3PLUA

Structure of hub-1 protein in complex with snu66 peptide (hindi)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
HMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Ubiquitin-like modifier HUB1
publication title Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pluA00
3QA8A 3IBEA 1WXAA 3JSVB 2NS5A 4BBNC 2DENB 2LVQA 1E90A 2KZRA 2K1FA 2PEAA 3JW0X 3APCA 2MBEA 3N32A 1WM3A 3V62A 3QJZA 4KIKA 3LDZE 1WGGA 3WIMA 1GUAB 4KDIC 2EKEC 4P7IA 3B0AA 1WIAA 2DX5B 1WGYA 1WZ0A 1X1MA 2KJRA 3U7DA 1SGHA 3JVZX 3ZW3A 3L13A 1WE7A 1S1QB 4MGKE 1EF5A 2OOBB 2KHWB 3PPAA 1WXMA 3DCGA 4IM0A 3L54A 1R4MI 3VTWA 2JRHA 1E7UA 3X0WA 1J0GA 3SU8X 2JY6A 3M63B 4FJVB 1LQBA 2O6VA 1RAXA 2FCSA 4WWNA 4K7UA 3ENEA 5J18A 4JLCA 3DBRI 3CSTA 4PS3A 3U30A 1AARA 2PJHA 3ZDTA 3ZIMA 1JRUA 2DAJA 3ZLZA 3ZNGC 5AZGA 4DBGA 3H7PA 3A9JB 3TL5A 4BFRA 3OJ4B 2ZVNA 1WF9A 1WY8A 2CHZA 2L0FA 4E3CA 3T9LA 2O2VB 5D2MB 2CKHB 2OJRA 3SHQA 3U8ZA 3DBSA 4XC2A 2Z0DB 3DVGX 1V81A 4IWOA 1WJNA 3QAQA 2PE9A 2UWQA 5E6OA 3R66C 4JIOU 2IO2B 4HXDA 4XX5A 2KXJA 2UYZB 1J19A 4B9KA 4EUTA 1XT9B 2DAFA 4PS8A 3UQBA 2FIFA 4KVGB 1WR6E 2DYBA 1WGRA 4LDTB 2RGFA 4K1RB 2KX3A 2L00B 3RZWC 1BT0A 3TIXA 1FXTB 3CSFA 5FR6A 4DHZB 1A5RA 1KOTA 5AZHA 3TJPA 1WMHA 1E5WA 2LGYA 3NS8A 2KJHB 1RRBA 2KWVB 2XEWA 2LD9A 3VUWA 2MP2A 2WYQA 3PGEA 1Y8RC 1LM8B 2KLCA 2KKCA 2LXCA 4HLEA 2L8JA 3W1YA 2C7MB 2NBWB 2LGXA 2JZ3B 3PZDA 1K8RB 2EMSA 4HK2A 4AJWA 4W9CA 3PS6A 1XQQA 3M3JA 2HTHA 4MGYE 2K39A 4WQOB 4BKGA 4KZ0A 2EMTA 3PTFC 3VHTC 1YD8U 1R4NI 4KSKC 3RCZA 1HE8A 1YX5B 2W9NA 2N9PC 4MH0E 2LUEA 3QC8B 2A5UA 2R2OA 3ONSA 3OAWA 1WH3A 4MELA 1XD3B 2IBIB 2K6QA 2IZVB 4E74A 2LRWA 5LXHA 2JF5A 2AYOB 5JH5C 4DHZE 2O6VB 2D2QA 2N1WA 2ZCCA 2IY1B 2I1JA 1ISNA 2CHXA 2R2QA 2AL6A 4J6IA 4EEWA 1Z5SB 1GC7A 4NNJB 1D3ZA 4M0WB 3PLVA 3H7PB 3QIJA 5C23A 3W1SA 1TZ1A 4K81A 2FCNA 2M8SA 3ZNZB 4FN2A 3ZTCA 3Q3JA 4ANWA 1WFYA 3MHSD 3P2BA 4TQ1A 3RT3B 3QCAA 4FHKA 3IHPC 2MCNB 3ZNID 4DHJD 2L76A 3QARA 4BBNF 3RD2A 1WE6A 4OVVA 2M0XA 5AEKB 4AWJA 2LXAA 2CS4A 2NPTA 2MBBB 3H6NA 5DPRA 5DPWA 1ZGUB 3APFA 3ZTDA 5BO4B 5KHOA 4MSMB 4ICVA 4JQWC 3VUXA 2N7EA 2JXXA 3OLMD 4CHKA 1YX6B 3DVGY 4GDKB 1IPGA 4N9F4 2KJ6A 1UD7A 1ZW7A 2LJ5A 1RFAA 1WMHB 4I6PA 4TV3A 4DDGD 2ZJDA 3PRPB 4EZKA 1GJZA 1EO6A 1WRDB 2GBJA 4JL9A 2ZZPB 4NQKE 5DPSA 2MP2B 2I1KA 2KLGA 1GG3A 2WX1A 4AP4C 3SDLC 3DVNU 4BOZB 2N9EB 4FULA 1I42A 3WAPA 1WJ6A 4M8MA 4ZYNA 1UH6A 4RM8A 2LGDA 1WXVA 3V61A 2RD0A 4W9FA 3VTVA 1Q5WB 3ZKJC 3GOEA 4HJKA 2KWCA 2J0KA 2D11A 2KVRA 2LRUA 3VQIA 4PYUA 2FUHB 4W9HA 2L7RA 3PREA 2ZCBA 5L95C 1WR1A 4IWPA 2PE6B 4TQ0A 2JZZA 3QX1A 3RZFA 2KTRA 5LXIB 3IVFA 3BY4B 1V2YA 3QK0A 3A1QA 3HM6X 5D6JB 3WA0A 2DYMA 2IO0B 3DBHI 1WYWB 3A4SC 2REXA 3PHWB 2M4NA 3NY5A 1PQSA 1EUVB 1WX9A 2NR2A 4GN1A 1YJ1A 4HVBA 2KTFA 2MW5A 2BWFA 2G45B 2M17A 4NY0A 4PYZA 3A9KA 5CHFA 4FJZA 2RPQA 5LLIA 3IFWB 5E6PA 1E8ZA 2PPHA 2AWTA 4DK5A 4BVUC 3ZRCA 1J8CA 2FNJB 2KMCA 2BKFA 4W9EA 3VTUA 3PV1A 3HIZA 3ML9A 4WJPA 2RSUA 3AU5A 4G11A 5D7GA 1V80A 2LWPA 4KV2A 3R7RA 1H8CA 1EF1A 4NAWB 4NPNA 4ZRIA 2J0JA 2XK5A 4IUMB 4IM3A 2N9XA 2DYOA 3VFKA 1UBIA 3PLUA 2BGFA 4GDKA 3TMPB 3X23A 4FADA 4WJQA 4KZCA 2NPTB 4B95A 2DZJA 1WGHA 2K6DB 1E8XA 3JSVA 3Q3FA 4YL8A 3RULA 3WANA 2DHZA 2WWZA 1UELA 1E8YA 2KANA 2YVCA 3O65B 2B3AA 2WX0A 2KQ7A 3H9DA 4MEMA 4MJSA 3L17A 4FJYA 4KIKB 4WJNA 4GMVA 4LCDE 1V9JA 4WWPA 4ANVA 3QWZB 3VAWA 3EFUA 4LDTD 5G55A 5DCNA 1V5TA 3C0RB 4URKA 3ECIA 4MM3A 4ASWC 2JWZA 4RM9A 3AI5A 4W9GA 4M8NA 2MWSB 2C7NB 1P98A 4DWFA 3N3KB 2D3GA 4EKUA 5G2NA 2GMIC 1WGDA 2ZPNA 2IY0B 3A33B 2VRRB 3PVLA 4MDKE 2K8CA 4MGIE 3B1LX 4ANXA 2FCQA 4F1SA 2DZKA 2MX2A 1V86A 4DHJB 1UGMA 3RUIB 3AULA 3L08A 2BYFA 4HCPB 1V5OA 4RMAA 5C1ZA 2KMAA 2QHOA 5TR5A 3RYTA 2JT4B 5JZEB 2LVOA 4IWQA 3PT2B 2NCNA 2C5LC 1LFDA 3ZRFA 1L2NA 4A3PA 4IW0A 2V1YA 5EDSA 3NHEB 3HK0A 2ZPYA 3AXCA 3KUCB 2CHWA 2FIDA 3UGBB 1KLVA 4W9DA 1KM7A 3A9KB 2C9WB 4HDQA 3UIOB 3QHTA 4CO7A 2Y5BB 3NOBA 4GDLA 3DVNV 4DXAB 1CMXB 4ZDVA 4BKSD 1KJTA 3EHVA 4FHJA 3TBLD 1TTNA 1I35A 3PHXB 4CYEA 4GB9A 2LASA 3EC8A 1U4AA 1P1AA 3HHMA 1YQBA 4F7ZA 3M62B 2HE7A 2KX0A 4FBJB 3K9PB 4I6LB 4AOFA 4A3OA 3I3TB 4NJ6A 4ZRKA 3VH4B 1V6EA 2BYVE 3DQVA 2DZIA 1TGZB 3UF8A 1OQYA 5DPTA 3V60A 3ZVVA 4F8CB 3PSEB 1IP9A 2GBKA 3ML8A 5CX3A 1P3QU 3KUZA 2NBUA 4AUQC 2MLBA 2XBBC 4MJSB 3TCAA 2BPSA 5GMVA 5J17A 1F9JA 1H4RA 4FLHA 4LJPB 1ZKHA 2KC1A 4B6WA 2MSED 3VDZA 3ALBA 4IM2A 3CF6E 2GBNA 4GSWA 3DBLI 4WAAA 5AZFA 4E71A 3D32A 5IA7A 2BF8B 2L05A 3KUDB 4ICUA 2MBHA 1VCBA 3DOWA 2CU1A 4EFOA 1G6JA 2KFKA 3WAOA 2L3ZA 1NDDA 1GNUA 2IYDB 4XZ4A 4ZRJA 4BKSA 2J0MA 1E8WA 4KDLB 2BYEA 5CTRC 3ZNHB 5CHWA 1P9DU 4GOCA 3B08A 1C3TA 4GU2A 2LVPA 4DDID 1RLFA 2KDEB 4II2B 3W1SC 1T0YA 3L16A 2IO1B 3DDCB 1OGWA 3KH0A 1GC6A 1V49A 3N30A 2N1VA 2GOWA 2V4LA 1C1YB 2KDIA 1WX8A 4GXBA 4K7WA 5E6NA 3WAMA 4HDOA 1MG8A 4OVUA 4EZJA 3A4RA 2JRIB 4W9KA 2RR9A 4BKTA 3NZUA 2L0TA 2A4ZA 2FCMA 2N4FA 1WI0A 1VD2A 4GGQA 3ZDMC 2AEHA 1OEYJ 5JHBA 2HJ8A 4BOSC 2C7HA 3PRMB 1QZEA 1OEYA 3T8MA 1L7YA 2ZNVC 2MBOA 5KHQA 4FA6A 3MJWA 2ZNVB 3SD5A 3KVFB 4G50A 4MGZE 2JVCA 3CMMB 4GDLB 1UZXB 2V3SA 5HKHA 2J7QB 2KDFB 1WXSA 2KWUB 2Z0EB 3HM3A 4LJOB 3QQ8B 3L10B 2C60A 3ZUNA 5D94A 2D10A 2KK8A 2KO3A 2KOXA 1NBFC 2MRPA 2HD5B 4NQLB 3V6CB 2DZMA 2GBMA 4G3XB 3VVWB 3NZSA 3L0WB 2NBVB 3OJ3A 3GZNI 1SE9A 1Q0WB 1WJUA 2BWES 2G4SA 4K7SA 2K25A 4JGHB 2MQJA 2ASQA 5JHAA 2Z59B 2JPHA 3V6EB 3R7QA 2CR5A 2G3QB 1WX7A 4IG7B 3VXWA 5L83A 1SIFA 3UIPB 3AU4A 3VH3B 5J2RA 1UBQA 2JUOA 2MBQA 3A9JA 4MSQB 4TKNA 3R3MA 1Z2MA 3K9OB 4WWOA 3ZO5B 1OTRB 3UINB 2MA9B 4X57B 2O2VA 2KDBA 4W9JA 4HPLB 4IC7B 2YLMA 3S2AA 3UQAA 2KD0A 4GIVA 4I6NB 4II3B 2G4DB 2GBRA 2WDTB 3IG3A 2KTRB 4W9IA 3DPDA 3KW5B 2K8HA 3A1QB 1WM2A 2ZVOA 4PS7A 4TUUA 2KFJA 2D07B 4EZLA 2KFKB 3WALA 1WZ3A 3JYUA 1M94A 3PRZA 2NVUI 1TBEA 1LXDA 3EECA 3H1UA 2N7DA 2KQSA 1WJ4A 3KYDD 1P0RA 3LJ3A 4HCNB 4NJ7A 4KSLC 4ANUA 2LZ6A 3KYCD 1IYFA 4AJYB 2KN5A 2ZEQA 4EOYA 2LI5A 2O6VD 3M95A 3VUYA 2KNBA 1YIWA 2M1MA 2IO3B 4HWIB 2BKRB 5IAAC 4HPMB 1Q1OA 3MTNB 4NAWA 1NI2A 3BINA 4WJOA 2KC2A 2XK5B 4G0NB 1E7VA 2AL3A 5CHVC 3APDA 2K8BA 1S3SG 4A20A 4W9LA 3H7SA 2FAZA
chains in the Genus database with same CATH superfamily
