3PLUA

Structure of hub-1 protein in complex with snu66 peptide (hindi)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
HMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Peptide binding protein
molecule keywords Ubiquitin-like modifier HUB1
total genus 22
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pluA00
4HXDA 3A9JB 2JUOA 4AWJA 1G6JA 2KDEB 3V60A 1TZ1A 3ZDTA 4B6WA 2GBRA 5DPTA 3VUWA 1LQBA 3LJ3A 4I6NB 2V4LA 3ZIMA 3RT3B 3A9KB 2LXAA 5JZEB 4GU2A 1V9JA 2C5LC 4K1RB 3APCA 3U8ZA 3ZRFA 5IAAC 4GOCA 2KJ6A 1WZ0A 3UQAA 2L76A 2DHZA 4AJWA 3SU8X 2WX0A 2I1JA 1E8YA 2WDTB 4NAWB 2N9EB 1KLVA 2FCNA 3R7RA 3H9DA 4M8MA 1JRUA 2NCNA 3VDZA 1P1AA 4W9JA 3ZW3A 4BFRA 2KO3A 2JT4B 2L3ZA 2N7DA 3PRZA 1V2YA 4W9KA 3H7SA 3DDCB 2GBJA 2KDBA 5AZHA 1YJ1A 2CU1A 2IO1B 2KANA 4HCNB 4HWIB 5TR5A 4HPLB 3B08A 1WE6A 1WGRA 3L08A 1TTNA 2RR9A 4A3PA 2J0MA 1E90A 4KSKC 1L2NA 4URKA 1HE8A 1UD7A 4P7IA 1WZ3A 3PRPB 2ZJDA 3PPAA 1D3ZA 4MH0E 2AYOB 4DK5A 4KZCA 3VXWA 2FCSA 2KMAA 2EMSA 2KTRA 3OJ3A 3ZNGC 2CHZA 4HK2A 5CHVC 3AXCA 3M62B 1Z2MA 3UIPB 3R3MA 2JF5A 4FHKA 3PLVA 2JPHA 3QC8B 2NBUA 2XEWA 1YX6B 2KJHB 2D07B 3HM3A 3PV1A 4HDQA 3IFWB 3WA0A 2NBVB 4GSWA 4CHKA 3NS8A 2IO3B 2KLGA 4WJQA 4NJ7A 1WY8A 2J7QB 3T8MA 3AU4A 4LCDE 1V49A 2LVQA 3ZRCA 3QHTA 3PVLA 2LRWA 1PQSA 1F9JA 2HD5B 3V61A 4G11A 4ZRKA 3DBSA 3NHEB 4GMVA 1WF9A 1Z5SB 4B95A 1K8RB 5EDSA 2LXCA 1MG8A 2BWES 2LGXA 1CMXB 3A33B 3PTFC 2DX5B 4E71A 3ZDMC 2MX2A 2XK5A 5GMVA 2KTRB 2CKHB 1WMHA 4FJZA 2XBBC 2KQ7A 3UGBB 2A4ZA 2K39A 2KK8A 4K7UA 4KIKB 5D7GA 1V6EA 2ZCCA 4IWOA 4M8NA 4BOZB 4GDKA 1WJUA 2KFJA 1WGDA 1IPGA 4II3B 1GUAB 3RUIB 4FJVB 5L83A 4JGHB 2FCMA 4KVGB 4MEMA 1UZXB 2M8SA 2L00B 4BKSD 4EFOA 3H6NA 1WFYA 1FXTB 1WJNA 1WH3A 1YIWA 2Z0DB 2K6DB 3A9JA 3VAWA 4DBGA 3V6EB 1X1MA 4W9EA 1UBIA 1LFDA 4ASWC 3PLUA 1WXSA 1WM3A 3DVGY 4ZRIA 1WRDB 3A4RA 2K1FA 2LWPA 2K25A 1KJTA 1WJ6A 5CHFA 2MLBA 4EKUA 4NY0A 2W9NA 5C23A 4F7ZA 4K81A 2XK5B 3JYUA 2LJ5A 4LDTB 2EMTA 2BYVE 4MJSA 1UELA 2JZ3B 4IG7B 4FN2A 3TCAA 1WX9A 3EECA 3N3KB 4JLCA 4W9HA 3X23A 3APFA 4XC2A 1AARA 2WWZA 1T0YA 2OJRA 2ZCBA 5KHQA 3ENEA 1NI2A 1C1YB 1V5TA 1GC7A 2LRUA 4IUMB 2AL3A 1P0RA 2LGDA 3RD2A 3C0RB 4KDLB 2RGFA 2JXXA 2O6VA 4AP4C 3GOEA 2N7EA 2C7NB 2LVPA 4NAWA 1H4RA 2FIDA 2IO2B 2V1YA 3L17A 1SE9A 2C7HA 2BYEA 4EZKA 2KN5A 2LASA 1WMHB 1Y8RC 1M94A 5E6OA 3HK0A 3WAOA 3PHXB 4DDID 5L95C 2DZJA 3B0AA 2N9XA 2KVRA 3M63B 4G0NB 4B9KA 3DVNV 3IBEA 2PJHA 2KNBA 3DBLI 1Q1OA 3V62A 1SIFA 4RM8A 3TJPA 3O65B 2EKEC 3UF8A 3APDA 4BOSC 1VCBA 2MBHA 2ZEQA 3ZVVA 1WXVA 2HTHA 3ZKJC 1V86A 1QZEA 1ZKHA 3L0WB 2D10A 3GZNI 2KTFA 2MBEA 3ZO5B 3ML8A 2LGYA 2N1VA 2WYQA 3PZDA 2YVCA 2CS4A 2FUHB 3EFUA 3ZNZB 3WIMA 2MRPA 2KC2A 5JHAA 2RSUA 2JWZA 1NDDA 3HHMA 1TGZB 4A20A 4WWOA 2A5UA 2DZIA 3VQIA 1OEYA 4ICUA 2KX0A 1WR6E 1C3TA 2AWTA 4HDOA 3NZUA 1P3QU 3QCAA 3IG3A 3UQBA 3EC8A 4JQWC 4HCPB 4W9IA 4FJYA 2BKRB 4PS3A 2IBIB 3QX1A 2KWUB 1VD2A 2KJRA 3VUYA 1P9DU 3KVFB 2D2QA 2DYMA 2K8HA 2R2QA 3HIZA 3JW0X 3OJ4B 3PSEB 4K7WA 4WJPA 2N4FA 3MJWA 2R2OA 4MM3A 4MGKE 3ZNID 2KX3A 3RULA 5FR6A 4MSMB 4X57B 2DYOA 2PPHA 2KDFB 3VFKA 2CR5A 3SHQA 2ZNVC 4F1SA 2PEAA 4IW0A 1H8CA 1LM8B 4MJSB 2IO0B 2UWQA 1WX7A 1WJ4A 4WWNA 1S1QB 1E8ZA 3WAMA 3HM6X 4GGQA 2NPTB 2JVCA 1WE7A 4ANXA 5E6PA 2J0JA 2MBOA 3ZTDA 3QJZA 1U4AA 1WYWB 2AEHA 2BYFA 3AULA 2DAFA 4II2B 3B1LX 4TV3A 4YL8A 3VUXA 3WAPA 4ANWA 2ZVOA 4GDLA 3ZNHB 2MP2B 2KOXA 4JIOU 3WANA 5J17A 1KM7A 2UYZB 3TL5A 3A1QA 1XQQA 4PS8A 3SDLC 3T9LA 4HPMB 2ASQA 5DPSA 1GJZA 4KDIC 2RD0A 5CTRC 2V3SA 4TQ0A 3JSVB 3H7PA 3LDZE 4EOYA 3VVWB 1J0GA 2KDIA 2KHWB 5CHWA 2VRRB 3CF6E 4JL9A 1R4MI 2CHWA 3BY4B 5D94A 5G2NA 4NNJB 2ZPYA 4XZ4A 3S2AA 1E8XA 3WALA 4ANUA 2O2VB 3QARA 5IA7A 1OGWA 4WWPA 3ZUNA 3DCGA 3R66C 4WJNA 1I35A 4DHJB 3MTNB 1V80A 3PGEA 4PYUA 4EEWA 2L0TA 5HKHA 5LXIB 3SD5A 1NBFC 3ONSA 3TIXA 2FAZA 3N30A 3RZWC 4MDKE 4AJYB 5AEKB 2REXA 1WM2A 3X0WA 3A9KA 1WXAA 2IY0B 3JSVA 2C7MB 3PHWB 1L7YA 4FA6A 3CSFA 3VH3B 3RYTA 2HE7A 5C1ZA 1J8CA 5KHOA 1E7VA 2J0KA 3EHVA 4N9F4 2GBNA 2NVUI 3NY5A 1YD8U 2ZZPB 1WX8A 3DBRI 3QK0A 2L7RA 4GN1A 2MP2A 3U7DA 3H1UA 4DHZE 2BPSA 2LVOA 4TUUA 5E6NA 2GBMA 2KXJA 4FADA 4MELA 2MW5A 3ALBA 5AZFA 4BKTA 2DZKA 3VTUA 1EO6A 1S3SG 4IC7B 3DOWA 3V6CB 4AOFA 2KWVB 4OVUA 2BWFA 2GMIC 5JH5C 2NBWB 2KMCA 5DPWA 3DPDA 1YQBA 4F8CB 2AL6A 1RFAA 2G4SA 2PE6B 2YLMA 3R7QA 3NZSA 4AUQC 2KZRA 3QAQA 2FIFA 1E8WA 4A3OA 3OAWA 3VTVA 3K9OB 4CYEA 2FNJB 4ZYNA 2KLCA 1WGGA 3QWZB 5JHBA 1I42A 3TMPB 3M3JA 3L13A 4ICVA 1UH6A 2ZNVB 1P98A 3MHSD 4KZ0A 2IY1B 4FULA 3TBLD 5J18A 1KOTA 3JVZX 2KQSA 2NPTA 3KW5B 1SGHA 1WGYA 2LZ6A 2NR2A 5DPRA 4M0WB 4E3CA 2MA9B 1ZGUB 2LD9A 3ZTCA 3Q3JA 3A4SC 2MWSB 5D2MB 4MGZE 2LUEA 4MSQB 4NJ6A 3K9PB 2L05A 3H7PB 4W9DA 4W9LA 4DHZB 2MBQA 1LXDA 3L10B 3VH4B 3UIOB 4J6IA 3CMMB 4G3XB 2CHXA 2GOWA 1UBQA 4GDLB 5AZGA 2BGFA 4WQOB 1WIAA 3I3TB 3QQ8B 2KFKB 2M1MA 4W9GA 2D11A 3ML9A 2DZMA 2JRHA 1WR1A 3AU5A 1RRBA 4HVBA 3BINA 2DAJA 2G4DB 5BO4B 1OEYJ 4BBNC 2N9PC 3QIJA 2KKCA 4NQLB 3DBHI 4BVUC 4BKGA 2O6VD 2PE9A 4FHJA 1XT9B 1V81A 2L0FA 4DDGD 2NS5A 2Z59B 2Z0EB 2DYBA 1EUVB 4PYZA 1GG3A 3UINB 2D3GA 3NOBA 3KUZA 3PS6A 1EF1A 3OLMD 2BKFA 3PRMB 4IM0A 2QHOA 4I6PA 4IWQA 4WAAA 1GNUA 2OOBB 3L54A 3U30A 4E74A 4ZRJA 1XD3B 4KSLC 4BBNF 4XX5A 4DXAB 2HJ8A 4I6LB 2ZPNA 4RMAA 4IWPA 2FCQA 1E7UA 2B3AA 1E5WA 2I1KA 2L8JA 4FLHA 3KYCD 5DCNA 2K6QA 3M95A 3P2BA 4GIVA 1BT0A 4G50A 2BF8B 2RPQA 4IM3A 4W9FA 1A5RA 1J19A 3PT2B 1ISNA 3DVGX 4PS7A 1TBEA 2JY6A 3PREA 5CX3A 4EUTA 4EZJA 3KUCB 2MCNB 2MBBB 4HJKA 1EF5A 4ANVA 3RZFA 3KH0A 3IHPC 2JRIB 2K8CA 3KUDB 4LJOB 1UGMA 4TKNA 2C60A 5G55A 5LLIA 4GXBA 1WXMA 3W1YA 1IP9A 2ZVNA 2KFKA 4DWFA 2MSED 3L16A 2WX1A 3RCZA 4LDTD 3Q3FA 4W9CA 1IYFA 1YX5B 1OQYA 4LJPB 2N1WA 1Q0WB 2M17A 2M0XA 3KYDD 1Q5WB 2MQJA 4FBJB 1ZW7A 3AI5A 1RAXA 2C9WB 3A1QB 1WGHA 2KD0A 4K7SA 3VTWA 3W1SA 4IM2A 4KV2A 1GC6A 4NQKE 3IVFA 4GDKB 3QA8A 2K8BA 4DHJD 1V5OA 4KIKA 3CSTA 4MGIE 3ECIA 2IYDB 4MGYE 5J2RA 3D32A 2KC1A 1OTRB 2G45B 2Y5BB 1R4NI 2DENB 4BKSA 4ZDVA 2JZZA 1RLFA 2G3QB 4OVVA 2O2VA 2KWCA 3ZLZA 4EZLA 3DQVA 4RM9A 2M4NA 4GB9A 5LXHA 2IZVB 3W1SC 1WI0A 4TQ1A 4CO7A 4WJOA 2GBKA 4NPNA 3N32A 5D6JB 2O6VB 4HLEA 3VHTC 3DVNU 2LI5A
chains in the Genus database with same CATH superfamily
