3PLUA

Structure of hub-1 protein in complex with snu66 peptide (hindi)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
HMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier HUB1
publication title Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Peptide binding protein
total genus 22
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pluA00
2K8BA 4W9JA 2K25A 3MTNB 4HCPB 1WR1A 4RM8A 5DPRA 3ZO5B 5J18A 1WJNA 1SIFA 2JRHA 2KTFA 2J0MA 1WXAA 4GU2A 4MGKE 2XEWA 2HJ8A 2JT4B 2K6QA 3M3JA 3ZNZB 2NS5A 3ZDMC 1WH3A 4HXDA 2LXCA 3BY4B 2LGDA 2O2VA 4WJNA 4CO7A 2LUEA 4BKTA 2KO3A 2NBWB 4K7UA 2KQ7A 4W9GA 4W9DA 4AP4C 2XK5B 2ZJDA 4TV3A 2KDIA 4ZRJA 4GN1A 1EF5A 3A4RA 1GUAB 4A3OA 3ZLZA 3ZNHB 2Z59B 2BYFA 3WAOA 4FJZA 2RD0A 2KC2A 2JVCA 2L3ZA 1TZ1A 4WJQA 3MJWA 3PLVA 1RFAA 1J19A 1UELA 2KC1A 3PGEA 2IO1B 4CYEA 2GBJA 3RUIB 1YIWA 3U30A 1WM3A 1LFDA 2KJRA 4G11A 4I6LB 4IC7B 3UQBA 2LI5A 3WAMA 1K8RB 2IO0B 1R4NI 2Z0EB 5J2RA 3CMMB 1WF9A 3K9PB 1E7VA 4NQKE 2C5LC 1TBEA 1H4RA 2C60A 2WX0A 1UBIA 4HPLB 5DPSA 4B6WA 3TBLD 3UF8A 2L0FA 2FIDA 2AYOB 4HK2A 3PS6A 2JXXA 1WRDB 5DPTA 4IM2A 3ML9A 1TTNA 1V81A 1P1AA 1SE9A 1WGHA 2N9EB 3T9LA 1GC6A 3WANA 2NCNA 4DHZE 4IWOA 2LVOA 2I1KA 1XD3B 2M4NA 4NPNA 2KFKA 3A1QB 4NJ6A 1Q1OA 2CHZA 3JSVB 4GMVA 4W9IA 3W1YA 1WJ4A 4URKA 3O65B 1I35A 4DDID 3RZWC 4DHZB 2FCQA 3L13A 4G50A 2NVUI 2D07B 3H7PB 4FJVB 3WAPA 1D3ZA 4TUUA 1GC7A 5AZFA 4BBNC 4JIOU 1AARA 5L95C 2LWPA 2EMSA 3N32A 2MBHA 4NJ7A 4KSLC 1WGDA 3UINB 4DHJD 4W9EA 3ZNGC 3M63B 1RAXA 1WXSA 2K8HA 4IM3A 5CHVC 5L83A 3DVNV 1ZGUB 4N9F4 2MP2B 4HJKA 4HDQA 4AUQC 1OEYJ 4NNJB 2NR2A 3L08A 2BYVE 1LXDA 5CHWA 4MSQB 1YX6B 2BF8B 2MBEA 5CHFA 3EECA 1E8XA 2HE7A 3A9KB 4HLEA 4MEMA 4IG7B 4ICUA 4II2B 3QQ8B 3KUDB 4MM3A 3R7RA 3IFWB 1Z5SB 2BGFA 3N30A 3DBLI 4BOSC 4B9KA 2REXA 1GNUA 2FAZA 2CHWA 2JUOA 2KOXA 1F9JA 3QK0A 2ZVOA 3CSFA 4KV2A 2UWQA 2MRPA 4MGZE 1A5RA 2MBOA 1V6EA 2LJ5A 2J7QB 5LXHA 1V80A 3X23A 1RRBA 1WFYA 1WX7A 1Y8RC 3SHQA 4ANVA 1BT0A 1E90A 2C7NB 3RULA 2L05A 4K1RB 5D94A 2MCNB 4GB9A 5GMVA 3OLMD 4ASWC 1GG3A 3VVWB 2LASA 4TQ0A 2GBMA 4XC2A 4ANUA 4AOFA 1J8CA 4M0WB 3DVGX 1S3SG 1IYFA 3L17A 1YJ1A 2K1FA 3JYUA 3SU8X 3R66C 2DZMA 4NQLB 3ZUNA 2CHXA 2KDFB 1JRUA 3TIXA 2RGFA 2C7MB 2ZEQA 4PS8A 3M62B 2K8CA 2PEAA 3PRPB 4ZDVA 4DXAB 2NPTA 2O2VB 2DX5B 4EKUA 2DENB 4EZKA 5JHBA 3HM3A 4BBNF 3DDCB 4WQOB 5D2MB 5CX3A 1WX9A 4WJPA 5IA7A 1X1MA 4HWIB 1S1QB 2FNJB 3NZSA 4NAWB 2IZVB 2V3SA 2FCMA 2RPQA 2YLMA 2KMAA 3RD2A 3WALA 4EZLA 2ZVNA 4P7IA 4BFRA 4NAWA 4KIKA 1LM8B 3PREA 1WGRA 4WWPA 3KVFB 4GIVA 4M8NA 5AZHA 1EO6A 1KM7A 2KTRA 2GBKA 3QCAA 4GDKB 4GSWA 2M1MA 4II3B 1RLFA 1OEYA 2A4ZA 2N1WA 3AU5A 2IBIB 3D32A 3KUCB 4G0NB 2FCSA 2BPSA 4GDLA 4PYUA 2HTHA 1VD2A 1WM2A 4GDKA 5E6PA 1V49A 3RYTA 3TCAA 4KDIC 4XZ4A 1WMHA 4FBJB 4BVUC 4E74A 1E8ZA 4HPMB 4JGHB 4LDTB 5LLIA 3S2AA 3ZDTA 3VAWA 4MH0E 3HK0A 2KFKB 4F1SA 1EF1A 5KHQA 3MHSD 5AEKB 2KQSA 4FHJA 1WYWB 3KW5B 3UIOB 3C0RB 2G4DB 1WR6E 4M8MA 4OVVA 3V6CB 1WE7A 2KK8A 1Z2MA 3H6NA 4LDTD 1XT9B 3K9OB 4F7ZA 3QIJA 3I3TB 4KZCA 4FA6A 4DHJB 1OQYA 2NBVB 1WJ6A 2KLGA 5C23A 2MBQA 2MX2A 3B0AA 4KDLB 1WXVA 2CS4A 5E6NA 1UZXB 3VFKA 1KLVA 1LQBA 4FJYA 4HDOA 2IYDB 3APDA 4TKNA 3PRMB 1V2YA 3KH0A 5HKHA 2AL6A 3ZTDA 5EDSA 3V62A 2PJHA 1V5TA 2CKHB 2GBRA 5BO4B 4A20A 4IWQA 2KN5A 2DYOA 4WWNA 2DAJA 2KFJA 4KZ0A 3U7DA 3OJ4B 1WX8A 2GOWA 3ZW3A 2WX1A 4KSKC 2BWES 1WGYA 3L0WB 4MDKE 4MJSA 2KKCA 2O6VA 2KZRA 3GOEA 1MG8A 2WWZA 4K81A 2K39A 2O6VD 3DOWA 3IG3A 2R2OA 4K7WA 2D3GA 2DYBA 4EUTA 4FLHA 4BOZB 4HVBA 2RSUA 4JQWC 2L8JA 2N9XA 4PYZA 3QX1A 2KJHB 3SDLC 3Q3FA 4MGIE 2MA9B 2PE9A 1UGMA 4JLCA 2KWCA 3IBEA 3H7SA 1WGGA 2G45B 3PLUA 2D2QA 2EKEC 3H1UA 3JW0X 4FULA 3DVNU 5FR6A 1UH6A 2KNBA 4FHKA 4K7SA 5AZGA 2MLBA 1M94A 3DPDA 3NOBA 4LJOB 5G55A 1H8CA 5J17A 3NHEB 2DZIA 2IY0B 4W9HA 3VH4B 2AWTA 3HIZA 2JF5A 3EHVA 2KLCA 1XQQA 2KJ6A 4DDGD 2J0KA 4G3XB 1UBQA 2NPTB 3RZFA 3A9JA 3VDZA 2AL3A 2XBBC 3P2BA 2V4LA 1J0GA 4F8CB 1HE8A 3QWZB 4AJYB 5JHAA 2M17A 3QAQA 3EC8A 2JWZA 1CMXB 2G4SA 4W9CA 5G2NA 5E6OA 4GGQA 3UIPB 4J6IA 1WIAA 4EEWA 3R3MA 3PRZA 4E71A 2JZ3B 3ZKJC 3TJPA 1L7YA 2KD0A 3ML8A 2LVPA 3DVGY 3ZRFA 1Q0WB 3A33B 4DWFA 1OGWA 1YQBA 3ZVVA 2KHWB 3VHTC 4B95A 2Z0DB 3TMPB 2LRUA 4KIKB 2K6DB 1ZW7A 1P98A 1C3TA 3KUZA 2LRWA 5JH5C 2ZNVB 3PPAA 2I1JA 3PZDA 3ZNID 1E8YA 2NBUA 2MQJA 5DPWA 4CHKA 4MSMB 2KTRB 1PQSA 2LGXA 3CF6E 4IWPA 2KDEB 1T0YA 4GDLB 2KDBA 2B3AA 3HHMA 4W9KA 2LZ6A 4XX5A 3AULA 2HD5B 2RR9A 3AXCA 3OAWA 4JL9A 2YVCA 5LXIB 3PSEB 4TQ1A 2JY6A 2N9PC 3NY5A 4IUMB 1WMHB 3Q3JA 3PT2B 2FUHB 2C9WB 2MW5A 4PS7A 4BKGA 1E5WA 2ZCBA 2EMTA 3RCZA 1FXTB 2XK5A 3L16A 2DYMA 2C7HA 1WZ3A 2GMIC 1G6JA 1IPGA 1P0RA 1UD7A 1V5OA 4E3CA 3DBHI 2KANA 3L54A 4OVUA 3AU4A 3IVFA 4FN2A 3JVZX 4ZYNA 3PTFC 3KYCD 5DCNA 3N3KB 3LJ3A 2LD9A 2OJRA 3ONSA 1YD8U 1OTRB 1NDDA 3VXWA 1I42A 3U8ZA 4EOYA 3VUXA 1SGHA 2JRIB 3DBSA 3VUWA 3ZTCA 2W9NA 2BYEA 2GBNA 2J0JA 2PE6B 1EUVB 3L10B 5C1ZA 2PPHA 1WI0A 2L76A 3OJ3A 3WA0A 2L00B 2Y5BB 3APCA 5IAAC 3PHXB 2M0XA 3QHTA 2IO3B 1IP9A 4FADA 3PVLA 2QHOA 3DCGA 4PS3A 2JZZA 2LXAA 4MGYE 3LDZE 4ANXA 4ZRKA 4YL8A 3TL5A 2ZCCA 2L0TA 3NZUA 4I6PA 3V6EB 1KOTA 2JPHA 3A4SC 1YX5B 2KWVB 3VTWA 4AJWA 1E8WA 4EZJA 2OOBB 3QC8B 1WE6A 2KXJA 4MJSB 2O6VB 3VH3B 1VCBA 2N4FA 5TR5A 1WZ0A 3GZNI 3V60A 1GJZA 1WXMA 4MELA 2L7RA 5D7GA 4W9FA 4I6NB 1Q5WB 3A1QA 4DK5A 3JSVA 5KHOA 4DBGA 2CU1A 3UQAA 1L2NA 3H9DA 4ANWA 1E7UA 3VTVA 1P3QU 3ENEA 3EFUA 3BINA 3H7PA 3IHPC 3B08A 2ZNVC 3ALBA 2MBBB 3QARA 2WDTB 1R4MI 2KMCA 2VRRB 3AI5A 4GOCA 4IM0A 4ICVA 3R7QA 3ZIMA 1NBFC 2V1YA 4KVGB 3UGBB 2ZPNA 1NI2A 2M8SA 2D10A 2DZKA 3W1SC 1QZEA 4IW0A 4BKSA 2AEHA 2BWFA 2KX0A 3X0WA 2MSED 1ISNA 3HM6X 4GXBA 1V9JA 2CR5A 2MP2A 2R2QA 2FCNA 2BKRB 4AWJA 2IO2B 3CSTA 4ZRIA 4BKSD 5JZEB 2WYQA 3A9JB 3NS8A 1TGZB 2DHZA 3VUYA 3ZRCA 3A9KA 2LGYA 3M95A 3DQVA 1V86A 1ZKHA 2LVQA 3QA8A 4LCDE 3RT3B 2UYZB 4A3PA 4EFOA 5CTRC 5D6JB 4W9LA 2D11A 3B1LX 1WJUA 2IY1B 4LJPB 3KYDD 3DBRI 2A5UA 3VTUA 2MWSB 4RMAA 3PHWB 2BKFA 2KVRA 2ZPYA 3W1SA 2KWUB 3WIMA 3V61A 2DAFA 4HCNB 4WJOA 4NY0A 2N1VA 3QJZA 3ECIA 1P9DU 4WAAA 2ZZPB 1U4AA 4WWOA 3APFA 4RM9A 3SD5A 1KJTA 2KX3A 3T8MA 2N7DA 1C1YB 2FIFA 2N7EA 2G3QB 4X57B 2DZJA 3PV1A 2ASQA 1WY8A 3VQIA
