3PLUA

Structure of hub-1 protein in complex with snu66 peptide (hindi)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
HMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier HUB1
publication title Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Peptide binding protein
total genus 22
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pluA00
3TL5A 3M3JA 3ZKJC 4W9CA 2FCQA 2M0XA 4PS3A 2LVOA 4LDTD 4AJWA 4EKUA 1Z2MA 3L10B 4GMVA 4KVGB 1WJ4A 4MGKE 4ZRJA 2V1YA 4HCPB 3S2AA 3N32A 3P2BA 3WIMA 3WA0A 2D11A 3AU4A 5LXIB 3LDZE 3WAPA 3H7PB 2R2QA 4M8MA 2KFKA 4K81A 4F1SA 1GC6A 3AI5A 1YD8U 3SDLC 4NJ6A 1R4NI 2KVRA 2N9PC 2RGFA 2YVCA 3PHWB 2BWFA 4M0WB 5CHFA 2BYVE 2KDIA 1OEYJ 4RMAA 4P7IA 2C9WB 3TBLD 1UD7A 4WJQA 4EOYA 4PS8A 2KWVB 1YIWA 1HE8A 4CYEA 1QZEA 1OGWA 3O65B 3PLVA 2ZJDA 4WWNA 2GOWA 1WGDA 2DZMA 4G3XB 2LXAA 4WJNA 2KX0A 3DQVA 4HPMB 5TR5A 2G4DB 4WQOB 4HDOA 2J0KA 3NZUA 4GIVA 3PV1A 5JH5C 1MG8A 2JY6A 3V6EB 4LDTB 4DDGD 1WZ3A 2LVQA 3RCZA 3AU5A 5IAAC 1WFYA 1WR1A 3PPAA 4W9IA 2CR5A 2KFKB 3X23A 2DAJA 2BYFA 1WX7A 2DENB 2IY1B 2MSED 2CHZA 2RR9A 4IM3A 5DPTA 1UH6A 2WYQA 2KKCA 2PPHA 4PS7A 3CSTA 5CX3A 1V49A 3KVFB 4LCDE 3VXWA 1PQSA 4HPLB 2CS4A 2DYOA 2HTHA 4G0NB 3ZRFA 3ALBA 3ZTDA 3VH3B 2L76A 2DZJA 4NAWA 3V62A 3A9JB 4XC2A 3AULA 3GZNI 3RZWC 2GBRA 2NBWB 2MW5A 4W9GA 2XK5B 4IWQA 1YQBA 4EZKA 1E5WA 3DOWA 5CHVC 5KHOA 3ZNID 5DPRA 3SU8X 4CO7A 3BY4B 4FN2A 4E3CA 1M94A 4HWIB 2V3SA 2O6VD 4TUUA 4B9KA 1J0GA 3QARA 2LI5A 4A3OA 4ANWA 3KW5B 3A33B 4WWOA 2MBEA 1I42A 4IUMB 4MSQB 2NBVB 3JSVA 2N1VA 1TTNA 2MBOA 4NAWB 2FUHB 2NBUA 4GB9A 1E7VA 2ZVOA 3OJ3A 4MGZE 3AXCA 1R4MI 2K39A 1S1QB 2MP2A 2Z0EB 4RM8A 5GMVA 1AARA 3VFKA 1WIAA 1CMXB 4GN1A 3APFA 3H9DA 2CHWA 1GUAB 4AJYB 2KC1A 2JF5A 3ML9A 4DBGA 3PS6A 1LM8B 4XX5A 4EZJA 2KK8A 4MM3A 1VCBA 1X1MA 2O6VB 2WDTB 4TKNA 5EDSA 2JXXA 3UQBA 3T8MA 2M4NA 1OTRB 2ZNVB 3L08A 2LGXA 1V5TA 2MWSB 4GU2A 2MCNB 3V60A 2HJ8A 4IWPA 4KDIC 5DCNA 2KDEB 2L05A 2A4ZA 3D32A 1YX5B 2XBBC 4IW0A 2IO3B 2ZEQA 4MSMB 3ZNGC 1S3SG 1F9JA 2KJ6A 3DBSA 2LGYA 3I3TB 4DWFA 1WYWB 3PLUA 2LRUA 4WJPA 4FJVB 5E6PA 4LJOB 3NS8A 3C0RB 4BOZB 4TV3A 4HCNB 4ANVA 2C7HA 2ZNVC 4ICVA 3QCAA 3DBLI 1EF5A 1RFAA 3APDA 2GBKA 2KQ7A 4JLCA 2IO2B 4K7SA 4BVUC 4E71A 2PE9A 2K8BA 2NCNA 3PSEB 4KSKC 2G4SA 2WX0A 3MTNB 4ANUA 2JRIB 2FIFA 2KO3A 2L0TA 1WMHB 1V2YA 1P3QU 3DPDA 4K7WA 4JQWC 2EMSA 1YX6B 2DYMA 1E8XA 1Q1OA 2KHWB 3EECA 2PE6B 2WWZA 3ML8A 4IWOA 4JGHB 1V80A 2DAFA 4M8NA 2IZVB 2LZ6A 3UIOB 1GJZA 2K6DB 1WF9A 2MX2A 3ZRCA 3Q3FA 4HLEA 2N4FA 2IO0B 3VQIA 3RYTA 2KX3A 1EO6A 1WM3A 2JVCA 2OJRA 2FAZA 4BBNF 1LXDA 4GDLA 2R2OA 4I6PA 2MLBA 3ZO5B 3UQAA 4MH0E 4A3PA 3DVGX 5JHBA 4NJ7A 3KUDB 5D94A 4TQ0A 3VH4B 2D10A 3ZNHB 3R7QA 3VAWA 3ECIA 3HM6X 3TCAA 5JHAA 2BKFA 4FA6A 4FULA 1P9DU 3A4SC 3TMPB 2BYEA 1TBEA 2BPSA 2LRWA 1UZXB 5C23A 4N9F4 3NHEB 3W1SA 2CHXA 4G50A 4YL8A 2DZKA 2CU1A 2LXCA 3UGBB 3U30A 4XZ4A 1WXAA 2A5UA 4KV2A 1T0YA 3QHTA 3L16A 4IG7B 4K7UA 2KMCA 1WE6A 2LASA 1WI0A 2JRHA 2L7RA 3JYUA 4HXDA 2GMIC 2KTRA 2K6QA 3R3MA 3ZW3A 2IY0B 4MGIE 2D07B 3HIZA 4NNJB 3NZSA 5KHQA 2Z0DB 4ZRIA 2PEAA 2BGFA 4MDKE 5D7GA 4NY0A 3HK0A 2V4LA 5BO4B 3EHVA 5L83A 1UGMA 4W9KA 4E74A 4OVVA 2B3AA 4LJPB 2L00B 3VTVA 4GXBA 4W9LA 3JVZX 3B0AA 4WJOA 3VHTC 4ASWC 4ANXA 1SGHA 1UELA 1V81A 4NQLB 3WALA 3DBRI 4BKTA 1L7YA 3K9OB 2KJRA 3IHPC 4KZCA 4WAAA 2OOBB 5AZFA 2FCNA 2N9EB 2KDFB 1JRUA 4KIKA 4BBNC 4GDKA 1I35A 2FNJB 2DX5B 2LVPA 2N7EA 4MJSA 4W9HA 2IBIB 2DZIA 2JZ3B 2VRRB 5J17A 2ZPNA 3LJ3A 5J18A 3HHMA 2ASQA 1C3TA 1ZW7A 2O2VA 2K8CA 2WX1A 3ENEA 2RSUA 3QA8A 4MGYE 3PTFC 1EUVB 1V86A 3M95A 4I6NB 3W1SC 3PT2B 4HJKA 1Q0WB 2LUEA 2Z59B 4A20A 2FCSA 2KC2A 2W9NA 2N1WA 2JZZA 3JSVB 3PVLA 4FADA 1LFDA 2BF8B 3ZDMC 4K1RB 4DHJD 3ZLZA 4IC7B 3ZDTA 3N30A 5D6JB 2KWCA 1KLVA 3A1QA 3HM3A 4B95A 2ZZPB 3SHQA 3VDZA 4URKA 1Y8RC 1WM2A 4GDKB 4BKSA 2C60A 1NI2A 1FXTB 1KM7A 2M17A 2PJHA 4KZ0A 2MP2B 3GOEA 3WANA 3WAOA 2J7QB 4FHKA 3H7SA 1IYFA 1J19A 3KH0A 3VTUA 4AOFA 1V9JA 4BKGA 4KDLB 4ZRKA 1Z5SB 1D3ZA 3PHXB 2NS5A 3V61A 2XEWA 2KJHB 3PREA 2ZCBA 3QX1A 1XQQA 2CKHB 2FIDA 4EEWA 1L2NA 3DVNV 1E90A 3IG3A 2FCMA 1NDDA 3R66C 5J2RA 3QQ8B 3KYDD 3H1UA 2KD0A 5DPSA 5G2NA 5AEKB 5LXHA 5L95C 1GG3A 4FJYA 4MEMA 3TIXA 3X0WA 4ZDVA 1WJUA 1GC7A 1KJTA 4DHJB 3R7RA 4II3B 3MHSD 1YJ1A 4J6IA 1K8RB 3WAMA 1SIFA 3K9PB 1WY8A 2K25A 3SD5A 1IPGA 2L3ZA 3VTWA 2D3GA 5JZEB 2KOXA 4NPNA 3JW0X 3RD2A 3ONSA 4F7ZA 3UF8A 2G3QB 2IYDB 3QJZA 4EFOA 3ZVVA 4ZYNA 5FR6A 5G55A 5D2MB 2LGDA 4JIOU 2BWES 1XD3B 3IVFA 2MRPA 2JPHA 3RZFA 1A5RA 4HK2A 3VUWA 4DXAB 3KUZA 1RAXA 2GBMA 2RD0A 3CF6E 4BFRA 1OEYA 2IO1B 1OQYA 1XT9B 3OJ4B 3CMMB 3V6CB 2KLGA 1UBQA 1P1AA 2EKEC 2YLMA 3A9JA 4X57B 3ZIMA 2LWPA 4GOCA 2JUOA 3MJWA 1E8WA 3PRZA 1VD2A 2XK5A 2AL6A 3W1YA 4MELA 2J0JA 2KN5A 4NQKE 3EFUA 4OVUA 2ZCCA 3BINA 3B08A 3QWZB 1UBIA 3NY5A 1WR6E 2N7DA 4GDLB 1WX8A 2KXJA 2UWQA 2QHOA 5E6NA 5AZHA 2KANA 4HVBA 4II2B 1BT0A 1ISNA 3ZNZB 4EUTA 1WXMA 2RPQA 3RT3B 2AWTA 1E8ZA 3U8ZA 4FJZA 2EMTA 1WH3A 1KOTA 3L13A 3IBEA 2C7MB 4CHKA 5IA7A 3UIPB 4DHZB 1WRDB 4JL9A 5LLIA 3PGEA 4W9EA 1EF1A 2MBBB 2MQJA 1NBFC 3OAWA 4B6WA 4FBJB 4W9JA 2G45B 1IP9A 2NR2A 1WGHA 1ZGUB 2Y5BB 3QC8B 5AZGA 1E8YA 2N9XA 2KDBA 2J0MA 3IFWB 3UINB 5DPWA 2D2QA 3L54A 4DHZE 2KTRB 2AYOB 4WWPA 3H6NA 3A9KA 3QAQA 3PZDA 2MBQA 3CSFA 4PYZA 4GSWA 4F8CB 1WXVA 1LQBA 2REXA 1WJ6A 1WJNA 3U7DA 2KTFA 3RUIB 1GNUA 2KFJA 4ICUA 2LJ5A 3DBHI 1WE7A 2O6VA 2KQSA 2UYZB 1RLFA 4DK5A 1V6EA 2AEHA 1RRBA 2MA9B 2M1MA 3OLMD 2I1KA 3ZTCA 3VUYA 2KZRA 1Q5WB 3DDCB 5CHWA 4TQ1A 2NPTA 4GGQA 3VUXA 4BKSD 1E7UA 4FHJA 3TJPA 4KSLC 2BKRB 2MBHA 3M62B 4FLHA 3VVWB 2K8HA 4KIKB 2NVUI 3APCA 2KMAA 1P98A 3A9KB 2C7NB 2DHZA 2L8JA 4MJSB 3KYCD 2KWUB 2JT4B 2ZPYA 1P0RA 1WXSA 2C5LC 1TZ1A 3A4RA 3PRMB 5CTRC 1ZKHA 2KLCA 5E6OA 2DYBA 2GBNA 4RM9A 2O2VB 3QK0A 4HDQA 1V5OA 4AUQC 4I6LB 3NOBA 1C1YB 5HKHA 4EZLA 4W9FA 1WX9A 1WZ0A 2HE7A 2K1FA 3B1LX 4G11A 4IM2A 1SE9A 1WGRA 3DVGY 3L17A 4AWJA 1J8CA 1G6JA 4PYUA 2KNBA 3QIJA 3ZUNA 2ZVNA 3PRPB 1H8CA 3H7PA 3Q3JA 2NPTB 2JWZA 1H4RA 3DVNU 3EC8A 3M63B 5C1ZA 4W9DA 1U4AA 2LD9A 3KUCB 1WGYA 1WMHA 3A1QB 3L0WB 4IM0A 3RULA 3DCGA 4BOSC 4DDID 2GBJA 2AL3A 3T9LA 4AP4C 3N3KB 2I1JA 2M8SA 2HD5B 2L0FA 1WGGA 1TGZB
chains in the Genus database with same CATH superfamily
