RNA A;  3IAS 1;  3UI3 A;  1JWS D;  3P4R B;  5C3J B;  1D5Z C;  5HI1 A;  1NI3 A;  3I9V 1;  2JZP A;  5BMI A;  5BMH A;  1SIJ A;  2AX5 A;  4DXG A;  4P6V F;  4US9 A;  1SE2 A;  3SEB A;  1L4D B;  1TZO A;  2KAC A;  1SXT A;  1TJE A;  1ZPS A;  2YEP F;  5D7G A;  5EE1 A;  1SJE D;  4XWT A;  3I57 A;  2QMT A;  1ESF A;  3V05 A;  4D2K A;  2Q5W D;  5MPO A;  1SEB D;  3J9C A;  4A55 A;  3HUI A;  5G5H A;  1VZ6 A;  3SFD B;  4RFB A;  2KDM A;  4IKG A;  2CU3 A;  2GB1 A;  1WWT A;  4HJG E;  1SE3 A;  2L52 A;  4TMA B;  3P4S B;  1FEH A;  1FXI A;  3Q8F A;  4A90 A;  4HRO A;  3NVY A;  2AQ1 B;  3MC0 B;  1RFK A;  3GP7 A;  4XDC A;  1P7F A;  4TQ0 A;  1QLB B;  1XEE A;  3AEA B;  3RPF C;  1TS2 A;  2H89 B;  2J53 A;  2M56 B;  1Q10 A;  1KRH A;  1XO3 A;  3CIR B;  3NVW A;  1TS3 A;  1TS4 A;  1Y56 A;  1YQ3 B;  1L5P A;  2RPV A;  3AV8 A;  3FIL A;  2PW9 A;  3N9Y C;  4JX1 C;  2K5P A;  3TEW A;  3KWL A;  1FRR A;  1N63 A;  1C4C A;  1KF6 B;  1NYR A;  2HTM E;  1T5X D;  3HVZ A;  2ON8 A;  3Q8B A;  2PVO D;  2J4X A;  2IGD A;  1FO4 A;  1E7P B;  3L4P A;  4KGT A;  4DQO C;  4HKZ E;  5AUK A;  4CQN A;  4C7Z A;  4OVZ A;  2ICI A;  1FIQ A;  1C4A A;  2V3P A;  2LFI A;  1FNV A;  2J52 A;  2WU5 B;  2J42 A;  2H88 B;  1UWX A;  1DOY A;  2WXQ A;  2WXL A;  2L83 A;  1M4V A;  1D5X C;  2BS3 B;  2SEB D;  1C9F A;  3BWU D;  4WWM A;  2B76 B;  1XCQ L;  1XLQ A;  4GLS C;  3AEE B;  1L6U A;  4B0M A;  2PLP A;  1FFV A;  3Q8E A;  4RF1 A;  3MFG A;  4KX6 B;  1N60 A;  1F77 A;  1XLP A;  2KAJ A;  2K3U A;  3R2T A;  3ZYY X;  1NYQ A;  2QJL A;  4JPS A;  4WQM A;  3BVM A;  4B0E A;  1V1P B;  5E6J A;  1WGK A;  2WXN A;  4GDL B;  3AED B;  3URY A;  1FRD A;  2BB6 A;  2WXG A;  1HZ5 A;  4MH8 A;  4N6E B;  2JWU A;  1QT9 A;  1RYJ A;  3ZJU A;  4RF0 A;  2DBY A;  2IGG A;  2L1A A;  2WQY B;  4TQ1 A;  2INP E;  2V3N A;  1NEK B;  3E56 A;  1D5M C;  1E9M A;  1N62 A;  4OZA A;  4FXC A;  1VDV A;  3AEG B;  1EWY C;  1JW9 D;  2ONQ A;  1YN3 A;  1FD6 A;  3IXS A;  1HEZ E;  2FE8 A;  3AE4 B;  3AMZ A;  3HVD A;  3IT6 B;  4N58 A;  3AE9 B;  2EKI A;  1JCK B;  1QOA A;  2NTT A;  2Y3A A;  1SSN A;  2PMV A;  2Z8L A;  1JRP A;  2DWQ A;  2FUG 1;  1TY2 A;  1I4H A;  3C8Y A;  4HRS A;  4WIP A;  5GXG B;  4MAC A;  