chains in the Genus database with same CATH superfamily
4WWMA 4W9JA 2K25A 3ZO5B 2PW9A 2KTFA 4LLGM 2K6QA 2DLBA 4IDIA 2NS5A 3MC8A 4HXDA 2EELA 4CO7A 4BKTA 2KO3A 2KQ7A 4W9GA 1LGRA 2MH7A 4TV3A 3BWUD 3A4RA 3UI3A 4YTMB 2KC2A 2DBYA 2K9XA 4WJQA 3MJWA 3PLVA 1UELA 1J19A 4CYEA 1YIWA 1AW7A 3GS2A 4XE0A 4G11A 2WLBA 4I6LB 4BZAA 2IO0B 1IUEA 3K9PB 1XXGA 2C5LC 1H4RA 4HPLB 3DBLB 3BYYB 2AYOB 4HK2A 4RGMA 2DWQA 1P1AA 2TSSA 1WGHA 3AE6B 3T9LA 4ZYSA 3WANA 2NCNA 2LVOA 3MC0B 2KFKA 4GMVA 4CQNA 4OZAA 1JWSD 5EE9A 3Q8FA 4BBNC 1AARA 2LWPA 2EMSA 3KWLA 2MBHA 2H88B 4W9EA 3T3OA 3BVGA 4K3BA 4HJKA 4AUQC 5FKAC 5C3JB 2BF8B 2MBEA 5CHFA 1E8XA 2QJLA 3AN1A 4MEMA 4IG7B 4ICUA 3QQ8B 2IGDA 2BGFA 3N30A 2JXTA 3DBLI 3W2DA 2WXOA 2SAKA 3CSFA 2V0GA 4KV2A 2UWQA 1JQ4A 1NYRA 2LJ5A 2JU6X 1V80A 3X23A 1WFYA 2Y5PA 1TT5B 3RULA 2L05A 1XLOA 4GB9A 1GG3A 3N1XC 4XC2A 5EE3A 2N0SB 3SU8X 4NQLB 2CHXA 2KDFB 1YQ4B 3M62B 2PEAA 4EKUA 2M56B 2DENB 1FRRA 1DOYA 1ZP0B 3DDCB 5MPOA 3NVZA 5IA7A 4HWIB 2MEKA 3NZSA 1JWUD 4K3CA 1QF6A 2NTSA 1STEA 4P7IA 1ENFA 5EE1A 1SEBD 1LM8B 2L52A 3KQ4A 2N9KA 5AZHA 4IOIE 2K5PA 1KM7A 2WXIA 2W82A 1FCCC 2N1WA 1OEYA 4GDLA 2IBIB 3D32A 4G0NB 2HTHA 3RYTA 4KDIC 4WAFA 1YN3A 1F77A 4JGHB 3ZDTA 4MH0E 2KFKB 4F1SA 3NJTA 1CQVA 5KHQA 1SIJA 4KGTA 4FHJA 3UIOB 3RNFC 3V6CB 1J7CA 2G9HD 4FA6A 3QIJA 4DHJB 2NBVB 3DWMA 1T0RC 5C23A 3B0AA 4KDLB 5E6NA 4L23A 4TKNA 3APDA 2VZKB 3R8BA 1V2YA 3BVZA 3ZTDA 3V62A 1BUIC 1HXYD 4A20A 2KMMA 2KFJA 4KZ0A 1FCLA 3U7DA 2VZKD 4M00A 3L0WB 4MDKE 2O6VA 3GOEA 3W5VB 2WWZA 2BQQA 3DOWA 1JROA 4FLHA 2B76B 3QX1A 3Q3NC 5IP4D 1UGMA 2KWCA 1YOVB 1KLGD 4JE3B 3JW0X 4FULA 3DVNU 2KNBA 1D5XC 2MLBA 4LJOB 5H8YE 4DQOC 1T6BX 3VH4B 1WGKA 3T3NA 2D3BA 2ICIA 3A9JA 3VDZA 4KKJA 4AJYB 5JHAA 3QAQA 3EC8A 2DNFA 4GGQA 1WIAA 2WDVB 3TJPA 1FNVA 4RGOS 1SXTA 1WSPA 3DVGY 1Q0WB 4DWFA 3MP9A 1I4HA 2BW2A 3GB1A 2LRWA 1SBBB 4S0RA 5D3IB 1GB1A 2I1JA 2NBUA 5DPWA 1PQSA 2LGXA 4JPSA 2CJOA 3GZNB 1XLNA 4GDLB 4IKGA 2LZ6A 1D5ZC 2YVCA 5LXIB 2JY6A 4IUMB 1FNWA 2C9WB 1QOBA 5BYSA 2K22A 4A90A 2XK5A 1SE4A 2GMIC 1G6JA 2J4XA 2KANA 3L54A 1VZ8A 1N63A 2MJDA 3KYCD 5DCNA 2AQ2B 3N3KB 3LJ3A 2IGGA 3ONSA 1OTRB 2PIAA 3U8ZA 3VUXA 3AH7A 3ZTCA 3VUWA 1N6ZA 2W9NA 1AYFA 1TY0A 2J0JA 1EUVB 5IO9A 2PPHA 3APCA 4ITKA 2JZZA 2LXAA 4YL8A 2L0TA 1KOTA 4HJGE 2OOBB 3QC8B 1WE6A 2KXJA 4TSSA 2O6VB 1KF6B 1VCBA 2N4FA 2VH2A 5TR5A 3GZNI 3RNEC 4W9FA 2QIEB 2QSDA 3A1QA 3CWIA 1YJJA 3H9DA 4NZLB 2J52A 4OW0A 3VTVA 3AEAB 3H7PA 1QKZA 4GOCA 3P1MA 1NI2A 2M8SA 1B9RA 1QZEA 4IW0A 2PLPA 2BWFA 2WNMA 3NRZA 1V9JA 3EA6A 4HROA 3A9JB 3NS8A 1I4QA 3VUYA 3A9KA 3DQVA 2LVQA 1FM0D 5CTRC 5D6JB 3PO0A 4ARCA 1R4NB 1WJUA 3DBRI 2K0PA 3AB5A 2V4IB 1Q10A 3PHWB 2KWUB 2AQ3B 4NY0A 1TS4A 3ECIA 1TKYA 4WWOA 3APFA 3T8MA 2KX3A 1V8CA 3KLSX 1UWMA 2G3QB 3AEBB 2MRPA 2K8BA 2ONQA 5DPRA 3MTNB 4RM8A 1WR1A 5J18A 2JRHA 1SIFA 2J0MA 3L4PA 2W55A 1PGAA 4HKQA 1WH3A 4C7YA 2LXCA 1HTOA 3BY4B 2O2VA 4FXCA 4K7UA 4W9DA 2XK5B 2ZJDA 1GUAB 2KAJA 4RGNA 2Z59B 4FJZA 4C00A 2L3ZA 1TZ1A 1L4DB 5H92C 1RFAA 1TS5A 2KC1A 3ZQ4A 3RUIB 1LFDA 1WYGA 1ZUD2 2KJRA 2LI5A 1R4NI 1PDXA 1CJEA 1WF9A 1E7VA 1YNTE 1SE2A 4ACFA 4O1NA 1D6EC 2FIDA 3PS6A 2JXXA 3RMKC 5G5HA 4XGAB 1TTNA 1GC6A 4DHZE 2OHFA 4GLSC 2BVCA 1XD3B 1FNUA 4W9IA 1AWDA 3A1QB 4HEA1 4NJ6A 3W1YA 2WXMA 1L0YB 1WJ4A 2WDRB 3LYYA 4OHJA 4QAYA 4DDID 3RZWC 4YWGG 1K51A 3L13A 2D07B 3H7PB 1D3ZA 3GP7A 4L2YA 5HG2A 2E3TA 3P4PB 4LK0M 4KSLC 2QC8A 3UINB 2GLSA 2Q5WD 1I7HA 2K8HA 1C4CA 1P7EA 3DVNV 3V05A 1ZGUB 4LNNA 3EFCA 4NAMA 2NR2A 4MSQB 3P4QB 3GE8C 1YX6B 3A9KB 4II2B 3KUDB 1MI0A 4MM3A 3IXSA 3IFWB 1FPYA 2FAZA 2BB6A 3GE3C 2KOXA 5FK9C 2PTLA 5EE0A 1E7PB 1L0XB 2NMQA 2MBOA 2J7QB 2MJEA 4NJCA 5LXHA 1WX7A 3SHQA 1BT0A 5D94A 2MCNB 3O13A 2KACA 2SEBD 3VVWB 4TQ0A 4AOFA 1J8CA 1IYFA 1P7FA 2DZMA 2YEPB 2RGFA 5I4DA 2C7MB 3BK2A 2KVZA 3PRPB 2NPTA 2O2VB 3W9CB 3BK1A 3AECB 2Z8LA 3HM3A 3NG0A 4M01A 4JWSC 1HTQA 4A9AA 2YLMA 1ACCA 1FRDA 1I4RA 2ZVNA 4BFRA 3PREA 3SR6A 4WWPA 1XLPA 2GBKA 1PYWD 1D5MC 1UUPA 4R3DA 3W1SA 1PGBA 4DXFA 1V49A 2BS3B 4XZ4A 4N59A 3LB8C 4BVUC 4E74A 1E8ZA 4LNOA 4LDTB 2JX5A 3S2AA 1XLQA 3VAWA 3AE7B 3HK0A 1ZPSA 3MHSD 1VZ6A 5AEKB 2KQSA 3KW5B 3C0RB 1WR6E 1WE7A 2KK8A 1Z2MA 3I63C 4LDTD 3Q8AA 3K9OB 2GB1A 4KZCA 3HVDA 1GPXA 3MHZA 3URYA 1F1HA 4HDOA 2IYDB 2X8XX 3ZYYX 1QILA 3KH0A 5HKHA 1MJDA 3AE1B 2AL6A 2KYWA 3I57A 2GBRA 5BO4B 1ET9A 1JCKB 2DYOA 2DAJA 1VDVA 1TJEA 3ZW3A 4MJSA 1WGYA 4MM3B 1MG8A 1C76A 1ET6A 4K81A 3IG3A 2DYBA 4BOZB 4JQWC 1I4XA 1VJKA 3Q3FA 2RDBC 1ZXIA 2INCC 4AS1A 3PLUA 3NZ3A 3TEXA 4K7SA 4YTPB 2PKOA 4ZHOA 1EU4A 1GAQB 2D5GA 1C4AA 5FR3A 4W9HA 3HIZA 2JF5A 3EHVA 2J0KA 2NPTB 2XBBC 2V4LA 4F8CB 2M17A 3ZJTA 4P1BC 2JWZA 3I9V1 1CMXB 2G4SA 2N9LA 2VH1A 5G2NA 1QOAA 1C9FA 1D4BA 3PRZA 3ZKJC 2KD0A 3ML8A 3ZRFA 3TSSA 3ZVVA 3VHTC 2Z0DB 2K6DB 1C3TA 4TMAB 2ZNVB 1T3QA 3BYTB 3PZDA 5IOIA 1VZ7A 3CF6E 4IWPA 4JWUC 3AE4B 1T0YA 2B3AA 4XX5A 2HD5B 3OAWA 2WXHA 3PT2B 2MW5A 3RCZA 2C7HA 3I5JC 1IPGA 1P0RA 1V5OA 4E3CA 