2ICIA 4LTUA 3JW0X 2KZRA 3N32A 3APCA 1WM3A 4ZHOA 3LDZE 3WIMA 4KDIC 2WXRA 3B0AA 1WIAA 2DX5B 1X1MA 3ZW3A 3L13A 1IGCA 1EF5A 2KHWB 2EKIA 4IM0A 1L5PA 4FJVB 2O6VA 4WWNA 5J18A 3CWIA 5IKCM 2PJHA 3ZIMA 3ZLZA 1HEZE 4M0WA 5AZGA 3NG0A 4E3CA 1WY8A 2CHZA 2L0FA 3T9LA 2O2VB 3AEFB 2CKHB 3SHQA 4XC2A 4USAA 4PK1A 1V81A 2H89B 5TSSA 2PE9A 5E6OA 3EUB2 2KXJA 2UYZB 2DAFA 1DOIA 2HDEA 4P1CC 1WR6E 2DYBA 1WGRA 2D5GA 4LDTB 3TIXA 3NVZA 4IDIA 1PFDA 3NS8A 2WXOA 5FR3A 3BYTB 4DXFA 2KWVB 4PT5A 2MP2A 2WYQA 3PGEA 2KLCA 2ACZB 4XE0A 4HLEA 3ZXVA 1FRRA 1XQQA 3MP9A 3PTFC 4MACA 3R2TA 4NZLB 1QQRA 3HRDD 1AWDA 2I2YA 2N9PC 2KACA 3QC8B 3OAWA 2Y5PA 1WH3A 1XD3B 2IZVB 3AM9A 1KF6B 5JH5C 4JE3B 2O6VB 3TSSA 2IY1B 1ENFA 2CHXA 4YWGG 1D3ZA 2AX5A 4M0WB 5C23A 1TZ1A 2FCNA 2M8SA 4KGSA 3ZTCA 4ANWA 3P2BA 4TQ1A 4FHKA 3ZNID 4DHJD 4OVVA 5AEKB 2WXIA 2IJ0A 2NPTA 2MBBB 1NEKB 2D3CA 3APFA 4MSMB 4JQWC 3VUXA 2N7EA 4CHKA 5GXGB 1K52A 3DVGY 3B9JA 4KX6B 4DDGD 2OJWA 4NQKE 2ZZPB 1DYQA 2MP2B 4A90A 3SDLC 4B0EA 4FULA 1WJ6A 4RM8A 3ZJVA 3VTVA 1IBXA 2ZW1A 3ZKJC 4KKIA 5T8IA 3VQIA 2ZCBA 2J42A 2M56B 2CU3A 3RZFA 1FXAA 5LXIB 3BY4B 3A1QA 3HM6X 3WA0A 2IO0B 2BS3B 3T3OA 1WYWB 3PHWB 2M4NA 1EUVB 2NR2A 4GN1A 1YJ1A 1QOBA 4NY0A 3H8HA 1V97A 2RPQA 1C76A 3P4SB 4DK5A 4BVUC 1D5XC 3AH7A 2KMCA 2LHEA 1D4BA 4W9EA 3HIZA 3ML9A 1F0ZA 1PGXA 2RSUA 1V80A 4KV2A 1L0VB 4ZRIA 1YMHE 4IM3A 4JX1C 4GLSC 1I4XA 5H8YE 2K5PA 4WJQA 4KZCA 2NPTB 4B95A 3JSVA 3Q3FA 5BMHA 3WANA 1UUPA 2VZKD 3AEDB 2YVCA 3O65B 4MEMA 3L17A 2Q5WD 4FJYA 4KIKB 4ANVA 3VAWA 2WDVB 3BK1A 4ASWC 1YN3A 4W9GA 1PUTA 4HJGE 1VRAB 1JMLA 3W9CB 4LNKA 2ZPNA 4XDCA 1IBXB 2VRRB 1JWBD 3B1LX 4MGIE 2FCQA 1ZOYB 1K51A 1V5OA 2QHOA 5TR5A 2CJNA 2LVOA 2NCNA 1NENB 3AV8A 1CK1A 1GB4A 3P1MA 2WXQA 2Y5CA 3DHHC 2PW9A 1FIQA 1N61A 5D3IB 3UIOB 5FK9C 1HXYD 5FKAC 2Y5BB 3NOBA 1B1ZA 3DVNV 3AE8B 1T3QA 2GRIA 4ZDVA 4BKSD 1KJTA 1TS3A 1JWUD 1TTNA 1I35A 3R2IA 2K3UA 4GB9A 2LASA 3EC8A 2YEPB 3HHMA 1JW9D 1YQBA 2KX0A 2G1EA 1KRHA 2WXLA 4I6LB 4AOFA 3I3TB 4NJ6A 3VH4B 4N58A 3RNEC 2JQRB 1XF5L 1T0RC 1F1HA 1FFVA 1VZ6A 2DZIA 1OQYA 5DPTA 3V60A 3P4RB 4F8CB 3Q8FA 2J4XA 2NBUA 2XBBC 5GMVA 1ZKHA 4B6WA 2MSED 4J3OD 2GBNA 4WAAA 3D32A 5BYQA 2L05A 4ICUA 3NRZA 2L83A 3CIRB 2IYDB 4ZRJA 2J0MA 1E8WA 2E6XA 1RLFA 1YQ3B 2BS4B 2KDIA 3WAMA 5E6NA 1MG8A 4BKTA 1XXGA 1VD2A 1OEYJ 2PKOA 4BOSC 2KWDA 3MC8A 1L7YA 5KHQA 2WXMA 4LNNA 2INPE 2DNFA 5HKHA 4D2KA 2KDFB 5HI1A 3HM3A 2J53A 4JPSA 2C60A 2Z8LA 4NQLB 3VVWB 2QEJC 3SEBA 1ZE3D 3OJ3A 1SE9A 1Q0WB 4K7SA 1WSPA 5JHAA 3R7QA 2G3QB 1N5XA 1XLQA 5L83A 3AU4A 1OFFA 2KVZA 2MBQA 4TKNA 3RFZB 3K9OB 3ZO5B 4X57B 1SEBD 2KDBA 2BQQA 4W9JA 3UQAA 4GIVA 4II3B 2G4DB 2GBRA 2NMQA 2KTRB 1KLUD 1FFUA 1HZ5A 2K8HA 4TUUA 2D07B 3WALA 1WZ3A 3JYUA 3NVWA 5H92C 1YQ4B 1EM7A 2QC8A 2NTSA 3LJ3A 4ANUA 2LZ6A 2KN5A 2ZEQA 4EOYA 2W55A 2BT6A 1YIWA 1FCCC 4HWIB 4NAWA 3T3NA 1J7BA 3FILA 2RDBC 5EE3A 3RNGC 2XK5B 5CHVC 3H7SA 3QA8A 1JRPA 1WXAA 1JWSD 1VZ8A 3ABVB 2MBEA 2N7JA 1WGGA 2EELA 1GAQB 1GUAB 2EKEC 1L6UA 2K0PA 3IT6B 1WZ0A 2KJRA 3U7DA 2KN4A 1EWYC 1WE7A 1S1QB 1QT9A 2V9HA 2OOBB 1WXMA 2VH2A 1KFYB 1E7UA 2JY6A 2UU7A 3ENEA 4JLCA 1GOZA 3DBRI 3PZ8A 3CSTA 3ZDTA 1J7CA 3AEAB 3ZNGC 3H7PA 3ZGZA 1TZOA 5D2MB 2KMMA 2Z0DB 5EE0A 1FNWA 4IWOA 1ZXHA 1ET9A 2N0SB 3B2GA 2IO2B 4HXDA 3AB5A 4EUTA 3UQBA 2MJ3A 2H88B 3FILB 2WGSA 3VUWA 4XYCA 2PTLA 3ZXRA 2LXCA 3AE3B 2L8JA 4S17A 2C7MB 3I5JC 4AJWA 3MFGA 4W9CA 1BXTA 3PS6A 1E10A 1ROEA 2HTHA 4MGYE 4BKGA 2TSSA 3DWMA 3RCZA 2DBYA 3ONSA 2ON8A 3W5UB 1FXIA 2IBIB 2R61A 2LRWA 5LXHA 2JF5A 2AYOB 2D2QA 2ZCCA 4A9AA 3L4PA 1N60A 2R2QA 4J6IA 4EEWA 1TKEA 2FBWB 1GC7A 4YTMB 3H7PB 3QIJA 1ZP0B 1SIJA 3PO0A 4YSYB 3ETRA 3Q3JA 1WFYA 4BBNF 2BVCA 3BVGA 4AWJA 3NS1A 2LGIA 1C9FA 2MHJA 5DPRA 1ZGUB 2IDYA 3ZTDA 2WP9B 5E6JA 3TEZA 1BMLC 1YX6B 4N9F4 2BYTA 1RFAA 2BBCA 4A8XC 1ET6A 1WGKA 1C79A 4I6PA 3ZQ4A 1GJZA 1WRDB 1XLOA 2GBJA 4AP4C 2RPVA 3DVNU 4BOZB 4M00A 2RD0A 2J52A 3I57A 1WYGA 2D11A 1TYGB 2OHFA 1FPYA 2JZZA 1V2YA 5D6JB 1LGRA 3NY5A 4HVBA 2KTFA 2MW5A 2BWFA 2G45B 3MC9A 3A9KA 3AEGB 5E6PA 1SE2A 2FNJB 3PV1A 4G11A 5D7GA 2LWPA 3Q2AC 1H8CA 4IOIE 2J0JA 4IUMB 3VFKA 2N9XA 1TS4A 4GDKA 3X23A 3P42A 3TMPB 1WGHA 2WXKA 3UI3A 1QILA 2WWZA 4AQ7A 3IXSA 2B3AA 4O1NA 3H9DA 2V4IB 4GMVA 1N5WA 4WWPA 2L52A 3EFUA 4LDTD 5G55A 5DCNA 4URKA 3C0RB 2JWZA 3TEXA 1QKZA 3EGRA 2MWSB 3OWEB 3DBLB 2WXHA 2C7NB 1P98A 4DWFA 1C4CA 5G2NA 4P16A 1WGDA 2IY0B 3PVLA 4MDKE 1F2RI 2K8CA 4ANXA 3R8BA 4DHJB 4C7ZA 3KWVA 3RUIB 1ZDVA 4HCPB 1TIFA 2GB1A 2KMAA 1BUIC 5JZEB 4IWQA 2C5LC 5HHDG 4A3PA 4IW0A 2V1YA 5EDSA 3NHEB 3HK0A 3AXCA 1KM7A 4WH4A 3A9KB 2PLPA 4HDQA 2JX5A 4GDLA 1CMXB 2RDHA 2M19A 3EHVA 1WRIA 3PHXB 4CYEA 3Q8AA 2WS3B 4F7ZA 3MC0B 3E56A 3PZ7A 3K9PB 1CQVA 3IAM1 3GZNB 4ZRKA 2OEDA 4ACFA 2BYVE 2WU2B 3DQVA 3UF8A 5LNK1 3ZVVA 1IP9A 2GBKA 3ML8A 3KUZA 4YTNB 4AUQC 2MLBA 1XLNA 3TCAA 2BPSA 3P4QB 1H4RA 4FLHA 4LJPB 4ZRPA 1MI0A 4IM2A 3CF6E 4A55A 3DBLI 2BF8B 1VCBA 1SXTA 4EFOA 2L3ZA 1NDDA 2MEKA 4BKSA 1IUEA 2BYEA 5CHWA 1AYFA 3HUIA 3KWLA 1P9DU 1C3TA 4EE2A 4II2B 4LNFA 2GOWA 2V4LA 4OVUA 1C77A 4W9KA 2L0TA 2A4ZA 2FCMA 2N4FA 3V3XA 4GGQA 4WAFA 2HJ8A 2BB6A 3PRMB 5AUKA 4BAXA 1QZEA 1OEYA 2ZNVC 2XNAC 4FA6A 3SD5A 4G50A 4MGZE 3CMMB 4GDLB 1UZXB 2J7QB 4LJOB 2Z0EB 1MHXA 2L1AA 1FCLA 1STEA 3L10B 1HTQA 2KK8A 2KOXA 2PIAA 1NBFC 4RNAA 3N1YC 3GZNI 2INCC 1R4MB 2JPHA 1L0YB 3V6EB 2BB5A 1WX7A 4IG7B 4DXGA 3OG5A 3UIPB 3Q3MC 3Q8CA 3VH3B 3A9JA 2SAKA 3MHZA 2AQ3B 2MA9B 3TUOA 4IC7B 4HPLB 1V8CA 1J7AA 4I6NB 2WDTB 1RFKA 3IG3A 4P6VF 3DPDA 3A1QB 4PS7A 2KFJA 3FKYA 2NVUI 1TBEA 1LXDA 2N7DA 2KQSA 4HCNB 3KYDD 1P0RA 3BWUD 1K53A 4NJ7A 4QAYA 3KYCD 4AJYB 2CJOA 1RWSA 5BMIA 3M95A 2LHDA 3C19A 2IO3B 3NVYA 2BKRB 1SJED 2JWUA 3MTNB 3VR9B 4G0NB 3KQ4A 3LYYA 2K8BA 4MM3A 2MCNB 4W9LA 2WLBA 2FAZA 1VLBA 3IBEA 3SFDB 2RDGA 2QILA 3JSVB 2D3AA 4BBNC 2DENB 2LVQA 1E90A 2K1FA 3QJZA 2KT7A 1EU4A 1XCQL 4KKJA 1HTOA 4WQMA 1KH0A 1SGHA 4HPPA 1R4NB 3BK2A 1E6EB 3PPAA 3AE6B 3DCGA 3L54A 1R4MI 3VTWA 1J0GA 1ZUD2 1TKGA 3M63B 2QJLA 1TKYA 2W3SA 4IKGA 4PS3A 3U30A 1AARA 2HJ1A 2QSDA 2DAJA 4DBGA 3A9JB 3TL5A 1WF9A 1IGDA 2BTEA 1HQRD 1OQRA 4RGOS 3N1ZC 4HKQA 1Y56A 3QAQA 4LNOA 2UWQA 2IPKD 4JIOU 1B9RA 2X8XX 1FM0D 1J19A 1XT9B 1UNSA 1F77A 1N62A 2RGFA 4K1RB 3RZWC 1BT0A 1FXTB 1WWTA 3I63C 2X38A 1KOTA 5AZHA 2LGYA 2KJHB 3WCQA 3RNFC 1YNTE 3BYYB 5JXVA 4MT5A 4MM3B 4Q2JA 5BYRA 3W1YA 2K22A 4RH6A 3AN1A 2NBWB 2LGXA 2EMSA 4H2AA 4HK2A 3AE4B 2WXPA 1FD6A 1L0XB 4KZ0A 2EMTA 1I4PA 1R4NI 1VZ7A 4BZAA 5IOIA 1HE8A 2W9NA 4WIPA 1NYQA 3AMZA 3N20C 3RI7C 2LUEA 2A5UA 1ZPSA 3GS2A 2LGSA 4E74A 2XN9C 1AW7A 3DBHB 4DHZE 3RNBC 2N1WA 1XLPA 4TSSA 2I1JA 1ISNA 2AL6A 1QLBB 2ZW0A 3PLVA 3I9V1 4FN2A 3EA6A 1HA5A 1TT5B 2LJIA 2KQ4X 3MHSD 4L23A 3QCAA 3IHPC 3RD2A 1NI3A 2M0XA 2WDQB 2LXAA 1MHHE 4NJCA 2JXTA 3N1XC 3NUHB 4CQNA 5KHOA 3Q3OC 3OLMD 3C8YA 1UD7A 1SJHD 2LJ5A 5D3DA 5C2TB 3AEBB 4K3BA 4M02A 3PRPB 4YTPB 1EO6A 1TY2A 4JL9A 2WU5B 5DPSA 2I1KA 2JSVX 2IGGA 3SFEB 1RYJA 4MH8A 2Y3AA 5MPOA 1D5ZC 2N9EB 1I42A 4ZYNA 2LGDA 1WXVA 1Q5WB 3GE8C 4HJKA 2KWCA 1FNVA 2KVRA 2LRUA 4W9HA 2L7RA 4US9A 4IWPA 2PE6B 4TQ0A 3IVFA 3QK0A 3W5VB 3RN9C 2DYMA 3DBHI 2AQ2B 3N9YC 1PQSA 1WX9A 3ZJUA 4XWWA 5LLIA 3IFWB 1E8ZA 2WXFA 4FXCA 2AWTA 3ZRCA 1J8CA 2BKFA 1FEHA 4WJPA 3AU5A 1UWXA 2JYTA 1EF1A 4NAWB 2DYOA 1UBIA 2PMVA 3BVMA 4FADA 2WNMA 1JWMD 3RULA 4YL8A 2LUMA 2DHZA 2KANA 2LMCA 3U2SC 2WX0A 4MJSA 4WJNA 3Q8BA 1TJEA 3DWGC 1JQ4A 1V9JA 1K50A 1V5TA 2FE8A 3AI5A 4OHJA 1E0ZA 1D5MC 2W54A 2MH7A 2D3BA 2M0AA 4ITKA 3TEWA 2KYWA 2WQYB 4F1SA 1ESFA 2MX2A 1UGMA 3AULA 1TS2A 3L08A 2BYFA 5C1ZA 4OZAA 3Q8EA 1C4PA 2JT4B 3LXFA 4DQOC 1LFDA 3ZRFA 1L2NA 1V1PA 4L2YA 2ZPYA 3KUCB 2CHWA 3UGBB 1KLVA 1AN8A 1JALA 2C9WB 1E7PB 2MJEA 1QOAA 4CO7A 3AE2B 4DXAB 3B2FA 3HVDA 2LEKA 1L4DB 1P1AA 2HE7A 3RNAC 1I4QA 4A3OA 3IAS1 3J9CA 1MPEA 1JCKB 2K9XA 5CX3A 1P3QU 1TS5A 4MJSB 1FO4A 5J17A 2RMMA 4ARCA 2NTTA 3VDZA 3ALBA 3ZYYX 4GSWA 4E71A 3KUDB 2MBHA 2CU1A 1G6JA 1V1OA 2WXNA 4B0MA 1SBBB 4GOCA 3B08A 4N59A 2KDEB 2HTME 3W1SC 1T0YA 2JYEA 1UF0A 3DDCB 2E3TA 1GC6A 2N1VA 4XWTA 1C1YB 4GXBA 4K7WA 4HDOA 1GB1A 2DWQA 2JRIB 2RR9A 1M4VA 3NZUA 1V1PB 1I7HA 1WI0A 3ZDMC 1E9MA 2AEHA 5JHBA 3TEYA 2MBOA 5EE1A 3KVFB 2PVGC 2V3SA 3ZUNA 5D94A 2D10A 4RF1A 2MRPA 2HD5B 2DZMA 1T0QC 2I38A 2G4SA 4JGHB 2MQJA 4YSZB 3RPFC 2IGDA 