4W9CA 1FD6A 2M0XA 4LDTD 3L10B 1ENFA 4KVGB 2BS3B 1WJ4A 3S2AA 1C79A 4HKQA 3LDZE 1VR9A 1YD8U 2ZW1A 3SDLC 3X23A 1IGDA 4M0WB 3PHWB 1SBBB 2BWFA 2L1AA 3IAM1 1UUPA 2H88B 2KWVB 1YIWA 4D2KA 1QZEA 1OGWA 2V3NA 2ZJDA 4WJNA 4LNOA 2KX0A 3DQVA 4WQOB 2WNMA 4HDOA 2J0KA 5JH5C 1FIQA 1MG8A 1WZ3A 2LVQA 3Q8EA 3PPAA 2J42A 2MSED 1WX7A 2RR9A 1K50A 2PPHA 3Q8BA 1KF6B 1KTKA 4PS7A 3VRBB 5CX3A 4BAXA 5E6JA 2DYOA 1UWXA 3U52E 2L76A 1ZE3D 4AQ7A 2RDHA 2NBWB 3R2IA 4EZKA 1VJKA 1NI3A 4C00A 4CO7A 4E3CA 1M94A 4HWIB 2V3SA 3ZJVA 4B9KA 3AE4B 2N0SB 3PZ8A 2LHDA 5GXGB 2MBEA 1QOGA 3JSVA 1OFFA 5IOIA 3IAS1 1E7VA 2KMMA 4MGZE 2K39A 5BYQA 2MP2A 4RM8A 1AARA 1SJED 3VFKA 1WIAA 2SAKA 1BXTA 1QOAA 3N1YC 2JF5A 2KC1A 3VR9B 4PK1A 1LM8B 2WU2B 4ACFA 1CZPA 4MM3A 2VH2A 1VCBA 2FUG1 2WDTB 4YSYB 2PKOA 2JXXA 1TZOA 1OTRB 4C4VA 3DHHC 3L08A 5MPOA 2MWSB 2MCNB 3V60A 3W2DA 2A4ZA 3D32A 2IO3B 3MC9A 1DGJA 4DWFA 3PLUA 3W5UB 1N6ZA 5EE1A 4BOZB 3TUOA 3APDA 3VR8B 4MACA 3DBHB 4BVUC 2K8BA 4KSKC 2JU6X 3MTNB 1SXTA 2JRIB 1N61A 5IKCM 3DPDA 2QIEB 4S0RA 2DYMA 2PE6B 1V80A 4M8NA 3Q8AA 2MJDA 2IO0B 2RMMA 1EWCA 3N1ZC 1GOZA 2FAZA 4I6PA 2MLBA 5IP4D 3UQAA 4MH0E 1XF5L 3AEDB 4A3PA 3KUDB 4TQ0A 1DYQA 2WXQA 1WSPA 3TCAA 2KAJA 1TBEA 5C23A 4G50A 2LXCA 1D5ZC 2BW2A 2PVGC 4XZ4A 1WXAA 1FM0D 3L16A 3P63A 2KMCA 3H8HA 2JRHA 2L7RA 4C7ZA 3R3MA 1JMLA 4NNJB 5KHQA 3P4SB 3EHVA 1E7PB 4OVVA 4LJPB 4GXBA 4ANXA 4ASWC 1UELA 3WALA 3DBRI 2LUMA 4BKTA 2INPE 3IHPC 1YMHE 4WAAA 4XDDA 4REZA 2FCNA 2KDFB 4P6VF 2K5PA 2IBIB 2JZ3B 1D5XC 5J18A 4YSXB 2RPVA 1WGKA 2LGSA 2WXRA 2O2VA 2RSUA 3ZXVA 4I6NB 4HJKA 4A20A 1PGBA 2BF8B 3ZDMC 3NVZA 4IC7B 3A1QA 4B95A 1Y8RC 1WM2A 4KZ0A 1FXTB 1KM7A 2PJHA 2EELA 5JXVA 3WAOA 2IGGA 3H7SA 4FHKA 2V0GA 1IYFA 4AOFA 2L52A 1D3ZA 4R3DA 5BMHA 3V61A 3QX1A 2CKHB 2FIDA 3DVNV 2FCMA 1C76A 2AQ1B 3QQ8B 1CJEA 2KD0A 4A9AA 1VRAB 5L95C 3TIXA 4ZDVA 4DHJB 3AN1A 3MHSD 1I4QA 2CU3A 2K25A 1T0RC 4NPNA 2D5GA 3J9CA 1HQRD 1HA5A 2KN4A 1XD3B 2JPHA 1D4BA 4N58A 2ACZB 4HK2A 4GLSC 3VUWA 2GBMA 4B0MA 2IO1B 2WXPA 1XLNA 3V6CB 4USAA 1UBQA 1P1AA 2EKEC 2YLMA 3A9JA 3NVVA 4X57B 5G5HA 1TS5A 1GPXA 1F77A 4GOCA 2JUOA 1FXAA 2W3RA 3W1YA 4LK0M 4NQKE 4OVUA 3RNBC 2ZCCA 1SIJA 4MH8A 4GDLB 1WWTA 1WX8A 5AZHA 5E6NA 3SFDB 2KANA 4WH4A 2KQ4X 1ISNA 3ZNZB 1B9RA 2RPQA 2AWTA 4LNKA 1AW7A 1KOTA 3L13A 2WU5B 5IA7A 3BVGA 4JPSA 4JL9A 4W9EA 1EF1A 4US9A 2MQJA 1IP9A 1WGHA 2KDBA 3IFWB 2W54A 1UF0A 2AYOB 3H6NA 3A9KA 1VZ7A 3PZDA 2MBQA 2Y3AA 3Q8FA 3RUIB 1GNUA 4ICUA 2LJ5A 1TS4A 2O6VA 2GI9A 2KQSA 1RLFA 2NTTA 2AEHA 2M1MA 2BB6A 2KZRA 4GGQA 1E7UA 4A6QA 3M62B 1N5XA 1IBXA 5IO9A 4A90A 4KGSA 1P98A 3A9KB 4IDIA 5AUKA 2DHZA 3RPFC 1P0RA 3AE9B 2C5LC 5CTRC 4YSZB 4WIPA 1ZKHA 4KKIA 4NAMA 1C4AA 4I6LB 1C1YB 1PYWD 2JSVX 1WZ0A 2HE7A 4OZCA 4IM2A 1G6JA 3QIJA 5BYRA 2LGIA 2JWZA 1AWDA 4QAYA 5C1ZA 1U4AA 3RULA 1JW9D 3DBRB 2J53A 5BMIA 2AL3A 2IGHA 3N3KB 2MJEA 3CWIA 4EEWA 3ZKJC 4PS3A 2LVOA 4AJWA 1Z2MA 3NZ3A 4ZRJA 3Q3NC 3N32A 5LXIB 3OG5A 5IN7A 1TS2A 1K53A 2R2QA 4K81A 1CQVA 1HTOA 1GC6A 1YN4A 4P1BC 1R4NI 2KDIA 1OEYJ 3ABVB 2C9WB 3TBLD 4WJQA 4PS8A 4A55A 3PLVA 4C56C 5TR5A 4G3XB 4ZHOA 4HPMB 2G4DB 1JWSD 4GIVA 3PV1A 1F0ZA 2N7JA 4LDTB 1I4RA 4W9IA 4NZLB 1NYQA 1XO3A 3KVFB 3OWEB 4HPLB 4KKJA 2HTHA 3ZRFA 3VH3B 1ZXIA 2DZJA 4NAWA 1N62A 4IOIE 3AULA 4W9GA 1R7SA 1NENB 2XK5B 4IWQA 2QDFA 1YQBA 5KHOA 3ZNID 1FFVA 1FRRA 2INCC 2KDMA 3BY4B 4FN2A 2O6VD 2LI5A 3KW5B 4MSQB 2GLSA 4KGTA 4NAWB 1TKEA 2FUHB 4K3CA 2RDGA 4GB9A 1FO4A 1E6EB 2ZVOA 3AXCA 5HG2A 5GMVA 1KLGD 3H9DA 2YEPB 1GUAB 1F1HA 1JWAD 3RNEC 4EZJA 2KACA 4OHJA 5EDSA 1C78A 1F52A 1V5TA 4GU2A 3KWVA 1L6UA 2DNFA 4IWPA 4KDIC 2EKIA 1YX5B 2XBBC 1I4XA 4IW0A 2ZEQA 1F9JA 1WYWB 2KT7A 3SFEB 5E6PA 4LJOB 3C0RB 4TV3A 1AYFA 4ICVA 3DBLI 1EF5A 1RFAA 2KQ7A 4LNFA 2IO2B 5LNK1 2WX0A 2FIFA 2KO3A 1NYRA 4OW0A 1V2YA 4DXGA 3KQ4A 1N63A 3EECA 2WWZA 3ML8A 2DBYA 1WF9A 3ZRCA 4P1CC 4TMAB 1KLUD 2X38A 2KX3A 1EO6A 4BBNF 2W55A 1LXDA 3ZO5B 1MJDA 4NJ7A 5D94A 2D10A 1DOXA 3VAWA 3HM6X 5JHAA 1P9DU 2AX5A 3A4SC 2B76B 2CU1A 3UGBB 3QHTA 4K7UA 1WE6A 3URYA 2LASA 3BYYB 3Q2AC 1WI0A 3JYUA 2GMIC 3ZW3A 2D07B 3C8YA 3TSSA 2PEAA 2WXLA 2BGFA 5D7GA 3LB8C 2HDEA 3HK0A 1UWMA 2V4LA 4E74A 2B3AA 3VTVA 3FAHA 2SEBD 3I9V1 4W9LA 4WJOA 3VHTC 2V4IB 3PZ7A 1R4NB 2IDYA 3BK1A 1L7YA 3K9OB 1ZOYB 2OOBB 4WURA 5AZFA 3ZJUA 2G1EA 4KIKA 1I35A 4RGMA 3NVWA 2DX5B 1P7FA 4MJSA 1YQ3B 3Q3MC 2VRRB 3T3NA 3LJ3A 3N20C 2K8CA 4JWUC 3M95A 3FILA 2PMVA 2Z59B 2LUEA 1WYGA 4FADA 2JZZA 3JSVB 4RGOS 4K1RB 3ZLZA 3N30A 1YQ4B 3SHQA 1VZ6A 3WANA 1CK1A 2MP2B 2D3BA 2QMTA 3AM9A 1T5XD 1Z5SB 3PHXB 2WXIA 5T8IA 1J7CA 3FILB 2KJHB 3PREA 3RI7C 4MM3B 1E90A 4YTMB 5J2RA 4C4VB 1TY0A 3UI3A 5AEKB 2LEKA 5G5GA 1GAQB 3R7RA 3LYYA 1N5WA 4II3B 1I7HA 3AE5B 1OQRA 2L3ZA 5JZEB 3HRDD 4A8XC 2KOXA 1JRPA 2G3QB 4EFOA 1K52A 4ZYNA 5G55A 2LGDA 4JIOU 2BWES 1XLPA 2PTLA 2VZKD 2JXTA 4DXAB 3KUZA 1V1OA 2KWDA 4NJCA 2JQRB 2XN9C 2RD0A 4BFRA 2WXFA 1PFDA 3RNGC 3SEBA 2NTSA 3AEAB 3AB5A 3AEBB 1ZDXA 2WHIA 3MJWA 1VD2A 4MELA 3AH7A 3EFUA 3AEEB 4US8A 3BVMA 3AEFB 3O13A 2IGDA 1ZPSA 3RT3B 1E8ZA 5EE0A 5HHDG 2EMTA 3DBLB 3IBEA 3UIPB 5BYSA 4DHZB 1WRDB 3PO0A 3PGEA 5C3JB 2MBBB 4FBJB 4W9JA 2G45B 1ZGUB 2Y5BB 1EWYC 5AZGA 1E8YA 2WDRB 2J0MA 1ESFA 2YEPF 2Y5CA 2QEJC 4WWPA 1PGXA 3QAQA 4PYZA 2OHFA 4GSWA 4F8CB 5C2TB 2REXA 1T0QC 2KFJA 4YTNB 2AQ2B 2UYZB 1RFKA 1RRBA 3NG0A 3OLMD 3ZTCA 1Q5WB 4TQ1A 3TJPA 2HTME 3B2FA 4KSLC 2BKRB 3P42A 1WXQA 2KMAA 4HKZE 1KH0A 2L8JA 1ZXHA 2JT4B 2K9XA 4M01A 2KLCA 5E6OA 2DYBA 2O2VB 4C80A 1QLBB 2WGSA 1WX9A 3B1LX 1WGRA 3DVGY 1J8CA 4L2YA 2W82A 3ZUNA 3PRPB 1A70A 3H7PA 2HJ1A 2DWQA 3M63B 1MI0A 4W9DA 4BOSC 1WMHA 3A1QB 1BMLC 2J52A 2I1JA 2M8SA 2L0FA 3M3JA 2BS2B 1FNUA 3AE8B 4C7YA 2FCQA 4O1NA 1MVKA 3DHIC 3IT4B 4HCPB 3P2BA 2D11A 1FEHA 3AU4A 3DWGC 1FPYA 3WAPA 3H7PB 4M8MA 3AI5A 4NJ6A 2N9PC 2RGFA 1JALA 2BYVE 1PGAA 4EOYA 3Q14C 3O65B 3MC8A 3Q6BA 2GOWA 1WGDA 2LXAA 2ONQA 2PLPA 4S17A 2JYTA 5D3DA 3V6EB 3RCZA 1WFYA 1WR1A 2CR5A 1P7EA 2BYFA 5DPTA 2OEDA 1MPEA 2WYQA 2LFIA 1V49A 4LCDE 3P1MA 1I4GA 1PQSA 3EGRA 3HUIA 2KYWA 3ZTDA 1IUEA 3A9JB 3AV8A 4XC2A 3GZNI 3RZWC 2GBRA 2MW5A 1E5WA 3AMZA 5CHVC 5DPRA 3P4RB 5FK9C 2FE8A 4TUUA 5EE9A 1FXIA 4A3OA 3A33B 1ET6A 4IUMB 5FKAC 3HVDA 2N1VA 1I4HA 3MJ5A 1TTNA 2MEKA 3OJ3A 1KFYB 1R4MI 1S1QB 3ZGZA 1SE2A 4GN1A 3APFA 2PVOD 2QSDA 4AJYB 2WQYB 3ML9A 2KK8A 2TSSA 2O6VB 1X1MA 3MP9A 2MJ3A 3AE7B 2JYEA 1TS3A 1L4DB 2HJ8A 4DXFA 4XWWA 3AE6B 3FKYA 5DCNA 2KDEB 2L05A 1IBXB 1D5MC 3ZNGC 1S3SG 2KJ6A 2LGYA 3ZQ4A 3I3TB 4WJPA 4FJVB 3GE8C 1IGCA 1N60A 3QCAA 4IKGA 4JLCA 4K7SA 4E71A 3PSEB 2NCNA 3BWUD 2G4SA 3BIID 2L0TA 3AE3B 3FC4A 4JQWC 2EMSA 1JWUD 1E8XA 1Q1OA 4IWOA 1GJZA 3UIOB 2MX2A 4ZHPA 1C9FA 4KX6B 4HLEA 2N4FA 3VQIA 3EFCA 2JVCA 2QJLA 1YN5A 3VH4B 3ZNHB 3R7QA 3ECIA 1QILA 3TMPB 2BYEA 1UZXB 2LRWA 3RNAC 3NHEB 1SEBD 3W1SA 4YL8A 2DZKA 1Y56A 1T0YA 4HXDA 1MFWA 3RN9C 2KTRA 2ICIA 2BTEA 2N9KA 4MGIE 3NZSA 2Z0DB 4MDKE 4NY0A 4Q2JA 2L00B 2M0AA 4JE3B 3JVZX 1C77A 3B0AA 5H92C 3IT6B 1SGHA 4L1BA 2JZPA 2RDBC 3HVZA 2K22A 1JRUA 3TEZA 4JWSC 2BS4B 2FNJB 2LVPA 2N7EA 5J17A 3BZDB 2ZPNA 2WLBA 3HHMA 3ENEA 3QA8A 4MGYE 3PTFC 1V86A 3W1SC 3PT2B 2KC2A 2N1WA 3PVLA 1FNWA 1XLOA 2Y5PA 4HJGE 1KLVA 2KWCA 3HM3A 3BK2A 4M00A 4BKSA 1NI2A 3GOEA 3GZNB 2J7QB 5HI1A 2CJOA 1J19A 3KH0A 2LJIA 3VTUA 1OQQA 4BKGA 4KDLB 2CJNA 3I63C 1XQQA 3Q3OC 3R66C 3KYDD 3H1UA 2I2YA 2WXHA 5DPSA 2WXMA 4MEMA 3ZJTA 1GC7A 2J4XA 5AUIA 1YJ1A 4LNIA 3WAMA 2GB1A 1SIFA 3K9PB 3VTWA 1R4MB 3SD5A 1F2RC 3JW0X 3RD2A 3ONSA 4F7ZA 1TIFA 3QJZA 2IYDB 1VZ8A 3ZVVA 3RFZB 4HPPA 3KWLA 4XGAB 5D2MB 2KVZA 5FR3A 3RZFA 2WP9B 2OJWA 1RAXA 3DWMA 3CF6E 1VDVA 1OEYA 1Q10A 3OJ4B 1GB4A 3ZIMA 4ZYSA 4OZBA 3PRZA 2ON8A 2D3AA 2I38A 2AL6A 2BQQA 4WWMA 3EA6A 2QILA 3B08A 1TKYA 4XYCA 4ITKA 3NY5A 4RGTA 1WR6E 2KXJA 4HVBA 1TY2A 2QC8A 1BT0A 1YJJA 4EUTA 3P4PB 3P4QB 1ZDVA 2R61A 1M4VA 1MG4A 1WH3A 5BMGA 2VZKB 1UNSA 2WXJA 3C19A 5LLIA 3OAWA 4B6WA 1STEA 2N9XA 3UINB 2D2QA 4DHZE 3ZYYX 3RNFC 3CSFA 1RYJA 1WXVA 1WJNA 2KTFA 2BT6A 1WE7A 3W9CB 1YN3A 4DK5A 2MA9B 2I1KA 3DDCB 5CHWA 2NPTA 4BKSD 3VUXA 1HTQA 3R2TA 2MBHA 4FLHA 4OVZA 3AECB 3N9YC 2K8HA 4KIKB 3APCA 3ETRA 4N6EB 2WDVB 2GRIA 4MJSB 1C4PA 1HZ5A 4RCOA 4WAFA 3A4RA 2ZPYA 1WXSA 4OZAA 1TZ1A 4M02A 2INDC 4AUQC 5HKHA 1XCTL 