4OVUA 1VRAB 1BMLC 1ZDXA 2KDMA 2LD9A 2OJRA 1CZPA 3DWGC 1NDDA 1I42A 1Y56A 2WXQA 3DBSA 1EM7A 3BIID 2L1AA 3L10B 3OJ3A 3WA0A 2L76A 2Y5BB 4WURA 5IAAC 2M0XA 2LHDA 4FADA 2QHOA 3LDZE 4ANXA 3TL5A 2ZCCA 4I6PA 3V6EB 2JPHA 2RDHA 1YX5B 4AJWA 2RMMA 4MJSB 1BXTA 3VH3B 4JX1C 1M4VA 1WXMA 3P42A 1UF0A 5KHOA 4DBGA 1L2NA 4OZCA 1UNSA 1T5XD 3B08A 2BBCA 4C80A 2WDTB 2KMCA 2VRRB 4M02A 1HZ5A 4ICVA 1NBFC 4MT5A 3UGBB 1E6EB 2D10A 1PFDA 1SB3C 1C79A 2MSED 3HM6X 1QLBB 2R2QA 4AWJA 3CSTA 1R7SA 5D3DA 1ROEA 2JQRB 4RFBA 3ZRCA 2WGSA 3RT3B 2HTME 1TYGB 2KN4A 2IGHA 3EUB2 2LMCA 2A5UA 3WIMA 3DHHC 3V61A 4WJOA 3QJZA 2WP9B 4X57B 2DZJA 3PV1A 3WAOA 4HCPB 4M0WA 3AE8B 2Y3AA 3HUIA 2HJ1A 4ZRPA 2XEWA 1FEHA 2HJ8A 3M3JA 3FILA 2LGDA 2LUEA 2WXGA 2E6XA 4ZRJA 4C4VA 3U2SC 1IGDA 4A3OA 2BYFA 1SJED 2JVCA 4A55A 2BT6A 3AMZA 3PGEA 3ZXVA 2IO1B 1NYQA 1L5PA 2GBJA 3Q3MC 3DHIC 4IC7B 3UQBA 3WAMA 3CIRB 2Z0EB 5J2RA 4NQKE 1TBEA 2BS2B 3TBLD 1WWTA 3EGRA 5AUKA 3ML9A 1HZ6A 1V81A 4REZA 4S17A 1SE9A 1TIFA 2M4NA 4NPNA 2CHZA 4DHZB 4G50A 4FJVB 1F2RI 4TUUA 1GC7A 2Y5CA 3Q8CA 5AZFA 3PZ7A 1LO5D 3N32A 2BTEA 3ZNGC 3PZ8A 4WQMA 3OWEB 5L83A 2V3PA 4N9F4 4NNJB 5GXGB 2BYVE 5CHWA 1N5WA 1L6UA 2IPKD 3E9SA 1J7AA 3EECA 1ZE3D 2HE7A 4HLEA 2GRIA 2BS4B 4AQ7A 3R7RA 1MVKA 1Z5SB 4BOSC 1QT9A 4ARIA 1V97A 3E56A 2JUOA 5E6JA 2LGSA 4MGZE 4MACA 4LNFA 5GMVA 3OLMD 3J9CA 1PGXA 1FO4A 3AE9B 3DBHB 4M0WB 4LNKA 3L17A 1YJ1A 2K1FA 3JYUA 3Q69A 4US8A 3R66C 3ZUNA 1JRUA 3TIXA 2FBWB 2ZEQA 1RYJA 4PS8A 3FILB 4ZDVA 2M0AA 4KGRA 2I2YA 2QEJC 4OZBA 5JHBA 1NEKB 4WQOB 5CX3A 1WX9A 4MH8A 4WJPA 4C4VB 1X1MA 5HFYA 3TEZA 3RNAC 1S1QB 4NAWB 2IZVB 2MHJA 2V3SA 2RPQA 3WALA 1AN8A 4M8NA 4KKIA 2KTRA 2HDEA 4GDKB 4GSWA 1K52A 4II3B 4PYUA 3KUCB 2FCSA 3AEGB 2JWUA 2INPE 1N60A 5E6PA 2AX5A 2W3RA 3TCAA 4XWWA 1WMHA 3MJ5A 2WXRA 4HPMB 3RI7C 4USAA 5LLIA 2H89B 1N5XA 1EF1A 1I4PA 3B2FA 1WYWB 4OVVA 4M8MA 2V9HA 1TZOA 3H6NA 1OQQA 1XT9B 4F7ZA 2LEKA 1WXVA 3VFKA 1KLVA 1LQBA 4FJYA 3BZDB 3PRMB 2EKIA 1C4PA 2G1EA 2FE8A 2PJHA 5HI1A 1V5TA 2CKHB 4IWQA 4N6EB 2N7JA 4WWNA 3P4SB 1FD6A 1WXQA 3OJ4B 1WX8A 2GOWA 4KSKC 2BWES 2V3NA 2KKCA 1JWBD 2JYTA 4KGSA 1DOXA 4YXDB 3TEYA 1A70A 4K7WA 4EUTA 2PVOD 4XDCA 4EE2A 2L8JA 2QDFA 4PYZA 4MGIE 4BAXA 2PE9A 5BMIA 1IGCA 2NTTA 1RM6C 2D2QA 2EKEC 3H1UA 3IT4B 1UH6A 4FHKA 2RDGA 5AZGA 3HVZA 3DPDA 3NOBA 2LGIA 3Q6BA 2DZIA 2WXNA 1XQQA 3AV8A 4RF1A 2AL3A 1J0GA 4H2AA 3QWZB 1QOGA 3AE3B 5E6OA 4J6IA 4EEWA 3R3MA 4E71A 1E9MA 1L7YA 1OGWA 1YQBA 2LRUA 1ZW7A 3DHGC 5IN7A 3VRBB 1K50A 2GI9A 2ON8A 2WXPA 2MQJA 1WRIA 2KTRB 1HQRD 2KDEB 4RNAA 2KDBA 3HHMA 4RF0A 2RR9A 3AXCA 1SSNA 2PMVA 4JL9A 2N9PC 2WDQB 1WMHB 3Q3JA 2FUHB 1MPEA 4PS7A 3R2TA 3C19A 1JWMD 1E5WA 1FXTB 3L16A 2DYMA 1R4MB 1WZ3A 1V1OA 1XO3A 2WQYB 1YN5A 3U52E 3IVFA 2OEDA 5LNK1 1YD8U 3IT6B 4A8XC 2LUMA 1HEZE 1C77A 2PE6B 5C1ZA 1WI0A 2L00B 3IAS1 3PHXB 3ETRA 3QHTA 2IO3B 1IP9A 3PVLA 3DCGA 4J3OD 4MGYE 4ZRKA 3FAHA 4RH6A 5TSSA 3NZUA 3RNGC 3A4SC 3VTWA 4EZJA 1E8WA 1SE3A 4US9A 2CU3A 4ZHPA 2L7RA 5D7GA 1Q5WB 5BYRA 4DK5A 3JSVA 2CU1A 3UQAA 1E0ZA 1E7UA 1YQ3B 4KX6B 3ENEA 3B9JA 3Q3OC 2ZNVC 2JZPA 1YMHE 1R4MI 3ZIMA 2V1YA 4KVGB 3N20C 2DZKA 3W1SC 3FC4A 3X0WA 4GXBA 4RCOA 2MP2A 2BKRB 4BKSD 4ZRIA 1TGZB 2INNE 1ZKHA 3QA8A 4A3PA 2UYZB 3KWVA 4EFOA 1IBXA 4W9LA 1EU3A 2D11A 5IKCM 3B1LX 1V1PA 4P1CC 3KYDD 5C2TB 1L0VB 3VTUA 2ZPYA 2KVRA 4A6QA 1FFVA 1YN4A 4HCNB 3TEWA 1P9DU 4WAAA 4ZOHC 1U4AA 3WCQA 4RM9A 1KH0A 2N7DA 2YEPF 2N7EA 1WY8A 2ZW0A 1GOZA 1WJNA 3RFZB 1NVID 2JYEA 1WXAA 4GU2A 4MGKE 4B0MA 2JT4B 3RNCC 3ZNZB 3ZDMC 4WJNA 2NBWB 2WXKA 4AP4C 2KDIA 4GN1A 3ZXRA 1EF5A 3ZLZA 3ZNHB 2RD0A 1KRHA 1QOFA 3U30A 1FXAA 1WM3A 4Q2JA 4LTUA 2QILA 1FFUA 3FKYA 1K8RB 1MHXA 3AE5B 3CMMB 4YSZB 1T0SC 2C60A 2WX0A 2MJ3A 1UBIA 5DPSA 4B6WA 3UF8A 2L0FA 1ZDVA 1WRDB 5DPTA 4IM2A 1F52A 1DYQA 2KWDA 2N9EB 4IWOA 2I1KA 1NENB 1Q1OA 3MFGA 3JSVB 4URKA 3O65B 1I35A 1EWYC 2FCQA 1RFKA 2NVUI 3WAPA 2WXLA 2WS3B 4JIOU 1J7BA 2J42A 5L95C 3NVYA 5T8IA 4NJ7A 1WGDA 2KQ4X 4DHJD 1YJIA 3M63B 1RAXA 2LJIA 4IM3A 1WXSA 1VLBA 5CHVC 2ACZB 2MP2B 1TS2A 4HDQA 1OEYJ 3U4EG 3L08A 1XEEA 1LXDA 3NVWA 2RPVA 1XCTL 1F2RC 3N9YC 3IAM1 1IBXB 3SFEB 1KLUD 2D3CA 1V1PB 3VR9B 4B9KA 3P63A 2REXA 1GNUA 2CHWA 4C56C 1F9JA 3QK0A 2ZVOA 4YSYB 2LFIA 2PVGC 1A5RA 1V6EA 3ZJVA 2AQ1B 1RRBA 2M19A 1Y8RC 2L83A 4ANVA 1E90A 2C7NB 4K1RB 2INDC 3B2GA 4ASWC 3ZJUA 2LASA 2GBMA 4ANUA 4HPPA 3DVGX 1S3SG 1N61A 1KTKA 2JSVX 4B0EA 2K8CA 4DXAB 2XNAC 3HRDD 2DX5B 2QCZA 1UGJA 4EZKA 4BBNF 1PUTA 5D2MB 1CK1A 2FNJB 2LHEA 2FCMA 2KMAA 3RD2A 4EZLA 5BYQA 4NAWA 4KIKA 1WGRA 4YSXB 3KVFB 4GIVA 3AM9A 1EO6A 2KT7A 3QCAA 1EWCA 3TUOA 4WIPA 1MFWA 1ESFA 2M1MA 1RLFA 2A4ZA 1TKGA 4EOYA 3AU5A 4DXGA 2BPSA 1KFYB 2WHIA 1OQRA 1VD2A 1WM2A 4GDKA 4FBJB 1RWSA 1ZOYB 4PK1A 1JRPA 2I38A 2WXJA 1FIQA 3NUHB 2WXFA 2G4DB 4UDUC 3I3TB 3H8HA 1OQYA 4N58A 1WJ6A 2KLGA 3U7ZA 2MBQA 2MX2A 4XDDA 2CS4A 1DGJA 1UZXB 3P4RB 4YTNB 3DBRB 5EDSA 5AUIA 2WU2B 2KN5A 5BMGA 4XWTA 2WX1A 3VRAB 2KZRA 1ZXHA 3ZGZA 4RGTA 2K39A 2O6VD 2R2OA 2D3GA 3SEBA 3ABVB 4HVBA 2RSUA 3N1ZC 2W54A 2N9XA 1FMAD 2BB5A 2KJHB 3SDLC 3LXFA 2MA9B 4HKZE 1L4ZB 4JLCA 3IBEA 3H7SA 1MG4A 1WGGA 2G45B 2K3UA 1JW9D 3Q14C 5FR6A 2XN9C 1L6VA 5JXVA 3C8YA 1M94A 5G55A 1H8CA 5J17A 3NHEB 3RN9C 2IY0B 2CJNA 2AWTA 1TKEA 2KLCA 2KJ6A 4DDGD 4G3XB 1UBQA 1SF0A 3RZFA 3P2BA 1HE8A 1HA5A 2WU5B 4W9CA 5HHDG 1XF5L 3UIPB 2JZ3B 1B1ZA 1VR9A 4ZRQA 2LVPA 3A33B 2KHWB 4B95A 3TMPB 4KIKB 1P98A 3NS1A 3KUZA 1XCQL 4OVZA 3Q8EA 5JH5C 3PPAA 4C7ZA 3OG5A 1E8YA 3MC9A 3ZNID 4CHKA 4MSMB 3RNBC 1E10A 3SFDB 1TS3A 4W9KA 2J53A 3AULA 4L1BA 2R61A 3PSEB 4TQ1A 3NY5A 1F0ZA 1FXIA 3AEEB 3BVMA 1JWAD 4BKGA 2ZCBA 2EMTA 1TY2A 2X38A 1OFFA 1UD7A 3DBHI 1GB4A 3AU4A 4FN2A 3JVZX 1C78A 4ZYNA 3PTFC 2W3SA 1UWXA 3VXWA 1SGHA 2JRIB 2BYEA 2GBNA 1K53A 4PS3A 1I4GA 4WH4A 2QMTA 3AE2B 2KWVB 2ZW1A 1JALA 1WZ0A 3V60A 1GJZA 2FUG1 4MELA 4XYCA 3Q2AC 4I6NB 4D2KA 1JMLA 4ANWA 4P16A 1P3QU 4YT0B 2L32A 3EFUA 3BINA 3IHPC 3ALBA 2MBBB 3QARA 3AI5A 1NI3A 2OJWA 4IM0A 3R7QA 4HRSA 1SJHD 2ZPNA 5G5GA 4BKSA 2AEHA 2KX0A 3Q8BA 1ISNA 2CR5A 3W5UB 2FCNA 2BYTA 2IO2B 5JZEB 2WYQA 1DOIA 2DHZA 1MHHE 4LNIA 2LGYA 3M95A 4LCDE 1V86A 3R2IA 1N62A 2IY1B 4LJPB 3NVVA 1T0QC 2D3AA 2MWSB 3AEDB 3AEFB 2BKFA 4RMAA 2DAFA 4PT5A 1QQRA 2N1VA 3N1YC 2IDYA 5BMHA 3V3XA 2ZZPB 2IJ0A 3SD5A 1KJTA 1C1YB 2FIFA 3RPFC 3VR8B 2UU7A 4P6VF 2ASQA 3VQIA