2ASQA 2QMTA 4RGNA 2CR5A 1SIFA 1F52A 1YN5A 1PYWD 3P63A 1UBQA 1YJIA 2JUOA 3R3MA 1Z2MA 1OTRB 1FMAD 3S2AA 3AE9B 2KD0A 1KTKA 1PDXA 4C80A 4W9IA 3LB8C 4EZLA 3PRZA 3AE5B 2VH1A 4KSLC 5AUIA 2G9HD 2O6VD 2KNBA 2M1MA 2SEBD 5IAAC 1Q1OA 1EWCA 4WURA 3BINA 4WJOA 4YT0B 2AL3A 3APDA 2JZ3B 1S3SG 1HZ6A 4GDKB 2AQ1B 5BYSA 4XGAB 2NS5A 5J2RA 1XEEA 3V62A 2PEAA 1VDVA 4KIKA 5C3JB 4NAMA 4P7IA 1WGYA 3AECB 2JU6X 3JVZX 3FC4A 4KGRA 4LLGM 4MGKE 4LK0M 2GLSA 3E9SA 2WXJA 3X0WA 2JRHA 2W82A 3SU8X 1LQBA 1RAXA 3NJTA 2FCSA 3HVZA 4K7UA 4JWSC 1JROA 4P1BC 1JRUA 4M01A 1I4GA 4BFRA 1R7SA 3OJ4B 1L6VA 2ZVNA 1C4AA 4OZCA 2B76B 2OJRA 3U8ZA 4OZBA 3DBSA 3DVGX 2VZKB 1D6EC 1WJNA 3R66C 4XX5A 2IGHA 2MJDA 4B9KA 4PS8A 2FIFA 3AE1B 1YN4A 4KVGB 3O13A 2KX3A 2L00B 4RCOA 2GI9A 3CSFA 5FR6A 4DHZB 1A5RA 4YXDB 3TJPA 1WMHA 1E5WA 3U7ZA 1RRBA 2XEWA 2LD9A 1RM6C 1Y8RC 1LM8B 2KKCA 2W3RA 4XDDA 1PGAA 5G5HA 3U52E 5EE9A 1UWMA 1KLGD 3PZDA 1K8RB 4ZYSA 3M3JA 4RFBA 1TY0A 2K39A 4WQOB 3VHTC 1YD8U 2N9KA 4KSKC 1SSNA 2WHIA 3ZJTA 1YX5B 4MH0E 4ARIA 1CZPA 2R2OA 3BVZA 4MELA 2BW2A 1ACCA 2K6QA 2ONQA 1DOXA 1Z5SB 4NNJB 5G5GA 3GE3C 2YEPF 3RNCC 3W1SA 4K81A 1L4ZB 3ZNZB 4WWMA 2LFIA 4C56C 3RT3B 1MVKA 1UGJA 4HEA1 2L76A 3QARA 1WE6A 4ZRQA 3BZDB 2CS4A 1MJDA 1EU3A 3SR6A 3H6NA 2L32A 5DPWA 2V3NA 5BO4B 4C7YA 4ICVA 2V0GA 2JXXA 1IPGA 2KJ6A 1ZW7A 1SB3C 1WMHB 4TV3A 4EZKA 2DLBA 2ZJDA 2WDRB 4UDUC 2KLGA 5IP4D 1GG3A 2WX1A 3WAPA 4M8MA 3IT4B 1UH6A 3V61A 4US8A 4W9FA 3GOEA 3MJ5A 1F2RC 2J0KA 3URYA 4PYUA 1DOYA 2FUHB 3PREA 5L95C 1ZXIA 1CJEA 1WR1A 3EFCA 3QX1A 2KTRA 3AEEB 3A4SC 2REXA 4OVZA 2M17A 1N6ZA 4K3CA 2QDFA 4PYZA 5CHFA 4FJZA 2PPHA 1P7FA 1I4RA 3VTUA 4YSXB 3R7RA 3VR8B 3V05A 4NPNA 3VXWA 1I4HA 2XK5A 3U4EG 3PLUA 2BGFA 3W2DA 2DZJA 2K6DB 1E8XA 2KDMA 4N6EB 4R3DA 2BS2B 1UELA 1E8YA 2KQ7A 4LCDE 4AS1A 3QWZB 1A70A 3ECIA 3GB1A 1N63A 1MG4A 4RM9A 2QIEB 4M8NA 3N3KB 2D3GA 4EKUA 2GMIC 3A33B 3DBRB 5HG2A 1FRDA 2DZKA 4ZHPA 1XCTL 1V86A 4OW0A 2KAJA 1Q10A 3VRAB 3KLSX 4RMAA 1T5XD 1NVID 3AE7B 1FNUA 3Q14C 3RYTA 3PT2B 4A6QA 1MFWA 2FIDA 4W9DA 4C4VA 1XO3A 4ZOHC 3QHTA 1LO5D 1P7EA 1QF6A 1VR9A 1SE4A 1NYRA 1QOGA 4S0RA 4FHJA 3TBLD 1U4AA 3M62B 4HROA 4FBJB 4RGTA 1V6EA 2PVOD 1TGZB 3PSEB 1OQQA 1F9JA 4HKZE 1GPXA 2KC1A 2JZPA 1JWAD 3VRBB 5AZFA 1VJKA 5IA7A 2WXGA 3RMKC 3P4PB 3DOWA 2KFKA 3WAOA 3Q69A 1GNUA 4XZ4A 4KDLB 5CTRC 3ZNHB 2N9LA 3Q6BA 4GU2A 2LVPA 4RGMA 4DDID 2QCZA 1WXQA 3L16A 2IO1B 1OGWA 3KH0A 1V49A 3N30A 1WX8A 4EZJA 3A4RA 2INNE 5I4DA 2C7HA 4LNIA 4C4VB 3T8MA 3Q3NC 1SE3A 3DHGC 3MJWA 2ZNVB 1PGBA 2JVCA 2V3PA 1WXSA 2KWUB 4RF0A 5IN7A 3QQ8B 4L1BA 3BIID 4JWUC 2KO3A 3V6CB 4G3XB 2GBMA 3NVVA 3NZSA 3L0WB 2NBVB 1WJUA 2BWES 1SF0A 1T0SC 2K25A 2Z59B 1YOVB 4KGTA 4MSQB 4TMAB 2INDC 1T6BX 4WWOA 3UINB 1C78A 2O2VA 3FAHA 4REZA 5IO9A 2YLMA 1YJJA 5HFYA 3KW5B 1WM2A 2ZVOA 1QOFA 2KFKB 3DHIC 1M94A 4C00A 3EECA 3H1UA 1WJ4A 1IYFA 2FUG1 1ZDXA 2LI5A 3VUYA 5BMGA 4HPMB 1NI2A 4HRSA 3GP7A 2KC2A 1E7VA 3NZ3A 4A20A 1DGJA
chains in the Genus database with same CATH topology
3QA8A 3IBEA 1WXAA 3JSVB 2NS5A 4BBNC 2DENB 2LVQA 1E90A 2KZRA 2K1FA 2PEAA 3JW0X 3APCA 2MBEA 3N32A 1WM3A 3V62A 3QJZA 4KIKA 3LDZE 1WGGA 3WIMA 1GUAB 4KDIC 2EKEC 4P7IA 3B0AA 1WIAA 2DX5B 1WGYA 1WZ0A 1X1MA 2KJRA 3U7DA 1SGHA 3JVZX 3ZW3A 3L13A 1WE7A 1S1QB 4MGKE 1EF5A 2OOBB 2KHWB 3PPAA 1WXMA 3DCGA 4IM0A 3L54A 1R4MI 3VTWA 2JRHA 1E7UA 3X0WA 1J0GA 3SU8X 2JY6A 3M63B 4FJVB 1LQBA 2O6VA 1RAXA 2FCSA 4WWNA 4K7UA 3ENEA 5J18A 4JLCA 3DBRI 3CSTA 4PS3A 3U30A 1AARA 2PJHA 3ZDTA 3ZIMA 1JRUA 2DAJA 3ZLZA 3ZNGC 5AZGA 4DBGA 3H7PA 3A9JB 3TL5A 4BFRA 3OJ4B 2ZVNA 1WF9A 1WY8A 2CHZA 2L0FA 4E3CA 3T9LA 2O2VB 5D2MB 2CKHB 2OJRA 3SHQA 3U8ZA 3DBSA 4XC2A 2Z0DB 3DVGX 1V81A 4IWOA 1WJNA 3QAQA 2PE9A 2UWQA 5E6OA 3R66C 4JIOU 2IO2B 4HXDA 4XX5A 2KXJA 2UYZB 1J19A 4B9KA 4EUTA 1XT9B 2DAFA 4PS8A 3UQBA 2FIFA 4KVGB 1WR6E 2DYBA 1WGRA 4LDTB 2RGFA 4K1RB 2KX3A 2L00B 3RZWC 1BT0A 3TIXA 1FXTB 3CSFA 5FR6A 4DHZB 1A5RA 1KOTA 5AZHA 3TJPA 1WMHA 1E5WA 2LGYA 3NS8A 2KJHB 1RRBA 2KWVB 2XEWA 2LD9A 3VUWA 2MP2A 2WYQA 3PGEA 1Y8RC 1LM8B 2KLCA 2KKCA 2LXCA 4HLEA 2L8JA 3W1YA 2C7MB 2NBWB 2LGXA 2JZ3B 3PZDA 1K8RB 2EMSA 4HK2A 4AJWA 4W9CA 3PS6A 1XQQA 3M3JA 2HTHA 4MGYE 2K39A 4WQOB 4BKGA 4KZ0A 2EMTA 3PTFC 3VHTC 1YD8U 1R4NI 4KSKC 3RCZA 1HE8A 1YX5B 2W9NA 2N9PC 4MH0E 2LUEA 3QC8B 2A5UA 2R2OA 3ONSA 3OAWA 1WH3A 4MELA 1XD3B 2IBIB 2K6QA 2IZVB 4E74A 2LRWA 5LXHA 2JF5A 2AYOB 5JH5C 4DHZE 2O6VB 2D2QA 2N1WA 2ZCCA 2IY1B 2I1JA 1ISNA 2CHXA 2R2QA 2AL6A 4J6IA 4EEWA 1Z5SB 1GC7A 4NNJB 1D3ZA 4M0WB 3PLVA 3H7PB 3QIJA 5C23A 3W1SA 1TZ1A 4K81A 2FCNA 2M8SA 3ZNZB 4FN2A 3ZTCA 3Q3JA 4ANWA 1WFYA 3MHSD 3P2BA 4TQ1A 3RT3B 3QCAA 4FHKA 3IHPC 2MCNB 3ZNID 4DHJD 2L76A 3QARA 4BBNF 3RD2A 1WE6A 4OVVA 2M0XA 5AEKB 4AWJA 2LXAA 2CS4A 2NPTA 2MBBB 3H6NA 5DPRA 5DPWA 1ZGUB 3APFA 3ZTDA 5BO4B 5KHOA 4MSMB 4ICVA 4JQWC 3VUXA 2N7EA 2JXXA 3OLMD 4CHKA 1YX6B 3DVGY 4GDKB 1IPGA 4N9F4 2KJ6A 1UD7A 1ZW7A 2LJ5A 1RFAA 1WMHB 4I6PA 4TV3A 4DDGD 2ZJDA 3PRPB 4EZKA 1GJZA 1EO6A 1WRDB 2GBJA 4JL9A 2ZZPB 4NQKE 5DPSA 2MP2B 2I1KA 2KLGA 1GG3A 2WX1A 4AP4C 3SDLC 3DVNU 4BOZB 2N9EB 4FULA 1I42A 3WAPA 1WJ6A 4M8MA 4ZYNA 1UH6A 4RM8A 2LGDA 1WXVA 3V61A 2RD0A 4W9FA 3VTVA 1Q5WB 3ZKJC 3GOEA 4HJKA 2KWCA 2J0KA 2D11A 2KVRA 2LRUA 3VQIA 4PYUA 2FUHB 4W9HA 2L7RA 3PREA 2ZCBA 5L95C 1WR1A 4IWPA 2PE6B 4TQ0A 2JZZA 3QX1A 3RZFA 2KTRA 5LXIB 3IVFA 3BY4B 1V2YA 3QK0A 3A1QA 3HM6X 5D6JB 3WA0A 2DYMA 2IO0B 3DBHI 1WYWB 3A4SC 2REXA 3PHWB 2M4NA 3NY5A 1PQSA 1EUVB 1WX9A 2NR2A 4GN1A 1YJ1A 4HVBA 2KTFA 2MW5A 2BWFA 2G45B 2M17A 4NY0A 4PYZA 3A9KA 5CHFA 4FJZA 2RPQA 5LLIA 3IFWB 5E6PA 1E8ZA 2PPHA 2AWTA 4DK5A 4BVUC 3ZRCA 1J8CA 2FNJB 2KMCA 2BKFA 4W9EA 3VTUA 3PV1A 3HIZA 3ML9A 4WJPA 2RSUA 3AU5A 4G11A 5D7GA 1V80A 2LWPA 4KV2A 3R7RA 1H8CA 1EF1A 4NAWB 4NPNA 4ZRIA 2J0JA 2XK5A 4IUMB 4IM3A 2N9XA 2DYOA 3VFKA 1UBIA 3PLUA 2BGFA 4GDKA 3TMPB 3X23A 4FADA 4WJQA 4KZCA 2NPTB 4B95A 2DZJA 1WGHA 2K6DB 1E8XA 3JSVA 3Q3FA 4YL8A 3RULA 3WANA 2DHZA 2WWZA 1UELA 1E8YA 2KANA 2YVCA 3O65B 2B3AA 2WX0A 2KQ7A 3H9DA 4MEMA 4MJSA 3L17A 4FJYA 4KIKB 4WJNA 4GMVA 4LCDE 1V9JA 4WWPA 4ANVA 3QWZB 3VAWA 3EFUA 4LDTD 5G55A 5DCNA 1V5TA 3C0RB 4URKA 3ECIA 4MM3A 4ASWC 2JWZA 4RM9A 3AI5A 4W9GA 4M8NA 2MWSB 2C7NB 1P98A 4DWFA 3N3KB 2D3GA 4EKUA 5G2NA 2GMIC 1WGDA 2ZPNA 2IY0B 3A33B 2VRRB 3PVLA 4MDKE 2K8CA 4MGIE 3B1LX 4ANXA 2FCQA 4F1SA 2DZKA 2MX2A 1V86A 4DHJB 1UGMA 3RUIB 3AULA 3L08A 2BYFA 4HCPB 1V5OA 4RMAA 5C1ZA 2KMAA 2QHOA 5TR5A 3RYTA 2JT4B 5JZEB 2LVOA 4IWQA 3PT2B 2NCNA 2C5LC 1LFDA 3ZRFA 1L2NA 4A3PA 4IW0A 2V1YA 5EDSA 3NHEB 3HK0A 2ZPYA 3AXCA 3KUCB 2CHWA 2FIDA 3UGBB 1KLVA 4W9DA 1KM7A 3A9KB 2C9WB 4HDQA 3UIOB 3QHTA 4CO7A 2Y5BB 3NOBA 4GDLA 3DVNV 4DXAB 1CMXB 4ZDVA 4BKSD 1KJTA 3EHVA 4FHJA 3TBLD 1TTNA 1I35A 3PHXB 4CYEA 4GB9A 2LASA 3EC8A 1U4AA 1P1AA 3HHMA 1YQBA 4F7ZA 3M62B 2HE7A 2KX0A 4FBJB 3K9PB 4I6LB 4AOFA 4A3OA 3I3TB 4NJ6A 4ZRKA 3VH4B 1V6EA 2BYVE 3DQVA 2DZIA 1TGZB 3UF8A 1OQYA 5DPTA 3V60A 3ZVVA 4F8CB 3PSEB 1IP9A 2GBKA 3ML8A 5CX3A 1P3QU 3KUZA 2NBUA 4AUQC 2MLBA 2XBBC 4MJSB 3TCAA 2BPSA 5GMVA 5J17A 1F9JA 1H4RA 4FLHA 4LJPB 1ZKHA 2KC1A 4B6WA 2MSED 3VDZA 3ALBA 4IM2A 3CF6E 2GBNA 4GSWA 3DBLI 4WAAA 5AZFA 4E71A 3D32A 5IA7A 2BF8B 2L05A 3KUDB 4ICUA 2MBHA 1VCBA 3DOWA 2CU1A 4EFOA 