3A9JB 4AWJA 4A90A 3E56A 3ZDTA 5DPTA 4RH6A 2MH7A 3LJ3A 2V4LA 2KWDA 3RT3B 1P7FA 4K1RB 3CWIA 2V4IB 4GOCA 3UQAA 3AMZA 1B9RA 1C4AA 2WX0A 1F2RI 2WDVB 4AQ7A 2WDTB 2FCNA 3R7RA 3VDZA 3AE7B 4XWWA 2WXMA 4W9KA 3H7SA 4HCNB 4HPLB 1TTNA 2WXKA 2LGIA 4URKA 1IGCA 4ARCA 4JWSC 3PRPB 4MH0E 4S0RA 3AEBB 5D3IB 1WWTA 3DBHB 3P4SB 2ZW0A 1Z2MA 1QLBB 3QC8B 2XEWA 1YX6B 2D07B 2WS3B 4R3DA 3Q8BA 4GSWA 4HROA 3AU4A 3PO0A 3QHTA 3MJ5A 2LRWA 4G11A 4ZRKA 3DBSA 1L0XB 4OW0A 4B95A 4OZCA 2LXCA 2LGXA 3ZDMC 2MX2A 1R7SA 1ESFA 2M0AA 1QT9A 2KK8A 1YMHE 5D7GA 4KIKB 1NI3A 4IWOA 2BB6A 1WJUA 1WGDA 1IPGA 3RMKC 3RUIB 5L83A 4RCOA 3GE3C 1FXIA 2FCMA 2K9XA 4KVGB 4MEMA 2L00B 1PDXA 1LGRA 2Z0DB 1BUIC 1DOIA 1I4XA 1JWUD 5EE1A 3VAWA 1SE3A 1ZDXA 4ASWC 1WXSA 1K51A 1QQRA 1F77A 1WRDB 3IXSA 5JXVA 4JE3B 3R8BA 2LWPA 3DWMA 1L4DB 2GB1A 4EKUA 2EELA 4K81A 3JYUA 4LDTB 3N20C 4IG7B 3TCAA 4JLCA 3N3KB 1KRHA 1VJKA 3AE4B 1ZPSA 5KHQA 1V5TA 2LRUA 3DBLB 2I2YA 3RD2A 2O6VA 3GOEA 2C7NB 4NAWA 1MI0A 3J9CA 3Q3NC 1GAQB 2WLBA 1F0ZA 5IN7A 3PHXB 2N9XA 4G0NB 3DVNV 1Q10A 4M01A 4LNIA 1ZXHA 2KNBA 1PYWD 3BYTB 2FUG1 4NAMA 1AW7A 5FR3A 1SF0A 3GZNI 2PVGC 2OHFA 1QOAA 3ZO5B 3ML8A 1TS4A 2WXNA 3W2DA 1FNWA 2CS4A 2L52A 3GS2A 1XLNA 1NDDA 4KGTA 4TSSA 1P3QU 4JQWC 3P1MA 4W9IA 2BKRB 2IBIB 3QX1A 2KJRA 4DXGA 3VUYA 2INNE 4MGKE 1E6EB 3ZNID 2PPHA 3SHQA 2ZNVC 1HQRD 4F1SA 2WXPA 4MJSB 1QILA 2PIAA 2RMMA 3WAMA 1S1QB 4A55A 2NPTB 2HTME 2INDC 3QJZA 1U4AA 2DAFA 4TV3A 2NMQA 2KOXA 4JIOU 4XE0A 5HI1A 2UYZB 3TL5A 3A1QA 1XQQA 3T9LA 2ASQA 4C4VB 2MJ3A 3MHZA 2NTSA 5CTRC 4MT5A 4OZBA 1YQ3B 1QOBA 4EOYA 2KHWB 2MJDA 4KKIA 5CHWA 2VRRB 3I5JC 2KAJA 3AECB 1R4MI 3BY4B 5D94A 4ANUA 2O2VB 4HKZE 4WWPA 4WJNA 1I35A 1FXAA 3FC4A 3NVZA 3RPFC 3PGEA 2Q5WD 5LXIB 3SD5A 3ONSA 3TIXA 3EGRA 2L32A 2IY0B 3JSVA 4JPSA 3VH3B 3RYTA 1LO5D 2HE7A 1E7VA 3ZYYX 2NVUI 3DBRI 4GN1A 2BPSA 3DHHC 1JROA 4YWGG 3FILA 3I57A 4IC7B 3FILB 1QF6A 2GMIC 1F1HA 2QSDA 3DPDA 4F8CB 2G4SA 2YLMA 2ONQA 3NZSA 4AUQC 2FIFA 2N9KA 4A3OA 4J3OD 5T8IA 2FNJB 2BS4B 2CU3A 3MC9A 1P98A 1SJHD 4ARIA 2NPTA 3KW5B 3NRZA 1R4MB 1FM0D 3MFGA 2LD9A 3ZTCA 3EFCA 3Q3JA 1ZP0B 4NJ6A 3K9PB 2QILA 5AUIA 3NVYA 3H7PB 2K3UA 4W9DA 4C00A 3LXFA 1N5XA 4DHZB 3LYYA 3UIOB 3CMMB 5AZGA 2PW9A 1WIAA 3BVMA 2KFKB 3AEFB 2M1MA 3LB8C 1WYGA 1RRBA 4HVBA 3BINA 3P42A 1FEHA 3QIJA 4XWTA 4BKGA 1XT9B 1ET6A 2KQ4X 2NS5A 1I7HA 2Z0EB 3NVVA 1C79A 2LEKA 1GNUA 3U30A 1FIQA 2QCZA 4BBNF 3NVWA 2BB5A 2ZPNA 4IWPA 2FCQA 2B3AA 1E5WA 4FLHA 2RDBC 1C4PA 2BF8B 1ISNA 3PREA 2ICIA 3KUCB 3NUHB 4DXFA 2K0PA 3KUDB 1JQ4A 3Q3MC 1IP9A 4RFBA 4ZHPA 3RCZA 2SEBD 4W9CA 3HUIA 2N1WA 1Q0WB 1Q5WB 2QJLA 2N9LA 5AUKA 1ZW7A 3VTWA 1WGHA 1XXGA 4K7SA 4GDKB 4RGNA 1EM7A 3CSTA 4MGIE 2IYDB 2KC1A 2WHIA 2Y5BB 2DENB 1RLFA 3ZLZA 3IT4B 2M4NA 1IGDA 1FO4A 5D6JB 3B9JA 4HLEA 3HVDA 2JUOA 3UI3A 1VRAB 2W3RA 2GBRA 2D5GA 4I6NB 3ZIMA 4QAYA 5JZEB 4GU2A 4C80A 1V9JA 1I4PA 3N1ZC 5IAAC 4UDUC 1N63A 2INPE 4YT0B 2DHZA 2WXHA 2MHJA 1VR9A 4PK1A 4K3BA 4B0MA 1UF0A 1KLVA 4YSYB 2NCNA 2BW2A 2JT4B 2WXJA 1TKYA 1N6ZA 4IOIE 3DDCB 2KDBA 5MPOA 5AZHA 2IO1B 3VR9B 1WE6A 1YJIA 1VZ6A 4A3PA 1L2NA 2CJOA 1HE8A 1WZ3A 1ZE3D 4DK5A 3VXWA 2FCSA 2EMSA 3NJTA 3P4QB 3UIPB 1L6VA 3TJPA 2JPHA 2NBUA 3WA0A 2KJHB 3HM3A 5EE9A 4HDQA 3IFWB 2NBVB 1I4GA 3NS8A 4WJQA 2XNAC 2J7QB 1UNSA 4LCDE 3WCQA 1V49A 2LVQA 3ZRCA 3PVLA 1F9JA 1UUPA 3KWVA 4YXDB 4GMVA 3Q8CA 1XCQL 2BWES 4E71A 3A33B 3PTFC 2DX5B 2XK5A 5GMVA 1WMHA 4FJZA 4L23A 1L0VB 1MHHE 2K39A 1ET9A 4K7UA 1V6EA 2ZCCA 4BOZB 1GUAB 4FJVB 4JGHB 1UZXB 1ZUD2 5BMHA 3H6NA 1WFYA 1WH3A 4DQOC 3A9JA 1FFVA 4W9EA 3VRAB 3A4RA 1XLQA 5CHFA 2W82A 4NY0A 2EKIA 4RGOS 2BYVE 4MJSA 4YTMB 1UELA 3EECA 3V3XA 3W5VB 3X23A 1PGBA 4XC2A 3P4RB 5IP4D 2WXGA 3ENEA 3AH7A 1XLPA 3URYA 1P0RA 3C0RB 4KDLB 2N7JA 2RGFA 1ACCA 4AP4C 2LVPA 2FIDA 2V1YA 2G1EA 1SE9A 2BYEA 1Y8RC 2PTLA 2BYTA 1PUTA 2DZJA 1I4HA 3IBEA 4JWUC 2PJHA 1Q1OA 1VDVA 1SIFA 3I63C 3O65B 1T3QA 1VCBA 2ZEQA 3ZVVA 1KLGD 2HTHA 3ZKJC 1ZKHA 3L0WB 3TUOA 2KTFA 2WQYB 2LGYA 2WYQA 2WXOA 3PZDA 2FUHB 1V1PB 3ZNZB 2Y3AA 1SEBD 1SE4A 3HHMA 2DZIA 3E9SA 1OQRA 4FXCA 4ICUA 1JWSD 1C3TA 1WRIA 3QCAA 3EC8A 4HCPB 2CJNA 4FJYA 2INCC 1D6EC 1P9DU 3KVFB 2DYMA 2K8HA 3JW0X 1D5MC 3OJ4B 4WJPA 4NZLB 4WURA 4RF1A 1SSNA 2KX3A 3GZNB 4X57B 3AEDB 1GB4A 1RYJA 4IW0A 2J53A 2X38A 1D5ZC 4WWNA 1WX7A 3AB5A 1WE7A 4ANXA 2AEHA 1T0QC 3AULA 3WAPA 3B1LX 4ANWA 2ZVOA 1F52A 3MC0B 1WXQA 3FAHA 2MP2B 3WANA 2K5PA 3U52E 2JX5A 3MC8A 4P16A 4YTNB 1GJZA 3H7PA 3LDZE 3VVWB 1J0GA 3CF6E 4JL9A 2CHWA 2ZPYA 4XZ4A 1IBXB 3QARA 2YEPF 3ZUNA 1PFDA 4DHJB 4LNOA 4EEWA 5HKHA 3AE6B 3N30A 3RZWC 4MDKE 4AJYB 5AEKB 2REXA 3PHWB 1L7YA 1SXTA 4FA6A 3P4PB 1STEA 2J0KA 3Q8FA 3EHVA 2QDFA 5D3DA 1YD8U 2ZZPB 4DHZE 2LMCA 4OHJA 4TUUA 5E6NA 3ALBA 5AZFA 4BKTA 1EO6A 3DOWA 2KWVB 4OVUA 2NBWB 3TEWA 3ZGZA 2IGHA 1YQBA 1IUEA 2X8XX 3R7QA 1V1OA 3QAQA 1E8WA 1YN5A 3K9OB 2OJWA 3M3JA 4LNNA 3L13A 1J7BA 1KTKA 1UH6A 3AE9B 3MHSD 4FULA 3TBLD 2WDQB 2GI9A 3JVZX 4PT5A 1ZGUB 4WWMA 5D2MB 2PVOD 1ENFA 2LHEA 2CHXA 2GOWA 1UBQA 4BZAA 2BGFA 4WQOB 2JZPA 1XO3A 4W9GA 1NVID 2D11A 2ZW1A 3ML9A 3ZJVA 2DZMA 5BO4B 2KKCA 4BVUC 1V81A 3TEZA 3T3OA 2D3GA 1PGXA 1EF1A 3OLMD 3PRMB 2QHOA 2KVZA 4WAAA 2OOBB 3L54A 4ZRJA 1UGJA 4KSLC 4DXAB 4XYCA 3AE5B 4RMAA 2I1KA 4H2AA 3ETRA 1TKEA 3M95A 3B2FA 1VLBA 1QOGA 4GIVA 4IM3A 1N61A 1XF5L 4EZJA 3NS1A 3PZ8A 2K8CA 2C60A 4WAFA 2MSED 2WNMA 3GB1A 3BK2A 1Y56A 5C2TB 4LJPB 2M17A 3KYDD 2FE8A 2MQJA 3AE3B 4WH4A 2ACZB 3U2SC 3W1SA 2KACA 3RNGC 4DHJD 1V5OA 1XLOA 3ECIA 3D32A 4BKSA 1VZ7A 1PGAA 1GPXA 2WDRB 3W5UB 2KWCA 2LFIA 4RM9A 4RF0A 3BYYB 1TS2A 5LXHA 1C9FA 1WI0A 3N32A 1HZ5A 2O6VB 2D3AA 2DLBA 4B6WA 3VUWA 3B2GA 3A9KB 2LXAA 4XDCA 4LNFA 2C5LC 3U8ZA 3ZRFA 1EWYC 2XN9C 4CQNA 4P1CC 2KJ6A 1WZ0A 2L76A 2JYEA 1SE2A 1E8YA 2IGGA 2WXLA 4NAWB 1V1PA 1HA5A 2VH2A 2E3TA 4BFRA 1ROEA 2MJEA 2N7DA 4HRSA 1V2YA 2QMTA 2RDHA 2GBJA 2WXQA 1YJ1A 2CU1A 5EE3A 2KANA 4HWIB 5TR5A 3IAS1 2BTEA 1WGRA 3L08A 2RR9A 2IDYA 3SFDB 1UD7A 4P7IA 3PPAA 2AYOB 2JQRB 5TSSA 2KMAA 4HK2A 5CHVC 3AXCA 3M62B 2JF5A 2J4XA 3PV1A 3RNAC 4CHKA 2KLGA 2BVCA 4YSXB 3T8MA 3HVZA 1QKZA 4O1NA 2HD5B 3V61A 5BYQA 1WF9A 4D2KA 2WXFA 5EDSA 1SBBB 4KGRA 4WIPA 2IJ0A 4XDDA 2A4ZA 1DOXA 2BT6A 2M8SA 3N9YC 1I4RA 4EFOA 1FXTB 1WJNA 3V6EB 3KWLA 1UBIA 2JU6X 3PLUA 1TYGB 4ZRIA 1SB3C 1DGJA 2K25A 2MLBA 2MEKA 3V05A 2XK5B 2LJ5A 2JZ3B 3R2IA 1WX9A 4W9HA 1FD6A 3RFZB 1AARA 1T0YA 2ZCBA 1NI2A 1C1YB 3RNEC 1MFWA 1TT5B 3FKYA 2LHDA 4IUMB 2LGDA 2JXXA 1HEZE 2IO2B 2V0GA 3L17A 2M19A 4EZKA 2KN5A 1WMHB 5E6OA 3WAOA 4DDID 3O13A 5L95C 4RNAA 1HXYD 3B0AA 2OEDA 3PZ7A 3V62A 4A9AA 2JXTA 3APDA 1C4CA 3AE1B 4BOSC 2MBHA 1AYFA 2D3BA 2D10A 3AE2B 2H89B 2AX5A 2YVCA 1T0SC 5BMIA 5JHAA 3WIMA 2MRPA 2JWZA 1NEKB 4N58A 2Y5PA 4A20A 1ZDVA 3IAM1 3VQIA 4S17A 2IPKD 1WR6E 1YOVB 2VZKB 3NZUA 2H88B 4PS3A 2KWUB 1FNUA 5E6JA 3SEBA 2D2QA 2R2QA 3DHGC 3PSEB 3BVZA 2BS2B 4K7WA 4L2YA 2R2OA 3RULA 5FR6A 4MSMB 2DYOA 3W9CB 1ZXIA 3TEXA 1XEEA 1H8CA 1LM8B 1N5WA 4M0WA 2UWQA 1WJ4A 1E8ZA 4GGQA 2J0JA 2MBOA 2ON8A 1IBXA 3VUXA 5FKAC 4GDLA 4PS8A 4ITKA 3SDLC 5DPSA 2RD0A 2V3SA 1E10A 3DBRB 4LTUA 2KDIA 4US8A 5G2NA 3S2AA 3WALA 1D4BA 5IA7A 4ZHOA 1V80A 1AN8A 1NBFC 4KKJA 4B0EA 2G9HD 1WGKA 1TIFA 1WM2A 3A9KA 1WXAA 2C7MB 3CSFA 2DNFA 5KHOA 4N9F4 2GBNA 1V8CA 3OWEB 3QK0A 2L7RA 2MP2A 4BAXA 3H1UA 2LVOA 4WQMA 2GBMA 2KXJA 2MW5A 2SAKA 3VTUA 1UWXA 3V6CB 2BWFA 5JH5C 1ZOYB 1GB1A 2KN4A 2PE6B 5HG2A 2KZRA 1RM6C 1JWAD 3VTVA 1TY0A 2W3SA 4CYEA 4ZYNA 3AEEB 3Q14C 1JW9D 1WGGA 3QWZB 5JHBA 2WP9B 3TMPB 2ZNVB 3H8HA 4KZ0A 4HEA1 2IY1B 5J18A 3Q3OC 3L4PA 2KQSA 3BVGA 2LZ6A 5DPRA 4M0WB 2M56B 1L5PA 2MWSB 3BK1A 3AN1A 4MSQB 1MG4A 1N62A 2WXRA 4HJGE 1T5XD 5FK9C 2MBQA 1LXDA 2R61A 1HZ6A 3L10B 3VH4B 4GDLB 3QQ8B 1SJED 1WR1A 3RN9C 3AU5A 2DAJA 1CQVA 4BBNC 2N9PC 4NQLB 3DBHI 3EUB2 2UU7A 4C56C 1EUVB 1GG3A 3UINB 3I9V1 2J52A 4I6PA 5LNK1 4E74A 1XD3B 2JWUA 4MM3B 4XX5A 2HJ8A 3NZ3A 4JX1C 5IO9A 4M00A 4HPPA 1BXTA 5DCNA 2KYWA 1J7CA 1J7AA 1BT0A 5G5GA 1J19A 4PS7A 5I4DA 1TBEA 1CK1A 5CX3A 4EUTA 3BZDB 2AQ1B 2RDGA 2MCNB 2MBBB 1SIJA 1EF5A 4ANVA 3RZFA 2JRIB 2LGSA 4LJOB 4TKNA 5LLIA 3NG0A 3W1YA 4DWFA 4A8XC 3L16A 2WX1A 4IKGA 1IYFA 1C76A 1YX5B 1OQYA 1FCLA 2KT7A 3AI5A 1RAXA 2C9WB 2RPVA 2KD0A 3A1QB 3C19A 1GC6A 4NQKE 1K52A 2JYTA 2K8BA 4ZRQA 3CIRB 1GOZA 