chains in the Genus database with same CATH topology
2K8BA 4W9JA 2K25A 3MTNB 4HCPB 1WR1A 4RM8A 5DPRA 3ZO5B 5J18A 1WJNA 1SIFA 2JRHA 2KTFA 2J0MA 1WXAA 4GU2A 4MGKE 2XEWA 2HJ8A 2JT4B 2K6QA 3M3JA 3ZNZB 2NS5A 3ZDMC 1WH3A 4HXDA 2LXCA 3BY4B 2LGDA 2O2VA 4WJNA 4CO7A 2LUEA 4BKTA 2KO3A 2NBWB 4K7UA 2KQ7A 4W9GA 4W9DA 4AP4C 2XK5B 2ZJDA 4TV3A 2KDIA 4ZRJA 4GN1A 1EF5A 3A4RA 1GUAB 4A3OA 3ZLZA 3ZNHB 2Z59B 2BYFA 3WAOA 4FJZA 2RD0A 2KC2A 2JVCA 2L3ZA 1TZ1A 4WJQA 3MJWA 3PLVA 1RFAA 1J19A 1UELA 2KC1A 3PGEA 2IO1B 4CYEA 2GBJA 3RUIB 1YIWA 3U30A 1WM3A 1LFDA 2KJRA 4G11A 4I6LB 4IC7B 3UQBA 2LI5A 3WAMA 1K8RB 2IO0B 1R4NI 2Z0EB 5J2RA 3CMMB 1WF9A 3K9PB 1E7VA 4NQKE 2C5LC 1TBEA 1H4RA 2C60A 2WX0A 1UBIA 4HPLB 5DPSA 4B6WA 3TBLD 3UF8A 2L0FA 2FIDA 2AYOB 4HK2A 3PS6A 2JXXA 1WRDB 5DPTA 4IM2A 3ML9A 1TTNA 1V81A 1P1AA 1SE9A 1WGHA 2N9EB 3T9LA 1GC6A 3WANA 2NCNA 4DHZE 4IWOA 2LVOA 2I1KA 1XD3B 2M4NA 4NPNA 2KFKA 3A1QB 4NJ6A 1Q1OA 2CHZA 3JSVB 4GMVA 4W9IA 3W1YA 1WJ4A 4URKA 3O65B 1I35A 4DDID 3RZWC 4DHZB 2FCQA 3L13A 4G50A 2NVUI 2D07B 3H7PB 4FJVB 3WAPA 1D3ZA 4TUUA 1GC7A 5AZFA 4BBNC 4JIOU 1AARA 5L95C 2LWPA 2EMSA 3N32A 2MBHA 4NJ7A 4KSLC 1WGDA 3UINB 4DHJD 4W9EA 3ZNGC 3M63B 1RAXA 1WXSA 2K8HA 4IM3A 5CHVC 5L83A 3DVNV 1ZGUB 4N9F4 2MP2B 4HJKA 4HDQA 4AUQC 1OEYJ 4NNJB 2NR2A 3L08A 2BYVE 1LXDA 5CHWA 4MSQB 1YX6B 2BF8B 2MBEA 5CHFA 3EECA 1E8XA 2HE7A 3A9KB 4HLEA 4MEMA 4IG7B 4ICUA 4II2B 3QQ8B 3KUDB 4MM3A 3R7RA 3IFWB 1Z5SB 2BGFA 3N30A 3DBLI 4BOSC 4B9KA 2REXA 1GNUA 2FAZA 2CHWA 2JUOA 2KOXA 1F9JA 3QK0A 2ZVOA 3CSFA 4KV2A 2UWQA 2MRPA 4MGZE 1A5RA 2MBOA 1V6EA 2LJ5A 2J7QB 5LXHA 1V80A 3X23A 1RRBA 1WFYA 1WX7A 1Y8RC 3SHQA 4ANVA 1BT0A 1E90A 2C7NB 3RULA 2L05A 4K1RB 5D94A 2MCNB 4GB9A 5GMVA 3OLMD 4ASWC 1GG3A 3VVWB 2LASA 4TQ0A 2GBMA 4XC2A 4ANUA 4AOFA 1J8CA 4M0WB 3DVGX 1S3SG 1IYFA 3L17A 1YJ1A 2K1FA 3JYUA 3SU8X 3R66C 2DZMA 4NQLB 3ZUNA 2CHXA 2KDFB 1JRUA 3TIXA 2RGFA 2C7MB 2ZEQA 4PS8A 3M62B 2K8CA 2PEAA 3PRPB 4ZDVA 4DXAB 2NPTA 2O2VB 2DX5B 4EKUA 2DENB 4EZKA 5JHBA 3HM3A 4BBNF 3DDCB 4WQOB 5D2MB 5CX3A 1WX9A 4WJPA 5IA7A 1X1MA 4HWIB 1S1QB 2FNJB 3NZSA 4NAWB 2IZVB 2V3SA 2FCMA 2RPQA 2YLMA 2KMAA 3RD2A 3WALA 4EZLA 2ZVNA 4P7IA 4BFRA 4NAWA 4KIKA 1LM8B 3PREA 1WGRA 4WWPA 3KVFB 4GIVA 4M8NA 5AZHA 1EO6A 1KM7A 2KTRA 2GBKA 3QCAA 4GDKB 4GSWA 2M1MA 4II3B 1RLFA 1OEYA 2A4ZA 2N1WA 3AU5A 2IBIB 3D32A 3KUCB 4G0NB 2FCSA 2BPSA 4GDLA 4PYUA 2HTHA 1VD2A 1WM2A 4GDKA 5E6PA 1V49A 3RYTA 3TCAA 4KDIC 4XZ4A 1WMHA 4FBJB 4BVUC 4E74A 1E8ZA 4HPMB 4JGHB 4LDTB 5LLIA 3S2AA 3ZDTA 3VAWA 4MH0E 3HK0A 2KFKB 4F1SA 1EF1A 5KHQA 3MHSD 5AEKB 2KQSA 4FHJA 1WYWB 3KW5B 3UIOB 3C0RB 2G4DB 1WR6E 4M8MA 4OVVA 3V6CB 1WE7A 2KK8A 1Z2MA 3H6NA 4LDTD 1XT9B 3K9OB 4F7ZA 3QIJA 3I3TB 4KZCA 4FA6A 4DHJB 1OQYA 2NBVB 1WJ6A 2KLGA 5C23A 2MBQA 2MX2A 3B0AA 4KDLB 1WXVA 2CS4A 5E6NA 1UZXB 3VFKA 1KLVA 1LQBA 4FJYA 4HDOA 2IYDB 3APDA 4TKNA 3PRMB 1V2YA 3KH0A 5HKHA 2AL6A 3ZTDA 5EDSA 3V62A 2PJHA 1V5TA 2CKHB 2GBRA 5BO4B 4A20A 4IWQA 2KN5A 2DYOA 4WWNA 2DAJA 2KFJA 4KZ0A 3U7DA 3OJ4B 1WX8A 2GOWA 3ZW3A 2WX1A 4KSKC 2BWES 1WGYA 3L0WB 4MDKE 4MJSA 2KKCA 2O6VA 2KZRA 3GOEA 1MG8A 2WWZA 4K81A 2K39A 2O6VD 3DOWA 3IG3A 2R2OA 4K7WA 2D3GA 2DYBA 4EUTA 4FLHA 4BOZB 4HVBA 2RSUA 4JQWC 2L8JA 2N9XA 4PYZA 3QX1A 2KJHB 3SDLC 3Q3FA 4MGIE 2MA9B 2PE9A 1UGMA 4JLCA 2KWCA 3IBEA 3H7SA 1WGGA 2G45B 3PLUA 2D2QA 2EKEC 3H1UA 3JW0X 4FULA 3DVNU 5FR6A 1UH6A 2KNBA 4FHKA 4K7SA 5AZGA 2MLBA 1M94A 3DPDA 3NOBA 4LJOB 5G55A 1H8CA 5J17A 3NHEB 2DZIA 2IY0B 4W9HA 3VH4B 2AWTA 3HIZA 2JF5A 3EHVA 2KLCA 1XQQA 2KJ6A 4DDGD 2J0KA 4G3XB 1UBQA 2NPTB 3RZFA 3A9JA 3VDZA 2AL3A 2XBBC 3P2BA 2V4LA 1J0GA 4F8CB 1HE8A 3QWZB 4AJYB 5JHAA 2M17A 3QAQA 3EC8A 2JWZA 1CMXB 2G4SA 4W9CA 5G2NA 5E6OA 4GGQA 3UIPB 4J6IA 1WIAA 4EEWA 3R3MA 3PRZA 4E71A 2JZ3B 3ZKJC 3TJPA 1L7YA 2KD0A 3ML8A 2LVPA 3DVGY 3ZRFA 1Q0WB 3A33B 4DWFA 1OGWA 1YQBA 3ZVVA 2KHWB 3VHTC 4B95A 2Z0DB 3TMPB 2LRUA 4KIKB 2K6DB 1ZW7A 1P98A 1C3TA 3KUZA 2LRWA 5JH5C 2ZNVB 3PPAA 2I1JA 3PZDA 3ZNID 1E8YA 2NBUA 2MQJA 5DPWA 4CHKA 4MSMB 2KTRB 1PQSA 2LGXA 3CF6E 4IWPA 2KDEB 1T0YA 4GDLB 2KDBA 2B3AA 3HHMA 4W9KA 2LZ6A 4XX5A 3AULA 2HD5B 2RR9A 3AXCA 3OAWA 4JL9A 2YVCA 5LXIB 3PSEB 4TQ1A 2JY6A 2N9PC 3NY5A 4IUMB 1WMHB 3Q3JA 3PT2B 2FUHB 2C9WB 2MW5A 4PS7A 4BKGA 1E5WA 2ZCBA 2EMTA 3RCZA 1FXTB 2XK5A 3L16A 2DYMA 2C7HA 1WZ3A 2GMIC 1G6JA 1IPGA 1P0RA 1UD7A 1V5OA 4E3CA 3DBHI 2KANA 3L54A 4OVUA 3AU4A 3IVFA 4FN2A 3JVZX 4ZYNA 3PTFC 3KYCD 5DCNA 3N3KB 3LJ3A 2LD9A 2OJRA 3ONSA 1YD8U 1OTRB 1NDDA 3VXWA 1I42A 3U8ZA 4EOYA 3VUXA 1SGHA 2JRIB 3DBSA 3VUWA 3ZTCA 2W9NA 2BYEA 2GBNA 2J0JA 2PE6B 1EUVB 3L10B 5C1ZA 2PPHA 1WI0A 2L76A 3OJ3A 3WA0A 2L00B 2Y5BB 3APCA 5IAAC 3PHXB 2M0XA 3QHTA 2IO3B 1IP9A 4FADA 3PVLA 2QHOA 3DCGA 4PS3A 2JZZA 2LXAA 4MGYE 3LDZE 4ANXA 4ZRKA 4YL8A 3TL5A 2ZCCA 2L0TA 3NZUA 4I6PA 3V6EB 1KOTA 2JPHA 3A4SC 1YX5B 2KWVB 3VTWA 