4G11A 1XLQA 3I5JC 5HFYA 2KNBA 4UDUC 1PDXA 2Z8LA 2ZVNA 4WQMA 4YT0B 1H8CA 3Q3JA 2NPTB 4RFBA 1ZUD2 3KUCB 1WGYA 3L0WB 4IM0A 4TSSA 3DCGA 2GBJA 3U4EG 2HD5B 1TGZB 2L32A 3TL5A 4PT5A 4EKUA 2WXNA 4GMVA 4AS1A 4MGKE 2V1YA 3WIMA 2N9LA 3WA0A 1FFUA 1NEKB 2KFKA 1UGJA 4F1SA 3NRZA 1XXGA 5CHFA 2KVRA 4EZLA 2LMCA 2YVCA 4RMAA 4P7IA 1UD7A 2PIAA 3GP7A 1RM6C 1HE8A 4CYEA 1SF0A 4WWNA 2DZMA 2XNAC 1HEZE 3NZUA 1SE3A 2JY6A 4DDGD 4ZRQA 3AU5A 5IAAC 2KFKB 2DAJA 1JROA 2DENB 2IY1B 2CHZA 4IM3A 1UH6A 3I57A 2KKCA 1V1PA 3CSTA 3AE2B 4LNNA 3VXWA 1QF6A 2CS4A 3V3XA 4G0NB 3ALBA 3MHZA 3B9JA 3V62A 1TJEA 2MH7A 3DOWA 1E0ZA 3SU8X 1L0XB 1J0GA 3QARA 1V1PB 3T3OA 4ANWA 1QOBA 4WWOA 5TSSA 4B0EA 1I42A 2NBVB 3B2GA 1MHHE 2MBOA 4KGRA 2NBUA 1QT9A 4P16A 2Z0EB 4XDCA 3GS2A 2INNE 1CMXB 2CHWA 2WXOA 1QOFA 4DBGA 1TKGA 3PS6A 4XX5A 3E9SA 1RWSA 4TKNA 4ARCA 3UQBA 3T8MA 2M4NA 2WDQB 2V3PA 2ZNVB 1HXYD 2LGXA 1I4PA 2M19A 1L0YB 1L6VA 2L83A 2WS3B 2Q5WD 4MSMB 3DBSA 2LRUA 4YXDB 3E56A 2W3SA 1LGRA 3NS8A 1L5PA 4HCNB 4ANVA 3AE1B 2C7HA 2ZNVC 3NS1A 3GE3C 2GBKA 2PE9A 4ANUA 4BZAA 1AN8A 3EUB2 3Q69A 2BB5A 4RF1A 2IPKD 1WMHB 3MFGA 1P3QU 1EM7A 3TEXA 1SJHD 4K7WA 3Q8CA 1YX6B 2KHWB 2D3CA 4JGHB 2DAFA 2IZVB 2LZ6A 2K6DB 3CIRB 3Q3FA 3WCQA 1YJIA 1V8CA 3RYTA 1WM3A 2OJRA 2IJ0A 1EU4A 1C4CA 4GDLA 3ZXRA 2R2OA 2QCZA 1SE4A 3DVGX 5JHBA 2BKFA 4FA6A 4FULA 1GB1A 1T6BX 1TYGB 2BPSA 4N9F4 2CHXA 3U30A 1B1ZA 4L23A 1L0VB 1TT5B 2A5UA 4KV2A 3N1XC 4XWTA 4IG7B 4HROA 1XCQL 2K6QA 2IY0B 3HIZA 1QQRA 1F2RI 4ZRIA 5BO4B 5L83A 1UGMA 4W9KA 4CQNA 1ROEA 1SB3C 1V81A 4NQLB 3DHGC 1ET9A 1FNVA 1FCLA 2KJRA 3LXFA 4KZCA 3KLSX 4FXCA 2N9EB 2K3UA 4BBNC 4GDKA 2WXKA 4W9HA 2DZIA 3TEYA 1BUIC 2ZW0A 3L4PA 3IXSA 1E9MA 2BYTA 2ASQA 1XEEA 1C3TA 1ZW7A 2WX1A 2V9HA 1EUVB 1ZP0B 4ZRPA 1Q0WB 2FCSA 2W9NA 1LFDA 4DHJD 1ACCA 3ZDTA 3U7ZA 5D6JB 2ZZPB 3VDZA 4LLGM 4URKA 4RF0A 1T0SC 4GDKB 2C60A 1FCCC 2M17A 1YOVB 4RNAA 4ARIA 1V9JA 4ZRKA 2FBWB 5EE3A 3W5VB 2NS5A 1FMAD 4YTPB 1DOIA 4RGNA 2XEWA 1J7BA 2ZCBA 1KRHA 1L2NA 3IG3A 4ZOHC 1NDDA 1VLBA 5G2NA 4JX1C 5LXHA 1GG3A 2E3TA 4FJYA 3X0WA 1WJUA 1JWBD 1KJTA 1E10A 4K3BA 3NJTA 4J6IA 4HEA1 2NMQA 1K51A 1K8RB 3RNCC 2H89B 1WY8A 3AEGB 1IPGA 2D3GA 1JWMD 2M56B 3UF8A 1LO5D 2DLBA 2BBCA 5FR6A 3TEWA 3IVFA 2MRPA 2UU7A 2WXGA 1A5RA 3NVYA 2JX5A 2JWUA 1OQYA 1XT9B 3CMMB 2KLGA 1HZ6A 1SSNA 2LWPA 1E8WA 2XK5A 2LHEA 1PUTA 2J0JA 2KN5A 3BINA 4EE2A 3QWZB 1UBIA 1JCKB 2N7DA 3U2SC 2UWQA 2QHOA 1JQ4A 4II2B 1WXMA 1QKZA 3U8ZA 4FJZA 1V97A 2C7MB 4H2AA 4CHKA 3NUHB 1EU3A 2BVCA 1NBFC 4DQOC 2VH1A 2NR2A 3QC8B 2E6XA 5DPWA 3L54A 2KTRB 1DOYA 4N59A 2X8XX 1D6EC 2AQ3B 3BVZA 3VRAB 1LQBA 1FRDA 1WJ6A 3U7DA 4YWGG 3RMKC 3DBHI 2G9HD 2PW9A 5D3IB 4XE0A 1V6EA 5H8YE 1NVID 4RH6A 3VUYA 3MC0B 4FHJA 3VVWB 2NVUI 3GB1A 2C7NB 3KYCD 2KWUB 3PRMB 4J3OD 4LTUA 3R8BA 2MHJA 2GBNA 4RM9A 4HRSA 3QK0A 4HDQA 1V5OA 3NOBA 3BYTB 4W9FA 2K1FA 1L4ZB 1T3QA 1SE9A 3L17A 4AWJA 4PYUA 3SR6A 2K0PA 1H4RA 3DVNU 3EC8A 1J7AA 1WRIA 2LD9A 4M0WA 1YNTE 4DDID 3T9LA 3V05A 4AP4C 1MHXA 4MT5A 5I4DA 1WGGA
chains in the Genus database with same CATH topology
3TL5A 3M3JA 3ZKJC 4W9CA 2FCQA 2M0XA 4PS3A 2LVOA 4LDTD 4AJWA 4EKUA 1Z2MA 3L10B 4GMVA 4KVGB 1WJ4A 4MGKE 4ZRJA 2V1YA 4HCPB 3S2AA 3N32A 3P2BA 3WIMA 3WA0A 2D11A 3AU4A 5LXIB 3LDZE 3WAPA 3H7PB 2R2QA 4M8MA 2KFKA 4K81A 4F1SA 1GC6A 3AI5A 1YD8U 3SDLC 4NJ6A 1R4NI 2KVRA 2N9PC 2RGFA 2YVCA 3PHWB 2BWFA 4M0WB 5CHFA 2BYVE 2KDIA 1OEYJ 4RMAA 4P7IA 2C9WB 3TBLD 1UD7A 4WJQA 4EOYA 4PS8A 2KWVB 1YIWA 1HE8A 4CYEA 1QZEA 1OGWA 3O65B 3PLVA 2ZJDA 4WWNA 2GOWA 1WGDA 2DZMA 4G3XB 2LXAA 4WJNA 2KX0A 3DQVA 4HPMB 5TR5A 2G4DB 4WQOB 4HDOA 2J0KA 3NZUA 4GIVA 3PV1A 5JH5C 1MG8A 2JY6A 3V6EB 4LDTB 4DDGD 1WZ3A 2LVQA 3RCZA 3AU5A 5IAAC 1WFYA 1WR1A 3PPAA 4W9IA 2CR5A 2KFKB 3X23A 2DAJA 2BYFA 1WX7A 2DENB 2IY1B 2MSED 2CHZA 2RR9A 4IM3A 5DPTA 1UH6A 2WYQA 2KKCA 2PPHA 4PS7A 3CSTA 5CX3A 1V49A 3KVFB 4LCDE 3VXWA 1PQSA 4HPLB 2CS4A 2DYOA 2HTHA 4G0NB 3ZRFA 3ALBA 3ZTDA 3VH3B 2L76A 2DZJA 4NAWA 3V62A 3A9JB 4XC2A 3AULA 3GZNI 3RZWC 2GBRA 2NBWB 2MW5A 4W9GA 2XK5B 4IWQA 1YQBA 4EZKA 1E5WA 3DOWA 5CHVC 5KHOA 3ZNID 5DPRA 3SU8X 4CO7A 3BY4B 4FN2A 4E3CA 1M94A 4HWIB 2V3SA 2O6VD 4TUUA 4B9KA 1J0GA 3QARA 2LI5A 4A3OA 4ANWA 3KW5B 3A33B 4WWOA 2MBEA 1I42A 4IUMB 4MSQB 2NBVB 3JSVA 2N1VA 1TTNA 2MBOA 4NAWB 2FUHB 2NBUA 4GB9A 1E7VA 2ZVOA 3OJ3A 4MGZE 3AXCA 1R4MI 2K39A 1S1QB 2MP2A 2Z0EB 4RM8A 5GMVA 1AARA 3VFKA 1WIAA 1CMXB 4GN1A 3APFA 3H9DA 2CHWA 1GUAB 4AJYB 2KC1A 2JF5A 3ML9A 4DBGA 3PS6A 1LM8B 4XX5A 4EZJA 2KK8A 4MM3A 1VCBA 1X1MA 2O6VB 2WDTB 4TKNA 5EDSA 2JXXA 3UQBA 3T8MA 2M4NA 1OTRB 2ZNVB 3L08A 2LGXA 1V5TA 2MWSB 4GU2A 2MCNB 3V60A 2HJ8A 4IWPA 4KDIC 5DCNA 2KDEB 2L05A 2A4ZA 3D32A 1YX5B 2XBBC 4IW0A 2IO3B 2ZEQA 4MSMB 3ZNGC 1S3SG 1F9JA 2KJ6A 3DBSA 2LGYA 3I3TB 4DWFA 1WYWB 3PLUA 2LRUA 4WJPA 4FJVB 5E6PA 4LJOB 3NS8A 3C0RB 4BOZB 4TV3A 4HCNB 4ANVA 2C7HA 2ZNVC 4ICVA 3QCAA 3DBLI 1EF5A 1RFAA 3APDA 2GBKA 2KQ7A 4JLCA 2IO2B 4K7SA 4BVUC 4E71A 2PE9A 2K8BA 2NCNA 3PSEB 4KSKC 2G4SA 2WX0A 3MTNB 4ANUA 2JRIB 2FIFA 2KO3A 2L0TA 1WMHB 1V2YA 1P3QU 3DPDA 4K7WA 4JQWC 2EMSA 1YX6B 2DYMA 1E8XA 1Q1OA 2KHWB 3EECA 2PE6B 2WWZA 3ML8A 4IWOA 4JGHB 1V80A 2DAFA 4M8NA 2IZVB 2LZ6A 3UIOB 1GJZA 2K6DB 1WF9A 2MX2A 3ZRCA 3Q3FA 4HLEA 2N4FA 2IO0B 3VQIA 3RYTA 2KX3A 1EO6A 1WM3A 2JVCA 2OJRA 2FAZA 4BBNF 1LXDA 4GDLA 2R2OA 4I6PA 2MLBA 3ZO5B 3UQAA 4MH0E 4A3PA 3DVGX 5JHBA 4NJ7A 3KUDB 5D94A 4TQ0A 3VH4B 2D10A 3ZNHB 3R7QA 3VAWA 3ECIA 3HM6X 3TCAA 5JHAA 2BKFA 4FA6A 4FULA 1P9DU 3A4SC 3TMPB 2BYEA 1TBEA 2BPSA 2LRWA 1UZXB 5C23A 4N9F4 3NHEB 3W1SA 2CHXA 4G50A 4YL8A 2DZKA 2CU1A 2LXCA 3UGBB 3U30A 4XZ4A 1WXAA 2A5UA 4KV2A 1T0YA 3QHTA 3L16A 4IG7B 4K7UA 2KMCA 1WE6A 2LASA 1WI0A 2JRHA 2L7RA 3JYUA 4HXDA 2GMIC 2KTRA 2K6QA 3R3MA 3ZW3A 2IY0B 4MGIE 2D07B 3HIZA 4NNJB 3NZSA 5KHQA 2Z0DB 4ZRIA 2PEAA 2BGFA 4MDKE 5D7GA 4NY0A 3HK0A 2V4LA 5BO4B 3EHVA 5L83A 1UGMA 4W9KA 4E74A 4OVVA 2B3AA 4LJPB 2L00B 3VTVA 4GXBA 4W9LA 3JVZX 3B0AA 4WJOA 3VHTC 4ASWC 4ANXA 1SGHA 1UELA 1V81A 4NQLB 3WALA 3DBRI 4BKTA 1L7YA 3K9OB 2KJRA 3IHPC 4KZCA 4WAAA 2OOBB 5AZFA 2FCNA 2N9EB 2KDFB 1JRUA 4KIKA 4BBNC 4GDKA 1I35A 2FNJB 2DX5B 2LVPA 2N7EA 4MJSA 4W9HA 2IBIB 2DZIA 2JZ3B 2VRRB 5J17A 2ZPNA 3LJ3A 5J18A 3HHMA 2ASQA 1C3TA 1ZW7A 2O2VA 2K8CA 2WX1A 3ENEA 2RSUA 3QA8A 4MGYE 3PTFC 1EUVB 1V86A 3M95A 4I6NB 3W1SC 3PT2B 4HJKA 1Q0WB 2LUEA 2Z59B 4A20A 2FCSA 2KC2A 2W9NA 2N1WA 2JZZA 3JSVB 3PVLA 4FADA 1LFDA 2BF8B 3ZDMC 4K1RB 4DHJD 3ZLZA 4IC7B 3ZDTA 3N30A 5D6JB 2KWCA 1KLVA 3A1QA 3HM3A 4B95A 2ZZPB 3SHQA 3VDZA 4URKA 1Y8RC 1WM2A 4GDKB 4BKSA 2C60A 1NI2A 1FXTB 1KM7A 2M17A 2PJHA 4KZ0A 2MP2B 3GOEA 3WANA 3WAOA 2J7QB 4FHKA 3H7SA 1IYFA 1J19A 3KH0A 3VTUA 4AOFA 1V9JA 4BKGA 4KDLB 4ZRKA 1Z5SB 1D3ZA 3PHXB 2NS5A 3V61A 2XEWA 2KJHB 3PREA 2ZCBA 3QX1A 1XQQA 2CKHB 2FIDA 4EEWA 1L2NA 3DVNV 1E90A 3IG3A 2FCMA 1NDDA 3R66C 5J2RA 3QQ8B 3KYDD 3H1UA 2KD0A 5DPSA 5G2NA 5AEKB 5LXHA 5L95C 1GG3A 4FJYA 4MEMA 3TIXA 3X0WA 4ZDVA 1WJUA 1GC7A 1KJTA 4DHJB 3R7RA 4II3B 3MHSD 1YJ1A 4J6IA 1K8RB 3WAMA 1SIFA 3K9PB 1WY8A 2K25A 3SD5A 1IPGA 2L3ZA 3VTWA 2D3GA 5JZEB 2KOXA 4NPNA 3JW0X 3RD2A 3ONSA 4F7ZA 3UF8A 2G3QB 2IYDB 3QJZA 4EFOA 3ZVVA 4ZYNA 5FR6A 5G55A 5D2MB 2LGDA 4JIOU 2BWES 1XD3B 3IVFA 2MRPA 2JPHA 3RZFA 1A5RA 4HK2A 3VUWA 