1G6JA 2KFKA 3WAOA 2L3ZA 1NDDA 1GNUA 2IYDB 4XZ4A 4ZRJA 4BKSA 2J0MA 1E8WA 4KDLB 2BYEA 5CTRC 3ZNHB 5CHWA 1P9DU 4GOCA 3B08A 1C3TA 4GU2A 2LVPA 4DDID 1RLFA 2KDEB 4II2B 3W1SC 1T0YA 3L16A 2IO1B 3DDCB 1OGWA 3KH0A 1GC6A 1V49A 3N30A 2N1VA 2GOWA 2V4LA 1C1YB 2KDIA 1WX8A 4GXBA 4K7WA 5E6NA 3WAMA 4HDOA 1MG8A 4OVUA 4EZJA 3A4RA 2JRIB 4W9KA 2RR9A 4BKTA 3NZUA 2L0TA 2A4ZA 2FCMA 2N4FA 1WI0A 1VD2A 4GGQA 3ZDMC 2AEHA 1OEYJ 5JHBA 2HJ8A 4BOSC 2C7HA 3PRMB 1QZEA 1OEYA 3T8MA 1L7YA 2ZNVC 2MBOA 5KHQA 4FA6A 3MJWA 2ZNVB 3SD5A 3KVFB 4G50A 4MGZE 2JVCA 3CMMB 4GDLB 1UZXB 2V3SA 5HKHA 2J7QB 2KDFB 1WXSA 2KWUB 2Z0EB 3HM3A 4LJOB 3QQ8B 3L10B 2C60A 3ZUNA 5D94A 2D10A 2KK8A 2KO3A 2KOXA 1NBFC 2MRPA 2HD5B 4NQLB 3V6CB 2DZMA 2GBMA 4G3XB 3VVWB 3NZSA 3L0WB 2NBVB 3OJ3A 3GZNI 1SE9A 1Q0WB 1WJUA 2BWES 2G4SA 4K7SA 2K25A 4JGHB 2MQJA 2ASQA 5JHAA 2Z59B 2JPHA 3V6EB 3R7QA 2CR5A 2G3QB 1WX7A 4IG7B 3VXWA 5L83A 1SIFA 3UIPB 3AU4A 3VH3B 5J2RA 1UBQA 2JUOA 2MBQA 3A9JA 4MSQB 4TKNA 3R3MA 1Z2MA 3K9OB 4WWOA 3ZO5B 1OTRB 3UINB 2MA9B 4X57B 2O2VA 2KDBA 4W9JA 4HPLB 4IC7B 2YLMA 3S2AA 3UQAA 2KD0A 4GIVA 4I6NB 4II3B 2G4DB 2GBRA 2WDTB 3IG3A 2KTRB 4W9IA 3DPDA 3KW5B 2K8HA 3A1QB 1WM2A 2ZVOA 4PS7A 4TUUA 2KFJA 2D07B 4EZLA 2KFKB 3WALA 1WZ3A 3JYUA 1M94A 3PRZA 2NVUI 1TBEA 1LXDA 3EECA 3H1UA 2N7DA 2KQSA 1WJ4A 3KYDD 1P0RA 3LJ3A 4HCNB 4NJ7A 4KSLC 4ANUA 2LZ6A 3KYCD 1IYFA 4AJYB 2KN5A 2ZEQA 4EOYA 2LI5A 2O6VD 3M95A 3VUYA 2KNBA 1YIWA 2M1MA 2IO3B 4HWIB 2BKRB 5IAAC 4HPMB 1Q1OA 3MTNB 4NAWA 1NI2A 3BINA 4WJOA 2KC2A 2XK5B 4G0NB 1E7VA 2AL3A 5CHVC 3APDA 2K8BA 1S3SG 4A20A 4W9LA 3H7SA 2FAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QA8 A;  3IBE A;  1WXA A;  3JSV B;  2NS5 A;  4BBN C;  2DEN B;  2LVQ A;  1E90 A;  2KZR A;  2K1F A;  2PEA A;  3JW0 X;  3APC A;  2MBE A;  3N32 A;  1WM3 A;  3V62 A;  3QJZ A;  4KIK A;  3LDZ E;  1WGG A;  3WIM A;  1GUA B;  4KDI C;  2EKE C;  4P7I A;  3B0A A;  1WIA A;  2DX5 B;  1WGY A;  1WZ0 A;  1X1M A;  2KJR A;  3U7D A;  1SGH A;  3JVZ X;  3ZW3 A;  3L13 A;  1WE7 A;  1S1Q B;  4MGK E;  1EF5 A;  2OOB B;  2KHW B;  3PPA A;  1WXM A;  3DCG A;  4IM0 A;  3L54 A;  1R4M I;  3VTW A;  2JRH A;  1E7U A;  3X0W A;  1J0G A;  3SU8 X;  2JY6 A;  3M63 B;  4FJV B;  1LQB A;  2O6V A;  1RAX A;  2FCS A;  4WWN A;  4K7U A;  3ENE A;  5J18 A;  4JLC A;  3DBR I;  3CST A;  4PS3 A;  3U30 A;  1AAR A;  2PJH A;  3ZDT A;  3ZIM A;  1JRU A;  2DAJ A;  3ZLZ A;  3ZNG C;  5AZG A;  4DBG A;  3H7P A;  3A9J B;  3TL5 A;  4BFR A;  3OJ4 B;  2ZVN A;  1WF9 A;  1WY8 A;  2CHZ A;  2L0F A;  4E3C A;  3T9L A;  2O2V B;  5D2M B;  2CKH B;  2OJR A;  3SHQ A;  3U8Z A;  3DBS A;  4XC2 A;  2Z0D B;  3DVG X;  1V81 A;  4IWO A;  1WJN A;  3QAQ A;  2PE9 A;  2UWQ A;  5E6O A;  3R66 C;  4JIO U;  2IO2 B;  4HXD A;  4XX5 A;  2KXJ A;  2UYZ B;  1J19 A;  4B9K A;  4EUT A;  1XT9 B;  2DAF A;  4PS8 A;  3UQB A;  2FIF A;  4KVG B;  1WR6 E;  2DYB A;  1WGR A;  4LDT B;  2RGF A;  4K1R B;  2KX3 A;  2L00 B;  3RZW C;  1BT0 A;  3TIX A;  1FXT B;  3CSF A;  5FR6 A;  4DHZ B;  1A5R A;  1KOT A;  5AZH A;  3TJP A;  1WMH A;  1E5W A;  2LGY A;  3NS8 A;  2KJH B;  1RRB A;  2KWV B;  2XEW A;  2LD9 A;  3VUW A;  2MP2 A;  2WYQ A;  3PGE A;  1Y8R C;  1LM8 B;  2KLC A;  2KKC A;  2LXC A;  4HLE A;  2L8J A;  3W1Y A;  2C7M B;  2NBW B;  2LGX A;  2JZ3 B;  3PZD A;  1K8R B;  2EMS A;  4HK2 A;  4AJW A;  4W9C A;  3PS6 A;  1XQQ A;  3M3J A;  2HTH A;  4MGY E;  2K39 A;  4WQO B;  4BKG A;  4KZ0 A;  2EMT A;  3PTF C;  3VHT C;  1YD8 U;  1R4N I;  4KSK C;  3RCZ A;  1HE8 A;  1YX5 B;  2W9N A;  2N9P C;  4MH0 E;  2LUE A;  3QC8 B;  2A5U A;  2R2O A;  3ONS A;  3OAW A;  1WH3 A;  4MEL A;  1XD3 B;  2IBI B;  2K6Q A;  2IZV B;  4E74 A;  2LRW A;  5LXH A;  2JF5 A;  2AYO B;  5JH5 C;  4DHZ E;  2O6V B;  2D2Q A;  2N1W A;  2ZCC A;  2IY1 B;  2I1J A;  1ISN A;  2CHX A;  2R2Q A;  2AL6 A;  4J6I A;  4EEW A;  1Z5S B;  1GC7 A;  4NNJ B;  1D3Z A;  4M0W B;  3PLV A;  3H7P B;  3QIJ A;  5C23 A;  3W1S A;  1TZ1 A;  4K81 A;  2FCN A;  2M8S A;  3ZNZ B;  4FN2 A;  3ZTC A;  3Q3J A;  4ANW A;  1WFY A;  3MHS D;  3P2B A;  4TQ1 A;  3RT3 B;  3QCA A;  4FHK A;  3IHP C;  2MCN B;  3ZNI D;  4DHJ D;  2L76 A;  3QAR A;  4BBN F;  3RD2 A;  1WE6 A;  4OVV A;  2M0X A;  5AEK B;  4AWJ A;  2LXA A;  2CS4 A;  2NPT A;  2MBB B;  3H6N A;  5DPR A;  5DPW A;  1ZGU B;  3APF A;  3ZTD A;  5BO4 B;  5KHO A;  4MSM B;  4ICV A;  4JQW C;  3VUX A;  2N7E A;  2JXX A;  3OLM D;  4CHK A;  1YX6 B;  3DVG Y;  4GDK B;  1IPG A;  4N9F 4;  2KJ6 A;  1UD7 A;  1ZW7 A;  2LJ5 A;  1RFA A;  1WMH B;  4I6P A;  4TV3 A;  4DDG D;  2ZJD A;  3PRP B;  4EZK A;  1GJZ A;  1EO6 A;  1WRD B;  2GBJ A;  4JL9 A;  2ZZP B;  4NQK E;  5DPS A;  2MP2 B;  2I1K A;  2KLG A;  1GG3 A;  2WX1 A;  4AP4 C;  3SDL C;  3DVN U;  4BOZ B;  2N9E B;  4FUL A;  1I42 A;  3WAP A;  1WJ6 A;  4M8M A;  4ZYN A;  1UH6 A;  4RM8 A;  2LGD A;  1WXV A;  3V61 A;  2RD0 A;  4W9F A;  3VTV A;  1Q5W B;  3ZKJ C;  3GOE A;  4HJK A;  2KWC A;  2J0K A;  2D11 A;  2KVR A;  2LRU A;  3VQI A;  4PYU A;  2FUH B;  4W9H A;  2L7R A;  3PRE A;  2ZCB A;  5L95 C;  1WR1 A;  4IWP A;  2PE6 B;  4TQ0 A;  2JZZ A;  3QX1 A;  3RZF A;  2KTR A;  5LXI B;  3IVF A;  3BY4 B;  1V2Y A;  3QK0 A;  3A1Q A;  3HM6 X;  5D6J B;  3WA0 A;  2DYM A;  2IO0 B;  3DBH I;  1WYW B;  3A4S C;  2REX A;  3PHW B;  2M4N A;  3NY5 A;  1PQS A;  1EUV B;  1WX9 A;  2NR2 A;  4GN1 A;  1YJ1 A;  4HVB A;  2KTF A;  2MW5 A;  2BWF A;  2G45 B;  2M17 A;  4NY0 A;  4PYZ A;  3A9K A;  5CHF A;  4FJZ A;  2RPQ A;  5LLI A;  3IFW B;  5E6P A;  1E8Z A;  2PPH A;  2AWT A;  4DK5 A;  4BVU C;  3ZRC A;  1J8C A;  2FNJ B;  2KMC A;  2BKF A;  4W9E A;  3VTU A;  3PV1 A;  3HIZ A;  3ML9 A;  4WJP A;  2RSU A;  3AU5 A;  4G11 A;  5D7G A;  1V80 A;  2LWP A;  4KV2 A;  3R7R A;  1H8C A;  1EF1 A;  4NAW B;  4NPN A;  4ZRI A;  2J0J A;  2XK5 A;  4IUM B;  4IM3 A;  2N9X A;  2DYO A;  3VFK A;  1UBI A;  3PLU A;  2BGF A;  4GDK A;  3TMP B;  3X23 A;  4FAD A;  4WJQ A;  4KZC A;  2NPT B;  4B95 A;  2DZJ A;  1WGH A;  2K6D B;  1E8X A;  3JSV A;  3Q3F A;  4YL8 A;  3RUL A;  3WAN A;  2DHZ A;  2WWZ A;  1UEL A;  1E8Y A;  2KAN A;  2YVC A;  3O65 B;  2B3A A;  2WX0 A;  2KQ7 A;  3H9D A;  4MEM A;  4MJS A;  3L17 A;  4FJY A;  4KIK B;  4WJN A;  4GMV A;  4LCD E;  1V9J A;  4WWP A;  4ANV A;  3QWZ B;  3VAW A;  3EFU A;  4LDT D;  5G55 A;  5DCN A;  1V5T A;  3C0R B;  4URK A;  3ECI A;  4MM3 A;  4ASW C;  2JWZ A;  4RM9 A;  3AI5 A;  4W9G A;  4M8N A;  2MWS B;  2C7N B;  1P98 A;  4DWF A;  3N3K B;  2D3G A;  4EKU A;  5G2N A;  2GMI C;  1WGD A;  2ZPN A;  2IY0 B;  3A33 B;  2VRR B;  3PVL A;  4MDK E;  2K8C A;  4MGI E;  3B1L X;  4ANX A;  2FCQ A;  4F1S A;  2DZK A;  2MX2 A;  1V86 A;  4DHJ B;  1UGM A;  3RUI B;  3AUL A;  3L08 A;  2BYF A;  4HCP B;  1V5O A;  4RMA A;  5C1Z A;  2KMA A;  2QHO A;  5TR5 A;  3RYT A;  2JT4 B;  5JZE B;  2LVO A;  4IWQ A;  3PT2 B;  2NCN A;  2C5L C;  1LFD A;  3ZRF A;  1L2N A;  4A3P A;  4IW0 A;  2V1Y A;  5EDS A;  3NHE B;  3HK0 A;  2ZPY A;  3AXC A;  3KUC B;  2CHW A;  2FID A;  3UGB B;  1KLV A;  4W9D A;  1KM7 A;  3A9K B;  2C9W B;  4HDQ A;  3UIO B;  3QHT A;  4CO7 A;  2Y5B B;  3NOB A;  4GDL A;  3DVN V;  4DXA B;  1CMX B;  4ZDV A;  4BKS D;  1KJT A;  3EHV A;  4FHJ A;  3TBL D;  1TTN A;  