4AJWA 1E8WA 4EZJA 2OOBB 3QC8B 1WE6A 2KXJA 4MJSB 2O6VB 3VH3B 1VCBA 2N4FA 5TR5A 1WZ0A 3GZNI 3V60A 1GJZA 1WXMA 4MELA 2L7RA 5D7GA 4W9FA 4I6NB 1Q5WB 3A1QA 4DK5A 3JSVA 5KHOA 4DBGA 2CU1A 3UQAA 1L2NA 3H9DA 4ANWA 1E7UA 3VTVA 1P3QU 3ENEA 3EFUA 3BINA 3H7PA 3IHPC 3B08A 2ZNVC 3ALBA 2MBBB 3QARA 2WDTB 1R4MI 2KMCA 2VRRB 3AI5A 4GOCA 4IM0A 4ICVA 3R7QA 3ZIMA 1NBFC 2V1YA 4KVGB 3UGBB 2ZPNA 1NI2A 2M8SA 2D10A 2DZKA 3W1SC 1QZEA 4IW0A 4BKSA 2AEHA 2BWFA 2KX0A 3X0WA 2MSED 1ISNA 3HM6X 4GXBA 1V9JA 2CR5A 2MP2A 2R2QA 2FCNA 2BKRB 4AWJA 2IO2B 3CSTA 4ZRIA 4BKSD 5JZEB 2WYQA 3A9JB 3NS8A 1TGZB 2DHZA 3VUYA 3ZRCA 3A9KA 2LGYA 3M95A 3DQVA 1V86A 1ZKHA 2LVQA 3QA8A 4LCDE 3RT3B 2UYZB 4A3PA 4EFOA 5CTRC 5D6JB 4W9LA 2D11A 3B1LX 1WJUA 2IY1B 4LJPB 3KYDD 3DBRI 2A5UA 3VTUA 2MWSB 4RMAA 3PHWB 2BKFA 2KVRA 2ZPYA 3W1SA 2KWUB 3WIMA 3V61A 2DAFA 4HCNB 4WJOA 4NY0A 2N1VA 3QJZA 3ECIA 1P9DU 4WAAA 2ZZPB 1U4AA 4WWOA 3APFA 4RM9A 3SD5A 1KJTA 2KX3A 3T8MA 2N7DA 1C1YB 2FIFA 2N7EA 2G3QB 4X57B 2DZJA 3PV1A 2ASQA 1WY8A 3VQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8B A;  4W9J A;  2K25 A;  3MTN B;  4HCP B;  1WR1 A;  4RM8 A;  5DPR A;  3ZO5 B;  5J18 A;  1WJN A;  1SIF A;  2JRH A;  2KTF A;  2J0M A;  1WXA A;  4GU2 A;  4MGK E;  2XEW A;  2HJ8 A;  2JT4 B;  2K6Q A;  3M3J A;  3ZNZ B;  2NS5 A;  3ZDM C;  1WH3 A;  4HXD A;  2LXC A;  3BY4 B;  2LGD A;  2O2V A;  4WJN A;  4CO7 A;  2LUE A;  4BKT A;  2KO3 A;  2NBW B;  4K7U A;  2KQ7 A;  4W9G A;  4W9D A;  4AP4 C;  2XK5 B;  2ZJD A;  4TV3 A;  2KDI A;  4ZRJ A;  4GN1 A;  1EF5 A;  3A4R A;  1GUA B;  4A3O A;  3ZLZ A;  3ZNH B;  2Z59 B;  2BYF A;  3WAO A;  4FJZ A;  2RD0 A;  2KC2 A;  2JVC A;  2L3Z A;  1TZ1 A;  4WJQ A;  3MJW A;  3PLV A;  1RFA A;  1J19 A;  1UEL A;  2KC1 A;  3PGE A;  2IO1 B;  4CYE A;  2GBJ A;  3RUI B;  1YIW A;  3U30 A;  1WM3 A;  1LFD A;  2KJR A;  4G11 A;  4I6L B;  4IC7 B;  3UQB A;  2LI5 A;  3WAM A;  1K8R B;  2IO0 B;  1R4N I;  2Z0E B;  5J2R A;  3CMM B;  1WF9 A;  3K9P B;  1E7V A;  4NQK E;  2C5L C;  1TBE A;  1H4R A;  2C60 A;  2WX0 A;  1UBI A;  4HPL B;  5DPS A;  4B6W A;  3TBL D;  3UF8 A;  2L0F A;  2FID A;  2AYO B;  4HK2 A;  3PS6 A;  2JXX A;  1WRD B;  5DPT A;  4IM2 A;  3ML9 A;  1TTN A;  1V81 A;  1P1A A;  1SE9 A;  1WGH A;  2N9E B;  3T9L A;  1GC6 A;  3WAN A;  2NCN A;  4DHZ E;  4IWO A;  2LVO A;  2I1K A;  1XD3 B;  2M4N A;  4NPN A;  2KFK A;  3A1Q B;  4NJ6 A;  1Q1O A;  2CHZ A;  3JSV B;  4GMV A;  4W9I A;  3W1Y A;  1WJ4 A;  4URK A;  3O65 B;  1I35 A;  4DDI D;  3RZW C;  4DHZ B;  2FCQ A;  3L13 A;  4G50 A;  2NVU I;  2D07 B;  3H7P B;  4FJV B;  3WAP A;  1D3Z A;  4TUU A;  1GC7 A;  5AZF A;  4BBN C;  4JIO U;  1AAR A;  5L95 C;  2LWP A;  2EMS A;  3N32 A;  2MBH A;  4NJ7 A;  4KSL C;  1WGD A;  3UIN B;  4DHJ D;  4W9E A;  3ZNG C;  3M63 B;  1RAX A;  1WXS A;  2K8H A;  4IM3 A;  5CHV C;  5L83 A;  3DVN V;  1ZGU B;  4N9F 4;  2MP2 B;  4HJK A;  4HDQ A;  4AUQ C;  1OEY J;  4NNJ B;  2NR2 A;  3L08 A;  2BYV E;  1LXD A;  5CHW A;  4MSQ B;  1YX6 B;  2BF8 B;  2MBE A;  5CHF A;  3EEC A;  1E8X A;  2HE7 A;  3A9K B;  4HLE A;  4MEM A;  4IG7 B;  4ICU A;  4II2 B;  3QQ8 B;  3KUD B;  4MM3 A;  3R7R A;  3IFW B;  1Z5S B;  2BGF A;  3N30 A;  3DBL I;  4BOS C;  4B9K A;  2REX A;  1GNU A;  2FAZ A;  2CHW A;  2JUO A;  2KOX A;  1F9J A;  3QK0 A;  2ZVO A;  3CSF A;  4KV2 A;  2UWQ A;  2MRP A;  4MGZ E;  1A5R A;  2MBO A;  1V6E A;  2LJ5 A;  2J7Q B;  5LXH A;  1V80 A;  3X23 A;  1RRB A;  1WFY A;  1WX7 A;  1Y8R C;  3SHQ A;  4ANV A;  1BT0 A;  1E90 A;  2C7N B;  3RUL A;  2L05 A;  4K1R B;  5D94 A;  2MCN B;  4GB9 A;  5GMV A;  3OLM D;  4ASW C;  1GG3 A;  3VVW B;  2LAS A;  4TQ0 A;  2GBM A;  4XC2 A;  4ANU A;  4AOF A;  1J8C A;  4M0W B;  3DVG X;  1S3S G;  1IYF A;  3L17 A;  1YJ1 A;  2K1F A;  3JYU A;  3SU8 X;  3R66 C;  2DZM A;  4NQL B;  3ZUN A;  2CHX A;  2KDF B;  1JRU A;  3TIX A;  2RGF A;  2C7M B;  2ZEQ A;  4PS8 A;  3M62 B;  2K8C A;  2PEA A;  3PRP B;  4ZDV A;  4DXA B;  2NPT A;  2O2V B;  2DX5 B;  4EKU A;  2DEN B;  4EZK A;  5JHB A;  3HM3 A;  4BBN F;  3DDC B;  4WQO B;  5D2M B;  5CX3 A;  1WX9 A;  4WJP A;  5IA7 A;  1X1M A;  4HWI B;  1S1Q B;  2FNJ B;  3NZS A;  4NAW B;  2IZV B;  2V3S A;  2FCM A;  2RPQ A;  2YLM A;  2KMA A;  3RD2 A;  3WAL A;  4EZL A;  2ZVN A;  4P7I A;  4BFR A;  4NAW A;  4KIK A;  1LM8 B;  3PRE A;  1WGR A;  4WWP A;  3KVF B;  4GIV A;  4M8N A;  5AZH A;  1EO6 A;  1KM7 A;  2KTR A;  2GBK A;  3QCA A;  4GDK B;  4GSW A;  2M1M A;  4II3 B;  1RLF A;  1OEY A;  2A4Z A;  2N1W A;  3AU5 A;  2IBI B;  3D32 A;  3KUC B;  4G0N B;  2FCS A;  2BPS A;  4GDL A;  4PYU A;  2HTH A;  1VD2 A;  1WM2 A;  4GDK A;  5E6P A;  1V49 A;  3RYT A;  3TCA A;  4KDI C;  4XZ4 A;  1WMH A;  4FBJ B;  4BVU C;  4E74 A;  1E8Z A;  4HPM B;  4JGH B;  4LDT B;  5LLI A;  3S2A A;  3ZDT A;  3VAW A;  4MH0 E;  3HK0 A;  2KFK B;  4F1S A;  1EF1 A;  5KHQ A;  3MHS D;  5AEK B;  2KQS A;  4FHJ A;  1WYW B;  3KW5 B;  3UIO B;  3C0R B;  2G4D B;  1WR6 E;  4M8M A;  4OVV A;  3V6C B;  1WE7 A;  2KK8 A;  1Z2M A;  3H6N A;  4LDT D;  1XT9 B;  3K9O B;  4F7Z A;  3QIJ A;  3I3T B;  4KZC A;  4FA6 A;  4DHJ B;  1OQY A;  2NBV B;  1WJ6 A;  2KLG A;  5C23 A;  2MBQ A;  2MX2 A;  3B0A A;  4KDL B;  1WXV A;  2CS4 A;  5E6N A;  1UZX B;  3VFK A;  1KLV A;  1LQB A;  4FJY A;  4HDO A;  2IYD B;  3APD A;  4TKN A;  3PRM B;  1V2Y A;  3KH0 A;  5HKH A;  2AL6 A;  3ZTD A;  5EDS A;  3V62 A;  2PJH A;  1V5T A;  2CKH B;  2GBR A;  5BO4 B;  4A20 A;  4IWQ A;  2KN5 A;  2DYO A;  4WWN A;  2DAJ A;  2KFJ A;  4KZ0 A;  3U7D A;  3OJ4 B;  1WX8 A;  2GOW A;  3ZW3 A;  2WX1 A;  4KSK C;  