4Q2JA 5GXGB 5J2RA 5C3JB 2WGSA 1F2RC 1OTRB 1JWMD 4ZDVA 2JZZA 2G3QB 4OVVA 2O2VA 4EZLA 4MACA 3C8YA 3W1SC 4WJOA 2GBKA 2LI5A 1EU4A 4HXDA 1K50A 2J42A 1JRPA 2KDEB 3AE8B 3V60A 5IKCM 1G6JA 4C4VA 1TZ1A 1LQBA 2GLSA 2FBWB 3APCA 2I38A 4L1BA 3N1XC 1C78A 4AJWA 3SU8X 3BIID 2I1JA 4P6VF 1NYRA 2N9EB 3H9DA 2VZKD 4M8MA 1JRUA 1P1AA 4W9JA 3ZW3A 2KO3A 2L3ZA 1WSPA 3PRZA 1KF6B 2W54A 1MJDA 2BS3B 3U7ZA 3GP7A 3B08A 2J0MA 1E90A 4KSKC 2PMVA 1FRRA 2K22A 1D5XC 2ZJDA 1D3ZA 2L1AA 4KZCA 3OJ3A 2VH1A 2KTRA 3ZNGC 2CHZA 1DYQA 1JCKB 3Q6BA 4YTPB 3R3MA 4FHKA 3PLVA 2PKOA 3AM9A 2IO3B 1L6UA 4NJ7A 1WY8A 5H8YE 3Q69A 1PQSA 3NHEB 1Z5SB 1K8RB 1MG8A 1CMXB 1FRDA 1HTOA 3AEAB 2KTRB 2WXIA 2CKHB 2XBBC 2KQ7A 3UGBB 5BYSA 4M8NA 4GDKA 2KFJA 4II3B 1QOFA 4BKSD 1YIWA 1N60A 3ZXRA 2E6XA 2K6DB 4IDIA 4DBGA 1X1MA 1LFDA 2DBYA 1WM3A 3DVGY 5HFYA 4ZRPA 3Q8EA 5EE0A 2K1FA 3Q8AA 1KJTA 1DOYA 1WJ6A 2W9NA 5C23A 4F7ZA 1TY2A 2N0SB 2EMTA 4ZYSA 3N1YC 2V9HA 4FN2A 3BWUD 1E9MA 3HRDD 4LK0M 2KMMA 3APFA 2WWZA 2OJRA 1GC7A 2AL3A 1MHXA 4GLSC 2N7EA 4LNKA 1UWMA 1H4RA 4NJCA 3VR8B 2C7HA 2LASA 1M94A 3HK0A 1JALA 1FNVA 2KVRA 3M63B 4B9KA 2D3CA 3DBLI 3P63A 4RM8A 2EKEC 4P1BC 3UF8A 2Z8LA 1A70A 1OQQA 1WXVA 2KDMA 1V86A 1QZEA 2MBEA 1FMAD 2N1VA 1FPYA 2B76B 3EFUA 2V3PA 2KC2A 2RSUA 2W55A 3MP9A 1TGZB 4WWOA 2A5UA 1YN3A 1OEYA 2KX0A 3Q2AC 2AQ2B 2AWTA 4HDOA 3IG3A 3UQBA 1MPEA 5IOIA 1JMLA 1TS5A 1B1ZA 5G5HA 1VD2A 3HIZA 2N4FA 3MJWA 4MM3A 4N6EB 4M02A 2KDFB 3VFKA 2CR5A 2PEAA 4OVZA 2IO0B 3HM6X 2JVCA 3ZXVA 3R2TA 5E6PA 3U4EG 3ZTDA 4C7ZA 1WYWB 2BYFA 4II2B 4K3CA 4YL8A 3DHIC 3IT6B 3TEYA 3ZNHB 5J17A 1KM7A 1KFYB 4HPMB 4KDIC 4TQ0A 3KLSX 1TS3A 3JSVB 1RWSA 4XGAB 2WU2B 4NNJB 2PLPA 1E8XA 2GRIA 1OGWA 1TKGA 3DCGA 1E7PB 3R66C 3EA6A 3MTNB 1NYQA 2AQ3B 4PYUA 2L0TA 2LUMA 1VZ8A 2FAZA 3ZJUA 2TSSA 4AS1A 1EWCA 3X0WA 2BBCA 5C1ZA 1J8CA 3OG5A 4C7YA 3NY5A 1WX8A 3U7DA 2NTTA 1V97A 1T0RC 3TSSA 4FADA 4MELA 2QIEB 2DZKA 4US9A 1S3SG 4LLGM 4AOFA 1YQ4B 1YJJA 2KMCA 5DPWA 4YSZB 1CZPA 2AL6A 1RFAA 5H92C 1JWBD 3OAWA 1YN4A 1TJEA 4A6QA 2KLCA 1I42A 1YNTE 4ICVA 2IGDA 2DWQA 1CJEA 2L83A 1KOTA 1HTQA 1BMLC 3ZJTA 1SGHA 1WGYA 2WU5B 2NR2A 4TMAB 2LJIA 4E3CA 2MA9B 4USAA 1E0ZA 4KGSA 3ZQ4A 1TZOA 3A4SC 4MGZE 2LUEA 1K53A 2L05A 4W9LA 1OFFA 4KX6B 4J6IA 4G3XB 3SR6A 3AEGB 3RI7C 3I3TB 1T6BX 1M4VA 2V3NA 2JRHA 2G4DB 1C77A 1OEYJ 3ABVB 2O6VD 1FFUA 2PE9A 4FHJA 4ACFA 1KLUD 2JSVX 3SFEB 3T3NA 2L0FA 4DDGD 2Z59B 2DYBA 4PYZA 3KQ4A 4N59A 3NOBA 3KUZA 3PS6A 1EU3A 2HJ1A 2BKFA 4IM0A 3RNCC 5BYRA 4IWQA 2QEJC 5BMGA 4I6LB 4REZA 1L0YB 3AV8A 1E7UA 2L8JA 3KYCD 2K6QA 3P2BA 1KH0A 4RGTA 4G50A 1A5RA 2RPQA 4W9FA 3PT2B 3DVGX 1FCCC 2JY6A 3RNBC 1AWDA 4MH8A 4HJKA 3VRBB 4OZAA 1L4ZB 4RGMA 3KH0A 3IHPC 5G55A 1UGMA 4GXBA 1WXMA 1RFKA 2ZVNA 2KFKA 1R4NB 2Y5CA 4LDTD 3Q3FA 5HHDG 2QC8A 2M0XA 2HDEA 4EE2A 1MVKA 3RNFC 4FBJB 1I4QA 4IM2A 4KV2A 3IVFA 3QA8A 4KIKA 1NENB 4MGYE 1P7EA 2G45B 1R4NI 3DWGC 3DQVA 4GB9A 2YEPB 4ZOHC 2IZVB 1XCTL 4TQ1A 4CO7A 4NPNA 2BQQA 4HKQA 3VHTC 3DVNU 3GE8C
chains in the Genus database with same CATH topology
4HXDA 3A9JB 2JUOA 4AWJA 1G6JA 2KDEB 3V60A 1TZ1A 3ZDTA 4B6WA 2GBRA 5DPTA 3VUWA 1LQBA 3LJ3A 4I6NB 2V4LA 3ZIMA 3RT3B 3A9KB 2LXAA 5JZEB 4GU2A 1V9JA 2C5LC 4K1RB 3APCA 3U8ZA 3ZRFA 5IAAC 4GOCA 2KJ6A 1WZ0A 3UQAA 2L76A 2DHZA 4AJWA 3SU8X 2WX0A 2I1JA 1E8YA 2WDTB 4NAWB 2N9EB 1KLVA 2FCNA 3R7RA 3H9DA 4M8MA 1JRUA 2NCNA 3VDZA 1P1AA 4W9JA 3ZW3A 4BFRA 2KO3A 2JT4B 2L3ZA 2N7DA 3PRZA 1V2YA 4W9KA 3H7SA 3DDCB 2GBJA 2KDBA 5AZHA 1YJ1A 2CU1A 2IO1B 2KANA 4HCNB 4HWIB 5TR5A 4HPLB 3B08A 1WE6A 1WGRA 3L08A 1TTNA 2RR9A 4A3PA 2J0MA 1E90A 4KSKC 1L2NA 4URKA 1HE8A 1UD7A 4P7IA 1WZ3A 3PRPB 2ZJDA 3PPAA 1D3ZA 4MH0E 2AYOB 4DK5A 4KZCA 3VXWA 2FCSA 2KMAA 2EMSA 2KTRA 3OJ3A 3ZNGC 2CHZA 4HK2A 5CHVC 3AXCA 3M62B 1Z2MA 3UIPB 3R3MA 2JF5A 4FHKA 3PLVA 2JPHA 3QC8B 2NBUA 2XEWA 1YX6B 2KJHB 2D07B 3HM3A 3PV1A 4HDQA 3IFWB 3WA0A 2NBVB 4GSWA 4CHKA 3NS8A 2IO3B 2KLGA 4WJQA 4NJ7A 1WY8A 2J7QB 3T8MA 3AU4A 4LCDE 1V49A 2LVQA 3ZRCA 3QHTA 3PVLA 2LRWA 1PQSA 1F9JA 2HD5B 3V61A 4G11A 4ZRKA 3DBSA 3NHEB 4GMVA 1WF9A 1Z5SB 4B95A 1K8RB 5EDSA 2LXCA 1MG8A 2BWES 2LGXA 1CMXB 3A33B 3PTFC 2DX5B 4E71A 3ZDMC 2MX2A 2XK5A 5GMVA 2KTRB 2CKHB 1WMHA 4FJZA 2XBBC 2KQ7A 3UGBB 2A4ZA 2K39A 2KK8A 4K7UA 4KIKB 5D7GA 1V6EA 2ZCCA 4IWOA 4M8NA 4BOZB 4GDKA 1WJUA 2KFJA 1WGDA 1IPGA 4II3B 1GUAB 3RUIB 4FJVB 5L83A 4JGHB 2FCMA 4KVGB 4MEMA 1UZXB 2M8SA 2L00B 4BKSD 4EFOA 3H6NA 1WFYA 1FXTB 1WJNA 1WH3A 1YIWA 2Z0DB 2K6DB 3A9JA 3VAWA 4DBGA 3V6EB 1X1MA 4W9EA 1UBIA 1LFDA 4ASWC 3PLUA 1WXSA 1WM3A 3DVGY 4ZRIA 1WRDB 3A4RA 2K1FA 2LWPA 2K25A 1KJTA 1WJ6A 5CHFA 2MLBA 4EKUA 4NY0A 2W9NA 5C23A 4F7ZA 4K81A 2XK5B 3JYUA 2LJ5A 4LDTB 2EMTA 2BYVE 4MJSA 1UELA 2JZ3B 4IG7B 4FN2A 3TCAA 1WX9A 3EECA 3N3KB 4JLCA 4W9HA 3X23A 3APFA 4XC2A 1AARA 2WWZA 1T0YA 2OJRA 2ZCBA 5KHQA 3ENEA 1NI2A 1C1YB 1V5TA 1GC7A 2LRUA 4IUMB 2AL3A 1P0RA 2LGDA 3RD2A 3C0RB 4KDLB 2RGFA 2JXXA 2O6VA 4AP4C 3GOEA 2N7EA 2C7NB 2LVPA 4NAWA 1H4RA 2FIDA 2IO2B 2V1YA 3L17A 1SE9A 2C7HA 2BYEA 4EZKA 2KN5A 2LASA 1WMHB 1Y8RC 1M94A 5E6OA 3HK0A 3WAOA 3PHXB 4DDID 5L95C 2DZJA 3B0AA 2N9XA 2KVRA 3M63B 4G0NB 4B9KA 3DVNV 3IBEA 2PJHA 2KNBA 3DBLI 1Q1OA 3V62A 1SIFA 4RM8A 3TJPA 3O65B 2EKEC 3UF8A 3APDA 4BOSC 1VCBA 2MBHA 2ZEQA 3ZVVA 1WXVA 2HTHA 3ZKJC 1V86A 1QZEA 1ZKHA 3L0WB 2D10A 3GZNI 2KTFA 2MBEA 3ZO5B 3ML8A 2LGYA 2N1VA 2WYQA 3PZDA 2YVCA 2CS4A 2FUHB 3EFUA 3ZNZB 3WIMA 2MRPA 2KC2A 5JHAA 2RSUA 2JWZA 1NDDA 3HHMA 1TGZB 4A20A 4WWOA 2A5UA 2DZIA 3VQIA 1OEYA 4ICUA 2KX0A 1WR6E 1C3TA 2AWTA 4HDOA 3NZUA 1P3QU 3QCAA 3IG3A 3UQBA 3EC8A 4JQWC 4HCPB 4W9IA 4FJYA 2BKRB 4PS3A 2IBIB 3QX1A 2KWUB 1VD2A 2KJRA 3VUYA 1P9DU 3KVFB 2D2QA 2DYMA 2K8HA 2R2QA 3HIZA 3JW0X 3OJ4B 3PSEB 4K7WA 4WJPA 2N4FA 3MJWA 2R2OA 4MM3A 4MGKE 3ZNID 2KX3A 3RULA 5FR6A 4MSMB 4X57B 2DYOA 2PPHA 2KDFB 3VFKA 2CR5A 3SHQA 2ZNVC 4F1SA 2PEAA 4IW0A 1H8CA 1LM8B 4MJSB 2IO0B 2UWQA 1WX7A 1WJ4A 4WWNA 1S1QB 1E8ZA 3WAMA 3HM6X 4GGQA 2NPTB 2JVCA 1WE7A 4ANXA 5E6PA 2J0JA 2MBOA 3ZTDA 3QJZA 1U4AA 1WYWB 2AEHA 2BYFA 3AULA 2DAFA 4II2B 3B1LX 4TV3A 4YL8A 3VUXA 3WAPA 4ANWA 2ZVOA 4GDLA 3ZNHB 2MP2B 2KOXA 4JIOU 3WANA 5J17A 1KM7A 2UYZB 3TL5A 3A1QA 1XQQA 4PS8A 3SDLC 3T9LA 4HPMB 2ASQA 5DPSA 1GJZA 4KDIC 2RD0A 5CTRC 2V3SA 4TQ0A 3JSVB 3H7PA 3LDZE 4EOYA 3VVWB 1J0GA 2KDIA 2KHWB 5CHWA 2VRRB 3CF6E 4JL9A 1R4MI 2CHWA 3BY4B 5D94A 5G2NA 4NNJB 2ZPYA 4XZ4A 3S2AA 1E8XA 3WALA 4ANUA 2O2VB 3QARA 5IA7A 1OGWA 4WWPA 3ZUNA 3DCGA 3R66C 4WJNA 1I35A 4DHJB 3MTNB 1V80A 3PGEA 4PYUA 4EEWA 2L0TA 5HKHA 5LXIB 3SD5A 1NBFC 3ONSA 3TIXA 2FAZA 3N30A 3RZWC 4MDKE 4AJYB 5AEKB 2REXA 1WM2A 3X0WA 3A9KA 1WXAA 2IY0B 3JSVA 2C7MB 3PHWB 1L7YA 4FA6A 3CSFA 3VH3B 3RYTA 2HE7A 5C1ZA 1J8CA 5KHOA 1E7VA 2J0KA 3EHVA 4N9F4 2GBNA 2NVUI 3NY5A 1YD8U 2ZZPB 1WX8A 3DBRI 3QK0A 2L7RA 4GN1A 2MP2A 3U7DA 3H1UA 4DHZE 2BPSA 2LVOA 4TUUA 5E6NA 2GBMA 2KXJA 4FADA 4MELA 2MW5A 3ALBA 5AZFA 4BKTA 2DZKA 3VTUA 1EO6A 1S3SG 4IC7B 3DOWA 3V6CB 4AOFA 2KWVB 4OVUA 2BWFA 2GMIC 5JH5C 2NBWB 2KMCA 5DPWA 3DPDA 1YQBA 4F8CB 2AL6A 1RFAA 2G4SA 2PE6B 2YLMA 3R7QA 3NZSA 4AUQC 2KZRA 3QAQA 2FIFA 1E8WA 4A3OA 3OAWA 3VTVA 3K9OB 4CYEA 2FNJB 4ZYNA 2KLCA 1WGGA 3QWZB 5JHBA 1I42A 3TMPB 3M3JA 3L13A 4ICVA 1UH6A 2ZNVB 1P98A 3MHSD 4KZ0A 2IY1B 4FULA 3TBLD 