4DXAB 3KUZA 1RAXA 2GBMA 2RD0A 3CF6E 4BFRA 1OEYA 2IO1B 1OQYA 1XT9B 3OJ4B 3CMMB 3V6CB 2KLGA 1UBQA 1P1AA 2EKEC 2YLMA 3A9JA 4X57B 3ZIMA 2LWPA 4GOCA 2JUOA 3MJWA 1E8WA 3PRZA 1VD2A 2XK5A 2AL6A 3W1YA 4MELA 2J0JA 2KN5A 4NQKE 3EFUA 4OVUA 2ZCCA 3BINA 3B08A 3QWZB 1UBIA 3NY5A 1WR6E 2N7DA 4GDLB 1WX8A 2KXJA 2UWQA 2QHOA 5E6NA 5AZHA 2KANA 4HVBA 4II2B 1BT0A 1ISNA 3ZNZB 4EUTA 1WXMA 2RPQA 3RT3B 2AWTA 1E8ZA 3U8ZA 4FJZA 2EMTA 1WH3A 1KOTA 3L13A 3IBEA 2C7MB 4CHKA 5IA7A 3UIPB 4DHZB 1WRDB 4JL9A 5LLIA 3PGEA 4W9EA 1EF1A 2MBBB 2MQJA 1NBFC 3OAWA 4B6WA 4FBJB 4W9JA 2G45B 1IP9A 2NR2A 1WGHA 1ZGUB 2Y5BB 3QC8B 5AZGA 1E8YA 2N9XA 2KDBA 2J0MA 3IFWB 3UINB 5DPWA 2D2QA 3L54A 4DHZE 2KTRB 2AYOB 4WWPA 3H6NA 3A9KA 3QAQA 3PZDA 2MBQA 3CSFA 4PYZA 4GSWA 4F8CB 1WXVA 1LQBA 2REXA 1WJ6A 1WJNA 3U7DA 2KTFA 3RUIB 1GNUA 2KFJA 4ICUA 2LJ5A 3DBHI 1WE7A 2O6VA 2KQSA 2UYZB 1RLFA 4DK5A 1V6EA 2AEHA 1RRBA 2MA9B 2M1MA 3OLMD 2I1KA 3ZTCA 3VUYA 2KZRA 1Q5WB 3DDCB 5CHWA 4TQ1A 2NPTA 4GGQA 3VUXA 4BKSD 1E7UA 4FHJA 3TJPA 4KSLC 2BKRB 2MBHA 3M62B 4FLHA 3VVWB 2K8HA 4KIKB 2NVUI 3APCA 2KMAA 1P98A 3A9KB 2C7NB 2DHZA 2L8JA 4MJSB 3KYCD 2KWUB 2JT4B 2ZPYA 1P0RA 1WXSA 2C5LC 1TZ1A 3A4RA 3PRMB 5CTRC 1ZKHA 2KLCA 5E6OA 2DYBA 2GBNA 4RM9A 2O2VB 3QK0A 4HDQA 1V5OA 4AUQC 4I6LB 3NOBA 1C1YB 5HKHA 4EZLA 4W9FA 1WX9A 1WZ0A 2HE7A 2K1FA 3B1LX 4G11A 4IM2A 1SE9A 1WGRA 3DVGY 3L17A 4AWJA 1J8CA 1G6JA 4PYUA 2KNBA 3QIJA 3ZUNA 2ZVNA 3PRPB 1H8CA 3H7PA 3Q3JA 2NPTB 2JWZA 1H4RA 3DVNU 3EC8A 3M63B 5C1ZA 4W9DA 1U4AA 2LD9A 3KUCB 1WGYA 1WMHA 3A1QB 3L0WB 4IM0A 3RULA 3DCGA 4BOSC 4DDID 2GBJA 2AL3A 3T9LA 4AP4C 3N3KB 2I1JA 2M8SA 2HD5B 2L0FA 1WGGA 1TGZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TL5 A;  3M3J A;  3ZKJ C;  4W9C A;  2FCQ A;  2M0X A;  4PS3 A;  2LVO A;  4LDT D;  4AJW A;  4EKU A;  1Z2M A;  3L10 B;  4GMV A;  4KVG B;  1WJ4 A;  4MGK E;  4ZRJ A;  2V1Y A;  4HCP B;  3S2A A;  3N32 A;  3P2B A;  3WIM A;  3WA0 A;  2D11 A;  3AU4 A;  5LXI B;  3LDZ E;  3WAP A;  3H7P B;  2R2Q A;  4M8M A;  2KFK A;  4K81 A;  4F1S A;  1GC6 A;  3AI5 A;  1YD8 U;  3SDL C;  4NJ6 A;  1R4N I;  2KVR A;  2N9P C;  2RGF A;  2YVC A;  3PHW B;  2BWF A;  4M0W B;  5CHF A;  2BYV E;  2KDI A;  1OEY J;  4RMA A;  4P7I A;  2C9W B;  3TBL D;  1UD7 A;  4WJQ A;  4EOY A;  4PS8 A;  2KWV B;  1YIW A;  1HE8 A;  4CYE A;  1QZE A;  1OGW A;  3O65 B;  3PLV A;  2ZJD A;  4WWN A;  2GOW A;  1WGD A;  2DZM A;  4G3X B;  2LXA A;  4WJN A;  2KX0 A;  3DQV A;  4HPM B;  5TR5 A;  2G4D B;  4WQO B;  4HDO A;  2J0K A;  3NZU A;  4GIV A;  3PV1 A;  5JH5 C;  1MG8 A;  2JY6 A;  3V6E B;  4LDT B;  4DDG D;  1WZ3 A;  2LVQ A;  3RCZ A;  3AU5 A;  5IAA C;  1WFY A;  1WR1 A;  3PPA A;  4W9I A;  2CR5 A;  2KFK B;  3X23 A;  2DAJ A;  2BYF A;  1WX7 A;  2DEN B;  2IY1 B;  2MSE D;  2CHZ A;  2RR9 A;  4IM3 A;  5DPT A;  1UH6 A;  2WYQ A;  2KKC A;  2PPH A;  4PS7 A;  3CST A;  5CX3 A;  1V49 A;  3KVF B;  4LCD E;  3VXW A;  1PQS A;  4HPL B;  2CS4 A;  2DYO A;  2HTH A;  4G0N B;  3ZRF A;  3ALB A;  3ZTD A;  3VH3 B;  2L76 A;  2DZJ A;  4NAW A;  3V62 A;  3A9J B;  4XC2 A;  3AUL A;  3GZN I;  3RZW C;  2GBR A;  2NBW B;  2MW5 A;  4W9G A;  2XK5 B;  4IWQ A;  1YQB A;  4EZK A;  1E5W A;  3DOW A;  5CHV C;  5KHO A;  3ZNI D;  5DPR A;  3SU8 X;  4CO7 A;  3BY4 B;  4FN2 A;  4E3C A;  1M94 A;  4HWI B;  2V3S A;  2O6V D;  4TUU A;  4B9K A;  1J0G A;  3QAR A;  2LI5 A;  4A3O A;  4ANW A;  3KW5 B;  3A33 B;  4WWO A;  2MBE A;  1I42 A;  4IUM B;  4MSQ B;  2NBV B;  3JSV A;  2N1V A;  1TTN A;  2MBO A;  4NAW B;  2FUH B;  2NBU A;  4GB9 A;  1E7V A;  2ZVO A;  3OJ3 A;  4MGZ E;  3AXC A;  1R4M I;  2K39 A;  1S1Q B;  2MP2 A;  2Z0E B;  4RM8 A;  5GMV A;  1AAR A;  3VFK A;  1WIA A;  1CMX B;  4GN1 A;  3APF A;  3H9D A;  2CHW A;  1GUA B;  4AJY B;  2KC1 A;  2JF5 A;  3ML9 A;  4DBG A;  3PS6 A;  1LM8 B;  4XX5 A;  4EZJ A;  2KK8 A;  4MM3 A;  1VCB A;  1X1M A;  2O6V B;  2WDT B;  4TKN A;  5EDS A;  2JXX A;  3UQB A;  3T8M A;  2M4N A;  1OTR B;  2ZNV B;  3L08 A;  2LGX A;  1V5T A;  2MWS B;  4GU2 A;  2MCN B;  3V60 A;  2HJ8 A;  4IWP A;  4KDI C;  5DCN A;  2KDE B;  2L05 A;  2A4Z A;  3D32 A;  1YX5 B;  2XBB C;  4IW0 A;  2IO3 B;  2ZEQ A;  4MSM B;  3ZNG C;  1S3S G;  1F9J A;  2KJ6 A;  3DBS A;  2LGY A;  3I3T B;  4DWF A;  1WYW B;  3PLU A;  2LRU A;  4WJP A;  4FJV B;  5E6P A;  4LJO B;  3NS8 A;  3C0R B;  4BOZ B;  4TV3 A;  4HCN B;  4ANV A;  2C7H A;  2ZNV C;  4ICV A;  3QCA A;  3DBL I;  1EF5 A;  1RFA A;  3APD A;  2GBK A;  2KQ7 A;  4JLC A;  2IO2 B;  4K7S A;  4BVU C;  4E71 A;  2PE9 A;  2K8B A;  2NCN A;  3PSE B;  4KSK C;  2G4S A;  2WX0 A;  3MTN B;  4ANU A;  2JRI B;  2FIF A;  2KO3 A;  2L0T A;  1WMH B;  1V2Y A;  1P3Q U;  3DPD A;  4K7W A;  4JQW C;  2EMS A;  1YX6 B;  2DYM A;  1E8X A;  1Q1O A;  2KHW B;  3EEC A;  2PE6 B;  2WWZ A;  3ML8 A;  4IWO A;  4JGH B;  1V80 A;  2DAF A;  4M8N A;  2IZV B;  2LZ6 A;  3UIO B;  1GJZ A;  2K6D B;  1WF9 A;  2MX2 A;  3ZRC A;  3Q3F A;  4HLE A;  2N4F A;  2IO0 B;  3VQI A;  3RYT A;  2KX3 A;  1EO6 A;  1WM3 A;  2JVC A;  2OJR A;  2FAZ A;  4BBN F;  1LXD A;  4GDL A;  2R2O A;  4I6P A;  2MLB A;  3ZO5 B;  3UQA A;  4MH0 E;  4A3P A;  3DVG X;  5JHB A;  4NJ7 A;  3KUD B;  5D94 A;  4TQ0 A;  3VH4 B;  2D10 A;  3ZNH B;  3R7Q A;  3VAW A;  3ECI A;  3HM6 X;  3TCA A;  5JHA A;  2BKF A;  4FA6 A;  4FUL A;  1P9D U;  3A4S C;  3TMP B;  2BYE A;  1TBE A;  2BPS A;  2LRW A;  1UZX B;  5C23 A;  4N9F 4;  3NHE B;  3W1S A;  2CHX A;  4G50 A;  4YL8 A;  2DZK A;  2CU1 A;  2LXC A;  3UGB B;  3U30 A;  4XZ4 A;  1WXA A;  2A5U A;  4KV2 A;  1T0Y A;  3QHT A;  3L16 A;  4IG7 B;  4K7U A;  2KMC A;  1WE6 A;  2LAS A;  1WI0 A;  2JRH A;  2L7R A;  3JYU A;  4HXD A;  2GMI C;  2KTR A;  2K6Q A;  3R3M A;  3ZW3 A;  2IY0 B;  4MGI E;  2D07 B;  3HIZ A;  4NNJ B;  3NZS A;  5KHQ A;  2Z0D B;  4ZRI A;  2PEA A;  2BGF A;  4MDK E;  5D7G A;  4NY0 A;  3HK0 A;  2V4L A;  5BO4 B;  3EHV A;  5L83 A;  1UGM A;  4W9K A;  4E74 A;  4OVV A;  2B3A A;  4LJP B;  2L00 B;  3VTV A;  4GXB A;  4W9L A;  3JVZ X;  3B0A A;  4WJO A;  3VHT C;  4ASW C;  4ANX A;  1SGH A;  1UEL A;  1V81 A;  4NQL B;  3WAL A;  3DBR I;  4BKT A;  1L7Y A;  3K9O B;  2KJR A;  3IHP C;  4KZC A;  4WAA A;  2OOB B;  5AZF A;  2FCN A;  2N9E B;  2KDF B;  1JRU A;  4KIK A;  4BBN C;  4GDK A;  1I35 A;  2FNJ B;  2DX5 B;  2LVP A;  2N7E A;  4MJS A;  4W9H A;  2IBI B;  2DZI A;  2JZ3 B;  2VRR B;  5J17 A;  2ZPN A;  3LJ3 A;  5J18 A;  3HHM A;  2ASQ A;  1C3T A;  1ZW7 A;  2O2V A;  2K8C A;  2WX1 A;  3ENE A;  2RSU A;  3QA8 A;  4MGY E;  3PTF C;  1EUV B;  1V86 A;  3M95 A;  4I6N B;  3W1S C;  3PT2 B;  4HJK A;  1Q0W B;  2LUE A;  2Z59 B;  4A20 A;  2FCS A;  2KC2 A;  2W9N A;  2N1W A;  2JZZ A;  3JSV B;  3PVL A;  4FAD A;  1LFD A;  2BF8 B;  3ZDM C;  4K1R B;  4DHJ D;  3ZLZ A;  4IC7 B;  3ZDT A;  3N30 A;  5D6J B;  2KWC A;  1KLV A;  3A1Q A;  3HM3 A;  4B95 A;  2ZZP B;  3SHQ A;  3VDZ A;  4URK A;  1Y8R C;  1WM2 A;  4GDK B;  4BKS A;  2C60 A;  1NI2 A;  1FXT B;  1KM7 A;  2M17 A;  2PJH A;  4KZ0 A;  2MP2 B;  3GOE A;  3WAN A;  3WAO A;  2J7Q B;  4FHK A;  3H7S A;  1IYF A;  1J19 A;  3KH0 A;  3VTU A;  4AOF A;  1V9J A;  4BKG A;  4KDL B;  4ZRK A;  1Z5S B;  1D3Z A;  3PHX B;  2NS5 A;  3V61 A;  2XEW A;  2KJH B;  3PRE A;  2ZCB A;  3QX1 A;  