2BWE S;  1WGY A;  3L0W B;  4MDK E;  4MJS A;  2KKC A;  2O6V A;  2KZR A;  3GOE A;  1MG8 A;  2WWZ A;  4K81 A;  2K39 A;  2O6V D;  3DOW A;  3IG3 A;  2R2O A;  4K7W A;  2D3G A;  2DYB A;  4EUT A;  4FLH A;  4BOZ B;  4HVB A;  2RSU A;  4JQW C;  2L8J A;  2N9X A;  4PYZ A;  3QX1 A;  2KJH B;  3SDL C;  3Q3F A;  4MGI E;  2MA9 B;  2PE9 A;  1UGM A;  4JLC A;  2KWC A;  3IBE A;  3H7S A;  1WGG A;  2G45 B;  3PLU A;  2D2Q A;  2EKE C;  3H1U A;  3JW0 X;  4FUL A;  3DVN U;  5FR6 A;  1UH6 A;  2KNB A;  4FHK A;  4K7S A;  5AZG A;  2MLB A;  1M94 A;  3DPD A;  3NOB A;  4LJO B;  5G55 A;  1H8C A;  5J17 A;  3NHE B;  2DZI A;  2IY0 B;  4W9H A;  3VH4 B;  2AWT A;  3HIZ A;  2JF5 A;  3EHV A;  2KLC A;  1XQQ A;  2KJ6 A;  4DDG D;  2J0K A;  4G3X B;  1UBQ A;  2NPT B;  3RZF A;  3A9J A;  3VDZ A;  2AL3 A;  2XBB C;  3P2B A;  2V4L A;  1J0G A;  4F8C B;  1HE8 A;  3QWZ B;  4AJY B;  5JHA A;  2M17 A;  3QAQ A;  3EC8 A;  2JWZ A;  1CMX B;  2G4S A;  4W9C A;  5G2N A;  5E6O A;  4GGQ A;  3UIP B;  4J6I A;  1WIA A;  4EEW A;  3R3M A;  3PRZ A;  4E71 A;  2JZ3 B;  3ZKJ C;  3TJP A;  1L7Y A;  2KD0 A;  3ML8 A;  2LVP A;  3DVG Y;  3ZRF A;  1Q0W B;  3A33 B;  4DWF A;  1OGW A;  1YQB A;  3ZVV A;  2KHW B;  3VHT C;  4B95 A;  2Z0D B;  3TMP B;  2LRU A;  4KIK B;  2K6D B;  1ZW7 A;  1P98 A;  1C3T A;  3KUZ A;  2LRW A;  5JH5 C;  2ZNV B;  3PPA A;  2I1J A;  3PZD A;  3ZNI D;  1E8Y A;  2NBU A;  2MQJ A;  5DPW A;  4CHK A;  4MSM B;  2KTR B;  1PQS A;  2LGX A;  3CF6 E;  4IWP A;  2KDE B;  1T0Y A;  4GDL B;  2KDB A;  2B3A A;  3HHM A;  4W9K A;  2LZ6 A;  4XX5 A;  3AUL A;  2HD5 B;  2RR9 A;  3AXC A;  3OAW A;  4JL9 A;  2YVC A;  5LXI B;  3PSE B;  4TQ1 A;  2JY6 A;  2N9P C;  3NY5 A;  4IUM B;  1WMH B;  3Q3J A;  3PT2 B;  2FUH B;  2C9W B;  2MW5 A;  4PS7 A;  4BKG A;  1E5W A;  2ZCB A;  2EMT A;  3RCZ A;  1FXT B;  2XK5 A;  3L16 A;  2DYM A;  2C7H A;  1WZ3 A;  2GMI C;  1G6J A;  1IPG A;  1P0R A;  1UD7 A;  1V5O A;  4E3C A;  3DBH I;  2KAN A;  3L54 A;  4OVU A;  3AU4 A;  3IVF A;  4FN2 A;  3JVZ X;  4ZYN A;  3PTF C;  3KYC D;  5DCN A;  3N3K B;  3LJ3 A;  2LD9 A;  2OJR A;  3ONS A;  1YD8 U;  1OTR B;  1NDD A;  3VXW A;  1I42 A;  3U8Z A;  4EOY A;  3VUX A;  1SGH A;  2JRI B;  3DBS A;  3VUW A;  3ZTC A;  2W9N A;  2BYE A;  2GBN A;  2J0J A;  2PE6 B;  1EUV B;  3L10 B;  5C1Z A;  2PPH A;  1WI0 A;  2L76 A;  3OJ3 A;  3WA0 A;  2L00 B;  2Y5B B;  3APC A;  5IAA C;  3PHX B;  2M0X A;  3QHT A;  2IO3 B;  1IP9 A;  4FAD A;  3PVL A;  2QHO A;  3DCG A;  4PS3 A;  2JZZ A;  2LXA A;  4MGY E;  3LDZ E;  4ANX A;  4ZRK A;  4YL8 A;  3TL5 A;  2ZCC A;  2L0T A;  3NZU A;  4I6P A;  3V6E B;  1KOT A;  2JPH A;  3A4S C;  1YX5 B;  2KWV B;  3VTW A;  4AJW A;  1E8W A;  4EZJ A;  2OOB B;  3QC8 B;  1WE6 A;  2KXJ A;  4MJS B;  2O6V B;  3VH3 B;  1VCB A;  2N4F A;  5TR5 A;  1WZ0 A;  3GZN I;  3V60 A;  1GJZ A;  1WXM A;  4MEL A;  2L7R A;  5D7G A;  4W9F A;  4I6N B;  1Q5W B;  3A1Q A;  4DK5 A;  3JSV A;  5KHO A;  4DBG A;  2CU1 A;  3UQA A;  1L2N A;  3H9D A;  4ANW A;  1E7U A;  3VTV A;  1P3Q U;  3ENE A;  3EFU A;  3BIN A;  3H7P A;  3IHP C;  3B08 A;  2ZNV C;  3ALB A;  2MBB B;  3QAR A;  2WDT B;  1R4M I;  2KMC A;  2VRR B;  3AI5 A;  4GOC A;  4IM0 A;  4ICV A;  3R7Q A;  3ZIM A;  1NBF C;  2V1Y A;  4KVG B;  3UGB B;  2ZPN A;  1NI2 A;  2M8S A;  2D10 A;  2DZK A;  3W1S C;  1QZE A;  4IW0 A;  4BKS A;  2AEH A;  2BWF A;  2KX0 A;  3X0W A;  2MSE D;  1ISN A;  3HM6 X;  4GXB A;  1V9J A;  2CR5 A;  2MP2 A;  2R2Q A;  2FCN A;  2BKR B;  4AWJ A;  2IO2 B;  3CST A;  4ZRI A;  4BKS D;  5JZE B;  2WYQ A;  3A9J B;  3NS8 A;  1TGZ B;  2DHZ A;  3VUY A;  3ZRC A;  3A9K A;  2LGY A;  3M95 A;  3DQV A;  1V86 A;  1ZKH A;  2LVQ A;  3QA8 A;  4LCD E;  3RT3 B;  2UYZ B;  4A3P A;  4EFO A;  5CTR C;  5D6J B;  4W9L A;  2D11 A;  3B1L X;  1WJU A;  2IY1 B;  4LJP B;  3KYD D;  3DBR I;  2A5U A;  3VTU A;  2MWS B;  4RMA A;  3PHW B;  2BKF A;  2KVR A;  2ZPY A;  3W1S A;  2KWU B;  3WIM A;  3V61 A;  2DAF A;  4HCN B;  4WJO A;  4NY0 A;  2N1V A;  3QJZ A;  3ECI A;  1P9D U;  4WAA A;  2ZZP B;  1U4A A;  4WWO A;  3APF A;  4RM9 A;  3SD5 A;  1KJT A;  2KX3 A;  3T8M A;  2N7D A;  1C1Y B;  2FIF A;  2N7E A;  2G3Q B;  4X57 B;  2DZJ A;  3PV1 A;  2ASQ A;  1WY8 A;  3VQI A; 
#chains in the Genus database with same CATH topology
 4WWM A;  4W9J A;  2K25 A;  3ZO5 B;  2PW9 A;  2KTF A;  4LLG M;  2K6Q A;  2DLB A;  4IDI A;  2NS5 A;  3MC8 A;  4HXD A;  2EEL A;  4CO7 A;  4BKT A;  2KO3 A;  2KQ7 A;  4W9G A;  1LGR A;  2MH7 A;  4TV3 A;  3BWU D;  3A4R A;  3UI3 A;  4YTM B;  2KC2 A;  2DBY A;  2K9X A;  4WJQ A;  3MJW A;  3PLV A;  1UEL A;  1J19 A;  4CYE A;  1YIW A;  1AW7 A;  3GS2 A;  4XE0 A;  4G11 A;  2WLB A;  4I6L B;  4BZA A;  2IO0 B;  1IUE A;  3K9P B;  1XXG A;  2C5L C;  1H4R A;  4HPL B;  3DBL B;  3BYY B;  2AYO B;  4HK2 A;  4RGM A;  2DWQ A;  1P1A A;  2TSS A;  1WGH A;  3AE6 B;  3T9L A;  4ZYS A;  3WAN A;  2NCN A;  2LVO A;  3MC0 B;  2KFK A;  4GMV A;  4CQN A;  4OZA A;  1JWS D;  5EE9 A;  3Q8F A;  4BBN C;  1AAR A;  2LWP A;  2EMS A;  3KWL A;  2MBH A;  2H88 B;  4W9E A;  3T3O A;  3BVG A;  4K3B A;  4HJK A;  4AUQ C;  5FKA C;  5C3J B;  2BF8 B;  2MBE A;  5CHF A;  1E8X A;  2QJL A;  3AN1 A;  4MEM A;  4IG7 B;  4ICU A;  3QQ8 B;  2IGD A;  2BGF A;  3N30 A;  2JXT A;  3DBL I;  3W2D A;  2WXO A;  2SAK A;  3CSF A;  2V0G A;  4KV2 A;  2UWQ A;  1JQ4 A;  1NYR A;  2LJ5 A;  2JU6 X;  1V80 A;  3X23 A;  1WFY A;  2Y5P A;  1TT5 B;  3RUL A;  2L05 A;  1XLO A;  4GB9 A;  1GG3 A;  3N1X C;  4XC2 A;  5EE3 A;  2N0S B;  3SU8 X;  4NQL B;  2CHX A;  2KDF B;  1YQ4 B;  3M62 B;  2PEA A;  