1I35 A;  3PHX B;  4CYE A;  4GB9 A;  2LAS A;  3EC8 A;  1U4A A;  1P1A A;  3HHM A;  1YQB A;  4F7Z A;  3M62 B;  2HE7 A;  2KX0 A;  4FBJ B;  3K9P B;  4I6L B;  4AOF A;  4A3O A;  3I3T B;  4NJ6 A;  4ZRK A;  3VH4 B;  1V6E A;  2BYV E;  3DQV A;  2DZI A;  1TGZ B;  3UF8 A;  1OQY A;  5DPT A;  3V60 A;  3ZVV A;  4F8C B;  3PSE B;  1IP9 A;  2GBK A;  3ML8 A;  5CX3 A;  1P3Q U;  3KUZ A;  2NBU A;  4AUQ C;  2MLB A;  2XBB C;  4MJS B;  3TCA A;  2BPS A;  5GMV A;  5J17 A;  1F9J A;  1H4R A;  4FLH A;  4LJP B;  1ZKH A;  2KC1 A;  4B6W A;  2MSE D;  3VDZ A;  3ALB A;  4IM2 A;  3CF6 E;  2GBN A;  4GSW A;  3DBL I;  4WAA A;  5AZF A;  4E71 A;  3D32 A;  5IA7 A;  2BF8 B;  2L05 A;  3KUD B;  4ICU A;  2MBH A;  1VCB A;  3DOW A;  2CU1 A;  4EFO A;  1G6J A;  2KFK A;  3WAO A;  2L3Z A;  1NDD A;  1GNU A;  2IYD B;  4XZ4 A;  4ZRJ A;  4BKS A;  2J0M A;  1E8W A;  4KDL B;  2BYE A;  5CTR C;  3ZNH B;  5CHW A;  1P9D U;  4GOC A;  3B08 A;  1C3T A;  4GU2 A;  2LVP A;  4DDI D;  1RLF A;  2KDE B;  4II2 B;  3W1S C;  1T0Y A;  3L16 A;  2IO1 B;  3DDC B;  1OGW A;  3KH0 A;  1GC6 A;  1V49 A;  3N30 A;  2N1V A;  2GOW A;  2V4L A;  1C1Y B;  2KDI A;  1WX8 A;  4GXB A;  4K7W A;  5E6N A;  3WAM A;  4HDO A;  1MG8 A;  4OVU A;  4EZJ A;  3A4R A;  2JRI B;  4W9K A;  2RR9 A;  4BKT A;  3NZU A;  2L0T A;  2A4Z A;  2FCM A;  2N4F A;  1WI0 A;  1VD2 A;  4GGQ A;  3ZDM C;  2AEH A;  1OEY J;  5JHB A;  2HJ8 A;  4BOS C;  2C7H A;  3PRM B;  1QZE A;  1OEY A;  3T8M A;  1L7Y A;  2ZNV C;  2MBO A;  5KHQ A;  4FA6 A;  3MJW A;  2ZNV B;  3SD5 A;  3KVF B;  4G50 A;  4MGZ E;  2JVC A;  3CMM B;  4GDL B;  1UZX B;  2V3S A;  5HKH A;  2J7Q B;  2KDF B;  1WXS A;  2KWU B;  2Z0E B;  3HM3 A;  4LJO B;  3QQ8 B;  3L10 B;  2C60 A;  3ZUN A;  5D94 A;  2D10 A;  2KK8 A;  2KO3 A;  2KOX A;  1NBF C;  2MRP A;  2HD5 B;  4NQL B;  3V6C B;  2DZM A;  2GBM A;  4G3X B;  3VVW B;  3NZS A;  3L0W B;  2NBV B;  3OJ3 A;  3GZN I;  1SE9 A;  1Q0W B;  1WJU A;  2BWE S;  2G4S A;  4K7S A;  2K25 A;  4JGH B;  2MQJ A;  2ASQ A;  5JHA A;  2Z59 B;  2JPH A;  3V6E B;  3R7Q A;  2CR5 A;  2G3Q B;  1WX7 A;  4IG7 B;  3VXW A;  5L83 A;  1SIF A;  3UIP B;  3AU4 A;  3VH3 B;  5J2R A;  1UBQ A;  2JUO A;  2MBQ A;  3A9J A;  4MSQ B;  4TKN A;  3R3M A;  1Z2M A;  3K9O B;  4WWO A;  3ZO5 B;  1OTR B;  3UIN B;  2MA9 B;  4X57 B;  2O2V A;  2KDB A;  4W9J A;  4HPL B;  4IC7 B;  2YLM A;  3S2A A;  3UQA A;  2KD0 A;  4GIV A;  4I6N B;  4II3 B;  2G4D B;  2GBR A;  2WDT B;  3IG3 A;  2KTR B;  4W9I A;  3DPD A;  3KW5 B;  2K8H A;  3A1Q B;  1WM2 A;  2ZVO A;  4PS7 A;  4TUU A;  2KFJ A;  2D07 B;  4EZL A;  2KFK B;  3WAL A;  1WZ3 A;  3JYU A;  1M94 A;  3PRZ A;  2NVU I;  1TBE A;  1LXD A;  3EEC A;  3H1U A;  2N7D A;  2KQS A;  1WJ4 A;  3KYD D;  1P0R A;  3LJ3 A;  4HCN B;  4NJ7 A;  4KSL C;  4ANU A;  2LZ6 A;  3KYC D;  1IYF A;  4AJY B;  2KN5 A;  2ZEQ A;  4EOY A;  2LI5 A;  2O6V D;  3M95 A;  3VUY A;  2KNB A;  1YIW A;  2M1M A;  2IO3 B;  4HWI B;  2BKR B;  5IAA C;  4HPM B;  1Q1O A;  3MTN B;  4NAW A;  1NI2 A;  3BIN A;  4WJO A;  2KC2 A;  2XK5 B;  4G0N B;  1E7V A;  2AL3 A;  5CHV C;  3APD A;  2K8B A;  1S3S G;  4A20 A;  4W9L A;  3H7S A;  2FAZ A; 
#chains in the Genus database with same CATH topology
 2ICI A;  4LTU A;  3JW0 X;  2KZR A;  3N32 A;  3APC A;  1WM3 A;  4ZHO A;  3LDZ E;  3WIM A;  4KDI C;  2WXR A;  3B0A A;  1WIA A;  2DX5 B;  1X1M A;  3ZW3 A;  3L13 A;  1IGC A;  1EF5 A;  2KHW B;  2EKI A;  4IM0 A;  1L5P A;  4FJV B;  2O6V A;  4WWN A;  5J18 A;  3CWI A;  5IKC M;  2PJH A;  3ZIM A;  3ZLZ A;  1HEZ E;  4M0W A;  5AZG A;  3NG0 A;  4E3C A;  1WY8 A;  2CHZ A;  2L0F A;  3T9L A;  2O2V B;  3AEF B;  2CKH B;  3SHQ A;  4XC2 A;  4USA A;  4PK1 A;  1V81 A;  2H89 B;  5TSS A;  2PE9 A;  5E6O A;  3EUB 2;  2KXJ A;  2UYZ B;  2DAF A;  1DOI A;  2HDE A;  4P1C C;  1WR6 E;  2DYB A;  1WGR A;  2D5G A;  4LDT B;  3TIX A;  3NVZ A;  4IDI A;  1PFD A;  3NS8 A;  2WXO A;  5FR3 A;  3BYT B;  4DXF A;  2KWV B;  4PT5 A;  2MP2 A;  2WYQ A;  3PGE A;  2KLC A;  2ACZ B;  4XE0 A;  4HLE A;  3ZXV A;  1FRR A;  1XQQ A;  3MP9 A;  3PTF C;  4MAC A;  3R2T A;  4NZL B;  1QQR A;  3HRD D;  1AWD A;  2I2Y A;  2N9P C;  2KAC A;  3QC8 B;  3OAW A;  2Y5P A;  1WH3 A;  1XD3 B;  2IZV B;  3AM9 A;  1KF6 B;  5JH5 C;  4JE3 B;  2O6V B;  3TSS A;  2IY1 B;  1ENF A;  2CHX A;  4YWG G;  1D3Z A;  2AX5 A;  4M0W B;  5C23 A;  1TZ1 A;  2FCN A;  2M8S A;  4KGS A;  3ZTC A;  4ANW A;  3P2B A;  4TQ1 A;  4FHK A;  3ZNI D;  4DHJ D;  4OVV A;  5AEK B;  2WXI A;  2IJ0 A;  2NPT A;  2MBB B;  1NEK B;  2D3C A;  3APF A;  4MSM B;  4JQW C;  3VUX A;  2N7E A;  4CHK A;  5GXG B;  1K52 A;  3DVG Y;  3B9J A;  4KX6 B;  4DDG D;  2OJW A;  4NQK E;  2ZZP B;  1DYQ A;  2MP2 B;  4A90 A;  3SDL C;  4B0E A;  4FUL A;  1WJ6 A;  4RM8 A;  3ZJV A;  3VTV A;  1IBX A;  2ZW1 A;  3ZKJ C;  4KKI A;  5T8I A;  3VQI A;  2ZCB A;  2J42 A;  2M56 B;  2CU3 A;  3RZF A;  1FXA A;  5LXI B;  3BY4 B;  3A1Q A;  3HM6 X;  3WA0 A;  2IO0 B;  2BS3 B;  3T3O A;  1WYW B;  3PHW B;  2M4N A;  1EUV B;  2NR2 A;  4GN1 A;  1YJ1 A;  1QOB A;  4NY0 A;  3H8H A;  1V97 A;  2RPQ A;  1C76 A;  3P4S B;  4DK5 A;  4BVU C;  1D5X C;  3AH7 A;  2KMC A;  2LHE A;  1D4B A;  4W9E A;  3HIZ A;  3ML9 A;  1F0Z A;  1PGX A;  2RSU A;  1V80 A;  4KV2 A;  1L0V B;  4ZRI A;  1YMH E;  4IM3 A;  4JX1 C;  4GLS C;  1I4X A;  5H8Y E;  2K5P A;  4WJQ A;  4KZC A;  2NPT B;  4B95 A;  3JSV A;  3Q3F A;  5BMH A;  3WAN A;  1UUP A;  2VZK D;  3AED B;  2YVC A;  3O65 B;  4MEM A;  3L17 A;  2Q5W D;  4FJY A;  4KIK B;  4ANV A;  3VAW A;  2WDV B;  3BK1 A;  4ASW C;  1YN3 A;  4W9G A;  1PUT A;  4HJG E;  1VRA B;  1JML A;  3W9C B;  4LNK A;  2ZPN A;  4XDC A;  1IBX B;  2VRR B;  1JWB D;  3B1L X;  4MGI E;  2FCQ A;  1ZOY B;  1K51 A;  1V5O A;  2QHO A;  5TR5 A;  2CJN A;  2LVO A;  2NCN A;  1NEN B;  3AV8 A;  1CK1 A;  1GB4 A;  3P1M A;  2WXQ A;  2Y5C A;  3DHH C;  2PW9 A;  1FIQ A;  1N61 A;  5D3I B;  3UIO B;  5FK9 C;  1HXY D;  5FKA C;  2Y5B B;  3NOB A;  1B1Z A;  3DVN V;  3AE8 B;  1T3Q A;  2GRI A;  4ZDV A;  4BKS D;  1KJT A;  1TS3 A;  1JWU D;  1TTN A;  1I35 A;  3R2I A;  2K3U A;  4GB9 A;  2LAS A;  3EC8 A;  2YEP B;  3HHM A;  1JW9 D;  1YQB A;  2KX0 A;  2G1E A;  1KRH A;  2WXL A;  4I6L B;  4AOF A;  3I3T B;  4NJ6 A;  3VH4 B;  4N58 A;  3RNE C;  2JQR B;  1XF5 L;  1T0R C;  1F1H A;  1FFV A;  1VZ6 A;  2DZI A;  1OQY A;  5DPT A;  3V60 A;  3P4R B;  4F8C B;  3Q8F A;  2J4X A;  2NBU A;  2XBB C;  5GMV A;  1ZKH A;  4B6W A;  2MSE D;  4J3O D;  2GBN A;  4WAA A;  3D32 A;  5BYQ A;  2L05 A;  4ICU A;  3NRZ A;  2L83 A;  3CIR B;  2IYD B;  4ZRJ A;  2J0M A;  1E8W A;  2E6X A;  1RLF A;  1YQ3 B;  2BS4 B;  2KDI A;  3WAM A;  5E6N A;  1MG8 A;  4BKT A;  1XXG A;  1VD2 A;  1OEY J;  2PKO A;  4BOS C;  2KWD A;  3MC8 A;  1L7Y A;  5KHQ A;  2WXM A;  4LNN A;  2INP E;  2DNF A;  5HKH A;  4D2K A;  2KDF B;  5HI1 A;  3HM3 A;  2J53 A;  4JPS A;  2C60 A;  2Z8L A;  4NQL B;  3VVW B;  2QEJ C;  3SEB A;  1ZE3 D;  3OJ3 A;  1SE9 A;  1Q0W B;  4K7S A;  1WSP A;  5JHA A;  3R7Q A;  2G3Q B;  1N5X A;  1XLQ A;  5L83 A;  3AU4 A;  1OFF A;  2KVZ A;  2MBQ A;  4TKN A;  3RFZ B;  3K9O B;  3ZO5 B;  4X57 B;  1SEB D;  2KDB A;  2BQQ A;  4W9J A;  3UQA A;  4GIV A;  4II3 B;  2G4D B;  2GBR A;  2NMQ A;  2KTR B;  1KLU D;  1FFU A;  1HZ5 A;  2K8H A;  4TUU A;  2D07 B;  3WAL A;  1WZ3 A;  3JYU A;  3NVW A;  5H92 C;  1YQ4 B;  1EM7 A;  2QC8 A;  2NTS A;  3LJ3 A;  4ANU A;  2LZ6 A;  2KN5 A;  2ZEQ A;  4EOY A;  2W55 A;  2BT6 A;  1YIW A;  1FCC C;  4HWI B;  4NAW A;  3T3N A;  1J7B A;  3FIL A;  2RDB C;  5EE3 A;  3RNG C;  2XK5 B;  5CHV C;  3H7S A;  3QA8 A;  1JRP A;  1WXA A;  1JWS D;  1VZ8 A;  3ABV B;  2MBE A;  2N7J A;  1WGG A;  2EEL A;  1GAQ B;  1GUA B;  2EKE C;  1L6U A;  2K0P A;  3IT6 B;  1WZ0 A;  2KJR A;  3U7D A;  2KN4 A;  1EWY C;  1WE7 A;  1S1Q B;  1QT9 A;  2V9H A;  2OOB B;  1WXM A;  2VH2 A;  1KFY B;  1E7U A;  2JY6 A;  2UU7 A;  3ENE A;  4JLC A;  1GOZ A;  3DBR I;  3PZ8 A;  3CST A;  3ZDT A;  1J7C A;  3AEA B;  3ZNG C;  3H7P A;  3ZGZ A;  1TZO A;  5D2M B;  2KMM A;  2Z0D B;  5EE0 A;  1FNW A;  4IWO A;  1ZXH A;  1ET9 A;  2N0S B;  3B2G A;  2IO2 B;  4HXD A;  3AB5 A;  4EUT A;  3UQB A;  2MJ3 A;  2H88 B;  3FIL B;  2WGS A;  3VUW A;  4XYC A;  2PTL A;  3ZXR A;  2LXC A;  3AE3 B;  2L8J A;  4S17 A;  2C7M B;  3I5J C;  4AJW A;  3MFG A;  4W9C A;  1BXT A;  3PS6 A;  1E10 A;  1ROE A;  2HTH A;  4MGY E;  4BKG A;  2TSS A;  3DWM A;  3RCZ A;  2DBY A;  3ONS A;  2ON8 A;  3W5U B;  1FXI A;  2IBI B;  2R61 A;  2LRW A;  5LXH A;  2JF5 A;  2AYO B;  2D2Q A;  2ZCC A;  4A9A A;  3L4P A;  1N60 A;  2R2Q A;  4J6I A;  4EEW A;  1TKE A;  2FBW B;  1GC7 A;  4YTM B;  3H7P B;  3QIJ A;  1ZP0 B;  1SIJ A;  3PO0 A;  4YSY B;  3ETR A;  3Q3J A;  1WFY A;  4BBN F;  2BVC A;  3BVG A;  4AWJ A;  3NS1 A;  2LGI A;  1C9F A;  2MHJ A;  5DPR A;  1ZGU B;  2IDY A;  3ZTD A;  2WP9 B;  5E6J A;  3TEZ A;  1BML C;  1YX6 B;  4N9F 4;  2BYT A;  1RFA A;  2BBC A;  4A8X C;  1ET6 A;  1WGK A;  1C79 A;  4I6P A;  3ZQ4 A;  1GJZ A;  1WRD B;  1XLO A;  2GBJ A;  4AP4 C;  2RPV A;  3DVN U;  4BOZ B;  4M00 A;  2RD0 A;  2J52 A;  3I57 A;  1WYG A;  2D11 A;  1TYG B;  2OHF A;  1FPY A;  2JZZ A;  1V2Y A;  5D6J B;  1LGR A;  3NY5 A;  4HVB A;  2KTF A;  2MW5 A;  2BWF A;  2G45 B;  3MC9 A;  3A9K A;  3AEG B;  5E6P A;  1SE2 A;  2FNJ B;  3PV1 A;  4G11 A;  5D7G A;  2LWP A;  3Q2A C;  1H8C A;  4IOI E;  2J0J A;  4IUM B;  3VFK A;  2N9X A;  1TS4 A;  4GDK A;  3X23 A;  3P42 A;  3TMP B;  1WGH A;  2WXK A;  3UI3 A;  1QIL A;  2WWZ A;  4AQ7 A;  3IXS A;  2B3A A;  4O1N A;  3H9D A;  2V4I B;  4GMV A;  1N5W A;  4WWP A;  2L52 A;  3EFU A;  4LDT D;  5G55 A;  5DCN A;  4URK A;  3C0R B;  2JWZ A;  3TEX A;  1QKZ A;  3EGR A;  2MWS B;  3OWE B;  3DBL B;  2WXH A;  2C7N B;  1P98 A;  4DWF A;  1C4C A;  5G2N A;  4P16 A;  1WGD A;  2IY0 B;  3PVL A;  4MDK E;  1F2R I;  2K8C A;  4ANX A;  3R8B A;  4DHJ B;  4C7Z A;  3KWV A;  3RUI B;  1ZDV A;  4HCP B;  1TIF A;  2GB1 A;  2KMA A;  1BUI C;  5JZE B;  4IWQ A;  2C5L C;  5HHD G;  4A3P A;  4IW0 A;  2V1Y A;  5EDS A;  3NHE B;  3HK0 A;  3AXC A;  1KM7 A;  4WH4 A;  3A9K B;  2PLP A;  4HDQ A;  2JX5 A;  4GDL A;  1CMX B;  2RDH A;  2M19 A;  3EHV A;  1WRI A;  3PHX B;  4CYE A;  3Q8A A;  2WS3 B;  4F7Z A;  3MC0 B;  3E56 A;  3PZ7 A;  3K9P B;  1CQV A;  3IAM 1;  3GZN B;  4ZRK A;  2OED A;  4ACF A;  2BYV E;  2WU2 B;  3DQV A;  3UF8 A;  5LNK 1;  3ZVV A;  1IP9 A;  2GBK A;  3ML8 A;  3KUZ A;  4YTN B;  4AUQ C;  2MLB A;  1XLN A;  3TCA A;  2BPS A;  3P4Q B;  1H4R A;  4FLH A;  4LJP B;  4ZRP A;  1MI0 A;  4IM2 A;  3CF6 E;  4A55 A;  3DBL I;  2BF8 B;  1VCB A;  1SXT A;  4EFO A;  2L3Z A;  1NDD A;  2MEK A;  4BKS A;  1IUE A;  2BYE A;  5CHW A;  1AYF A;  3HUI A;  3KWL A;  1P9D U;  1C3T A;  4EE2 A;  4II2 B;  4LNF A;  2GOW A;  2V4L A;  4OVU A;  1C77 A;  4W9K A;  2L0T A;  2A4Z A;  2FCM A;  2N4F A;  3V3X A;  4GGQ A;  4WAF A;  2HJ8 A;  2BB6 A;  3PRM B;  5AUK A;  4BAX A;  1QZE A;  1OEY A;  2ZNV C;  2XNA C;  4FA6 A;  3SD5 A;  4G50 A;  4MGZ E;  3CMM B;  4GDL B;  1UZX B;  2J7Q B;  4LJO B;  2Z0E B;  1MHX A;  2L1A A;  1FCL A;  1STE A;  3L10 B;  1HTQ A;  2KK8 A;  2KOX A;  2PIA A;  1NBF C;  4RNA A;  3N1Y C;  3GZN I;  2INC C;  1R4M B;  2JPH A;  1L0Y B;  3V6E B;  2BB5 A;  1WX7 A;  4IG7 B;  4DXG A;  3OG5 A;  3UIP B;  3Q3M C;  3Q8C A;  3VH3 B;  3A9J A;  2SAK A;  3MHZ A;  2AQ3 B;  2MA9 B;  3TUO A;  4IC7 B;  4HPL B;  1V8C A;  1J7A A;  4I6N B;  2WDT B;  1RFK A;  3IG3 A;  4P6V F;  3DPD A;  3A1Q B;  4PS7 A;  2KFJ A;  3FKY A;  2NVU I;  1TBE A;  1LXD A;  2N7D A;  2KQS A;  4HCN B;  3KYD D;  1P0R A;  3BWU D;  1K53 A;  4NJ7 A;  4QAY A;  3KYC D;  4AJY B;  2CJO A;  1RWS A;  5BMI A;  3M95 A;  2LHD A;  3C19 A;  2IO3 B;  3NVY A;  2BKR B;  1SJE D;  2JWU A;  3MTN B;  3VR9 B;  4G0N B;  3KQ4 A;  3LYY A;  2K8B A;  4MM3 A;  2MCN B;  4W9L A;  2WLB A;  2FAZ A;  1VLB A;  3IBE A;  3SFD B;  2RDG A;  2QIL A;  3JSV B;  2D3A A;  4BBN C;  2DEN B;  2LVQ A;  1E90 A;  2K1F A;  3QJZ A;  2KT7 A;  1EU4 A;  1XCQ L;  4KKJ A;  1HTO A;  4WQM A;  1KH0 A;  1SGH A;  4HPP A;  1R4N B;  3BK2 A;  1E6E B;  3PPA A;  3AE6 B;  3DCG A;  3L54 A;  1R4M I;  3VTW A;  1J0G A;  1ZUD 2;  1TKG A;  3M63 B;  2QJL A;  1TKY A;  2W3S A;  4IKG A;  4PS3 A;  3U30 A;  1AAR A;  2HJ1 A;  2QSD A;  2DAJ A;  4DBG A;  3A9J B;  3TL5 A;  1WF9 A;  1IGD A;  2BTE A;  1HQR D;  1OQR A;  4RGO S;  3N1Z C;  4HKQ A;  1Y56 A;  3QAQ A;  4LNO A;  2UWQ A;  2IPK D;  4JIO U;  1B9R A;  2X8X X;  1FM0 D;  1J19 A;  1XT9 B;  1UNS A;  1F77 A;  1N62 A;  2RGF A;  4K1R B;  3RZW C;  1BT0 A;  1FXT B;  1WWT A;  3I63 C;  2X38 A;  1KOT A;  5AZH A;  2LGY A;  2KJH B;  3WCQ A;  3RNF C;  1YNT E;  3BYY B;  5JXV A;  4MT5 A;  4MM3 B;  4Q2J A;  5BYR A;  3W1Y A;  2K22 A;  4RH6 A;  3AN1 A;  2NBW B;  2LGX A;  2EMS A;  4H2A A;  4HK2 A;  3AE4 B;  2WXP A;  1FD6 A;  1L0X B;  4KZ0 A;  2EMT A;  1I4P A;  1R4N I;  1VZ7 A;  4BZA A;  5IOI A;  1HE8 A;  2W9N A;  4WIP A;  1NYQ A;  3AMZ A;  3N20 C;  3RI7 C;  2LUE A;  2A5U A;  1ZPS A;  3GS2 A;  2LGS A;  4E74 A;  2XN9 C;  1AW7 A;  3DBH B;  4DHZ E;  3RNB C;  2N1W A;  1XLP A;  4TSS A;  2I1J A;  1ISN A;  2AL6 A;  1QLB B;  2ZW0 A;  3PLV A;  3I9V 1;  4FN2 A;  3EA6 A;  1HA5 A;  1TT5 B;  2LJI A;  2KQ4 X;  3MHS D;  4L23 A;  3QCA A;  3IHP C;  3RD2 A;  1NI3 A;  2M0X A;  2WDQ B;  2LXA A;  1MHH E;  4NJC A;  2JXT A;  3N1X C;  3NUH B;  4CQN A;  5KHO A;  3Q3O C;  3OLM D;  3C8Y A;  1UD7 A;  1SJH D;  2LJ5 A;  5D3D A;  5C2T B;  3AEB B;  4K3B A;  4M02 A;  3PRP B;  4YTP B;  1EO6 A;  1TY2 A;  4JL9 A;  2WU5 B;  5DPS A;  2I1K A;  2JSV X;  2IGG A;  3SFE B;  1RYJ A;  4MH8 A;  2Y3A A;  5MPO A;  1D5Z C;  2N9E B;  1I42 A;  4ZYN A;  2LGD A;  1WXV A;  1Q5W B;  3GE8 C;  4HJK A;  2KWC A;  1FNV A;  2KVR A;  2LRU A;  4W9H A;  2L7R A;  4US9 A;  4IWP A;  2PE6 B;  4TQ0 A;  3IVF A;  3QK0 A;  3W5V B;  3RN9 C;  2DYM A;  3DBH I;  2AQ2 B;  3N9Y C;  1PQS A;  1WX9 A;  3ZJU A;  4XWW A;  5LLI A;  3IFW B;  1E8Z A;  2WXF A;  4FXC A;  2AWT A;  3ZRC A;  1J8C A;  2BKF A;  1FEH A;  4WJP A;  3AU5 A;  1UWX A;  2JYT A;  1EF1 A;  4NAW B;  2DYO A;  1UBI A;  2PMV A;  3BVM A;  4FAD A;  2WNM A;  1JWM D;  3RUL A;  4YL8 A;  2LUM A;  2DHZ A;  2KAN A;  2LMC A;  3U2S C;  2WX0 A;  4MJS A;  4WJN A;  3Q8B A;  1TJE A;  3DWG C;  1JQ4 A;  1V9J A;  1K50 A;  1V5T A;  2FE8 A;  3AI5 A;  4OHJ A;  1E0Z A;  1D5M C;  2W54 A;  2MH7 A;  2D3B A;  2M0A A;  4ITK A;  3TEW A;  2KYW A;  2WQY