1K52 A;  4MT5 A;  4HEA 1;  1B9R A;  1QOF A;  3BK2 A;  4DXF A;  2M19 A;  2KQ4 X;  1IBX B;  1KFY B;  1YN4 A;  3VR9 B;  1T6B X;  1CK1 A;  1CZP A;  1ENF A;  4OZC A;  3GB1 A;  1UUP A;  3EA6 A;  2RDH A;  3R2I A;  3ZQ4 A;  3ZJV A;  2L32 A;  1ZP0 B;  1EU4 A;  2CJN A;  2QSD A;  2WXH A;  1MVK A;  1CQV A;  3IAM 1;  4YWG G;  1EU3 A;  1I4P A;  2DYM A;  1YJI A;  1TY0 A;  3W5V B;  5T8I A;  4AS1 A;  1GAQ B;  3TSS A;  1GB4 A;  2GRI A;  1PYW D;  4MM3 B;  1PGB A;  3H8H A;  3PO0 A;  1J7A A;  3ETR A;  1I4X A;  2K0P A;  1K53 A;  1N61 A;  1JWA D;  3WCQ A;  2XN9 C;  3ZJT A;  1SF0 A;  3NZ3 A;  3NVV A;  1UNS A;  3AH7 A;  4A6Q A;  2ACZ B;  1VLB A;  5FR3 A;  5C2T B;  4IOI E;  1FNU A;  3Q69 A;  3AE1 B;  4P16 A;  4USA A;  1HQR D;  2AQ2 B;  2K9X A;  4RH6 A;  4US8 A;  1PFD A;  3AE7 B;  2IGH A;  1TS5 A;  2G9H D;  1QOG A;  1FCC C;  4KGS A;  1JML A;  1SJH D;  1V1P A;  1VZ8 A;  4M0W A;  1R7S A;  1OQQ A;  2N9K A;  2WDQ B;  4YSY B;  3MJ5 A;  1QF6 A;  1E0Z A;  2WXJ A;  1C76 A;  3VRB B;  3P4P B;  1RM6 C;  1DGJ A;  2W82 A;  5D3D A;  3U52 E;  1PGX A;  2AQ3 B;  3NUH B;  4LK0 M;  1SE4 A;  3KLS X;  3AEC B;  1EM7 A;  4ZHO A;  2BYT A;  2MJD A;  1VRA B;  2N7J A;  4LTU A;  1L4Z B;  1N5X A;  4YTN B;  1DYQ A;  1F2R C;  2WXK A;  1WYG A;  3NRZ A;  2MH7 A;  2CJO A;  5H8Y E;  2ZW1 A;  4C7Y A;  1KH0 A;  2M0A A;  2WDV B;  4R3D A;  1V8C A;  1WRI A;  5TSS A;  4OZB A;  3ZGZ A;  1DOX A;  4Q2J A;  1IBX A;  1DOI A;  3RFZ B;  4OW0 A;  1L0X B;  2KN4 A;  5G5G A;  3P42 A;  3FAH A;  1MI0 A;  1XCT L;  1K50 A;  3AE6 B;  4EE2 A;  2LHD A;  5D3I B;  4A8X C;  1C78 A;  2QIL A;  3EGR A;  1D6E C;  3B9J A;  5HFY A;  2WXF A;  5LNK 1;  2DYO A;  3FIL B;  2W3S A;  5BYR A;  2GI9 A;  1TKY A;  1B1Z A;  2N9L A;  5EE9 A;  1KTK A;  2QEJ C;  4UDU C;  4JWU C;  3KQ4 A;  3SFE B;  3LB8 C;  4NAM A;  3U2S C;  4O1N A;  2LMC A;  2WU2 B;  1I4R A;  2PVG C;  1HA5 A;  3TEZ A;  2X38 A;  1GPX A;  2Y5P A;  1ROE A;  4HKQ A;  3BVZ A;  1I4Q A;  3IT4 B;  2RMM A;  1WSP A;  3AE2 B;  2BS2 B;  2E6X A;  2WS3 B;  1QIL A;  2E3T A;  4JE3 B;  5HHD G;  4ZRP A;  3U7Z A;  3W1S A;  1BXT A;  1IUE A;  2V4I B;  1QOB A;  1KLG D;  4ZHP A;  1FXA A;  2WP9 B;  1JAL A;  2YEP B;  2BBC A;  1FCL A;  1VR9 A;  2ZW0 A;  3Q8C A;  3O13 A;  2I38 A;  5EE0 A;  4RGT A;  2DLB A;  4L23 A;  3NVZ A;  2JXT A;  2JX5 A;  3VRA B;  3AEB B;  3V3X A;  2WXR A;  3P4Q B;  2JYT A;  2MEK A;  3Q8A A;  2JYE A;  1J7B A;  5AUI A;  5BYQ A;  2OED A;  3W5U B;  4ITK A;  1QKZ A;  4ARC A;  2MJE A;  3W2D A;  1OFF A;  1MHH E;  4NAW B;  2RDG A;  1BUI C;  2WLB A;  1TKG A;  4NZL B;  2W3R A;  1FNW A;  3FC4 A;  1YQ4 B;  1V1O A;  2Y5C A;  1AYF A;  3AB5 A;  4YTP B;  1ZDX A;  4C80 A;  4KKI A;  1C79 A;  1VJK A;  1WXQ A;  1L0V B;  2BTE A;  2WXI A;  4PT5 A;  1IGC A;  2JQR B;  3B2G A;  1N5W A;  4YTM B;  1PUT A;  1C4P A;  1P7E A;  4N59 A;  1IGD A;  3DWM A;  1PGA A;  1NEN B;  1TKE A;  5FKA C;  5EE3 A;  1SBB B;  1FM0 D;  1KLU D;  2BS4 B;  3AM9 A;  4J3O D;  2BW2 A;  4A9A A;  4XE0 A;  3MHZ A;  1F0Z A;  1JWU D;  1XLO A;  1J7C A;  3SR6 A;  1JWB D;  1ZXH A;  2NTS A;  5H92 C;  3AEF B;  4WH4 A;  3NS1 A;  3ABV B;  5BYS A;  2WXP A;  3P1M A;  1YNT E;  1AW7 A;  2KMM A;  4WUR A;  2W54 A;  4WAF A;  2R61 A;  3DWG C;  1RWS A;  2W55 A;  1JQ4 A;  4YXD B;  1ACC A;  1FFU A;  3TUO A;  5JXV A;  2OHF A;  1I4G A;  1C77 A;  1EWC A;  2TSS A;  3OWE B;  4JWS C;  2PTL A;  2IPK D;  3TEY A;  2BT6 A;  3PZ8 A;  5I4D A;  4XWW A;  1ZXI A;  1ET9 A;  1ZE3 D;  1FMA D;  2HDE A;  2G1E A;  1PDX A;  2WXM A;  4H2A A;  1YN5 A;  1AWD A;  4RGO S;  4ZOH C;  1TYG B;  1F2R I;  3HRD D;  1SB3 C;  1GB1 A;  1HZ6 A;  1OQR A;  5FK9 C;  2EEL A;  1XF5 L;  4ZRQ A;  4L2Y A;  1L6V A;  1QQR A;  1UGJ A;  4RGN A;  2JSV X;  5BMG A;  3VQI A;  3BYY B;  3AN1 A;  2VZK B;  2I2Y A;  2LJI A;  4ARI A;  1BML C;  1UWM A;  3GS2 A;  1NVI D;  1STE A;  4NJC A;  2LUM A;  3W9C B;  2IDY A;  1ZDV A;  4LLG M;  4RGM A;  1CJE A;  1A70 A;  3P63 A;  3EUB 2;  4C56 C;  1VZ7 A;  1AN8 A;  3LYY A;  1MPE A;  4TSS A;  4XDD A;  5HG2 A;  2QIE B;  1XXG A;  3TEX A;  1JWM D;  1ZUD 2;  2N0S B;  2PIA A;  2WXO A;  4YSZ B;  1HXY D;  4YT0 B;  2JU6 X;  1L0Y B;  3MP9 A;  1T3Q A;  1JRO A;  2FBW B;  2PKO A;  4KKJ A;  3U4E G;  1E10 A;  2SAK A;  3E9S A;  2MJ3 A;  2IJ0 A;  2XNA C;  3LXF A;  3BZD B;  2INN E;  4IDI A;  1GOZ A;  3PZ7 A;  4RCO A;  1LO5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...