1XQQ A;  2CKH B;  2FID A;  4EEW A;  1L2N A;  3DVN V;  1E90 A;  3IG3 A;  2FCM A;  1NDD A;  3R66 C;  5J2R A;  3QQ8 B;  3KYD D;  3H1U A;  2KD0 A;  5DPS A;  5G2N A;  5AEK B;  5LXH A;  5L95 C;  1GG3 A;  4FJY A;  4MEM A;  3TIX A;  3X0W A;  4ZDV A;  1WJU A;  1GC7 A;  1KJT A;  4DHJ B;  3R7R A;  4II3 B;  3MHS D;  1YJ1 A;  4J6I A;  1K8R B;  3WAM A;  1SIF A;  3K9P B;  1WY8 A;  2K25 A;  3SD5 A;  1IPG A;  2L3Z A;  3VTW A;  2D3G A;  5JZE B;  2KOX A;  4NPN A;  3JW0 X;  3RD2 A;  3ONS A;  4F7Z A;  3UF8 A;  2G3Q B;  2IYD B;  3QJZ A;  4EFO A;  3ZVV A;  4ZYN A;  5FR6 A;  5G55 A;  5D2M B;  2LGD A;  4JIO U;  2BWE S;  1XD3 B;  3IVF A;  2MRP A;  2JPH A;  3RZF A;  1A5R A;  4HK2 A;  3VUW A;  4DXA B;  3KUZ A;  1RAX A;  2GBM A;  2RD0 A;  3CF6 E;  4BFR A;  1OEY A;  2IO1 B;  1OQY A;  1XT9 B;  3OJ4 B;  3CMM B;  3V6C B;  2KLG A;  1UBQ A;  1P1A A;  2EKE C;  2YLM A;  3A9J A;  4X57 B;  3ZIM A;  2LWP A;  4GOC A;  2JUO A;  3MJW A;  1E8W A;  3PRZ A;  1VD2 A;  2XK5 A;  2AL6 A;  3W1Y A;  4MEL A;  2J0J A;  2KN5 A;  4NQK E;  3EFU A;  4OVU A;  2ZCC A;  3BIN A;  3B08 A;  3QWZ B;  1UBI A;  3NY5 A;  1WR6 E;  2N7D A;  4GDL B;  1WX8 A;  2KXJ A;  2UWQ A;  2QHO A;  5E6N A;  5AZH A;  2KAN A;  4HVB A;  4II2 B;  1BT0 A;  1ISN A;  3ZNZ B;  4EUT A;  1WXM A;  2RPQ A;  3RT3 B;  2AWT A;  1E8Z A;  3U8Z A;  4FJZ A;  2EMT A;  1WH3 A;  1KOT A;  3L13 A;  3IBE A;  2C7M B;  4CHK A;  5IA7 A;  3UIP B;  4DHZ B;  1WRD B;  4JL9 A;  5LLI A;  3PGE A;  4W9E A;  1EF1 A;  2MBB B;  2MQJ A;  1NBF C;  3OAW A;  4B6W A;  4FBJ B;  4W9J A;  2G45 B;  1IP9 A;  2NR2 A;  1WGH A;  1ZGU B;  2Y5B B;  3QC8 B;  5AZG A;  1E8Y A;  2N9X A;  2KDB A;  2J0M A;  3IFW B;  3UIN B;  5DPW A;  2D2Q A;  3L54 A;  4DHZ E;  2KTR B;  2AYO B;  4WWP A;  3H6N A;  3A9K A;  3QAQ A;  3PZD A;  2MBQ A;  3CSF A;  4PYZ A;  4GSW A;  4F8C B;  1WXV A;  1LQB A;  2REX A;  1WJ6 A;  1WJN A;  3U7D A;  2KTF A;  3RUI B;  1GNU A;  2KFJ A;  4ICU A;  2LJ5 A;  3DBH I;  1WE7 A;  2O6V A;  2KQS A;  2UYZ B;  1RLF A;  4DK5 A;  1V6E A;  2AEH A;  1RRB A;  2MA9 B;  2M1M A;  3OLM D;  2I1K A;  3ZTC A;  3VUY A;  2KZR A;  1Q5W B;  3DDC B;  5CHW A;  4TQ1 A;  2NPT A;  4GGQ A;  3VUX A;  4BKS D;  1E7U A;  4FHJ A;  3TJP A;  4KSL C;  2BKR B;  2MBH A;  3M62 B;  4FLH A;  3VVW B;  2K8H A;  4KIK B;  2NVU I;  3APC A;  2KMA A;  1P98 A;  3A9K B;  2C7N B;  2DHZ A;  2L8J A;  4MJS B;  3KYC D;  2KWU B;  2JT4 B;  2ZPY A;  1P0R A;  1WXS A;  2C5L C;  1TZ1 A;  3A4R A;  3PRM B;  5CTR C;  1ZKH A;  2KLC A;  5E6O A;  2DYB A;  2GBN A;  4RM9 A;  2O2V B;  3QK0 A;  4HDQ A;  1V5O A;  4AUQ C;  4I6L B;  3NOB A;  1C1Y B;  5HKH A;  4EZL A;  4W9F A;  1WX9 A;  1WZ0 A;  2HE7 A;  2K1F A;  3B1L X;  4G11 A;  4IM2 A;  1SE9 A;  1WGR A;  3DVG Y;  3L17 A;  4AWJ A;  1J8C A;  1G6J A;  4PYU A;  2KNB A;  3QIJ A;  3ZUN A;  2ZVN A;  3PRP B;  1H8C A;  3H7P A;  3Q3J A;  2NPT B;  2JWZ A;  1H4R A;  3DVN U;  3EC8 A;  3M63 B;  5C1Z A;  4W9D A;  1U4A A;  2LD9 A;  3KUC B;  1WGY A;  1WMH A;  3A1Q B;  3L0W B;  4IM0 A;  3RUL A;  3DCG A;  4BOS C;  4DDI D;  2GBJ A;  2AL3 A;  3T9L A;  4AP4 C;  3N3K B;  2I1J A;  2M8S A;  2HD5 B;  2L0F A;  1WGG A;  1TGZ B; 
#chains in the Genus database with same CATH topology
 4W9C A;  1FD6 A;  2M0X A;  4LDT D;  3L10 B;  1ENF A;  4KVG B;  2BS3 B;  1WJ4 A;  3S2A A;  1C79 A;  4HKQ A;  3LDZ E;  1VR9 A;  1YD8 U;  2ZW1 A;  3SDL C;  3X23 A;  1IGD A;  4M0W B;  3PHW B;  1SBB B;  2BWF A;  2L1A A;  3IAM 1;  1UUP A;  2H88 B;  2KWV B;  1YIW A;  4D2K A;  1QZE A;  1OGW A;  2V3N A;  2ZJD A;  4WJN A;  4LNO A;  2KX0 A;  3DQV A;  4WQO B;  2WNM A;  4HDO A;  2J0K A;  5JH5 C;  1FIQ A;  1MG8 A;  1WZ3 A;  2LVQ A;  3Q8E A;  3PPA A;  2J42 A;  2MSE D;  1WX7 A;  2RR9 A;  1K50 A;  2PPH A;  3Q8B A;  1KF6 B;  1KTK A;  4PS7 A;  3VRB B;  5CX3 A;  4BAX A;  5E6J A;  2DYO A;  1UWX A;  3U52 E;  2L76 A;  1ZE3 D;  4AQ7 A;  2RDH A;  2NBW B;  3R2I A;  4EZK A;  1VJK A;  1NI3 A;  4C00 A;  4CO7 A;  4E3C A;  1M94 A;  4HWI B;  2V3S A;  3ZJV A;  4B9K A;  3AE4 B;  2N0S B;  3PZ8 A;  2LHD A;  5GXG B;  2MBE A;  1QOG A;  3JSV A;  1OFF A;  5IOI A;  3IAS 1;  1E7V A;  2KMM A;  4MGZ E;  2K39 A;  5BYQ A;  2MP2 A;  4RM8 A;  1AAR A;  1SJE D;  3VFK A;  1WIA A;  2SAK A;  1BXT A;  1QOA A;  3N1Y C;  2JF5 A;  2KC1 A;  3VR9 B;  4PK1 A;  1LM8 B;  2WU2 B;  4ACF A;  1CZP A;  4MM3 A;  2VH2 A;  1VCB A;  2FUG 1;  2WDT B;  4YSY B;  2PKO A;  2JXX A;  1TZO A;  1OTR B;  4C4V A;  3DHH C;  3L08 A;  5MPO A;  2MWS B;  2MCN B;  3V60 A;  3W2D A;  2A4Z A;  3D32 A;  2IO3 B;  3MC9 A;  1DGJ A;  4DWF A;  3PLU A;  3W5U B;  1N6Z A;  5EE1 A;  4BOZ B;  3TUO A;  3APD A;  3VR8 B;  4MAC A;  3DBH B;  4BVU C;  2K8B A;  4KSK C;  2JU6 X;  3MTN B;  1SXT A;  2JRI B;  1N61 A;  5IKC M;  3DPD A;  2QIE B;  4S0R A;  2DYM A;  2PE6 B;  1V80 A;  4M8N A;  3Q8A A;  2MJD A;  2IO0 B;  2RMM A;  1EWC A;  3N1Z C;  1GOZ A;  2FAZ A;  4I6P A;  2MLB A;  5IP4 D;  3UQA A;  4MH0 E;  1XF5 L;  3AED B;  4A3P A;  3KUD B;  4TQ0 A;  1DYQ A;  2WXQ A;  1WSP A;  3TCA A;  2KAJ A;  1TBE A;  5C23 A;  4G50 A;  2LXC A;  1D5Z C;  2BW2 A;  2PVG C;  4XZ4 A;  1WXA A;  1FM0 D;  3L16 A;  3P63 A;  2KMC A;  3H8H A;  2JRH A;  2L7R A;  4C7Z A;  3R3M A;  1JML A;  4NNJ B;  5KHQ A;  3P4S B;  3EHV A;  1E7P B;  4OVV A;  4LJP B;  4GXB A;  4ANX A;  4ASW C;  1UEL A;  3WAL A;  3DBR I;  2LUM A;  4BKT A;  2INP E;  3IHP C;  1YMH E;  4WAA A;  4XDD A;  4REZ A;  2FCN A;  2KDF B;  4P6V F;  2K5P A;  2IBI B;  2JZ3 B;  1D5X C;  5J18 A;  4YSX B;  2RPV A;  1WGK A;  2LGS A;  2WXR A;  2O2V A;  2RSU A;  3ZXV A;  4I6N B;  4HJK A;  4A20 A;  1PGB A;  2BF8 B;  3ZDM C;  3NVZ A;  4IC7 B;  3A1Q A;  4B95 A;  1Y8R C;  1WM2 A;  4KZ0 A;  1FXT B;  1KM7 A;  2PJH A;  2EEL A;  5JXV A;  3WAO A;  2IGG A;  3H7S A;  4FHK A;  2V0G A;  1IYF A;  4AOF A;  2L52 A;  1D3Z A;  4R3D A;  5BMH A;  3V61 A;  3QX1 A;  2CKH B;  2FID A;  3DVN V;  2FCM A;  1C76 A;  2AQ1 B;  3QQ8 B;  1CJE A;  2KD0 A;  4A9A A;  1VRA B;  5L95 C;  3TIX A;  4ZDV A;  4DHJ B;  3AN1 A;  3MHS D;  1I4Q A;  2CU3 A;  2K25 A;  1T0R C;  4NPN A;  2D5G A;  3J9C A;  1HQR D;  1HA5 A;  2KN4 A;  1XD3 B;  2JPH A;  1D4B A;  4N58 A;  2ACZ B;  4HK2 A;  4GLS C;  3VUW A;  2GBM A;  4B0M A;  2IO1 B;  2WXP A;  1XLN A;  3V6C B;  4USA A;  1UBQ A;  1P1A A;  2EKE C;  2YLM A;  3A9J A;  3NVV A;  4X57 B;  5G5H A;  1TS5 A;  1GPX A;  1F77 A;  4GOC A;  2JUO A;  1FXA A;  2W3R A;  3W1Y A;  4LK0 M;  4NQK E;  4OVU A;  3RNB C;  2ZCC A;  1SIJ A;  4MH8 A;  4GDL B;  1WWT A;  1WX8 A;  5AZH A;  5E6N A;  3SFD B;  2KAN A;  4WH4 A;  2KQ4 X;  1ISN A;  3ZNZ B;  1B9R A;  2RPQ A;  2AWT A;  4LNK A;  1AW7 A;  1KOT A;  3L13 A;  2WU5 B;  5IA7 A;  3BVG A;  4JPS A;  4JL9 A;  4W9E A;  1EF1 A;  4US9 A;  2MQJ A;  1IP9 A;  1WGH A;  2KDB A;  3IFW B;  2W54 A;  1UF0 A;  2AYO B;  3H6N A;  3A9K A;  1VZ7 A;  3PZD A;  2MBQ A;  2Y3A A;  3Q8F A;  3RUI B;  1GNU A;  4ICU A;  2LJ5 A;  1TS4 A;  2O6V A;  2GI9 A;  2KQS A;  1RLF A;  2NTT A;  2AEH A;  2M1M A;  2BB6 A;  2KZR A;  4GGQ A;  1E7U A;  4A6Q A;  3M62 B;  1N5X A;  1IBX A;  5IO9 A;  4A90 A;  4KGS A;  1P98 A;  3A9K B;  4IDI A;  5AUK A;  2DHZ A;  3RPF C;  1P0R A;  3AE9 