B;  4F1S A;  1ESF A;  2MX2 A;  1UGM A;  3AUL A;  1TS2 A;  3L08 A;  2BYF A;  5C1Z A;  4OZA A;  3Q8E A;  1C4P A;  2JT4 B;  3LXF A;  4DQO C;  1LFD A;  3ZRF A;  1L2N A;  1V1P A;  4L2Y A;  2ZPY A;  3KUC B;  2CHW A;  3UGB B;  1KLV A;  1AN8 A;  1JAL A;  2C9W B;  1E7P B;  2MJE A;  1QOA A;  4CO7 A;  3AE2 B;  4DXA B;  3B2F A;  3HVD A;  2LEK A;  1L4D B;  1P1A A;  2HE7 A;  3RNA C;  1I4Q A;  4A3O A;  3IAS 1;  3J9C A;  1MPE A;  1JCK B;  2K9X A;  5CX3 A;  1P3Q U;  1TS5 A;  4MJS B;  1FO4 A;  5J17 A;  2RMM A;  4ARC A;  2NTT A;  3VDZ A;  3ALB A;  3ZYY X;  4GSW A;  4E71 A;  3KUD B;  2MBH A;  2CU1 A;  1G6J A;  1V1O A;  2WXN A;  4B0M A;  1SBB B;  4GOC A;  3B08 A;  4N59 A;  2KDE B;  2HTM E;  3W1S C;  1T0Y A;  2JYE A;  1UF0 A;  3DDC B;  2E3T A;  1GC6 A;  2N1V A;  4XWT A;  1C1Y B;  4GXB A;  4K7W A;  4HDO A;  1GB1 A;  2DWQ A;  2JRI B;  2RR9 A;  1M4V A;  3NZU A;  1V1P B;  1I7H A;  1WI0 A;  3ZDM C;  1E9M A;  2AEH A;  5JHB A;  3TEY A;  2MBO A;  5EE1 A;  3KVF B;  2PVG C;  2V3S A;  3ZUN A;  5D94 A;  2D10 A;  4RF1 A;  2MRP A;  2HD5 B;  2DZM A;  1T0Q C;  2I38 A;  2G4S A;  4JGH B;  2MQJ A;  4YSZ B;  3RPF C;  2IGD A;  2ASQ A;  2QMT A;  4RGN A;  2CR5 A;  1SIF A;  1F52 A;  1YN5 A;  1PYW D;  3P63 A;  1UBQ A;  1YJI A;  2JUO A;  3R3M A;  1Z2M A;  1OTR B;  1FMA D;  3S2A A;  3AE9 B;  2KD0 A;  1KTK A;  1PDX A;  4C80 A;  4W9I A;  3LB8 C;  4EZL A;  3PRZ A;  3AE5 B;  2VH1 A;  4KSL C;  5AUI A;  2G9H D;  2O6V D;  2KNB A;  2M1M A;  2SEB D;  5IAA C;  1Q1O A;  1EWC A;  4WUR A;  3BIN A;  4WJO A;  4YT0 B;  2AL3 A;  3APD A;  2JZ3 B;  1S3S G;  1HZ6 A;  4GDK B;  2AQ1 B;  5BYS A;  4XGA B;  2NS5 A;  5J2R A;  1XEE A;  3V62 A;  2PEA A;  1VDV A;  4KIK A;  5C3J B;  4NAM A;  4P7I A;  1WGY A;  3AEC B;  2JU6 X;  3JVZ X;  3FC4 A;  4KGR A;  4LLG M;  4MGK E;  4LK0 M;  2GLS A;  3E9S A;  2WXJ A;  3X0W A;  2JRH A;  2W82 A;  3SU8 X;  1LQB A;  1RAX A;  3NJT A;  2FCS A;  3HVZ A;  4K7U A;  4JWS C;  1JRO A;  4P1B C;  1JRU A;  4M01 A;  1I4G A;  4BFR A;  1R7S A;  3OJ4 B;  1L6V A;  2ZVN A;  1C4A A;  4OZC A;  2B76 B;  2OJR A;  3U8Z A;  4OZB A;  3DBS A;  3DVG X;  2VZK B;  1D6E C;  1WJN A;  3R66 C;  4XX5 A;  2IGH A;  2MJD A;  4B9K A;  4PS8 A;  2FIF A;  3AE1 B;  1YN4 A;  4KVG B;  3O13 A;  2KX3 A;  2L00 B;  4RCO A;  2GI9 A;  3CSF A;  5FR6 A;  4DHZ B;  1A5R A;  4YXD B;  3TJP A;  1WMH A;  1E5W A;  3U7Z A;  1RRB A;  2XEW A;  2LD9 A;  1RM6 C;  1Y8R C;  1LM8 B;  2KKC A;  2W3R A;  4XDD A;  1PGA A;  5G5H A;  3U52 E;  5EE9 A;  1UWM A;  1KLG D;  3PZD A;  1K8R B;  4ZYS A;  3M3J A;  4RFB A;  1TY0 A;  2K39 A;  4WQO B;  3VHT C;  1YD8 U;  2N9K A;  4KSK C;  1SSN A;  2WHI A;  3ZJT A;  1YX5 B;  4MH0 E;  4ARI A;  1CZP A;  2R2O A;  3BVZ A;  4MEL A;  2BW2 A;  1ACC A;  2K6Q A;  2ONQ A;  1DOX A;  1Z5S B;  4NNJ B;  5G5G A;  3GE3 C;  2YEP F;  3RNC C;  3W1S A;  4K81 A;  1L4Z B;  3ZNZ B;  4WWM A;  2LFI A;  4C56 C;  3RT3 B;  1MVK A;  1UGJ A;  4HEA 1;  2L76 A;  3QAR A;  1WE6 A;  4ZRQ A;  3BZD B;  2CS4 A;  1MJD A;  1EU3 A;  3SR6 A;  3H6N A;  2L32 A;  5DPW A;  2V3N A;  5BO4 B;  4C7Y A;  4ICV A;  2V0G A;  2JXX A;  1IPG A;  2KJ6 A;  1ZW7 A;  1SB3 C;  1WMH B;  4TV3 A;  4EZK A;  2DLB A;  2ZJD A;  2WDR B;  4UDU C;  2KLG A;  5IP4 D;  1GG3 A;  2WX1 A;  3WAP A;  4M8M A;  3IT4 B;  1UH6 A;  3V61 A;  4US8 A;  4W9F A;  3GOE A;  3MJ5 A;  1F2R C;  2J0K A;  3URY A;  4PYU A;  1DOY A;  2FUH B;  3PRE A;  5L95 C;  1ZXI A;  1CJE A;  1WR1 A;  3EFC A;  3QX1 A;  2KTR A;  3AEE B;  3A4S C;  2REX A;  4OVZ A;  2M17 A;  1N6Z A;  4K3C A;  2QDF A;  4PYZ A;  5CHF A;  4FJZ A;  2PPH A;  1P7F A;  1I4R A;  3VTU A;  4YSX B;  3R7R A;  3VR8 B;  3V05 A;  4NPN A;  3VXW A;  1I4H A;  2XK5 A;  3U4E G;  3PLU A;  2BGF A;  3W2D A;  2DZJ A;  2K6D B;  1E8X A;  2KDM A;  4N6E B;  4R3D A;  2BS2 B;  1UEL A;  1E8Y A;  2KQ7 A;  4LCD E;  4AS1 A;  3QWZ B;  1A70 A;  3ECI A;  3GB1 A;  1N63 A;  1MG4 A;  4RM9 A;  2QIE B;  4M8N A;  3N3K B;  2D3G A;  4EKU A;  2GMI C;  3A33 B;  3DBR B;  5HG2 A;  1FRD A;  2DZK A;  4ZHP A;  1XCT L;  1V86 A;  4OW0 A;  2KAJ A;  1Q10 A;  3VRA B;  3KLS X;  4RMA A;  1T5X D;  1NVI D;  3AE7 B;  1FNU A;  3Q14 C;  3RYT A;  3PT2 B;  4A6Q A;  1MFW A;  2FID A;  4W9D A;  4C4V A;  1XO3 A;  4ZOH C;  3QHT A;  1LO5 D;  1P7E A;  1QF6 A;  1VR9 A;  1SE4 A;  1NYR A;  1QOG A;  4S0R A;  4FHJ A;  3TBL D;  1U4A A;  3M62 B;  4HRO A;  4FBJ B;  4RGT A;  1V6E A;  2PVO D;  1TGZ B;  3PSE B;  1OQQ A;  1F9J A;  4HKZ E;  1GPX A;  2KC1 A;  2JZP A;  1JWA D;  3VRB B;  5AZF A;  1VJK A;  5IA7 A;  2WXG A;  3RMK C;  3P4P B;  3DOW A;  2KFK A;  3WAO A;  3Q69 A;  1GNU A;  4XZ4 A;  4KDL B;  5CTR C;  3ZNH B;  2N9L A;  3Q6B A;  4GU2 A;  2LVP A;  4RGM A;  4DDI D;  2QCZ A;  1WXQ A;  3L16 A;  2IO1 B;  1OGW A;  3KH0 A;  1V49 A;  3N30 A;  1WX8 A;  4EZJ A;  3A4R A;  2INN E;  5I4D A;  2C7H A;  4LNI A;  4C4V B;  3T8M A;  3Q3N C;  1SE3 A;  3DHG C;  3MJW A;  2ZNV B;  1PGB A;  2JVC A;  2V3P A;  1WXS A;  2KWU B;  4RF0 A;  5IN7 A;  3QQ8 B;  4L1B A;  3BII D;  4JWU C;  2KO3 A;  3V6C B;  4G3X B;  2GBM A;  3NVV A;  3NZS A;  3L0W B;  2NBV B;  1WJU A;  2BWE S;  1SF0 A;  1T0S C;  2K25 A;  2Z59 B;  1YOV B;  4KGT A;  4MSQ B;  4TMA B;  2IND C;  1T6B X;  4WWO A;  3UIN B;  1C78 A;  2O2V A;  3FAH A;  4REZ A;  5IO9 A;  2YLM A;  1YJJ A;  5HFY A;  3KW5 B;  1WM2 A;  2ZVO A;  1QOF A;  2KFK B;  3DHI C;  1M94 A;  4C00 A;  3EEC A;  3H1U A;  1WJ4 A;  1IYF A;  2FUG 1;  1ZDX A;  2LI5 A;  3VUY A;  5BMG A;  4HPM B;  1NI2 A;  4HRS A;  3GP7 A;  2KC2 A;  1E7V A;  3NZ3 A;  4A20 A;  1DGJ A; 
#chains in the Genus database with same CATH homology
 3QA8 A;  3IBE A;  1WXA A;  3JSV B;  2NS5 A;  4BBN C;  2DEN B;  2LVQ A;  1E90 A;  2KZR A;  2K1F A;  2PEA A;  3JW0 X;  3APC A;  2MBE A;  3N32 A;  1WM3 A;  3V62 A;  3QJZ A;  4KIK A;  3LDZ E;  1WGG A;  3WIM A;  1GUA B;  4KDI C;  2EKE C;  4P7I A;  3B0A A;  1WIA A;  2DX5 B;  1WGY A;  1WZ0 A;  1X1M A;  2KJR A;  3U7D A;  1SGH A;  3JVZ X;  3ZW3 A;  3L13 A;  1WE7 A;  1S1Q B;  4MGK E;  1EF5 A;  2OOB B;  2KHW B;  3PPA A;  1WXM A;  3DCG A;  4IM0 A;  3L54 A;  1R4M I;  3VTW A;  2JRH A;  1E7U A;  3X0W A;  1J0G A;  3SU8 X;  2JY6 A;  3M63 B;  4FJV B;  1LQB A;  2O6V A;  1RAX A;  2FCS A;  4WWN A;  4K7U A;  3ENE A;  5J18 A;  4JLC A;  3DBR I;  3CST A;  4PS3 A;  3U30 A;  1AAR A;  2PJH A;  3ZDT A;  3ZIM A;  1JRU A;  2DAJ A;  3ZLZ A;  3ZNG C;  5AZG A;  4DBG A;  3H7P A;  3A9J B;  3TL5 A;  4BFR A;  3OJ4 B;  2ZVN A;  1WF9 A;  1WY8 A;  2CHZ A;  2L0F A;  4E3C A;  3T9L A;  2O2V B;  5D2M B;  2CKH B;  2OJR A;  3SHQ A;  3U8Z A;  3DBS A;  4XC2 A;  2Z0D B;  3DVG X;  1V81 A;  4IWO A;  1WJN A;  3QAQ A;  2PE9 A;  2UWQ A;  5E6O A;  3R66 C;  4JIO U;  2IO2 B;  4HXD A;  4XX5 A;  2KXJ A;  2UYZ B;  1J19 A;  4B9K A;  4EUT A;  1XT9 B;  2DAF A;  4PS8 A;  3UQB A;  2FIF A;  4KVG B;  1WR6 E;  2DYB A;  1WGR A;  4LDT B;  2RGF A;  4K1R B;  2KX3 A;  2L00 B;  3RZW C;  1BT0 A;  3TIX A;  1FXT B;  3CSF A;  5FR6 A;  4DHZ B;  1A5R A;  1KOT A;  5AZH A;  3TJP A;  1WMH A;  1E5W A;  2LGY A;  3NS8 A;  2KJH B;  1RRB A;  2KWV B;  2XEW A;  2LD9 A;  3VUW A;  2MP2 A;  2WYQ A;  3PGE A;  1Y8R C;  1LM8 B;  2KLC