5J18A 1KOTA 3JVZX 2KQSA 2NPTA 3KW5B 1SGHA 1WGYA 2LZ6A 2NR2A 5DPRA 4M0WB 4E3CA 2MA9B 1ZGUB 2LD9A 3ZTCA 3Q3JA 3A4SC 2MWSB 5D2MB 4MGZE 2LUEA 4MSQB 4NJ6A 3K9PB 2L05A 3H7PB 4W9DA 4W9LA 4DHZB 2MBQA 1LXDA 3L10B 3VH4B 3UIOB 4J6IA 3CMMB 4G3XB 2CHXA 2GOWA 1UBQA 4GDLB 5AZGA 2BGFA 4WQOB 1WIAA 3I3TB 3QQ8B 2KFKB 2M1MA 4W9GA 2D11A 3ML9A 2DZMA 2JRHA 1WR1A 3AU5A 1RRBA 4HVBA 3BINA 2DAJA 2G4DB 5BO4B 1OEYJ 4BBNC 2N9PC 3QIJA 2KKCA 4NQLB 3DBHI 4BVUC 4BKGA 2O6VD 2PE9A 4FHJA 1XT9B 1V81A 2L0FA 4DDGD 2NS5A 2Z59B 2Z0EB 2DYBA 1EUVB 4PYZA 1GG3A 3UINB 2D3GA 3NOBA 3KUZA 3PS6A 1EF1A 3OLMD 2BKFA 3PRMB 4IM0A 2QHOA 4I6PA 4IWQA 4WAAA 1GNUA 2OOBB 3L54A 3U30A 4E74A 4ZRJA 1XD3B 4KSLC 4BBNF 4XX5A 4DXAB 2HJ8A 4I6LB 2ZPNA 4RMAA 4IWPA 2FCQA 1E7UA 2B3AA 1E5WA 2I1KA 2L8JA 4FLHA 3KYCD 5DCNA 2K6QA 3M95A 3P2BA 4GIVA 1BT0A 4G50A 2BF8B 2RPQA 4IM3A 4W9FA 1A5RA 1J19A 3PT2B 1ISNA 3DVGX 4PS7A 1TBEA 2JY6A 3PREA 5CX3A 4EUTA 4EZJA 3KUCB 2MCNB 2MBBB 4HJKA 1EF5A 4ANVA 3RZFA 3KH0A 3IHPC 2JRIB 2K8CA 3KUDB 4LJOB 1UGMA 4TKNA 2C60A 5G55A 5LLIA 4GXBA 1WXMA 3W1YA 1IP9A 2ZVNA 2KFKA 4DWFA 2MSED 3L16A 2WX1A 3RCZA 4LDTD 3Q3FA 4W9CA 1IYFA 1YX5B 1OQYA 4LJPB 2N1WA 1Q0WB 2M17A 2M0XA 3KYDD 1Q5WB 2MQJA 4FBJB 1ZW7A 3AI5A 1RAXA 2C9WB 3A1QB 1WGHA 2KD0A 4K7SA 3VTWA 3W1SA 4IM2A 4KV2A 1GC6A 4NQKE 3IVFA 4GDKB 3QA8A 2K8BA 4DHJD 1V5OA 4KIKA 3CSTA 4MGIE 3ECIA 2IYDB 4MGYE 5J2RA 3D32A 2KC1A 1OTRB 2G45B 2Y5BB 1R4NI 2DENB 4BKSA 4ZDVA 2JZZA 1RLFA 2G3QB 4OVVA 2O2VA 2KWCA 3ZLZA 4EZLA 3DQVA 4RM9A 2M4NA 4GB9A 5LXHA 2IZVB 3W1SC 1WI0A 4TQ1A 4CO7A 4WJOA 2GBKA 4NPNA 3N32A 5D6JB 2O6VB 4HLEA 3VHTC 3DVNU 2LI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXD A;  3A9J B;  2JUO A;  4AWJ A;  1G6J A;  2KDE B;  3V60 A;  1TZ1 A;  3ZDT A;  4B6W A;  2GBR A;  5DPT A;  3VUW A;  1LQB A;  3LJ3 A;  4I6N B;  2V4L A;  3ZIM A;  3RT3 B;  3A9K B;  2LXA A;  5JZE B;  4GU2 A;  1V9J A;  2C5L C;  4K1R B;  3APC A;  3U8Z A;  3ZRF A;  5IAA C;  4GOC A;  2KJ6 A;  1WZ0 A;  3UQA A;  2L76 A;  2DHZ A;  4AJW A;  3SU8 X;  2WX0 A;  2I1J A;  1E8Y A;  2WDT B;  4NAW B;  2N9E B;  1KLV A;  2FCN A;  3R7R A;  3H9D A;  4M8M A;  1JRU A;  2NCN A;  3VDZ A;  1P1A A;  4W9J A;  3ZW3 A;  4BFR A;  2KO3 A;  2JT4 B;  2L3Z A;  2N7D A;  3PRZ A;  1V2Y A;  4W9K A;  3H7S A;  3DDC B;  2GBJ A;  2KDB A;  5AZH A;  1YJ1 A;  2CU1 A;  2IO1 B;  2KAN A;  4HCN B;  4HWI B;  5TR5 A;  4HPL B;  3B08 A;  1WE6 A;  1WGR A;  3L08 A;  1TTN A;  2RR9 A;  4A3P A;  2J0M A;  1E90 A;  4KSK C;  1L2N A;  4URK A;  1HE8 A;  1UD7 A;  4P7I A;  1WZ3 A;  3PRP B;  2ZJD A;  3PPA A;  1D3Z A;  4MH0 E;  2AYO B;  4DK5 A;  4KZC A;  3VXW A;  2FCS A;  2KMA A;  2EMS A;  2KTR A;  3OJ3 A;  3ZNG C;  2CHZ A;  4HK2 A;  5CHV C;  3AXC A;  3M62 B;  1Z2M A;  3UIP B;  3R3M A;  2JF5 A;  4FHK A;  3PLV A;  2JPH A;  3QC8 B;  2NBU A;  2XEW A;  1YX6 B;  2KJH B;  2D07 B;  3HM3 A;  3PV1 A;  4HDQ A;  3IFW B;  3WA0 A;  2NBV B;  4GSW A;  4CHK A;  3NS8 A;  2IO3 B;  2KLG A;  4WJQ A;  4NJ7 A;  1WY8 A;  2J7Q B;  3T8M A;  3AU4 A;  4LCD E;  1V49 A;  2LVQ A;  3ZRC A;  3QHT A;  3PVL A;  2LRW A;  1PQS A;  1F9J A;  2HD5 B;  3V61 A;  4G11 A;  4ZRK A;  3DBS A;  3NHE B;  4GMV A;  1WF9 A;  1Z5S B;  4B95 A;  1K8R B;  5EDS A;  2LXC A;  1MG8 A;  2BWE S;  2LGX A;  1CMX B;  3A33 B;  3PTF C;  2DX5 B;  4E71 A;  3ZDM C;  2MX2 A;  2XK5 A;  5GMV A;  2KTR B;  2CKH B;  1WMH A;  4FJZ A;  2XBB C;  2KQ7 A;  3UGB B;  2A4Z A;  2K39 A;  2KK8 A;  4K7U A;  4KIK B;  5D7G A;  1V6E A;  2ZCC A;  4IWO A;  4M8N A;  4BOZ B;  4GDK A;  1WJU A;  2KFJ A;  1WGD A;  1IPG A;  4II3 B;  1GUA B;  3RUI B;  4FJV B;  5L83 A;  4JGH B;  2FCM A;  4KVG B;  4MEM A;  1UZX B;  2M8S A;  2L00 B;  4BKS D;  4EFO A;  3H6N A;  1WFY A;  1FXT B;  1WJN A;  1WH3 A;  1YIW A;  2Z0D B;  2K6D B;  3A9J A;  3VAW A;  4DBG A;  3V6E B;  1X1M A;  4W9E A;  1UBI A;  1LFD A;  4ASW C;  3PLU A;  1WXS A;  1WM3 A;  3DVG Y;  4ZRI A;  1WRD B;  3A4R A;  2K1F A;  2LWP A;  2K25 A;  1KJT A;  1WJ6 A;  5CHF A;  2MLB A;  4EKU A;  4NY0 A;  2W9N A;  5C23 A;  4F7Z A;  4K81 A;  2XK5 B;  3JYU A;  2LJ5 A;  4LDT B;  2EMT A;  2BYV E;  4MJS A;  1UEL A;  2JZ3 B;  4IG7 B;  4FN2 A;  3TCA A;  1WX9 A;  3EEC A;  3N3K B;  4JLC A;  4W9H A;  3X23 A;  3APF A;  4XC2 A;  1AAR A;  2WWZ A;  1T0Y A;  2OJR A;  2ZCB A;  5KHQ A;  3ENE A;  1NI2 A;  1C1Y B;  1V5T A;  1GC7 A;  2LRU A;  4IUM B;  2AL3 A;  1P0R A;  2LGD A;  3RD2 A;  3C0R B;  4KDL B;  2RGF A;  2JXX A;  2O6V A;  4AP4 C;  3GOE A;  2N7E A;  2C7N B;  2LVP A;  4NAW A;  1H4R A;  2FID A;  2IO2 B;  2V1Y A;  3L17 A;  1SE9 A;  2C7H A;  2BYE A;  4EZK A;  2KN5 A;  2LAS A;  1WMH B;  1Y8R C;  1M94 A;  5E6O A;  3HK0 A;  3WAO A;  3PHX B;  4DDI D;  5L95 C;  2DZJ A;  3B0A A;  2N9X A;  2KVR A;  3M63 B;  4G0N B;  4B9K A;  3DVN V;  3IBE A;  2PJH A;  2KNB A;  3DBL I;  1Q1O A;  3V62 A;  1SIF A;  4RM8 A;  3TJP A;  3O65 B;  2EKE C;  3UF8 A;  3APD A;  4BOS C;  1VCB A;  2MBH A;  2ZEQ A;  3ZVV A;  1WXV A;  2HTH A;  3ZKJ C;  1V86 A;  1QZE A;  1ZKH A;  3L0W B;  2D10 A;  3GZN I;  2KTF A;  2MBE A;  3ZO5 B;  3ML8 A;  2LGY A;  2N1V A;  2WYQ A;  3PZD A;  2YVC A;  2CS4 A;  2FUH B;  3EFU A;  3ZNZ B;  3WIM A;  2MRP A;  2KC2 A;  5JHA A;  2RSU A;  2JWZ A;  1NDD A;  3HHM A;  1TGZ B;  4A20 A;  4WWO A;  2A5U A;  2DZI A;  3VQI A;  1OEY A;  4ICU A;  2KX0 A;  1WR6 E;  1C3T A;  2AWT A;  4HDO A;  3NZU A;  1P3Q U;  3QCA A;  3IG3 A;  3UQB A;  3EC8 A;  4JQW C;  4HCP B;  4W9I A;  4FJY A;  2BKR B;  4PS3 A;  2IBI B;  3QX1 A;  2KWU B;  1VD2 A;  2KJR A;  3VUY A;  1P9D U;  3KVF B;  2D2Q A;  2DYM A;  2K8H A;  2R2Q A;  3HIZ A;  3JW0 X;  3OJ4 B;  3PSE B;  4K7W A;  4WJP A;  2N4F A;  3MJW A;  2R2O A;  4MM3 A;  4MGK E;  3ZNI D;  2KX3 A;  3RUL A;  5FR6 A;  4MSM B;  4X57 B;  2DYO A;  2PPH A;  2KDF B;  3VFK A;  2CR5 A;  3SHQ A;  2ZNV C;  4F1S A;  2PEA A;  4IW0 A;  1H8C A;  1LM8 B;  4MJS B;  2IO0 B;  2UWQ A;  1WX7 A;  1WJ4 A;  4WWN A;  1S1Q B;  1E8Z A;  3WAM A;  3HM6 X;  4GGQ A;  2NPT B;  2JVC A;  1WE7 A;  4ANX A;  5E6P A;  2J0J A;  2MBO A;  3ZTD A;  3QJZ A;  1U4A A;  1WYW B;  2AEH A;  2BYF A;  3AUL A;  2DAF A;  4II2 B;  3B1L X;  4TV3 A;  4YL8 A;  3VUX A;  3WAP A;  4ANW A;  2ZVO A;  4GDL A;  3ZNH B;  2MP2 B;  2KOX A;  4JIO U;  3WAN A;  5J17 A;  1KM7 A;  2UYZ B;  3TL5 A;  3A1Q A;  1XQQ A;  4PS8 A;  3SDL C;  3T9L A;  4HPM B;  2ASQ A;  5DPS A;  1GJZ A;  4KDI C;  2RD0 A;  5CTR C;  2V3S A;  4TQ0 A;  3JSV B;  3H7P A;  3LDZ E;  4EOY A;  3VVW B;  1J0G A;  2KDI A;  2KHW B;  5CHW A;  2VRR B;  3CF6 E;  4JL9 A;  1R4M I;  2CHW A;  3BY4 B;  5D94 A;  5G2N A;  4NNJ B;  2ZPY A;  4XZ4 A;  3S2A A;  1E8X A;  3WAL A;  4ANU A;  2O2V B;  3QAR A;  5IA7 A;  1OGW A;  4WWP A;  3ZUN A;  3DCG A;  3R66 C;  4WJN A;  1I35 A;  4DHJ B;  3MTN B;  1V80 A;  3PGE A;  4PYU A;  4EEW A;  2L0T A;  5HKH A;  5LXI B;  3SD5 A;  1NBF C;  3ONS A;  3TIX A;  2FAZ A;  3N30 A;  3RZW C;  4MDK E;  4AJY B;  5AEK B;  2REX A;  1WM2 A;  3X0W A;  3A9K A;  1WXA A;  2IY0 B;  3JSV A;  2C7M B;  3PHW B;  1L7Y A;  4FA6 A;  3CSF A;  3VH3 B;  3RYT A;  2HE7 A;  5C1Z A;  1J8C A;  5KHO A;  1E7V A;  2J0K A;  3EHV A;  4N9F 4;  2GBN A;  2NVU I;  3NY5 A;  1YD8 U;  2ZZP