B;  2C5L C;  5CTR C;  4YSZ B;  4WIP A;  1ZKH A;  4KKI A;  4NAM A;  1C4A A;  4I6L B;  1C1Y B;  1PYW D;  2JSV X;  1WZ0 A;  2HE7 A;  4OZC A;  4IM2 A;  1G6J A;  3QIJ A;  5BYR A;  2LGI A;  2JWZ A;  1AWD A;  4QAY A;  5C1Z A;  1U4A A;  3RUL A;  1JW9 D;  3DBR B;  2J53 A;  5BMI A;  2AL3 A;  2IGH A;  3N3K B;  2MJE A;  3CWI A;  4EEW A;  3ZKJ C;  4PS3 A;  2LVO A;  4AJW A;  1Z2M A;  3NZ3 A;  4ZRJ A;  3Q3N C;  3N32 A;  5LXI B;  3OG5 A;  5IN7 A;  1TS2 A;  1K53 A;  2R2Q A;  4K81 A;  1CQV A;  1HTO A;  1GC6 A;  1YN4 A;  4P1B C;  1R4N I;  2KDI A;  1OEY J;  3ABV B;  2C9W B;  3TBL D;  4WJQ A;  4PS8 A;  4A55 A;  3PLV A;  4C56 C;  5TR5 A;  4G3X B;  4ZHO A;  4HPM B;  2G4D B;  1JWS D;  4GIV A;  3PV1 A;  1F0Z A;  2N7J A;  4LDT B;  1I4R A;  4W9I A;  4NZL B;  1NYQ A;  1XO3 A;  3KVF B;  3OWE B;  4HPL B;  4KKJ A;  2HTH A;  3ZRF A;  3VH3 B;  1ZXI A;  2DZJ A;  4NAW A;  1N62 A;  4IOI E;  3AUL A;  4W9G A;  1R7S A;  1NEN B;  2XK5 B;  4IWQ A;  2QDF A;  1YQB A;  5KHO A;  3ZNI D;  1FFV A;  1FRR A;  2INC C;  2KDM A;  3BY4 B;  4FN2 A;  2O6V D;  2LI5 A;  3KW5 B;  4MSQ B;  2GLS A;  4KGT A;  4NAW B;  1TKE A;  2FUH B;  4K3C A;  2RDG A;  4GB9 A;  1FO4 A;  1E6E B;  2ZVO A;  3AXC A;  5HG2 A;  5GMV A;  1KLG D;  3H9D A;  2YEP B;  1GUA B;  1F1H A;  1JWA D;  3RNE C;  4EZJ A;  2KAC A;  4OHJ A;  5EDS A;  1C78 A;  1F52 A;  1V5T A;  4GU2 A;  3KWV A;  1L6U A;  2DNF A;  4IWP A;  4KDI C;  2EKI A;  1YX5 B;  2XBB C;  1I4X A;  4IW0 A;  2ZEQ A;  1F9J A;  1WYW B;  2KT7 A;  3SFE B;  5E6P A;  4LJO B;  3C0R B;  4TV3 A;  1AYF A;  4ICV A;  3DBL I;  1EF5 A;  1RFA A;  2KQ7 A;  4LNF A;  2IO2 B;  5LNK 1;  2WX0 A;  2FIF A;  2KO3 A;  1NYR A;  4OW0 A;  1V2Y A;  4DXG A;  3KQ4 A;  1N63 A;  3EEC A;  2WWZ A;  3ML8 A;  2DBY A;  1WF9 A;  3ZRC A;  4P1C C;  4TMA B;  1KLU D;  2X38 A;  2KX3 A;  1EO6 A;  4BBN F;  2W55 A;  1LXD A;  3ZO5 B;  1MJD A;  4NJ7 A;  5D94 A;  2D10 A;  1DOX A;  3VAW A;  3HM6 X;  5JHA A;  1P9D U;  2AX5 A;  3A4S C;  2B76 B;  2CU1 A;  3UGB B;  3QHT A;  4K7U A;  1WE6 A;  3URY A;  2LAS A;  3BYY B;  3Q2A C;  1WI0 A;  3JYU A;  2GMI C;  3ZW3 A;  2D07 B;  3C8Y A;  3TSS A;  2PEA A;  2WXL A;  2BGF A;  5D7G A;  3LB8 C;  2HDE A;  3HK0 A;  1UWM A;  2V4L A;  4E74 A;  2B3A A;  3VTV A;  3FAH A;  2SEB D;  3I9V 1;  4W9L A;  4WJO A;  3VHT C;  2V4I B;  3PZ7 A;  1R4N B;  2IDY A;  3BK1 A;  1L7Y A;  3K9O B;  1ZOY B;  2OOB B;  4WUR A;  5AZF A;  3ZJU A;  2G1E A;  4KIK A;  1I35 A;  4RGM A;  3NVW A;  2DX5 B;  1P7F A;  4MJS A;  1YQ3 B;  3Q3M C;  2VRR B;  3T3N A;  3LJ3 A;  3N20 C;  2K8C A;  4JWU C;  3M95 A;  3FIL A;  2PMV A;  2Z59 B;  2LUE A;  1WYG A;  4FAD A;  2JZZ A;  3JSV B;  4RGO S;  4K1R B;  3ZLZ A;  3N30 A;  1YQ4 B;  3SHQ A;  1VZ6 A;  3WAN A;  1CK1 A;  2MP2 B;  2D3B A;  2QMT A;  3AM9 A;  1T5X D;  1Z5S B;  3PHX B;  2WXI A;  5T8I A;  1J7C A;  3FIL B;  2KJH B;  3PRE A;  3RI7 C;  4MM3 B;  1E90 A;  4YTM B;  5J2R A;  4C4V B;  1TY0 A;  3UI3 A;  5AEK B;  2LEK A;  5G5G A;  1GAQ B;  3R7R A;  3LYY A;  1N5W A;  4II3 B;  1I7H A;  3AE5 B;  1OQR A;  2L3Z A;  5JZE B;  3HRD D;  4A8X C;  2KOX A;  1JRP A;  2G3Q B;  4EFO A;  1K52 A;  4ZYN A;  5G55 A;  2LGD A;  4JIO U;  2BWE S;  1XLP A;  2PTL A;  2VZK D;  2JXT A;  4DXA B;  3KUZ A;  1V1O A;  2KWD A;  4NJC A;  2JQR B;  2XN9 C;  2RD0 A;  4BFR A;  2WXF A;  1PFD A;  3RNG C;  3SEB A;  2NTS A;  3AEA B;  3AB5 A;  3AEB B;  1ZDX A;  2WHI A;  3MJW A;  1VD2 A;  4MEL A;  3AH7 A;  3EFU A;  3AEE B;  4US8 A;  3BVM A;  3AEF B;  3O13 A;  2IGD A;  1ZPS A;  3RT3 B;  1E8Z A;  5EE0 A;  5HHD G;  2EMT A;  3DBL B;  3IBE A;  3UIP B;  5BYS A;  4DHZ B;  1WRD B;  3PO0 A;  3PGE A;  5C3J B;  2MBB B;  4FBJ B;  4W9J A;  2G45 B;  1ZGU B;  2Y5B B;  1EWY C;  5AZG A;  1E8Y A;  2WDR B;  2J0M A;  1ESF A;  2YEP F;  2Y5C A;  2QEJ C;  4WWP A;  1PGX A;  3QAQ A;  4PYZ A;  2OHF A;  4GSW A;  4F8C B;  5C2T B;  2REX A;  1T0Q C;  2KFJ A;  4YTN B;  2AQ2 B;  2UYZ B;  1RFK A;  1RRB A;  3NG0 A;  3OLM D;  3ZTC A;  1Q5W B;  4TQ1 A;  3TJP A;  2HTM E;  3B2F A;  4KSL C;  2BKR B;  3P42 A;  1WXQ A;  2KMA A;  4HKZ E;  1KH0 A;  2L8J A;  1ZXH A;  2JT4 B;  2K9X A;  4M01 A;  2KLC A;  5E6O A;  2DYB A;  2O2V B;  4C80 A;  1QLB B;  2WGS A;  1WX9 A;  3B1L X;  1WGR A;  3DVG Y;  1J8C A;  4L2Y A;  2W82 A;  3ZUN A;  3PRP B;  1A70 A;  3H7P A;  2HJ1 A;  2DWQ A;  3M63 B;  1MI0 A;  4W9D A;  4BOS C;  1WMH A;  3A1Q B;  1BML C;  2J52 A;  2I1J A;  2M8S A;  2L0F A;  3M3J A;  2BS2 B;  1FNU A;  3AE8 B;  4C7Y A;  2FCQ A;  4O1N A;  1MVK A;  3DHI C;  3IT4 B;  4HCP B;  3P2B A;  2D11 A;  1FEH A;  3AU4 A;  3DWG C;  1FPY A;  3WAP A;  3H7P B;  4M8M A;  3AI5 A;  4NJ6 A;  2N9P C;  2RGF A;  1JAL A;  2BYV E;  1PGA A;  4EOY A;  3Q14 C;  3O65 B;  3MC8 A;  3Q6B A;  2GOW A;  1WGD A;  2LXA A;  2ONQ A;  2PLP A;  4S17 A;  2JYT A;  5D3D A;  3V6E B;  3RCZ A;  1WFY A;  1WR1 A;  2CR5 A;  1P7E A;  2BYF A;  5DPT A;  2OED A;  1MPE A;  2WYQ A;  2LFI A;  1V49 A;  4LCD E;  3P1M A;  1I4G A;  1PQS A;  3EGR A;  3HUI A;  2KYW A;  3ZTD A;  1IUE A;  3A9J B;  3AV8 A;  4XC2 A;  3GZN I;  3RZW C;  2GBR A;  2MW5 A;  1E5W A;  3AMZ A;  5CHV C;  5DPR A;  3P4R B;  5FK9 C;  2FE8 A;  4TUU A;  5EE9 A;  1FXI A;  4A3O A;  3A33 B;  1ET6 A;  4IUM B;  5FKA C;  3HVD A;  2N1V A;  1I4H A;  3MJ5 A;  1TTN A;  2MEK A;  3OJ3 A;  1KFY B;  1R4M I;  1S1Q B;  3ZGZ A;  1SE2 A;  4GN1 A;  3APF A;  2PVO D;  2QSD A;  4AJY B;  2WQY B;  3ML9 A;  2KK8 A;  2TSS A;  2O6V B;  1X1M A;  3MP9 A;  2MJ3 A;  3AE7 B;  2JYE A;  1TS3 A;  1L4D B;  2HJ8 A;  4DXF A;  4XWW A;  3AE6 B;  3FKY A;  5DCN A;  2KDE B;  2L05 A;  1IBX B;  1D5M C;  3ZNG C;  1S3S G;  2KJ6 A;  2LGY A;  3ZQ4 A;  3I3T B;  4WJP A;  4FJV B;  3GE8 C;  1IGC A;  1N60 A;  3QCA A;  4IKG A;  4JLC A;  4K7S A;  4E71 A;  3PSE B;  2NCN A;  3BWU D;  2G4S A;  3BII D;  2L0T A;  3AE3 B;  3FC4 A;  4JQW C;  2EMS A;  1JWU D;  1E8X A;  1Q1O A;  4IWO A;  1GJZ A;  3UIO B;  2MX2 A;  4ZHP A;  1C9F A;  4KX6 B;  4HLE A;  2N4F A;  3VQI A;  3EFC A;  2JVC A;  2QJL A;  1YN5 A;  3VH4 B;  3ZNH B;  3R7Q A;  3ECI A;  1QIL A;  3TMP B;  2BYE A;  1UZX B;  2LRW A;  3RNA C;  3NHE B;  1SEB D;  3W1S A;  4YL8 A;  2DZK A;  1Y56 A;  1T0Y A;  4HXD A;  1MFW A;  3RN9 C;  2KTR A;  2ICI A;  2BTE A;  2N9K A;  4MGI E;  3NZS A;  2Z0D B;  4MDK E;  4NY0 A;  4Q2J A;  2L00 B;  2M0A A;  4JE3 B;  3JVZ X;  1C77 A;  3B0A A;  5H92 C;  3IT6 B;  1SGH A;  4L1B A;  2JZP A;  2RDB C;  3HVZ A;  2K22 A;  1JRU A;  3TEZ A;  4JWS C;  2BS4 B;  2FNJ B;  2LVP A;  2N7E A;  5J17 A;  3BZD B;  2ZPN A;  2WLB A;  3HHM A;  3ENE A;  3QA8 A;  4MGY E;  3PTF C;  1V86 A;  3W1S C;  3PT2 B;  2KC2 A;  2N1W A;  3PVL A;  1FNW A;  1XLO A;  2Y5P A;  4HJG E;  1KLV A;  2KWC A;  3HM3 A;  3BK2 A;  4M00 A;  4BKS A;  1NI2 A;  3GOE A;  3GZN B;  2J7Q B;  5HI1 A;  2CJO A;  1J19 A;  3KH0 A;  2LJI A;  3VTU A;  1OQQ A;  4BKG A;  4KDL B;  2CJN A;  3I63 C;  1XQQ A;  3Q3O C;  3R66 C;  3KYD D;  3H1U A;  2I2Y A;  2WXH A;  5DPS A;  2WXM A;  4MEM A;  3ZJT A;  1GC7 A;  2J4X A;  5AUI A;  1YJ1 A;  4LNI A;  3WAM A;  2GB1 A;  1SIF A;  3K9P B;  3VTW A;  1R4M B;  3SD5 A;  1F2R C;  3JW0 X;  3RD2 A;  3ONS A;  4F7Z A;  1TIF A;  3QJZ A;  2IYD B;  1VZ8 A;  3ZVV A;  3RFZ B;  4HPP A;  3KWL A;  4XGA B;  5D2M B;  2KVZ A;  5FR3 A;  3RZF A;  2WP9 B;  2OJW A;  1RAX A;  3DWM A;  3CF6 E;  1VDV A;  1OEY A;  1Q10 A;  3OJ4 B;  1GB4 A;  3ZIM A;  4ZYS A;  4OZB A;  3PRZ A;  2ON8 A;  2D3A A;  2I38 A;  2AL6 A;  2BQQ A;  4WWM A;  3EA6 A;  2QIL A;  3B08 A;  1TKY A;  4XYC A;  4ITK A;  3NY5 A;  4RGT A;  1WR6 E;  2KXJ A;  4HVB A;  1TY2 A;  2QC8 A;  1BT0 A;  1YJJ A;  4EUT A;  3P4P B;  3P4Q B;  1ZDV A;  2R61 A;  1M4V A;  1MG4 A;  1WH3 A;  5BMG A;  2VZK B;  1UNS A;  2WXJ A;  3C19 A;  5LLI A;  3OAW A;  4B6W A;  1STE A;  2N9X A;  3UIN B;  2D2Q A;  4DHZ E;  3ZYY X;  3RNF C;  3CSF A;  1RYJ A;  1WXV A;  1WJN A;  2KTF A;  2BT6 A;  1WE7 A;  3W9C B;  1YN3 A;  4DK5 A;  2MA9 B;  2I1K A;  3DDC B;  5CHW A;  2NPT A;  4BKS D;  3VUX A;  1HTQ A;  3R2T A;  2MBH A;  4FLH A;  4OVZ A;  3AEC B;  3N9Y C;  2K8H A;  4KIK B;  3APC A;  3ETR A;  4N6E B;  2WDV B;  2GRI A;  4MJS B;  1C4P A;  1HZ5 A;  4RCO A;  4WAF A;  3A4R A;  2ZPY A;  1WXS A;  4OZA A;  1TZ1 A;  4M02 A;  2IND C;  4AUQ C;  5HKH A;  1XCT L;  4G11 A;  1XLQ A;  3I5J C;  5HFY A;  2KNB A;  4UDU C;  1PDX A;  2Z8L A;  2ZVN A;  4WQM A;  4YT0 B;  1H8C A;  3Q3J A;  2NPT B;  4RFB A;  1ZUD 2;  3KUC B;  1WGY A;  3L0W B;  4IM0 A;  4TSS A;  3DCG A;  2GBJ A;  3U4E G;  2HD5 B;  1TGZ B;  2L32 A;  3TL5 A;  4PT5 A;  4EKU A;  2WXN A;  4GMV A;  4AS1 A;  4MGK E;  2V1Y A;  3WIM A;  2N9L A;  3WA0 A;  1FFU A;  1NEK B;  2KFK A;  1UGJ A;  4F1S A;  3NRZ A;  1XXG A;  5CHF A;  2KVR A;  4EZL A;  2LMC A;  2YVC A;  4RMA A;  4P7I A;  1UD7 A;  2PIA A;  3GP7 A;  1RM6 C;  1HE8 A;  4CYE A;  1SF0 A;  4WWN A;  2DZM A;  2XNA C;  1HEZ E;  3NZU A;  1SE3 A;  2JY6 A;  4DDG D;  4ZRQ A;  3AU5 A;  5IAA C;  2KFK B;  2DAJ A;  1JRO A;  2DEN B;  2IY1 B;  2CHZ A;  4IM3 A;  1UH6 A;  3I57 A;  2KKC A;  1V1P A;  3CST A;  3AE2 B;  4LNN A;  3VXW A;  1QF6 A;  2CS4 A;  3V3X A;  4G0N B;  3ALB A;  3MHZ A;  3B9J A;  3V62 A;  1TJE A;  2MH7 A;  3DOW A;  1E0Z A;  3SU8 X;  1L0X B;  1J0G A;  3QAR A;  1V1P B;  3T3O A;  4ANW A;  1QOB A;  4WWO A;  5TSS A;  4B0E A;  1I42 A;  2NBV B;  3B2G A;  1MHH E;  2MBO A;  4KGR A;  2NBU A;  1QT9 A;  4P16 A;  2Z0E B;  4XDC A;  3GS2 A;  2INN E;  1CMX B;  2CHW A;  2WXO A;  1QOF A;  4DBG A;  1TKG A;  3PS6 A;  4XX5 A;  3E9S A;  1RWS A;  4TKN A;  4ARC A;  3UQB A;  3T8M A;  2M4N A;  2WDQ B;  2V3P A;  2ZNV B;  1HXY D;  2LGX A;  1I4P A;  2M19 A;  1L0Y B;  1L6V A;  2L83 A;  2WS3 B;  2Q5W D;  4MSM B;  3DBS A;  2LRU A;  4YXD B;  3E56 A;  2W3S A;  1LGR A;  3NS8 A;  1L5P A;  4HCN B;  4ANV A;  3AE1 B;  2C7H A;  2ZNV C;  3NS1 A;  3GE3 C;  2GBK A;  2PE9 A;  4ANU A;  4BZA A;  1AN8 A;  3EUB 2;  3Q69 A;  2BB5 A;  4RF1 A;  2IPK D;  1WMH B;  3MFG A;  1P3Q U;  1EM7 A;  3TEX A;  1SJH D;  4K7W A;  3Q8C A;  1YX6 B;  2KHW B;  2D3C A;  4JGH B;  2DAF A;  2IZV B;  2LZ6 A;  2K6D B;  3CIR B;  3Q3F A;  3WCQ A;  1YJI A;  1V8C A;  3RYT A;  1WM3 A;  2OJR A;  2IJ0 A;  1EU4 A;  1C4C A;  4GDL A;  3ZXR A;  2R2O A;  2QCZ A;  1SE4 A;  3DVG X;  5JHB A;  2BKF A;  4FA6 A;  4FUL A;  1GB1 A;  1T6B X;  1TYG B;  2BPS A;  4N9F 4;  2CHX A;  3U30 A;  1B1Z A;  4L23 A;  1L0V B;  1TT5 B;  2A5U A;  4KV2 A;  3N1X C;  4XWT A;  4IG7 B;  4HRO A;  1XCQ L;  2K6Q A;  2IY0 B;  3HIZ A;  1QQR A;  1F2R I;  4ZRI A;  5BO4 B;  5L83 A;  1UGM A;  4W9K A;  4CQN A;  1ROE A;  1SB3 C;  1V81 A;  4NQL B;  3DHG C;  1ET9 A;  1FNV A;  1FCL A;  2KJR A;  3LXF A;  4KZC A;  3KLS X;  4FXC A;  2N9E B;  2K3U A;  4BBN C;  4GDK A;  2WXK A;  4W9H A;  2DZI A;  3TEY A;  1BUI C;  2ZW0 A;  3L4P A;  3IXS A;  1E9M A;  2BYT A;  2ASQ A;  1XEE A;  1C3T A;  1ZW7 A;  2WX1 A;  2V9H A;  1EUV B;  1ZP0 B;  4ZRP A;  1Q0W B;  2FCS A;  2W9N A;  1LFD A;  4DHJ D;  1ACC A;  3ZDT A;  3U7Z A;  5D6J B;  2ZZP B;  3VDZ A;  4LLG M;  4URK A;  4RF0 A;  1T0S C;  4GDK B;  2C60 A;  1FCC C;  2M17 A;  1YOV B;  4RNA A;  4ARI A;  1V9J A;  4ZRK A;  2FBW B;  5EE3 A;  3W5V B;  2NS5 A;  1FMA D;  4YTP B;  1DOI A;  4RGN A;  2XEW A;  1J7B A;  2ZCB A;  1KRH A;  1L2N A;  3IG3 A;  4ZOH C;  1NDD A;  1VLB A;  5G2N A;  4JX1 C;  5LXH A;  1GG3 A;  2E3T A;  4FJY A;  3X0W A;  1WJU A;  1JWB D;  1KJT A;  1E10 A;  4K3B A;  3NJT A;  4J6I A;  4HEA 1;  2NMQ A;  1K51 A;  1K8R B;  3RNC C;  2H89 B;  1WY8 A;  3AEG B;  1IPG A;  2D3G A;  1JWM D;  2M56 B;  3UF8 A;  1LO5 D;  2DLB A;  2BBC A;  5FR6 A;  3TEW A;  3IVF A;  2MRP A;  2UU7 A;  2WXG A;  1A5R A;  3NVY A;  2JX5 A;  2JWU A;  1OQY A;  1XT9 B;  3CMM B;  2KLG A;  1HZ6 A;  1SSN A;  2LWP A;  1E8W A;  2XK5 A;  2LHE A;  1PUT A;  2J0J A;  2KN5 A;  3BIN A;  4EE2 A;  3QWZ B;  1UBI A;  1JCK B;  2N7D A;  3U2S C;  2UWQ A;  2QHO A;  1JQ4 A;  4II2 B;  1WXM A;  1QKZ A;  3U8Z A;  4FJZ A;  1V97 A;  2C7M B;  4H2A A;  4CHK A;  3NUH B;  1EU3 A;  2BVC A;  1NBF C;  4DQO C;  2VH1 A;  2NR2 A;  3QC8 B;  2E6X A;  5DPW A;  3L54 A;  2KTR B;  1DOY A;  4N59 A;  2X8X X;  1D6E C;  2AQ3 B;  3BVZ A;  3VRA B;  1LQB A;  1FRD A;  1WJ6 A;  3U7D A;  4YWG G;  3RMK C;  3DBH I;  2G9H D;  2PW9 A;  5D3I B;  4XE0 A;  1V6E A;  5H8Y E;  1NVI D;  4RH6 A;  3VUY A;  3MC0 B;  4FHJ A;  3VVW B;  2NVU I;  3GB1 A;  2C7N B;  3KYC D;  2KWU B;  3PRM B;  4J3O D;  4LTU A;  3R8B A;  2MHJ A;  2GBN A;  4RM9 A;  4HRS A;  3QK0 A;  4HDQ A;  1V5O A;  3NOB A;  3BYT B;  4W9F A;  2K1F A;  1L4Z B;  1T3Q A;  1SE9 A;  3L17 A;  4AWJ A;  4PYU A;  3SR6 A;  2K0P A;  1H4R A;  3DVN U;  3EC8 A;  1J7A A;  1WRI A;  2LD9 A;  4M0W A;  1YNT E;  4DDI D;  3T9L A;  3V05 A;  4AP4 C;  1MHX A;  4MT5 A;  5I4D A;  1WGG A; 
#chains in the Genus database with same CATH homology
 3TL5 A;  3M3J A;  3ZKJ C;  4W9C A;  2FCQ A;  2M0X A;  4PS3 A;  2LVO A;  4LDT D;  4AJW A;  4EKU A;  1Z2M A;  3L10 B;  4GMV A;  4KVG B;  1WJ4 A;  4MGK E;  4ZRJ A;  2V1Y A;  4HCP B;  3S2A A;  3N32 A;  3P2B A;  3WIM A;  3WA0 A;  2D11 A;  3AU4 A;  5LXI B;  3LDZ E;  3WAP A;  3H7P B;  2R2Q A;  4M8M A;  2KFK A;  4K81 A;  4F1S A;  1GC6 A;  3AI5 A;  1YD8 U;  3SDL C;  4NJ6 A;  1R4N I;  2KVR A;  2N9P C;  2RGF A;  2YVC A;  3PHW B;  2BWF A;  4M0W B;  5CHF A;  2BYV E;  2KDI A;  1OEY J;  4RMA A;  4P7I A;  2C9W B;  3TBL D;  1UD7 A;  4WJQ A;  4EOY A;  4PS8 A;  2KWV B;  1YIW A;  1HE8 A;  4CYE A;  1QZE A;  1OGW A;  3O65 B;  3PLV A;  2ZJD A;  4WWN A;  2GOW A;  1WGD A;  2DZM A;  4G3X B;  2LXA A;  4WJN A;  2KX0 A;  3DQV A;  4HPM B;  5TR5 A;  2G4D B;  4WQO B;  4HDO A;  2J0K A;  3NZU A;  4GIV A;  3PV1 A;  5JH5 C;  1MG8 A;  2JY6 A;  3V6E B;  4LDT B;  4DDG D;  1WZ3 A;  2LVQ A;  3RCZ A;  3AU5 A;  5IAA C;  1WFY A;  1WR1 A;  3PPA A;  4W9I A;  2CR5 A;  2KFK B;  3X23 A;  2DAJ A;  2BYF A;  1WX7 A;  2DEN B;  2IY1 B;  2MSE D;  2CHZ A;  2RR9 A;  4IM3 A;  5DPT A;  1UH6 A;  2WYQ A;  2KKC A;  2PPH A;  4PS7 A;  3CST A;  5CX3 A;  1V49 A;  3KVF B;  4LCD E;  3VXW A;  1PQS A;  4HPL B;  2CS4 A;  2DYO A;  2HTH A;  4G0N B;  3ZRF A;  3ALB A;  3ZTD A;  3VH3 B;  2L76 A;  2DZJ A;  4NAW A;  3V62 A;  3A9J B;  4XC2 A;  3AUL A;  3GZN I;  3RZW C;  2GBR A;  2NBW B;  2MW5 A;  4W9G A;  2XK5 B;  4IWQ A;  1YQB A;  4EZK A;  1E5W A;  3DOW A;  5CHV C;  5KHO A;  3ZNI D;  5DPR A;  3SU8 X;  4CO7 