A;  2KKC A;  2LXC A;  4HLE A;  2L8J A;  3W1Y A;  2C7M B;  2NBW B;  2LGX A;  2JZ3 B;  3PZD A;  1K8R B;  2EMS A;  4HK2 A;  4AJW A;  4W9C A;  3PS6 A;  1XQQ A;  3M3J A;  2HTH A;  4MGY E;  2K39 A;  4WQO B;  4BKG A;  4KZ0 A;  2EMT A;  3PTF C;  3VHT C;  1YD8 U;  1R4N I;  4KSK C;  3RCZ A;  1HE8 A;  1YX5 B;  2W9N A;  2N9P C;  4MH0 E;  2LUE A;  3QC8 B;  2A5U A;  2R2O A;  3ONS A;  3OAW A;  1WH3 A;  4MEL A;  1XD3 B;  2IBI B;  2K6Q A;  2IZV B;  4E74 A;  2LRW A;  5LXH A;  2JF5 A;  2AYO B;  5JH5 C;  4DHZ E;  2O6V B;  2D2Q A;  2N1W A;  2ZCC A;  2IY1 B;  2I1J A;  1ISN A;  2CHX A;  2R2Q A;  2AL6 A;  4J6I A;  4EEW A;  1Z5S B;  1GC7 A;  4NNJ B;  1D3Z A;  4M0W B;  3PLV A;  3H7P B;  3QIJ A;  5C23 A;  3W1S A;  1TZ1 A;  4K81 A;  2FCN A;  2M8S A;  3ZNZ B;  4FN2 A;  3ZTC A;  3Q3J A;  4ANW A;  1WFY A;  3MHS D;  3P2B A;  4TQ1 A;  3RT3 B;  3QCA A;  4FHK A;  3IHP C;  2MCN B;  3ZNI D;  4DHJ D;  2L76 A;  3QAR A;  4BBN F;  3RD2 A;  1WE6 A;  4OVV A;  2M0X A;  5AEK B;  4AWJ A;  2LXA A;  2CS4 A;  2NPT A;  2MBB B;  3H6N A;  5DPR A;  5DPW A;  1ZGU B;  3APF A;  3ZTD A;  5BO4 B;  5KHO A;  4MSM B;  4ICV A;  4JQW C;  3VUX A;  2N7E A;  2JXX A;  3OLM D;  4CHK A;  1YX6 B;  3DVG Y;  4GDK B;  1IPG A;  4N9F 4;  2KJ6 A;  1UD7 A;  1ZW7 A;  2LJ5 A;  1RFA A;  1WMH B;  4I6P A;  4TV3 A;  4DDG D;  2ZJD A;  3PRP B;  4EZK A;  1GJZ A;  1EO6 A;  1WRD B;  2GBJ A;  4JL9 A;  2ZZP B;  4NQK E;  5DPS A;  2MP2 B;  2I1K A;  2KLG A;  1GG3 A;  2WX1 A;  4AP4 C;  3SDL C;  3DVN U;  4BOZ B;  2N9E B;  4FUL A;  1I42 A;  3WAP A;  1WJ6 A;  4M8M A;  4ZYN A;  1UH6 A;  4RM8 A;  2LGD A;  1WXV A;  3V61 A;  2RD0 A;  4W9F A;  3VTV A;  1Q5W B;  3ZKJ C;  3GOE A;  4HJK A;  2KWC A;  2J0K A;  2D11 A;  2KVR A;  2LRU A;  3VQI A;  4PYU A;  2FUH B;  4W9H A;  2L7R A;  3PRE A;  2ZCB A;  5L95 C;  1WR1 A;  4IWP A;  2PE6 B;  4TQ0 A;  2JZZ A;  3QX1 A;  3RZF A;  2KTR A;  5LXI B;  3IVF A;  3BY4 B;  1V2Y A;  3QK0 A;  3A1Q A;  3HM6 X;  5D6J B;  3WA0 A;  2DYM A;  2IO0 B;  3DBH I;  1WYW B;  3A4S C;  2REX A;  3PHW B;  2M4N A;  3NY5 A;  1PQS A;  1EUV B;  1WX9 A;  2NR2 A;  4GN1 A;  1YJ1 A;  4HVB A;  2KTF A;  2MW5 A;  2BWF A;  2G45 B;  2M17 A;  4NY0 A;  4PYZ A;  3A9K A;  5CHF A;  4FJZ A;  2RPQ A;  5LLI A;  3IFW B;  5E6P A;  1E8Z A;  2PPH A;  2AWT A;  4DK5 A;  4BVU C;  3ZRC A;  1J8C A;  2FNJ B;  2KMC A;  2BKF A;  4W9E A;  3VTU A;  3PV1 A;  3HIZ A;  3ML9 A;  4WJP A;  2RSU A;  3AU5 A;  4G11 A;  5D7G A;  1V80 A;  2LWP A;  4KV2 A;  3R7R A;  1H8C A;  1EF1 A;  4NAW B;  4NPN A;  4ZRI A;  2J0J A;  2XK5 A;  4IUM B;  4IM3 A;  2N9X A;  2DYO A;  3VFK A;  1UBI A;  3PLU A;  2BGF A;  4GDK A;  3TMP B;  3X23 A;  4FAD A;  4WJQ A;  4KZC A;  2NPT B;  4B95 A;  2DZJ A;  1WGH A;  2K6D B;  1E8X A;  3JSV A;  3Q3F A;  4YL8 A;  3RUL A;  3WAN A;  2DHZ A;  2WWZ A;  1UEL A;  1E8Y A;  2KAN A;  2YVC A;  3O65 B;  2B3A A;  2WX0 A;  2KQ7 A;  3H9D A;  4MEM A;  4MJS A;  3L17 A;  4FJY A;  4KIK B;  4WJN A;  4GMV A;  4LCD E;  1V9J A;  4WWP A;  4ANV A;  3QWZ B;  3VAW A;  3EFU A;  4LDT D;  5G55 A;  5DCN A;  1V5T A;  3C0R B;  4URK A;  3ECI A;  4MM3 A;  4ASW C;  2JWZ A;  4RM9 A;  3AI5 A;  4W9G A;  4M8N A;  2MWS B;  2C7N B;  1P98 A;  4DWF A;  3N3K B;  2D3G A;  4EKU A;  5G2N A;  2GMI C;  1WGD A;  2ZPN A;  2IY0 B;  3A33 B;  2VRR B;  3PVL A;  4MDK E;  2K8C A;  4MGI E;  3B1L X;  4ANX A;  2FCQ A;  4F1S A;  2DZK A;  2MX2 A;  1V86 A;  4DHJ B;  1UGM A;  3RUI B;  3AUL A;  3L08 A;  2BYF A;  4HCP B;  1V5O A;  4RMA A;  5C1Z A;  2KMA A;  2QHO A;  5TR5 A;  3RYT A;  2JT4 B;  5JZE B;  2LVO A;  4IWQ A;  3PT2 B;  2NCN A;  2C5L C;  1LFD A;  3ZRF A;  1L2N A;  4A3P A;  4IW0 A;  2V1Y A;  5EDS A;  3NHE B;  3HK0 A;  2ZPY A;  3AXC A;  3KUC B;  2CHW A;  2FID A;  3UGB B;  1KLV A;  4W9D A;  1KM7 A;  3A9K B;  2C9W B;  4HDQ A;  3UIO B;  3QHT A;  4CO7 A;  2Y5B B;  3NOB A;  4GDL A;  3DVN V;  4DXA B;  1CMX B;  4ZDV A;  4BKS D;  1KJT A;  3EHV A;  4FHJ A;  3TBL D;  1TTN A;  1I35 A;  3PHX B;  4CYE A;  4GB9 A;  2LAS A;  3EC8 A;  1U4A A;  1P1A A;  3HHM A;  1YQB A;  4F7Z A;  3M62 B;  2HE7 A;  2KX0 A;  4FBJ B;  3K9P B;  4I6L B;  4AOF A;  4A3O A;  3I3T B;  4NJ6 A;  4ZRK A;  3VH4 B;  1V6E A;  2BYV E;  3DQV A;  2DZI A;  1TGZ B;  3UF8 A;  1OQY A;  5DPT A;  3V60 A;  3ZVV A;  4F8C B;  3PSE B;  1IP9 A;  2GBK A;  3ML8 A;  5CX3 A;  1P3Q U;  3KUZ A;  2NBU A;  4AUQ C;  2MLB A;  2XBB C;  4MJS B;  3TCA A;  2BPS A;  5GMV A;  5J17 A;  1F9J A;  1H4R A;  4FLH A;  4LJP B;  1ZKH A;  2KC1 A;  4B6W A;  2MSE D;  3VDZ A;  3ALB A;  4IM2 A;  3CF6 E;  2GBN A;  4GSW A;  3DBL I;  4WAA A;  5AZF A;  4E71 A;  3D32 A;  5IA7 A;  2BF8 B;  2L05 A;  3KUD B;  4ICU A;  2MBH A;  1VCB A;  3DOW A;  2CU1 A;  4EFO A;  1G6J A;  2KFK A;  3WAO A;  2L3Z A;  1NDD A;  1GNU A;  2IYD B;  4XZ4 A;  4ZRJ A;  4BKS A;  2J0M A;  1E8W A;  4KDL B;  2BYE A;  5CTR C;  3ZNH B;  5CHW A;  1P9D U;  4GOC A;  3B08 A;  1C3T A;  4GU2 A;  2LVP A;  4DDI D;  1RLF A;  2KDE B;  4II2 B;  3W1S C;  1T0Y A;  3L16 A;  2IO1 B;  3DDC B;  1OGW A;  3KH0 A;  1GC6 A;  1V49 A;  3N30 A;  2N1V A;  2GOW A;  2V4L A;  1C1Y B;  2KDI A;  1WX8 A;  4GXB A;  4K7W A;  5E6N A;  3WAM A;  4HDO A;  1MG8 A;  4OVU A;  4EZJ A;  3A4R A;  2JRI B;  4W9K A;  2RR9 A;  4BKT A;  3NZU A;  2L0T A;  2A4Z A;  2FCM A;  2N4F A;  1WI0 A;  1VD2 A;  4GGQ A;  3ZDM C;  2AEH A;  1OEY J;  5JHB A;  2HJ8 A;  4BOS C;  2C7H A;  3PRM B;  1QZE A;  1OEY A;  3T8M A;  1L7Y A;  2ZNV C;  2MBO A;  5KHQ A;  4FA6 A;  3MJW A;  2ZNV B;  3SD5 A;  3KVF B;  4G50 A;  4MGZ E;  2JVC A;  3CMM B;  4GDL B;  1UZX B;  2V3S A;  5HKH A;  2J7Q B;  2KDF B;  1WXS A;  2KWU B;  2Z0E B;  3HM3 A;  4LJO B;  3QQ8 B;  3L10 B;  2C60 A;  3ZUN A;  5D94 A;  2D10 A;  2KK8 A;  2KO3 A;  2KOX A;  1NBF C;  2MRP A;  2HD5 B;  4NQL B;  3V6C B;  2DZM A;  2GBM A;  4G3X B;  3VVW B;  3NZS A;  3L0W B;  2NBV B;  3OJ3 A;  3GZN I;  1SE9 A;  1Q0W B;  1WJU A;  2BWE S;  2G4S A;  4K7S A;  2K25 A;  4JGH B;  2MQJ A;  2ASQ A;  5JHA A;  2Z59 B;  2JPH A;  3V6E B;  3R7Q A;  2CR5 A;  2G3Q B;  1WX7 A;  4IG7 B;  3VXW A;  5L83 A;  1SIF A;  3UIP B;  3AU4 A;  3VH3 B;  5J2R A;  1UBQ A;  2JUO A;  2MBQ A;  3A9J A;  4MSQ B;  4TKN A;  3R3M A;  1Z2M A;  3K9O B;  4WWO A;  3ZO5 B;  1OTR B;  3UIN B;  2MA9 B;  4X57 B;  2O2V A;  2KDB A;  4W9J A;  4HPL B;  4IC7 B;  2YLM A;  3S2A A;  3UQA A;  2KD0 A;  4GIV A;  4I6N B;  4II3 B;  2G4D B;  2GBR A;  2WDT B;  3IG3 A;  2KTR B;  4W9I A;  3DPD A;  3KW5 B;  2K8H A;  3A1Q B;  1WM2 A;  2ZVO A;  4PS7 A;  4TUU A;  2KFJ A;  2D07 B;  4EZL A;  2KFK B;  3WAL A;  1WZ3 A;  3JYU A;  1M94 A;  3PRZ A;  2NVU I;  1TBE A;  1LXD A;  3EEC A;  3H1U A;  2N7D A;  2KQS A;  1WJ4 A;  3KYD D;  1P0R A;  3LJ3 A;  4HCN B;  4NJ7 A;  4KSL C;  4ANU A;  2LZ6 A;  3KYC D;  1IYF A;  4AJY B;  2KN5 A;  2ZEQ A;  4EOY A;  2LI5 A;  2O6V D;  3M95 A;  3VUY A;  2KNB A;  1YIW A;  2M1M A;  2IO3 B;  4HWI B;  2BKR B;  5IAA C;  4HPM B;  1Q1O A;  3MTN B;  4NAW A;  1NI2 A;  3BIN A;  4WJO A;  2KC2 A;  2XK5 B;  4G0N B;  1E7V A;  2AL3 A;  5CHV C;  3APD A;  2K8B A;  1S3S G;  4A20 A;  4W9L A;  3H7S A;  2FAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...