4EKU A;  2M56 B;  2DEN B;  1FRR A;  1DOY A;  1ZP0 B;  3DDC B;  5MPO A;  3NVZ A;  5IA7 A;  4HWI B;  2MEK A;  3NZS A;  1JWU D;  4K3C A;  1QF6 A;  2NTS A;  1STE A;  4P7I A;  1ENF A;  5EE1 A;  1SEB D;  1LM8 B;  2L52 A;  3KQ4 A;  2N9K A;  5AZH A;  4IOI E;  2K5P A;  1KM7 A;  2WXI A;  2W82 A;  1FCC C;  2N1W A;  1OEY A;  4GDL A;  2IBI B;  3D32 A;  4G0N B;  2HTH A;  3RYT A;  4KDI C;  4WAF A;  1YN3 A;  1F77 A;  4JGH B;  3ZDT A;  4MH0 E;  2KFK B;  4F1S A;  3NJT A;  1CQV A;  5KHQ A;  1SIJ A;  4KGT A;  4FHJ A;  3UIO B;  3RNF C;  3V6C B;  1J7C A;  2G9H D;  4FA6 A;  3QIJ A;  4DHJ B;  2NBV B;  3DWM A;  1T0R C;  5C23 A;  3B0A A;  4KDL B;  5E6N A;  4L23 A;  4TKN A;  3APD A;  2VZK B;  3R8B A;  1V2Y A;  3BVZ A;  3ZTD A;  3V62 A;  1BUI C;  1HXY D;  4A20 A;  2KMM A;  2KFJ A;  4KZ0 A;  1FCL A;  3U7D A;  2VZK D;  4M00 A;  3L0W B;  4MDK E;  2O6V A;  3GOE A;  3W5V B;  2WWZ A;  2BQQ A;  3DOW A;  1JRO A;  4FLH A;  2B76 B;  3QX1 A;  3Q3N C;  5IP4 D;  1UGM A;  2KWC A;  1YOV B;  1KLG D;  4JE3 B;  3JW0 X;  4FUL A;  3DVN U;  2KNB A;  1D5X C;  2MLB A;  4LJO B;  5H8Y E;  4DQO C;  1T6B X;  3VH4 B;  1WGK A;  3T3N A;  2D3B A;  2ICI A;  3A9J A;  3VDZ A;  4KKJ A;  4AJY B;  5JHA A;  3QAQ A;  3EC8 A;  2DNF A;  4GGQ A;  1WIA A;  2WDV B;  3TJP A;  1FNV A;  4RGO S;  1SXT A;  1WSP A;  3DVG Y;  1Q0W B;  4DWF A;  3MP9 A;  1I4H A;  2BW2 A;  3GB1 A;  2LRW A;  1SBB B;  4S0R A;  5D3I B;  1GB1 A;  2I1J A;  2NBU A;  5DPW A;  1PQS A;  2LGX A;  4JPS A;  2CJO A;  3GZN B;  1XLN A;  4GDL B;  4IKG A;  2LZ6 A;  1D5Z C;  2YVC A;  5LXI B;  2JY6 A;  4IUM B;  1FNW A;  2C9W B;  1QOB A;  5BYS A;  2K22 A;  4A90 A;  2XK5 A;  1SE4 A;  2GMI C;  1G6J A;  2J4X A;  2KAN A;  3L54 A;  1VZ8 A;  1N63 A;  2MJD A;  3KYC D;  5DCN A;  2AQ2 B;  3N3K B;  3LJ3 A;  2IGG A;  3ONS A;  1OTR B;  2PIA A;  3U8Z A;  3VUX A;  3AH7 A;  3ZTC A;  3VUW A;  1N6Z A;  2W9N A;  1AYF A;  1TY0 A;  2J0J A;  1EUV B;  5IO9 A;  2PPH A;  3APC A;  4ITK A;  2JZZ A;  2LXA A;  4YL8 A;  2L0T A;  1KOT A;  4HJG E;  2OOB B;  3QC8 B;  1WE6 A;  2KXJ A;  4TSS A;  2O6V B;  1KF6 B;  1VCB A;  2N4F A;  2VH2 A;  5TR5 A;  3GZN I;  3RNE C;  4W9F A;  2QIE B;  2QSD A;  3A1Q A;  3CWI A;  1YJJ A;  3H9D A;  4NZL B;  2J52 A;  4OW0 A;  3VTV A;  3AEA B;  3H7P A;  1QKZ A;  4GOC A;  3P1M A;  1NI2 A;  2M8S A;  1B9R A;  1QZE A;  4IW0 A;  2PLP A;  2BWF A;  2WNM A;  3NRZ A;  1V9J A;  3EA6 A;  4HRO A;  3A9J B;  3NS8 A;  1I4Q A;  3VUY A;  3A9K A;  3DQV A;  2LVQ A;  1FM0 D;  5CTR C;  5D6J B;  3PO0 A;  4ARC A;  1R4N B;  1WJU A;  3DBR I;  2K0P A;  3AB5 A;  2V4I B;  1Q10 A;  3PHW B;  2KWU B;  2AQ3 B;  4NY0 A;  1TS4 A;  3ECI A;  1TKY A;  4WWO A;  3APF A;  3T8M A;  2KX3 A;  1V8C A;  3KLS X;  1UWM A;  2G3Q B;  3AEB B;  2MRP A;  2K8B A;  2ONQ A;  5DPR A;  3MTN B;  4RM8 A;  1WR1 A;  5J18 A;  2JRH A;  1SIF A;  2J0M A;  3L4P A;  2W55 A;  1PGA A;  4HKQ A;  1WH3 A;  4C7Y A;  2LXC A;  1HTO A;  3BY4 B;  2O2V A;  4FXC A;  4K7U A;  4W9D A;  2XK5 B;  2ZJD A;  1GUA B;  2KAJ A;  4RGN A;  2Z59 B;  4FJZ A;  4C00 A;  2L3Z A;  1TZ1 A;  1L4D B;  5H92 C;  1RFA A;  1TS5 A;  2KC1 A;  3ZQ4 A;  3RUI B;  1LFD A;  1WYG A;  1ZUD 2;  2KJR A;  2LI5 A;  1R4N I;  1PDX A;  1CJE A;  1WF9 A;  1E7V A;  1YNT E;  1SE2 A;  4ACF A;  4O1N A;  1D6E C;  2FID A;  3PS6 A;  2JXX A;  3RMK C;  5G5H A;  4XGA B;  1TTN A;  1GC6 A;  4DHZ E;  2OHF A;  4GLS C;  2BVC A;  1XD3 B;  1FNU A;  4W9I A;  1AWD A;  3A1Q B;  4HEA 1;  4NJ6 A;  3W1Y A;  2WXM A;  1L0Y B;  1WJ4 A;  2WDR B;  3LYY A;  4OHJ A;  4QAY A;  4DDI D;  3RZW C;  4YWG G;  1K51 A;  3L13 A;  2D07 B;  3H7P B;  1D3Z A;  3GP7 A;  4L2Y A;  5HG2 A;  2E3T A;  3P4P B;  4LK0 M;  4KSL C;  2QC8 A;  3UIN B;  2GLS A;  2Q5W D;  1I7H A;  2K8H A;  1C4C A;  1P7E A;  3DVN V;  3V05 A;  1ZGU B;  4LNN A;  3EFC A;  4NAM A;  2NR2 A;  4MSQ B;  3P4Q B;  3GE8 C;  1YX6 B;  3A9K B;  4II2 B;  3KUD B;  1MI0 A;  4MM3 A;  3IXS A;  3IFW B;  1FPY A;  2FAZ A;  2BB6 A;  3GE3 C;  2KOX A;  5FK9 C;  2PTL A;  5EE0 A;  1E7P B;  1L0X B;  2NMQ A;  2MBO A;  2J7Q B;  2MJE A;  4NJC A;  5LXH A;  1WX7 A;  3SHQ A;  1BT0 A;  5D94 A;  2MCN B;  3O13 A;  2KAC A;  2SEB D;  3VVW B;  4TQ0 A;  4AOF A;  1J8C A;  1IYF A;  1P7F A;  2DZM A;  2YEP B;  2RGF A;  5I4D A;  2C7M B;  3BK2 A;  2KVZ A;  3PRP B;  2NPT A;  2O2V B;  3W9C B;  3BK1 A;  3AEC B;  2Z8L A;  3HM3 A;  3NG0 A;  4M01 A;  4JWS C;  1HTQ A;  4A9A A;  2YLM A;  1ACC A;  1FRD A;  1I4R A;  2ZVN A;  4BFR A;  3PRE A;  3SR6 A;  4WWP A;  1XLP A;  2GBK A;  1PYW D;  1D5M C;  1UUP A;  4R3D A;  3W1S A;  1PGB A;  4DXF A;  1V49 A;  2BS3 B;  4XZ4 A;  4N59 A;  3LB8 C;  4BVU C;  4E74 A;  1E8Z A;  4LNO A;  4LDT B;  2JX5 A;  3S2A A;  1XLQ A;  3VAW A;  3AE7 B;  3HK0 A;  1ZPS A;  3MHS D;  1VZ6 A;  5AEK B;  2KQS A;  3KW5 B;  3C0R B;  1WR6 E;  1WE7 A;  2KK8 A;  1Z2M A;  3I63 C;  4LDT D;  3Q8A A;  3K9O B;  2GB1 A;  4KZC A;  3HVD A;  1GPX A;  3MHZ A;  3URY A;  1F1H A;  4HDO A;  2IYD B;  2X8X X;  3ZYY X;  1QIL A;  3KH0 A;  5HKH A;  1MJD A;  3AE1 B;  2AL6 A;  2KYW A;  3I57 A;  2GBR A;  5BO4 B;  1ET9 A;  1JCK B;  2DYO A;  2DAJ A;  1VDV A;  1TJE A;  3ZW3 A;  4MJS A;  1WGY A;  4MM3 B;  1MG8 A;  1C76 A;  1ET6 A;  4K81 A;  3IG3 A;  2DYB A;  4BOZ B;  4JQW C;  1I4X A;  1VJK A;  3Q3F A;  2RDB C;  1ZXI A;  2INC C;  4AS1 A;  3PLU A;  3NZ3 A;  3TEX A;  4K7S A;  4YTP B;  2PKO A;  4ZHO A;  1EU4 A;  1GAQ B;  2D5G A;  1C4A A;  5FR3 A;  4W9H A;  3HIZ A;  2JF5 A;  3EHV A;  2J0K A;  2NPT B;  2XBB C;  2V4L A;  4F8C B;  2M17 A;  