B;  1WX8 A;  3DBR I;  3QK0 A;  2L7R A;  4GN1 A;  2MP2 A;  3U7D A;  3H1U A;  4DHZ E;  2BPS A;  2LVO A;  4TUU A;  5E6N A;  2GBM A;  2KXJ A;  4FAD A;  4MEL A;  2MW5 A;  3ALB A;  5AZF A;  4BKT A;  2DZK A;  3VTU A;  1EO6 A;  1S3S G;  4IC7 B;  3DOW A;  3V6C B;  4AOF A;  2KWV B;  4OVU A;  2BWF A;  2GMI C;  5JH5 C;  2NBW B;  2KMC A;  5DPW A;  3DPD A;  1YQB A;  4F8C B;  2AL6 A;  1RFA A;  2G4S A;  2PE6 B;  2YLM A;  3R7Q A;  3NZS A;  4AUQ C;  2KZR A;  3QAQ A;  2FIF A;  1E8W A;  4A3O A;  3OAW A;  3VTV A;  3K9O B;  4CYE A;  2FNJ B;  4ZYN A;  2KLC A;  1WGG A;  3QWZ B;  5JHB A;  1I42 A;  3TMP B;  3M3J A;  3L13 A;  4ICV A;  1UH6 A;  2ZNV B;  1P98 A;  3MHS D;  4KZ0 A;  2IY1 B;  4FUL A;  3TBL D;  5J18 A;  1KOT A;  3JVZ X;  2KQS A;  2NPT A;  3KW5 B;  1SGH A;  1WGY A;  2LZ6 A;  2NR2 A;  5DPR A;  4M0W B;  4E3C A;  2MA9 B;  1ZGU B;  2LD9 A;  3ZTC A;  3Q3J A;  3A4S C;  2MWS B;  5D2M B;  4MGZ E;  2LUE A;  4MSQ B;  4NJ6 A;  3K9P B;  2L05 A;  3H7P B;  4W9D A;  4W9L A;  4DHZ B;  2MBQ A;  1LXD A;  3L10 B;  3VH4 B;  3UIO B;  4J6I A;  3CMM B;  4G3X B;  2CHX A;  2GOW A;  1UBQ A;  4GDL B;  5AZG A;  2BGF A;  4WQO B;  1WIA A;  3I3T B;  3QQ8 B;  2KFK B;  2M1M A;  4W9G A;  2D11 A;  3ML9 A;  2DZM A;  2JRH A;  1WR1 A;  3AU5 A;  1RRB A;  4HVB A;  3BIN A;  2DAJ A;  2G4D B;  5BO4 B;  1OEY J;  4BBN C;  2N9P C;  3QIJ A;  2KKC A;  4NQL B;  3DBH I;  4BVU C;  4BKG A;  2O6V D;  2PE9 A;  4FHJ A;  1XT9 B;  1V81 A;  2L0F A;  4DDG D;  2NS5 A;  2Z59 B;  2Z0E B;  2DYB A;  1EUV B;  4PYZ A;  1GG3 A;  3UIN B;  2D3G A;  3NOB A;  3KUZ A;  3PS6 A;  1EF1 A;  3OLM D;  2BKF A;  3PRM B;  4IM0 A;  2QHO A;  4I6P A;  4IWQ A;  4WAA A;  1GNU A;  2OOB B;  3L54 A;  3U30 A;  4E74 A;  4ZRJ A;  1XD3 B;  4KSL C;  4BBN F;  4XX5 A;  4DXA B;  2HJ8 A;  4I6L B;  2ZPN A;  4RMA A;  4IWP A;  2FCQ A;  1E7U A;  2B3A A;  1E5W A;  2I1K A;  2L8J A;  4FLH A;  3KYC D;  5DCN A;  2K6Q A;  3M95 A;  3P2B A;  4GIV A;  1BT0 A;  4G50 A;  2BF8 B;  2RPQ A;  4IM3 A;  4W9F A;  1A5R A;  1J19 A;  3PT2 B;  1ISN A;  3DVG X;  4PS7 A;  1TBE A;  2JY6 A;  3PRE A;  5CX3 A;  4EUT A;  4EZJ A;  3KUC B;  2MCN B;  2MBB B;  4HJK A;  1EF5 A;  4ANV A;  3RZF A;  3KH0 A;  3IHP C;  2JRI B;  2K8C A;  3KUD B;  4LJO B;  1UGM A;  4TKN A;  2C60 A;  5G55 A;  5LLI A;  4GXB A;  1WXM A;  3W1Y A;  1IP9 A;  2ZVN A;  2KFK A;  4DWF A;  2MSE D;  3L16 A;  2WX1 A;  3RCZ A;  4LDT D;  3Q3F A;  4W9C A;  1IYF A;  1YX5 B;  1OQY A;  4LJP B;  2N1W A;  1Q0W B;  2M17 A;  2M0X A;  3KYD D;  1Q5W B;  2MQJ A;  4FBJ B;  1ZW7 A;  3AI5 A;  1RAX A;  2C9W B;  3A1Q B;  1WGH A;  2KD0 A;  4K7S A;  3VTW A;  3W1S A;  4IM2 A;  4KV2 A;  1GC6 A;  4NQK E;  3IVF A;  4GDK B;  3QA8 A;  2K8B A;  4DHJ D;  1V5O A;  4KIK A;  3CST A;  4MGI E;  3ECI A;  2IYD B;  4MGY E;  5J2R A;  3D32 A;  2KC1 A;  1OTR B;  2G45 B;  2Y5B B;  1R4N I;  2DEN B;  4BKS A;  4ZDV A;  2JZZ A;  1RLF A;  2G3Q B;  4OVV A;  2O2V A;  2KWC A;  3ZLZ A;  4EZL A;  3DQV A;  4RM9 A;  2M4N A;  4GB9 A;  5LXH A;  2IZV B;  3W1S C;  1WI0 A;  4TQ1 A;  4CO7 A;  4WJO A;  2GBK A;  4NPN A;  3N32 A;  5D6J B;  2O6V B;  4HLE A;  3VHT C;  3DVN U;  2LI5 A; 
#chains in the Genus database with same CATH topology
 3A9J B;  4AWJ A;  4A90 A;  3E56 A;  3ZDT A;  5DPT A;  4RH6 A;  2MH7 A;  3LJ3 A;  2V4L A;  2KWD A;  3RT3 B;  1P7F A;  4K1R B;  3CWI A;  2V4I B;  4GOC A;  3UQA A;  3AMZ A;  1B9R A;  1C4A A;  2WX0 A;  1F2R I;  2WDV B;  4AQ7 A;  2WDT B;  2FCN A;  3R7R A;  3VDZ A;  3AE7 B;  4XWW A;  2WXM A;  4W9K A;  3H7S A;  4HCN B;  4HPL B;  1TTN A;  2WXK A;  2LGI A;  4URK A;  1IGC A;  4ARC A;  4JWS C;  3PRP B;  4MH0 E;  4S0R A;  3AEB B;  5D3I B;  1WWT A;  3DBH B;  3P4S B;  2ZW0 A;  1Z2M A;  1QLB B;  3QC8 B;  2XEW A;  1YX6 B;  2D07 B;  2WS3 B;  4R3D A;  3Q8B A;  4GSW A;  4HRO A;  3AU4 A;  3PO0 A;  3QHT A;  3MJ5 A;  2LRW A;  4G11 A;  4ZRK A;  3DBS A;  1L0X B;  4OW0 A;  4B95 A;  4OZC A;  2LXC A;  2LGX A;  3ZDM C;  2MX2 A;  1R7S A;  1ESF A;  2M0A A;  1QT9 A;  2KK8 A;  1YMH E;  5D7G A;  4KIK B;  1NI3 A;  4IWO A;  2BB6 A;  1WJU A;  1WGD A;  1IPG A;  3RMK C;  3RUI B;  5L83 A;  4RCO A;  3GE3 C;  1FXI A;  2FCM A;  2K9X A;  4KVG B;  4MEM A;  2L00 B;  1PDX A;  1LGR A;  2Z0D B;  1BUI C;  1DOI A;  1I4X A;  1JWU D;  5EE1 A;  3VAW A;  1SE3 A;  1ZDX A;  4ASW C;  1WXS A;  1K51 A;  1QQR A;  1F77 A;  1WRD B;  3IXS A;  5JXV A;  4JE3 B;  3R8B A;  2LWP A;  3DWM A;  1L4D B;  2GB1 A;  4EKU A;  2EEL A;  4K81 A;  3JYU A;  4LDT B;  3N20 C;  4IG7 B;  3TCA A;  4JLC A;  3N3K B;  1KRH A;  1VJK A;  3AE4 B;  1ZPS A;  5KHQ A;  1V5T A;  2LRU A;  3DBL B;  2I2Y A;  3RD2 A;  2O6V A;  3GOE A;  2C7N B;  4NAW A;  1MI0 A;  3J9C A;  3Q3N C;  1GAQ B;  2WLB A;  1F0Z A;  5IN7 A;  3PHX B;  2N9X A;  4G0N B;  3DVN V;  1Q10 A;  4M01 A;  4LNI A;  1ZXH A;  2KNB A;  1PYW D;  3BYT B;  2FUG 1;  4NAM A;  1AW7 A;  5FR3 A;  1SF0 A;  3GZN I;  2PVG C;  2OHF A;  1QOA A;  3ZO5 B;  3ML8 A;  1TS4 A;  2WXN A;  3W2D A;  1FNW A;  2CS4 A;  2L52 A;  3GS2 A;  1XLN A;  1NDD A;  4KGT A;  4TSS A;  1P3Q U;  4JQW C;  3P1M A;  4W9I A;  2BKR B;  2IBI B;  3QX1 A;  2KJR A;  4DXG A;  3VUY A;  2INN E;  4MGK E;  1E6E B;  3ZNI D;  2PPH A;  3SHQ A;  2ZNV C;  1HQR D;  4F1S A;  2WXP A;  4MJS B;  1QIL A;  2PIA A;  2RMM A;  3WAM A;  1S1Q B;  4A55 A;  2NPT B;  2HTM E;  2IND C;  3QJZ A;  1U4A A;  2DAF A;  4TV3 A;  2NMQ A;  2KOX A;  4JIO U;  4XE0 A;  5HI1 A;  2UYZ B;  3TL5 A;  3A1Q A;  1XQQ A;  3T9L A;  2ASQ A;  4C4V B;  2MJ3 A;  3MHZ A;  2NTS A;  5CTR C;  4MT5 A;  4OZB A;  1YQ3 B;  1QOB A;  4EOY A;  2KHW B;  2MJD A;  4KKI A;  5CHW A;  2VRR B;  3I5J C;  2KAJ A;  3AEC B;  1R4M I;  3BY4 B;  5D94 A;  4ANU A;  2O2V B;  4HKZ E;  4WWP A;  4WJN A;  1I35 A;  1FXA A;  3FC4 A;  3NVZ A;  3RPF C;  3PGE A;  2Q5W D;  5LXI B;  3SD5 A;  3ONS A;  3TIX A;  3EGR A;  2L32 A;  2IY0 B;  3JSV A;  4JPS A;  3VH3 B;  3RYT A;  1LO5 D;  2HE7 A;  1E7V A;  3ZYY X;  2NVU I;  3DBR I;  4GN1 A;  2BPS A;  3DHH C;  1JRO A;  4YWG G;  3FIL A;  3I57 A;  4IC7 B;  3FIL B;  1QF6 A;  2GMI C;  1F1H A;  2QSD A;  3DPD A;  4F8C B;  2G4S A;  2YLM A;  2ONQ A;  3NZS A;  4AUQ C;  2FIF A;  2N9K A;  4A3O A;  4J3O D;  5T8I A;  2FNJ B;  2BS4 B;  2CU3 A;  3MC9 A;  1P98 A;  1SJH D;  4ARI A;  2NPT A;  3KW5 B;  3NRZ A;  1R4M B;  1FM0 D;  3MFG A;  2LD9 A;  3ZTC A;  3EFC A;  3Q3J A;  1ZP0 B;  4NJ6 A;  3K9P B;  2QIL A;  5AUI A;  3NVY A;  3H7P B;  2K3U A;  4W9D A;  4C00 A;  3LXF A;  1N5X A;  4DHZ B;  3LYY A;  3UIO B;  3CMM B;  5AZG A;  2PW9 A;  1WIA A;  3BVM A;  2KFK B;  3AEF B;  2M1M A;  3LB8 C;  1WYG A;  1RRB A;  4HVB A;  3BIN A;  3P42 A;  1FEH A;  3QIJ A;  4XWT A;  4BKG A;  1XT9 B;  1ET6 A;  2KQ4 X;  2NS5 A;  1I7H A;  2Z0E B;  3NVV A;  1C79 A;  2LEK A;  1GNU A;  3U30 A;  1FIQ A;  2QCZ A;  4BBN F;  3NVW A;  2BB5 A;  2ZPN A;  4IWP A;  2FCQ A;  2B3A A;  1E5W A;  4FLH A;  2RDB C;  1C4P A;  2BF8 B;  1ISN A;  3PRE A;  2ICI A;  3KUC B;  3NUH B;  4DXF A;  2K0P A;  3KUD B;  1JQ4 A;  3Q3M C;  1IP9 A;  4RFB A;  4ZHP A;  3RCZ A;  2SEB D;  4W9C A;  3HUI A;  2N1W A;  1Q0W B;  1Q5W B;  2QJL A;  2N9L A;  5AUK A;  1ZW7 A;  3VTW A;  1WGH A;  1XXG A;  4K7S A;  4GDK B;  4RGN A;  1EM7 A;  3CST A;  4MGI E;  2IYD B;  2KC1 A;  2WHI A;  2Y5B B;  2DEN B;  1RLF A;  3ZLZ A;  3IT4 B;  2M4N A;  1IGD A;  1FO4 A;  5D6J B;  3B9J A;  4HLE A;  3HVD A;  2JUO A;  3UI3 A;  1VRA B;  2W3R A;  2GBR A;  2D5G A;  4I6N B;  3ZIM A;  4QAY A;  5JZE B;  4GU2 A;  4C80 A;  1V9J A;  1I4P A;  3N1Z C;  5IAA C;  4UDU C;  1N63 A;  2INP E;  4YT0 B;  2DHZ A;  2WXH A;  2MHJ A;  1VR9 A;  4PK1 A;  4K3B A;  4B0M A;  1UF0 A;  1KLV A;  4YSY B;  2NCN A;  2BW2 A;  2JT4 B;  2WXJ A;  1TKY A;  1N6Z A;  4IOI E;  3DDC B;  2KDB A;  5MPO A;  5AZH A;  2IO1 B;  3VR9 B;  1WE6 A;  1YJI A;  1VZ6 A;  4A3P A;  1L2N A;  2CJO A;  1HE8 A;  1WZ3 A;  1ZE3 D;  4DK5 A;  3VXW A;  2FCS A;  2EMS A;  3NJT A;  3P4Q B;  3UIP B;  1L6V A;  3TJP A;  2JPH A;  2NBU A;  3WA0 A;  2KJH B;  3HM3 A;  5EE9 A;  4HDQ A;  3IFW B;  2NBV B;  1I4G A;  3NS8 A;  4WJQ A;  2XNA C;  2J7Q B;  1UNS A;  4LCD E;  3WCQ A;  1V49 A;  2LVQ A;  3ZRC A;  3PVL A;  1F9J A;  1UUP A;  3KWV A;  4YXD B;  4GMV A;  3Q8C A;  1XCQ L;  2BWE S;  4E71 A;  3A33 B;  3PTF C;  2DX5 B;  2XK5 A;  5GMV A;  1WMH A;  4FJZ A;  4L23 A;  1L0V B;  1MHH E;  2K39 A;  1ET9 A;  4K7U A;  1V6E A;  2ZCC A;  4BOZ B;  1GUA B;  4FJV B;  4JGH B;  1UZX B;  1ZUD 2;  5BMH A;  3H6N A;  1WFY A;  1WH3 A;  4DQO C;  3A9J A;  1FFV A;  4W9E A;  3VRA B;  3A4R A;  1XLQ A;  5CHF A;  2W82 A;  4NY0 A;  2EKI A;  4RGO S;  2BYV E;  4MJS A;  4YTM B;  1UEL A;  3EEC A;  3V3X A;  3W5V B;  3X23 A;  1PGB A;  4XC2 A;  3P4R B;  5IP4 D;  2WXG A;  3ENE A;  3AH7 A;  1XLP A;  3URY A;  1P0R A;  3C0R B;  4KDL B;  2N7J A;  2RGF A;  1ACC A;  4AP4 C;  2LVP A;  2FID A;  2V1Y A;  2G1E A;  1SE9 A;  2BYE A;  1Y8R C;  2PTL A;  2BYT A;  1PUT A;  2DZJ A;  1I4H A;  3IBE A;  4JWU C;  2PJH A;  1Q1O A;  1VDV A;  1SIF A;  3I63 C;  3O65 B;  1T3Q A;  1VCB A;  2ZEQ A;  3ZVV A;  1KLG D;  2HTH A;  3ZKJ C;  1ZKH A;  3L0W B;  3TUO A;  2KTF A;  2WQY B;  2LGY A;  2WYQ A;  2WXO A;  3PZD A;  2FUH B;  1V1P B;  3ZNZ B;  2Y3A A;  1SEB D;  1SE4 A;  3HHM A;  2DZI A;  3E9S A;  1OQR A;  4FXC A;  4ICU A;  1JWS D;  1C3T A;  1WRI A;  3QCA A;  3EC8 A;  4HCP B;  2CJN A;  4FJY A;  2INC C;  1D6E C;  1P9D U;  3KVF B;  2DYM A;  2K8H A;  3JW0 X;  1D5M C;  3OJ4 B;  4WJP A;  4NZL B;  4WUR A;  4RF1 A;  1SSN A;  2KX3 A;  3GZN B;  4X57 B;  3AED B;  1GB4 A;  1RYJ A;  4IW0 A;  2J53 A;  2X38 A;  1D5Z C;  4WWN A;  1WX7 A;  3AB5 A;  1WE7 A;  4ANX A;  2AEH A;  1T0Q C;  3AUL A;  3WAP A;  3B1L X;  4ANW A;  2ZVO A;  1F52 A;  3MC0 B;  1WXQ A;  3FAH A;  2MP2 B;  3WAN A;  2K5P A;  3U52 E;  2JX5 A;  3MC8 A;  4P16 A;  4YTN B;  1GJZ A;  3H7P A;  3LDZ E;  3VVW B;  1J0G A;  3CF6 E;  4JL9 A;  2CHW A;  2ZPY A;  4XZ4 A;  1IBX B;  3QAR A;  2YEP F;  3ZUN A;  1PFD A;  4DHJ B;  4LNO A;  4EEW A;  5HKH A;  3AE6 B;  3N30 A;  3RZW C;  4MDK E;  4AJY B;  5AEK B;  2REX A;  3PHW B;  1L7Y A;  1SXT A;  4FA6 A;  3P4P B;  1STE A;  2J0K A;  3Q8F A;  3EHV A;  2QDF A;  5D3D A;  1YD8 U;  2ZZP B;  4DHZ E;  2LMC A;  4OHJ A;  4TUU A;  5E6N A;  3ALB A;  5AZF A;  4BKT A;  1EO6 A;  3DOW A;  2KWV B;  4OVU A;  2NBW B;  3TEW A;  3ZGZ A;  2IGH A;  1YQB A;  1IUE A;  2X8X X;  3R7Q A;  1V1O A;  3QAQ A;  1E8W A;  1YN5 A;  3K9O B;  2OJW A;  3M3J A;  4LNN A;  3L13 A;  1J7B A;  1KTK A;  1UH6 A;  3AE9 B;  3MHS D;  4FUL A;  3TBL D;  2WDQ B;  2GI9 A;  3JVZ X;  4PT5 A;  1ZGU B;  4WWM A;  5D2M B;  2PVO D;  1ENF A;  2LHE A;  2CHX A;  2GOW A;  1UBQ A;  4BZA A;  2BGF A;  4WQO B;  2JZP A;  1XO3 A;  4W9G A;  1NVI D;  2D11 A;  2ZW1 A;  3ML9 A;  3ZJV A;  2DZM A;  5BO4 B;  2KKC A;  4BVU C;  1V81 A;  3TEZ A;  3T3O A;  2D3G A;  1PGX A;  1EF1 A;  3OLM D;  3PRM B;  2QHO A;  2KVZ A;  4WAA A;  2OOB B;  3L54 A;  4ZRJ A;  1UGJ A;  4KSL C;  4DXA B;  4XYC A;  3AE5 B;  4RMA A;  2I1K A;  4H2A A;  3ETR A;  1TKE A;  3M95 A;  3B2F A;  1VLB A;  1QOG A;  4GIV A;  4IM3 A;  1N61 A;  1XF5 L;  4EZJ A;  3NS1 A;  3PZ8 A;  2K8C A;  2C60 A;  4WAF A;  2MSE D;  2WNM A;  3GB1 A;  3BK2 A;  1Y56 A;  5C2T B;  4LJP B;  2M17 A;  3KYD D;  2FE8 A;  2MQJ A;  3AE3 B;  4WH4 A;  2ACZ B;  3U2S C;  3W1S A;  2KAC A;  3RNG C;  4DHJ D;  1V5O A;  1XLO A;  3ECI A;  3D32 A;  4BKS A;  1VZ7 A;  1PGA A;  1GPX A;  2WDR B;  3W5U B;  2KWC A;  2LFI A;  4RM9 A;  4RF0 A;  3BYY B;  1TS2 A;  5LXH A;  1C9F A;  1WI0 A;  3N32 A;  1HZ5 A;  2O6V B;  2D3A A;  2DLB A;  4B6W A;  3VUW A;  3B2G A;  3A9K B;  2LXA A;  4XDC A;  4LNF A;  2C5L C;  3U8Z A;  3ZRF A;  1EWY C;  2XN9 C;  4CQN A;  4P1C C;  2KJ6 A;  1WZ0 A;  2L76 A;  2JYE A;  1SE2 A;  1E8Y A;  2IGG A;  2WXL A;  4NAW B;  1V1P A;  1HA5 A;  2VH2 A;  2E3T A;  4BFR A;  1ROE A;  2MJE A;  2N7D A;  4HRS A;  1V2Y A;  2QMT A;  2RDH A;  2GBJ A;  2WXQ A;  1YJ1 A;  2CU1 A;  5EE3 A;  2KAN A;  4HWI B;  5TR5 A;  3IAS 1;  2BTE A;  1WGR A;  3L08 A;  2RR9 A;  2IDY A;  3SFD B;  1UD7 A;  4P7I A;  3PPA A;  2AYO B;  2JQR B;  5TSS A;  2KMA A;  4HK2 A;  5CHV C;  3AXC A;  3M62 B;  2JF5 A;  2J4X A;  3PV1 A;  3RNA C;  4CHK A;  2KLG A;  2BVC A;  4YSX B;  3T8M A;  3HVZ A;  1QKZ A;  4O1N A;  2HD5 B;  3V61 A;  5BYQ A;  1WF9 A;  4D2K A;  2WXF A;  5EDS A;  1SBB B;  4KGR A;  4WIP A;  2IJ0 A;  4XDD A;  2A4Z A;  1DOX A;  2BT6 A;  2M8S A;  3N9Y C;  1I4R A;  4EFO A;  1FXT B;  1WJN A;  3V6E B;  3KWL A;  1UBI A;  2JU6 X;  3PLU A;  1TYG B;  4ZRI A;  1SB3 C;  1DGJ A;  2K25 A;  2MLB A;  2MEK A;  3V05 A;  2XK5 B;  2LJ5 A;  2JZ3 B;  3R2I A;  1WX9 A;  4W9H A;  1FD6 A;  3RFZ B;  1AAR A;  1T0Y A;  2ZCB A;  1NI2 A;  1C1Y B;  3RNE C;  1MFW A;  1TT5 B;  3FKY A;  2LHD A;  4IUM B;  2LGD A;  2JXX A;  1HEZ E;  2IO2 B;  2V0G A;  3L17 A;  2M19 A;  4EZK A;  2KN5 A;  1WMH B;  5E6O A;  3WAO A;  4DDI D;  3O13 A;  5L95 C;  4RNA A;  1HXY D;  3B0A A;  2OED A;  3PZ7 A;  3V62 A;  4A9A A;  2JXT A;  3APD A;  1C4C A;  3AE1 B;  4BOS C;  2MBH A;  1AYF A;  2D3B A;  2D10 A;  3AE2 B;  2H89 B;  2AX5 A;  2YVC A;  1T0S C;  5BMI A;  5JHA A;  3WIM A;  2MRP A;  2JWZ A;  1NEK B;  4N58 A;  2Y5P A;  4A20 A;  1ZDV A;  3IAM 1;  3VQI A;  4S17 A;  2IPK D;  1WR6 E;  1YOV B;  2VZK B;  3NZU A;  2H88 B;  4PS3 A;  2KWU B;  1FNU A;  5E6J A;  3SEB A;  2D2Q A;  2R2Q A;  3DHG C;  3PSE B;  3BVZ A;  2BS2 B;  4K7W A;  4L2Y A;  2R2O A;  3RUL A;  5FR6 A;  4MSM B;  2DYO A;  3W9C B;  1ZXI A;  3TEX A;  1XEE A;  1H8C A;  1LM8 B;  1N5W A;  4M0W A;  2UWQ A;  1WJ4 A;  1E8Z A;  4GGQ A;  2J0J A;  2MBO A;  2ON8 A;  1IBX A;  3VUX A;  5FKA C;  4GDL A;  4PS8 A;  4ITK A;  3SDL C;  5DPS A;  2RD0 A;  2V3S A;  1E10 A;  3DBR B;  4LTU A;  2KDI A;  4US8 A;  5G2N A;  3S2A A;  3WAL A;  1D4B A;  5IA7 A;  4ZHO A;  1V80 A;  1AN8 A;  1NBF C;  4KKJ A;  4B0E A;  2G9H D;  1WGK A;  1TIF A;  1WM2 A;  3A9K A;  1WXA A;  2C7M B;  3CSF A;  2DNF A;  5KHO A;  4N9F 4;  2GBN A;  1V8C A;  3OWE B;  3QK0 A;  2L7R A;  2MP2 A;  4BAX A;  3H1U A;  2LVO A;  4WQM A;  2GBM A;  2KXJ A;  2MW5 A;  2SAK A;  3VTU A;  1UWX A;  3V6C B;  2BWF A;  5JH5 C;  1ZOY B;  1GB1 A;  2KN4 A;  2PE6 B;  5HG2 A;  2KZR A;  1RM6 C;  1JWA D;  3VTV A;  1TY0 A;  2W3S A;  4CYE A;  4ZYN A;  3AEE B;  3Q14 C;  1JW9 D;  1WGG A;  3QWZ B;  5JHB A;  2WP9 B;  3TMP B;  2ZNV B;  3H8H