A;  3BY4 B;  4FN2 A;  4E3C A;  1M94 A;  4HWI B;  2V3S A;  2O6V D;  4TUU A;  4B9K A;  1J0G A;  3QAR A;  2LI5 A;  4A3O A;  4ANW A;  3KW5 B;  3A33 B;  4WWO A;  2MBE A;  1I42 A;  4IUM B;  4MSQ B;  2NBV B;  3JSV A;  2N1V A;  1TTN A;  2MBO A;  4NAW B;  2FUH B;  2NBU A;  4GB9 A;  1E7V A;  2ZVO A;  3OJ3 A;  4MGZ E;  3AXC A;  1R4M I;  2K39 A;  1S1Q B;  2MP2 A;  2Z0E B;  4RM8 A;  5GMV A;  1AAR A;  3VFK A;  1WIA A;  1CMX B;  4GN1 A;  3APF A;  3H9D A;  2CHW A;  1GUA B;  4AJY B;  2KC1 A;  2JF5 A;  3ML9 A;  4DBG A;  3PS6 A;  1LM8 B;  4XX5 A;  4EZJ A;  2KK8 A;  4MM3 A;  1VCB A;  1X1M A;  2O6V B;  2WDT B;  4TKN A;  5EDS A;  2JXX A;  3UQB A;  3T8M A;  2M4N A;  1OTR B;  2ZNV B;  3L08 A;  2LGX A;  1V5T A;  2MWS B;  4GU2 A;  2MCN B;  3V60 A;  2HJ8 A;  4IWP A;  4KDI C;  5DCN A;  2KDE B;  2L05 A;  2A4Z A;  3D32 A;  1YX5 B;  2XBB C;  4IW0 A;  2IO3 B;  2ZEQ A;  4MSM B;  3ZNG C;  1S3S G;  1F9J A;  2KJ6 A;  3DBS A;  2LGY A;  3I3T B;  4DWF A;  1WYW B;  3PLU A;  2LRU A;  4WJP A;  4FJV B;  5E6P A;  4LJO B;  3NS8 A;  3C0R B;  4BOZ B;  4TV3 A;  4HCN B;  4ANV A;  2C7H A;  2ZNV C;  4ICV A;  3QCA A;  3DBL I;  1EF5 A;  1RFA A;  3APD A;  2GBK A;  2KQ7 A;  4JLC A;  2IO2 B;  4K7S A;  4BVU C;  4E71 A;  2PE9 A;  2K8B A;  2NCN A;  3PSE B;  4KSK C;  2G4S A;  2WX0 A;  3MTN B;  4ANU A;  2JRI B;  2FIF A;  2KO3 A;  2L0T A;  1WMH B;  1V2Y A;  1P3Q U;  3DPD A;  4K7W A;  4JQW C;  2EMS A;  1YX6 B;  2DYM A;  1E8X A;  1Q1O A;  2KHW B;  3EEC A;  2PE6 B;  2WWZ A;  3ML8 A;  4IWO A;  4JGH B;  1V80 A;  2DAF A;  4M8N A;  2IZV B;  2LZ6 A;  3UIO B;  1GJZ A;  2K6D B;  1WF9 A;  2MX2 A;  3ZRC A;  3Q3F A;  4HLE A;  2N4F A;  2IO0 B;  3VQI A;  3RYT A;  2KX3 A;  1EO6 A;  1WM3 A;  2JVC A;  2OJR A;  2FAZ A;  4BBN F;  1LXD A;  4GDL A;  2R2O A;  4I6P A;  2MLB A;  3ZO5 B;  3UQA A;  4MH0 E;  4A3P A;  3DVG X;  5JHB A;  4NJ7 A;  3KUD B;  5D94 A;  4TQ0 A;  3VH4 B;  2D10 A;  3ZNH B;  3R7Q A;  3VAW A;  3ECI A;  3HM6 X;  3TCA A;  5JHA A;  2BKF A;  4FA6 A;  4FUL A;  1P9D U;  3A4S C;  3TMP B;  2BYE A;  1TBE A;  2BPS A;  2LRW A;  1UZX B;  5C23 A;  4N9F 4;  3NHE B;  3W1S A;  2CHX A;  4G50 A;  4YL8 A;  2DZK A;  2CU1 A;  2LXC A;  3UGB B;  3U30 A;  4XZ4 A;  1WXA A;  2A5U A;  4KV2 A;  1T0Y A;  3QHT A;  3L16 A;  4IG7 B;  4K7U A;  2KMC A;  1WE6 A;  2LAS A;  1WI0 A;  2JRH A;  2L7R A;  3JYU A;  4HXD A;  2GMI C;  2KTR A;  2K6Q A;  3R3M A;  3ZW3 A;  2IY0 B;  4MGI E;  2D07 B;  3HIZ A;  4NNJ B;  3NZS A;  5KHQ A;  2Z0D B;  4ZRI A;  2PEA A;  2BGF A;  4MDK E;  5D7G A;  4NY0 A;  3HK0 A;  2V4L A;  5BO4 B;  3EHV A;  5L83 A;  1UGM A;  4W9K A;  4E74 A;  4OVV A;  2B3A A;  4LJP B;  2L00 B;  3VTV A;  4GXB A;  4W9L A;  3JVZ X;  3B0A A;  4WJO A;  3VHT C;  4ASW C;  4ANX A;  1SGH A;  1UEL A;  1V81 A;  4NQL B;  3WAL A;  3DBR I;  4BKT A;  1L7Y A;  3K9O B;  2KJR A;  3IHP C;  4KZC A;  4WAA A;  2OOB B;  5AZF A;  2FCN A;  2N9E B;  2KDF B;  1JRU A;  4KIK A;  4BBN C;  4GDK A;  1I35 A;  2FNJ B;  2DX5 B;  2LVP A;  2N7E A;  4MJS A;  4W9H A;  2IBI B;  2DZI A;  2JZ3 B;  2VRR B;  5J17 A;  2ZPN A;  3LJ3 A;  5J18 A;  3HHM A;  2ASQ A;  1C3T A;  1ZW7 A;  2O2V A;  2K8C A;  2WX1 A;  3ENE A;  2RSU A;  3QA8 A;  4MGY E;  3PTF C;  1EUV B;  1V86 A;  3M95 A;  4I6N B;  3W1S C;  3PT2 B;  4HJK A;  1Q0W B;  2LUE A;  2Z59 B;  4A20 A;  2FCS A;  2KC2 A;  2W9N A;  2N1W A;  2JZZ A;  3JSV B;  3PVL A;  4FAD A;  1LFD A;  2BF8 B;  3ZDM C;  4K1R B;  4DHJ D;  3ZLZ A;  4IC7 B;  3ZDT A;  3N30 A;  5D6J B;  2KWC A;  1KLV A;  3A1Q A;  3HM3 A;  4B95 A;  2ZZP B;  3SHQ A;  3VDZ A;  4URK A;  1Y8R C;  1WM2 A;  4GDK B;  4BKS A;  2C60 A;  1NI2 A;  1FXT B;  1KM7 A;  2M17 A;  2PJH A;  4KZ0 A;  2MP2 B;  3GOE A;  3WAN A;  3WAO A;  2J7Q B;  4FHK A;  3H7S A;  1IYF A;  1J19 A;  3KH0 A;  3VTU A;  4AOF A;  1V9J A;  4BKG A;  4KDL B;  4ZRK A;  1Z5S B;  1D3Z A;  3PHX B;  2NS5 A;  3V61 A;  2XEW A;  2KJH B;  3PRE A;  2ZCB A;  3QX1 A;  1XQQ A;  2CKH B;  2FID A;  4EEW A;  1L2N A;  3DVN V;  1E90 A;  3IG3 A;  2FCM A;  1NDD A;  3R66 C;  5J2R A;  3QQ8 B;  3KYD D;  3H1U A;  2KD0 A;  5DPS A;  5G2N A;  5AEK B;  5LXH A;  5L95 C;  1GG3 A;  4FJY A;  4MEM A;  3TIX A;  3X0W A;  4ZDV A;  1WJU A;  1GC7 A;  1KJT A;  4DHJ B;  3R7R A;  4II3 B;  3MHS D;  1YJ1 A;  4J6I A;  1K8R B;  3WAM A;  1SIF A;  3K9P B;  1WY8 A;  2K25 A;  3SD5 A;  1IPG A;  2L3Z A;  3VTW A;  2D3G A;  5JZE B;  2KOX A;  4NPN A;  3JW0 X;  3RD2 A;  3ONS A;  4F7Z A;  3UF8 A;  2G3Q B;  2IYD B;  3QJZ A;  4EFO A;  3ZVV A;  4ZYN A;  5FR6 A;  5G55 A;  5D2M B;  2LGD A;  4JIO U;  2BWE S;  1XD3 B;  3IVF A;  2MRP A;  2JPH A;  3RZF A;  1A5R A;  4HK2 A;  3VUW A;  4DXA B;  3KUZ A;  1RAX A;  2GBM A;  2RD0 A;  3CF6 E;  4BFR A;  1OEY A;  2IO1 B;  1OQY A;  1XT9 B;  3OJ4 B;  3CMM B;  3V6C B;  2KLG A;  1UBQ A;  1P1A A;  2EKE C;  2YLM A;  3A9J A;  4X57 B;  3ZIM A;  2LWP A;  4GOC A;  2JUO A;  3MJW A;  1E8W A;  3PRZ A;  1VD2 A;  2XK5 A;  2AL6 A;  3W1Y A;  4MEL A;  2J0J A;  2KN5 A;  4NQK E;  3EFU A;  4OVU A;  2ZCC A;  3BIN A;  3B08 A;  3QWZ B;  1UBI A;  3NY5 A;  1WR6 E;  2N7D A;  4GDL B;  1WX8 A;  2KXJ A;  2UWQ A;  2QHO A;  5E6N A;  5AZH A;  2KAN A;  4HVB A;  4II2 B;  1BT0 A;  1ISN A;  3ZNZ B;  4EUT A;  1WXM A;  2RPQ A;  3RT3 B;  2AWT A;  1E8Z A;  3U8Z A;  4FJZ A;  2EMT A;  1WH3 A;  1KOT A;  3L13 A;  3IBE A;  2C7M B;  4CHK A;  5IA7 A;  3UIP B;  4DHZ B;  1WRD B;  4JL9 A;  5LLI A;  3PGE A;  4W9E A;  1EF1 A;  2MBB B;  2MQJ A;  1NBF C;  3OAW A;  4B6W A;  4FBJ B;  4W9J A;  2G45 B;  1IP9 A;  2NR2 A;  1WGH A;  1ZGU B;  2Y5B B;  3QC8 B;  5AZG A;  1E8Y A;  2N9X A;  2KDB A;  2J0M A;  3IFW B;  3UIN B;  5DPW A;  2D2Q A;  3L54 A;  4DHZ E;  2KTR B;  2AYO B;  4WWP A;  3H6N A;  3A9K A;  3QAQ A;  3PZD A;  2MBQ A;  3CSF A;  4PYZ A;  4GSW A;  4F8C B;  1WXV A;  1LQB A;  2REX A;  1WJ6 A;  1WJN A;  3U7D A;  2KTF A;  3RUI B;  1GNU A;  2KFJ A;  4ICU A;  2LJ5 A;  3DBH I;  1WE7 A;  2O6V A;  2KQS A;  2UYZ B;  1RLF A;  4DK5 A;  1V6E A;  2AEH A;  1RRB A;  2MA9 B;  2M1M A;  3OLM D;  2I1K A;  3ZTC A;  3VUY A;  2KZR A;  1Q5W B;  3DDC B;  5CHW A;  4TQ1 A;  2NPT A;  4GGQ A;  3VUX A;  4BKS D;  1E7U A;  4FHJ A;  3TJP A;  4KSL C;  2BKR B;  2MBH A;  3M62 B;  4FLH A;  3VVW B;  2K8H A;  4KIK B;  2NVU I;  3APC A;  2KMA A;  1P98 A;  3A9K B;  2C7N B;  2DHZ A;  2L8J A;  4MJS B;  3KYC D;  2KWU B;  2JT4 B;  2ZPY A;  1P0R A;  1WXS A;  2C5L C;  1TZ1 A;  3A4R A;  3PRM B;  5CTR C;  1ZKH A;  2KLC A;  5E6O A;  2DYB A;  2GBN A;  4RM9 A;  2O2V B;  3QK0 A;  4HDQ A;  1V5O A;  4AUQ C;  4I6L B;  3NOB A;  1C1Y B;  5HKH A;  4EZL A;  4W9F A;  1WX9 A;  1WZ0 A;  2HE7 A;  2K1F A;  3B1L X;  4G11 A;  4IM2 A;  1SE9 A;  1WGR A;  3DVG Y;  3L17 A;  4AWJ A;  1J8C A;  1G6J A;  4PYU A;  2KNB A;  3QIJ A;  3ZUN A;  2ZVN A;  3PRP B;  1H8C A;  3H7P A;  3Q3J A;  2NPT B;  2JWZ A;  1H4R A;  3DVN U;  3EC8 A;  3M63 B;  5C1Z A;  4W9D A;  1U4A A;  2LD9 A;  3KUC B;  1WGY A;  1WMH A;  3A1Q B;  3L0W B;  4IM0 A;  3RUL A;  3DCG A;  4BOS C;  4DDI D;  2GBJ A;  2AL3 A;  3T9L A;  4AP4 C;  3N3K B;  2I1J A;  2M8S A;  2HD5 B;  2L0F A;  1WGG A;  1TGZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...