A;  4KZ0 A;  4HEA 1;  2IY1 B;  5J18 A;  3Q3O C;  3L4P A;  2KQS A;  3BVG A;  2LZ6 A;  5DPR A;  4M0W B;  2M56 B;  1L5P A;  2MWS B;  3BK1 A;  3AN1 A;  4MSQ B;  1MG4 A;  1N62 A;  2WXR A;  4HJG E;  1T5X D;  5FK9 C;  2MBQ A;  1LXD A;  2R61 A;  1HZ6 A;  3L10 B;  3VH4 B;  4GDL B;  3QQ8 B;  1SJE D;  1WR1 A;  3RN9 C;  3AU5 A;  2DAJ A;  1CQV A;  4BBN C;  2N9P C;  4NQL B;  3DBH I;  3EUB 2;  2UU7 A;  4C56 C;  1EUV B;  1GG3 A;  3UIN B;  3I9V 1;  2J52 A;  4I6P A;  5LNK 1;  4E74 A;  1XD3 B;  2JWU A;  4MM3 B;  4XX5 A;  2HJ8 A;  3NZ3 A;  4JX1 C;  5IO9 A;  4M00 A;  4HPP A;  1BXT A;  5DCN A;  2KYW A;  1J7C A;  1J7A A;  1BT0 A;  5G5G A;  1J19 A;  4PS7 A;  5I4D A;  1TBE A;  1CK1 A;  5CX3 A;  4EUT A;  3BZD B;  2AQ1 B;  2RDG A;  2MCN B;  2MBB B;  1SIJ A;  1EF5 A;  4ANV A;  3RZF A;  2JRI B;  2LGS A;  4LJO B;  4TKN A;  5LLI A;  3NG0 A;  3W1Y A;  4DWF A;  4A8X C;  3L16 A;  2WX1 A;  4IKG A;  1IYF A;  1C76 A;  1YX5 B;  1OQY A;  1FCL A;  2KT7 A;  3AI5 A;  1RAX A;  2C9W B;  2RPV A;  2KD0 A;  3A1Q B;  3C19 A;  1GC6 A;  4NQK E;  1K52 A;  2JYT A;  2K8B A;  4ZRQ A;  3CIR B;  1GOZ A;  4Q2J A;  5GXG B;  5J2R A;  5C3J B;  2WGS A;  1F2R C;  1OTR B;  1JWM D;  4ZDV A;  2JZZ A;  2G3Q B;  4OVV A;  2O2V A;  4EZL A;  4MAC A;  3C8Y A;  3W1S C;  4WJO A;  2GBK A;  2LI5 A;  1EU4 A;  4HXD A;  1K50 A;  2J42 A;  1JRP A;  2KDE B;  3AE8 B;  3V60 A;  5IKC M;  1G6J A;  4C4V A;  1TZ1 A;  1LQB A;  2GLS A;  2FBW B;  3APC A;  2I38 A;  4L1B A;  3N1X C;  1C78 A;  4AJW A;  3SU8 X;  3BII D;  2I1J A;  4P6V F;  1NYR A;  2N9E B;  3H9D A;  2VZK D;  4M8M A;  1JRU A;  1P1A A;  4W9J A;  3ZW3 A;  2KO3 A;  2L3Z A;  1WSP A;  3PRZ A;  1KF6 B;  2W54 A;  1MJD A;  2BS3 B;  3U7Z A;  3GP7 A;  3B08 A;  2J0M A;  1E90 A;  4KSK C;  2PMV A;  1FRR A;  2K22 A;  1D5X C;  2ZJD A;  1D3Z A;  2L1A A;  4KZC A;  3OJ3 A;  2VH1 A;  2KTR A;  3ZNG C;  2CHZ A;  1DYQ A;  1JCK B;  3Q6B A;  4YTP B;  3R3M A;  4FHK A;  3PLV A;  2PKO A;  3AM9 A;  2IO3 B;  1L6U A;  4NJ7 A;  1WY8 A;  5H8Y E;  3Q69 A;  1PQS A;  3NHE B;  1Z5S B;  1K8R B;  1MG8 A;  1CMX B;  1FRD A;  1HTO A;  3AEA B;  2KTR B;  2WXI A;  2CKH B;  2XBB C;  2KQ7 A;  3UGB B;  5BYS A;  4M8N A;  4GDK A;  2KFJ A;  4II3 B;  1QOF A;  4BKS D;  1YIW A;  1N60 A;  3ZXR A;  2E6X A;  2K6D B;  4IDI A;  4DBG A;  1X1M A;  1LFD A;  2DBY A;  1WM3 A;  3DVG Y;  5HFY A;  4ZRP A;  3Q8E A;  5EE0 A;  2K1F A;  3Q8A A;  1KJT A;  1DOY A;  1WJ6 A;  2W9N A;  5C23 A;  4F7Z A;  1TY2 A;  2N0S B;  2EMT A;  4ZYS A;  3N1Y C;  2V9H A;  4FN2 A;  3BWU D;  1E9M A;  3HRD D;  4LK0 M;  2KMM A;  3APF A;  2WWZ A;  2OJR A;  1GC7 A;  2AL3 A;  1MHX A;  4GLS C;  2N7E A;  4LNK A;  1UWM A;  1H4R A;  4NJC A;  3VR8 B;  2C7H A;  2LAS A;  1M94 A;  3HK0 A;  1JAL A;  1FNV A;  2KVR A;  3M63 B;  4B9K A;  2D3C A;  3DBL I;  3P63 A;  4RM8 A;  2EKE C;  4P1B C;  3UF8 A;  2Z8L A;  1A70 A;  1OQQ A;  1WXV A;  2KDM A;  1V86 A;  1QZE A;  2MBE A;  1FMA D;  2N1V A;  1FPY A;  2B76 B;  3EFU A;  2V3P A;  2KC2 A;  2RSU A;  2W55 A;  3MP9 A;  1TGZ B;  4WWO A;  2A5U A;  1YN3 A;  1OEY A;  2KX0 A;  3Q2A C;  2AQ2 B;  2AWT A;  4HDO A;  3IG3 A;  3UQB A;  1MPE A;  5IOI A;  1JML A;  1TS5 A;  1B1Z A;  5G5H A;  1VD2 A;  3HIZ A;  2N4F A;  3MJW A;  4MM3 A;  4N6E B;  4M02 A;  2KDF B;  3VFK A;  2CR5 A;  2PEA A;  4OVZ A;  2IO0 B;  3HM6 X;  2JVC A;  3ZXV A;  3R2T A;  5E6P A;  3U4E G;  3ZTD A;  4C7Z A;  1WYW B;  2BYF A;  4II2 B;  4K3C A;  4YL8 A;  3DHI C;  3IT6 B;  3TEY A;  3ZNH B;  5J17 A;  1KM7 A;  1KFY B;  4HPM B;  4KDI C;  4TQ0 A;  3KLS X;  1TS3 A;  3JSV B;  1RWS A;  4XGA B;  2WU2 B;  4NNJ B;  2PLP A;  1E8X A;  2GRI A;  1OGW A;  1TKG A;  3DCG A;  1E7P B;  3R66 C;  3EA6 A;  3MTN B;  1NYQ A;  2AQ3 B;  4PYU A;  2L0T A;  2LUM A;  1VZ8 A;  2FAZ A;  3ZJU A;  2TSS A;  4AS1 A;  1EWC A;  3X0W A;  2BBC A;  5C1Z A;  1J8C A;  3OG5 A;  4C7Y A;  3NY5 A;  1WX8 A;  3U7D A;  2NTT A;  1V97 A;  1T0R C;  3TSS A;  4FAD A;  4MEL A;  2QIE B;  2DZK A;  4US9 A;  1S3S G;  4LLG M;  4AOF A;  1YQ4 B;  1YJJ A;  2KMC A;  5DPW A;  4YSZ B;  1CZP A;  2AL6 A;  1RFA A;  5H92 C;  1JWB D;  3OAW A;  1YN4 A;  1TJE A;  4A6Q A;  2KLC A;  1I42 A;  1YNT E;  4ICV A;  2IGD A;  2DWQ A;  1CJE A;  2L83 A;  1KOT A;  1HTQ A;  1BML C;  3ZJT A;  1SGH A;  1WGY A;  2WU5 B;  2NR2 A;  4TMA B;  2LJI A;  4E3C A;  2MA9 B;  4USA A;  1E0Z A;  4KGS A;  3ZQ4 A;  1TZO A;  3A4S C;  4MGZ E;  2LUE A;  1K53 A;  2L05 A;  4W9L A;  1OFF A;  4KX6 B;  4J6I A;  4G3X B;  3SR6 A;  3AEG B;  3RI7 C;  3I3T B;  1T6B X;  1M4V A;  2V3N A;  2JRH A;  2G4D B;  1C77 A;  1OEY J;  3ABV B;  2O6V D;  1FFU A;  2PE9 A;  4FHJ A;  4ACF A;  1KLU D;  2JSV X;  3SFE B;  3T3N A;  2L0F A;  4DDG D;  2Z59 B;  2DYB A;  4PYZ A;  3KQ4 A;  4N59 A;  3NOB A;  3KUZ A;  3PS6 A;  1EU3 A;  2HJ1 A;  2BKF A;  4IM0 A;  3RNC C;  5BYR A;  4IWQ A;  2QEJ C;  5BMG A;  4I6L B;  4REZ A;  1L0Y B;  3AV8 A;  1E7U A;  2L8J A;  3KYC D;  2K6Q A;  3P2B A;  1KH0 A;  4RGT A;  4G50 A;  1A5R A;  2RPQ A;  4W9F A;  3PT2 B;  3DVG X;  1FCC C;  2JY6 A;  3RNB C;  1AWD A;  4MH8 A;  4HJK A;  3VRB B;  4OZA A;  1L4Z B;  4RGM A;  3KH0 A;  3IHP C;  5G55 A;  1UGM A;  4GXB A;  1WXM A;  1RFK A;  2ZVN A;  2KFK A;  1R4N B;  2Y5C A;  4LDT D;  3Q3F A;  5HHD G;  2QC8 A;  2M0X A;  2HDE A;  4EE2 A;  1MVK A;  3RNF C;  4FBJ B;  1I4Q A;  4IM2 A;  4KV2 A;  3IVF A;  3QA8 A;  4KIK A;  1NEN B;  4MGY E;  1P7E A;  2G45 B;  1R4N I;  3DWG C;  3DQV A;  4GB9 A;  2YEP B;  4ZOH C;  2IZV B;  1XCT L;  4TQ1 A;  4CO7 A;  4NPN A;  2BQQ A;  4HKQ A;  3VHT C;  3DVN U;  3GE8 C; 
#chains in the Genus database with same CATH homology
 4HXD A;  3A9J B;  2JUO A;  4AWJ A;  1G6J A;  2KDE B;  3V60 A;  1TZ1 A;  3ZDT A;  4B6W A;  2GBR A;  5DPT A;  3VUW A;  1LQB A;  3LJ3 A;  4I6N B;  2V4L A;  3ZIM A;  3RT3 B;  3A9K B;  2LXA A;  5JZE B;  4GU2 A;  1V9J A;  2C5L C;  4K1R B;  3APC A;  3U8Z A;  3ZRF A;  5IAA C;  4GOC A;  2KJ6 A;  1WZ0 A;  3UQA A;  2L76 A;  2DHZ A;  4AJW A;  3SU8 X;  2WX0 A;  2I1J A;  1E8Y A;  2WDT B;  4NAW B;  2N9E B;  1KLV A;  2FCN A;  3R7R A;  3H9D A;  4M8M A;  1JRU A;  2NCN A;  3VDZ A;  1P1A A;  4W9J A;  3ZW3 A;  4BFR A;  2KO3 A;  2JT4 B;  2L3Z A;  2N7D A;  3PRZ A;  1V2Y A;  4W9K A;  3H7S A;  3DDC B;  2GBJ A;  2KDB A;  5AZH A;  1YJ1 A;  2CU1 A;  2IO1 B;  2KAN A;  4HCN B;  4HWI B;  5TR5 A;  4HPL B;  3B08 A;  1WE6 A;  1WGR A;  3L08 A;  1TTN A;  2RR9 A;  4A3P A;  2J0M A;  1E90 A;  4KSK C;  1L2N A;  4URK A;  1HE8 A;  1UD7 A;  4P7I A;  1WZ3 A;  3PRP B;  2ZJD A;  3PPA A;  1D3Z A;  4MH0 E;  2AYO B;  4DK5 A;  4KZC A;  3VXW A;  2FCS A;  2KMA A;  2EMS A;  2KTR A;  3OJ3 A;  3ZNG C;  2CHZ A;  4HK2 A;  5CHV C;  3AXC A;  3M62 B;  1Z2M A;  3UIP B;  3R3M A;  2JF5 A;  4FHK A;  3PLV A;  2JPH A;  3QC8 B;  2NBU A;  2XEW A;  1YX6 B;  2KJH B;  2D07 B;  3HM3 A;  3PV1 A;  4HDQ A;  3IFW B;  3WA0 A;  2NBV B;  4GSW A;  4CHK A;  3NS8 A;  2IO3 B;  2KLG A;  4WJQ A;  4NJ7 A;  1WY8 A;  2J7Q B;  3T8M A;  3AU4 A;  4LCD E;  1V49 A;  2LVQ A;  3ZRC A;  3QHT A;  3PVL A;  2LRW A;  1PQS A;  1F9J A;  2HD5 B;  3V61 A;  4G11 A;  4ZRK A;  3DBS A;  3NHE B;  4GMV A;  1WF9 A;  1Z5S B;  4B95 A;  1K8R B;  5EDS A;  2LXC A;  1MG8 A;  2BWE S;  2LGX A;  1CMX B;  3A33 B;  3PTF C;  2DX5 B;  4E71 A;  3ZDM C;  2MX2 A;  2XK5 A;  5GMV A;  2KTR B;  2CKH B;  1WMH A;  4FJZ A;  2XBB C;  2KQ7 A;  3UGB B;  2A4Z A;  2K39 A;  2KK8 A;  4K7U A;  4KIK B;  5D7G A;  1V6E A;  2ZCC A;  4IWO A;  4M8N A;  4BOZ B;  4GDK A;  1WJU A;  2KFJ A;  1WGD A;  1IPG A;  4II3 B;  1GUA B;  3RUI B;  4FJV B;  5L83 A;  4JGH B;  2FCM A;  4KVG B;  4MEM A;  1UZX B;  2M8S A;  2L00 B;  4BKS D;  4EFO A;  3H6N A;  1WFY A;  1FXT B;  1WJN A;  1WH3 A;  1YIW A;  2Z0D B;  2K6D B;  3A9J A;  3VAW A;  4DBG A;  3V6E B;  1X1M A;  4W9E A;  1UBI A;  1LFD A;  4ASW C;  3PLU A;  1WXS A;  1WM3 A;  3DVG Y;  4ZRI A;  1WRD B;  3A4R A;  2K1F A;  2LWP A;  2K25 A;  1KJT A;  1WJ6 A;  5CHF A;  2MLB A;  4EKU A;  4NY0 A;  2W9N A;  5C23 A;  4F7Z A;  4K81 A;  2XK5 B;  3JYU A;  2LJ5 A;  4LDT B;  2EMT A;  2BYV E;  4MJS A;  1UEL A;  2JZ3 B;  4IG7 B;  4FN2 A;  3TCA A;  1WX9 A;  3EEC A;  3N3K B;  4JLC A;  4W9H A;  3X23 A;  3APF A;  4XC2 A;  1AAR A;  2WWZ A;  1T0Y A;  2OJR A;  2ZCB A;  5KHQ A;  3ENE A;  1NI2 A;  1C1Y B;  1V5T A;  1GC7 A;  2LRU A;  4IUM B;  2AL3 A;  1P0R A;  2LGD A;  3RD2 A;  3C0R B;  4KDL B;  2RGF A;  2JXX A;  2O6V A;  4AP4 C;  3GOE A;  2N7E A;  2C7N B;  2LVP A;  4NAW A;  1H4R A;  2FID A;  2IO2 B;  2V1Y A;  3L17 A;  1SE9 A;  2C7H A;  2BYE A;  4EZK A;  2KN5 A;  2LAS A;  1WMH B;  1Y8R C;  1M94 A;  5E6O A;  3HK0 A;  3WAO A;  3PHX B;  4DDI D;  5L95 C;  2DZJ A;  3B0A A;  2N9X A;  2KVR A;  3M63 B;  4G0N B;  4B9K A;  3DVN V;  3IBE A;  2PJH A;  2KNB A;  3DBL I;  1Q1O A;  3V62 A;  1SIF A;  4RM8 A;  3TJP A;  3O65 B;  2EKE C;  3UF8 A;  3APD A;  4BOS C;  1VCB A;  2MBH A;  2ZEQ A;  3ZVV A;  1WXV A;  2HTH A;  3ZKJ C;  1V86 A;  1QZE A;  1ZKH A;  3L0W B;  2D10 A;  3GZN I;  2KTF A;  2MBE A;  3ZO5 B;  3ML8 A;  2LGY A;  2N1V A;  2WYQ A;  3PZD A;  2YVC A;  2CS4 A;  2FUH B;  3EFU A;  3ZNZ B;  3WIM A;  2MRP A;  2KC2 A;  5JHA A;  2RSU A;  2JWZ A;  1NDD A;  3HHM A;  1TGZ B;  4A20 A;  4WWO A;  2A5U A;  2DZI A;  3VQI A;  1OEY A;  4ICU A;  2KX0 A;  1WR6 E;  1C3T A;  2AWT A;  4HDO A;  3NZU A;  1P3Q U;  3QCA A;  3IG3 A;  3UQB A;  3EC8 A;  4JQW C;  4HCP B;  4W9I A;  4FJY A;  2BKR B;  4PS3 A;  2IBI B;  3QX1 A;  2KWU B;  1VD2 A;  2KJR A;  3VUY A;  1P9D U;  3KVF B;  2D2Q A;  2DYM A;  2K8H A;  2R2Q A;  3HIZ A;  3JW0 X;  3OJ4 B;  3PSE B;  4K7W A;  4WJP A;  2N4F A;  3MJW A;  2R2O A;  4MM3 A;  4MGK E;  3ZNI D;  2KX3 A;  3RUL A;  5FR6 A;  4MSM B;  4X57 B;  2DYO A;  2PPH A;  2KDF B;  3VFK A;  2CR5 A;  3SHQ A;  2ZNV C;  4F1S A;  2PEA A;  4IW0 A;  1H8C A;  1LM8 B;  4MJS B;  2IO0 B;  2UWQ A;  1WX7 A;  1WJ4 A;  4WWN A;  1S1Q B;  1E8Z A;  3WAM A;  3HM6 X;  4GGQ A;  2NPT B;  2JVC A;  1WE7 A;  4ANX A;  5E6P A;  2J0J A;  2MBO A;  3ZTD A;  3QJZ A;  1U4A A;  1WYW B;  2AEH A;  2BYF A;  3AUL A;  2DAF A;  4II2 B;  3B1L X;  4TV3 A;  4YL8 A;  3VUX A;  3WAP A;  4ANW A;  2ZVO A;  4GDL A;  3ZNH B;  2MP2 B;  2KOX A;  4JIO U;  3WAN A;  5J17 A;  1KM7 A;  2UYZ B;  3TL5 A;  3A1Q A;  1XQQ A;  4PS8 A;  3SDL C;  3T9L A;  4HPM B;  2ASQ A;  5DPS A;  1GJZ A;  4KDI C;  2RD0 A;  5CTR C;  2V3S A;  4TQ0 A;  3JSV B;  3H7P A;  3LDZ E;  4EOY A;  3VVW B;  1J0G A;  2KDI A;  2KHW B;  5CHW A;  2VRR B;  3CF6 E;  4JL9 A;  1R4M I;  2CHW A;  3BY4 B;  5D94 A;  5G2N A;  4NNJ B;  2ZPY A;  4XZ4 A;  3S2A A;  1E8X A;  3WAL A;  4ANU A;  2O2V B;  3QAR A;  5IA7 A;  1OGW A;  4WWP A;  3ZUN A;  3DCG A;  3R66 C;  4WJN A;  1I35 A;  4DHJ B;  3MTN B;  1V80 A;  3PGE A;  4PYU A;  4EEW A;  2L0T A;  5HKH A;  5LXI B;  3SD5 A;  1NBF C;  3ONS A;  3TIX A;  2FAZ A;  3N30 A;  3RZW C;  4MDK E;  4AJY B;  5AEK B;  2REX A;  1WM2 A;  3X0W A;  3A9K A;  1WXA A;  2IY0 B;  3JSV A;  2C7M B;  3PHW B;  1L7Y A;  4FA6 A;  3CSF A;  3VH3 B;  3RYT A;  2HE7 A;  5C1Z A;  1J8C A;  5KHO A;  1E7V A;  2J0K A;  3EHV A;  4N9F 4;  2GBN A;  2NVU I;  3NY5 A;  1YD8 U;  2ZZP B;  1WX8 A;  3DBR I;  3QK0 A;  2L7R A;  4GN1 A;  2MP2 A;  3U7D A;  3H1U A;  4DHZ E;  2BPS A;  2LVO A;  4TUU A;  5E6N A;  2GBM A;  2KXJ A;  4FAD A;  4MEL A;  2MW5 A;  3ALB A;  5AZF A;  4BKT A;  2DZK A;  3VTU A;  1EO6 A;  1S3S G;  4IC7 B;  3DOW A;  3V6C B;  4AOF A;  2KWV B;  4OVU A;  2BWF A;  2GMI C;  5JH5 C;  2NBW B;  2KMC A;  5DPW A;  3DPD A;  1YQB A;  4F8C B;  2AL6 A;  1RFA A;  2G4S A;  2PE6 B;  2YLM A;  3R7Q A;  3NZS A;  4AUQ C;  2KZR A;  3QAQ A;  2FIF A;  1E8W A;  4A3O A;  3OAW A;  3VTV A;  3K9O B;  4CYE A;  2FNJ B;  4ZYN A;  2KLC A;  1WGG A;  3QWZ B;  5JHB A;  1I42 A;  3TMP B;  3M3J A;  3L13 A;  4ICV A;  1UH6 A;  2ZNV B;  1P98 A;  3MHS D;  4KZ0 A;  2IY1 B;  4FUL A;  3TBL D;  5J18 A;  1KOT A;  3JVZ X;  2KQS A;  2NPT A;  3KW5 B;  1SGH A;  1WGY A;  2LZ6 A;  2NR2 A;  5DPR A;  4M0W B;  4E3C A;  2MA9 B;  1ZGU B;  2LD9 A;  3ZTC A;  3Q3J A;  3A4S C;  2MWS B;  5D2M B;  4MGZ E;  2LUE A;  4MSQ B;  4NJ6 A;  3K9P B;  2L05 A;  3H7P B;  4W9D A;  4W9L A;  4DHZ B;  2MBQ A;  1LXD A;  3L10 B;  3VH4 B;  3UIO B;  4J6I A;  3CMM B;  4G3X B;  2CHX A;  2GOW A;  1UBQ A;  4GDL B;  5AZG A;  2BGF A;  4WQO B;  1WIA A;  3I3T B;  3QQ8 B;  2KFK B;  2M1M A;  4W9G A;  2D11 A;  3ML9 A;  2DZM A;  2JRH A;  1WR1 A;  3AU5 A;  1RRB A;  4HVB A;  3BIN A;  2DAJ A;  2G4D B;  5BO4 B;  1OEY J;  4BBN C;  2N9P C;  3QIJ A;  2KKC A;  4NQL B;  3DBH I;  4BVU C;  4BKG A;  2O6V D;  2PE9 A;  4FHJ A;  1XT9 B;  1V81 A;  2L0F A;  4DDG D;  2NS5 A;  2Z59 B;  2Z0E B;  2DYB A;  1EUV B;  4PYZ A;  1GG3 A;  3UIN B;  2D3G A;  3NOB A;  3KUZ A;  3PS6 A;  1EF1 A;  3OLM D;  2BKF A;  3PRM B;  4IM0 A;  2QHO A;  4I6P A;  4IWQ A;  4WAA A;  1GNU A;  2OOB B;  3L54 A;  3U30 A;  4E74 A;  4ZRJ A;  1XD3 B;  4KSL C;  4BBN F;  4XX5 A;  4DXA B;  2HJ8 A;  4I6L B;  2ZPN A;  4RMA A;  4IWP A;  2FCQ A;  1E7U A;  2B3A A;  1E5W A;  2I1K A;  2L8J A;  4FLH A;  3KYC D;  5DCN A;  2K6Q A;  3M95 A;  3P2B A;  4GIV A;  1BT0 A;  4G50 A;  2BF8 B;  2RPQ A;  4IM3 A;  4W9F A;  1A5R A;  1J19 A;  3PT2 B;  1ISN A;  3DVG X;  4PS7 A;  1TBE A;  2JY6 A;  3PRE A;  5CX3 A;  4EUT A;  4EZJ A;  3KUC B;  2MCN B;  2MBB B;  4HJK A;  1EF5 A;  4ANV A;  3RZF A;  3KH0 A;  3IHP C;  2JRI B;  2K8C A;  3KUD B;  4LJO B;  1UGM A;  4TKN A;  2C60 A;  5G55 A;  5LLI A;  4GXB A;  1WXM A;  3W1Y A;  1IP9 A;  2ZVN A;  2KFK A;  4DWF A;  2MSE D;  3L16 A;  2WX1 A;  3RCZ A;  4LDT D;  3Q3F A;  4W9C A;  1IYF A;  1YX5 B;  1OQY A;  4LJP B;  2N1W A;  1Q0W B;  2M17 A;  2M0X A;  3KYD D;  1Q5W B;  2MQJ A;  4FBJ B;  1ZW7 A;  3AI5 A;  1RAX A;  2C9W B;  3A1Q B;  1WGH A;  2KD0 A;  4K7S A;  3VTW A;  3W1S A;  4IM2 A;  4KV2 A;  1GC6 A;  4NQK E;  3IVF A;  4GDK B;  3QA8 A;  2K8B A;  4DHJ D;  1V5O A;  4KIK A;  3CST A;  4MGI E;  3ECI A;  2IYD B;  4MGY E;  5J2R A;  3D32 A;  2KC1 A;  1OTR B;  2G45 B;  2Y5B B;  1R4N I;  2DEN B;  4BKS A;  4ZDV A;  2JZZ A;  1RLF A;  2G3Q B;  4OVV A;  2O2V A;  2KWC A;  3ZLZ A;  4EZL A;  3DQV A;  4RM9 A;  2M4N A;  4GB9 A;  5LXH A;  2IZV B;  3W1S C;  1WI0 A;  4TQ1 A;  4CO7 A;  4WJO A;  2GBK A;  4NPN A;  3N32 A;  5D6J B;  2O6V B;  4HLE A;  3VHT C;  3DVN U;  2LI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...