3ZJT A;  4P1B C;  2JWZ A;  3I9V 1;  1CMX B;  2G4S A;  2N9L A;  2VH1 A;  5G2N A;  1QOA A;  1C9F A;  1D4B A;  3PRZ A;  3ZKJ C;  2KD0 A;  3ML8 A;  3ZRF A;  3TSS A;  3ZVV A;  3VHT C;  2Z0D B;  2K6D B;  1C3T A;  4TMA B;  2ZNV B;  1T3Q A;  3BYT B;  3PZD A;  5IOI A;  1VZ7 A;  3CF6 E;  4IWP A;  4JWU C;  3AE4 B;  1T0Y A;  2B3A A;  4XX5 A;  2HD5 B;  3OAW A;  2WXH A;  3PT2 B;  2MW5 A;  3RCZ A;  2C7H A;  3I5J C;  1IPG A;  1P0R A;  1V5O A;  4E3C A;  4OVU A;  1VRA B;  1BML C;  1ZDX A;  2KDM A;  2LD9 A;  2OJR A;  1CZP A;  3DWG C;  1NDD A;  1I42 A;  1Y56 A;  2WXQ A;  3DBS A;  1EM7 A;  3BII D;  2L1A A;  3L10 B;  3OJ3 A;  3WA0 A;  2L76 A;  2Y5B B;  4WUR A;  5IAA C;  2M0X A;  2LHD A;  4FAD A;  2QHO A;  3LDZ E;  4ANX A;  3TL5 A;  2ZCC A;  4I6P A;  3V6E B;  2JPH A;  2RDH A;  1YX5 B;  4AJW A;  2RMM A;  4MJS B;  1BXT A;  3VH3 B;  4JX1 C;  1M4V A;  1WXM A;  3P42 A;  1UF0 A;  5KHO A;  4DBG A;  1L2N A;  4OZC A;  1UNS A;  1T5X D;  3B08 A;  2BBC A;  4C80 A;  2WDT B;  2KMC A;  2VRR B;  4M02 A;  1HZ5 A;  4ICV A;  1NBF C;  4MT5 A;  3UGB B;  1E6E B;  2D10 A;  1PFD A;  1SB3 C;  1C79 A;  2MSE D;  3HM6 X;  1QLB B;  2R2Q A;  4AWJ A;  3CST A;  1R7S A;  5D3D A;  1ROE A;  2JQR B;  4RFB A;  3ZRC A;  2WGS A;  3RT3 B;  2HTM E;  1TYG B;  2KN4 A;  2IGH A;  3EUB 2;  2LMC A;  2A5U A;  3WIM A;  3DHH C;  3V61 A;  4WJO A;  3QJZ A;  2WP9 B;  4X57 B;  2DZJ A;  3PV1 A;  3WAO A;  4HCP B;  4M0W A;  3AE8 B;  2Y3A A;  3HUI A;  2HJ1 A;  4ZRP A;  2XEW A;  1FEH A;  2HJ8 A;  3M3J A;  3FIL A;  2LGD A;  2LUE A;  2WXG A;  2E6X A;  4ZRJ A;  4C4V A;  3U2S C;  1IGD A;  4A3O A;  2BYF A;  1SJE D;  2JVC A;  4A55 A;  2BT6 A;  3AMZ A;  3PGE A;  3ZXV A;  2IO1 B;  1NYQ A;  1L5P A;  2GBJ A;  3Q3M C;  3DHI C;  4IC7 B;  3UQB A;  3WAM A;  3CIR B;  2Z0E B;  5J2R A;  4NQK E;  1TBE A;  2BS2 B;  3TBL D;  1WWT A;  3EGR A;  5AUK A;  3ML9 A;  1HZ6 A;  1V81 A;  4REZ A;  4S17 A;  1SE9 A;  1TIF A;  2M4N A;  4NPN A;  2CHZ A;  4DHZ B;  4G50 A;  4FJV B;  1F2R I;  4TUU A;  1GC7 A;  2Y5C A;  3Q8C A;  5AZF A;  3PZ7 A;  1LO5 D;  3N32 A;  2BTE A;  3ZNG C;  3PZ8 A;  4WQM A;  3OWE B;  5L83 A;  2V3P A;  4N9F 4;  4NNJ B;  5GXG B;  2BYV E;  5CHW A;  1N5W A;  1L6U A;  2IPK D;  3E9S A;  1J7A A;  3EEC A;  1ZE3 D;  2HE7 A;  4HLE A;  2GRI A;  2BS4 B;  4AQ7 A;  3R7R A;  1MVK A;  1Z5S B;  4BOS C;  1QT9 A;  4ARI A;  1V97 A;  3E56 A;  2JUO A;  5E6J A;  2LGS A;  4MGZ E;  4MAC A;  4LNF A;  5GMV A;  3OLM D;  3J9C A;  1PGX A;  1FO4 A;  3AE9 B;  3DBH B;  4M0W B;  4LNK A;  3L17 A;  1YJ1 A;  2K1F A;  3JYU A;  3Q69 A;  4US8 A;  3R66 C;  3ZUN A;  1JRU A;  3TIX A;  2FBW B;  2ZEQ A;  1RYJ A;  4PS8 A;  3FIL B;  4ZDV A;  2M0A A;  4KGR A;  2I2Y A;  2QEJ C;  4OZB A;  5JHB A;  1NEK B;  4WQO B;  5CX3 A;  1WX9 A;  4MH8 A;  4WJP A;  4C4V B;  1X1M A;  5HFY A;  3TEZ A;  3RNA C;  1S1Q B;  4NAW B;  2IZV B;  2MHJ A;  2V3S A;  2RPQ A;  3WAL A;  1AN8 A;  4M8N A;  4KKI A;  2KTR A;  2HDE A;  4GDK B;  4GSW A;  1K52 A;  4II3 B;  4PYU A;  3KUC B;  2FCS A;  3AEG B;  2JWU A;  2INP E;  1N60 A;  5E6P A;  2AX5 A;  2W3R A;  3TCA A;  4XWW A;  1WMH A;  3MJ5 A;  2WXR A;  4HPM B;  3RI7 C;  4USA A;  5LLI A;  2H89 B;  1N5X A;  1EF1 A;  1I4P A;  3B2F A;  1WYW B;  4OVV A;  4M8M A;  2V9H A;  1TZO A;  3H6N A;  1OQQ A;  1XT9 B;  4F7Z A;  2LEK A;  1WXV A;  3VFK A;  1KLV A;  1LQB A;  4FJY A;  3BZD B;  3PRM B;  2EKI A;  1C4P A;  2G1E A;  2FE8 A;  2PJH A;  5HI1 A;  1V5T A;  2CKH B;  4IWQ A;  4N6E B;  2N7J A;  4WWN A;  3P4S B;  1FD6 A;  1WXQ A;  3OJ4 B;  1WX8 A;  2GOW A;  4KSK C;  2BWE S;  2V3N A;  2KKC A;  1JWB D;  2JYT A;  4KGS A;  1DOX A;  4YXD B;  3TEY A;  1A70 A;  4K7W A;  4EUT A;  2PVO D;  4XDC A;  4EE2 A;  2L8J A;  2QDF A;  4PYZ A;  4MGI E;  4BAX A;  2PE9 A;  5BMI A;  1IGC A;  2NTT A;  1RM6 C;  2D2Q A;  2EKE C;  3H1U A;  3IT4 B;  1UH6 A;  4FHK A;  2RDG A;  5AZG A;  3HVZ A;  3DPD A;  3NOB A;  2LGI A;  3Q6B A;  2DZI A;  2WXN A;  1XQQ A;  3AV8 A;  4RF1 A;  2AL3 A;  1J0G A;  4H2A A;  3QWZ B;  1QOG A;  3AE3 B;  5E6O A;  4J6I A;  4EEW A;  3R3M A;  4E71 A;  1E9M A;  1L7Y A;  1OGW A;  1YQB A;  2LRU A;  1ZW7 A;  3DHG C;  5IN7 A;  3VRB B;  1K50 A;  2GI9 A;  2ON8 A;  2WXP A;  2MQJ A;  1WRI A;  2KTR B;  1HQR D;  2KDE B;  4RNA A;  2KDB A;  3HHM A;  4RF0 A;  2RR9 A;  3AXC A;  1SSN A;  2PMV A;  4JL9 A;  2N9P C;  2WDQ B;  1WMH B;  3Q3J A;  2FUH B;  1MPE A;  4PS7 A;  3R2T A;  3C19 A;  1JWM D;  1E5W A;  1FXT B;  3L16 A;  2DYM A;  1R4M B;  1WZ3 A;  1V1O A;  1XO3 A;  2WQY B;  1YN5 A;  3U52 E;  3IVF A;  2OED A;  5LNK 1;  1YD8 U;  3IT6 B;  4A8X C;  2LUM A;  1HEZ E;  1C77 A;  2PE6 B;  5C1Z A;  1WI0 A;  2L00 B;  3IAS 1;  3PHX B;  3ETR A;  3QHT A;  2IO3 B;  1IP9 A;  3PVL A;  3DCG A;  4J3O D;  4MGY E;  4ZRK A;  3FAH A;  4RH6 A;  5TSS A;  3NZU A;  3RNG C;  3A4S C;  3VTW A;  4EZJ A;  1E8W A;  1SE3 A;  4US9 A;  2CU3 A;  4ZHP A;  2L7R A;  5D7G A;  1Q5W B;  5BYR A;  4DK5 A;  3JSV A;  2CU1 A;  3UQA A;  1E0Z A;  1E7U A;  1YQ3 B;  4KX6 B;  3ENE A;  3B9J A;  3Q3O C;  2ZNV C;  2JZP A;  1YMH E;  1R4M I;  3ZIM A;  2V1Y A;  4KVG B;  3N20 C;  2DZK A;  3W1S C;  3FC4 A;  3X0W A;  4GXB A;  4RCO A;  2MP2 A;  2BKR B;  4BKS D;  4ZRI A;  1TGZ B;  2INN E;  1ZKH A;  3QA8 A;  4A3P A;  2UYZ B;  3KWV A;  4EFO A;  1IBX A;  4W9L A;  1EU3 A;  2D11 A;  5IKC M;  3B1L X;  1V1P A;  4P1C C;  3KYD D;  5C2T B;  1L0V B;  3VTU A;  2ZPY A;  2KVR A;  4A6Q A;  1FFV A;  1YN4 A;  4HCN B;  3TEW A;  1P9D U;  4WAA A;  4ZOH C;  1U4A A;  3WCQ A;  4RM9 A;  1KH0 A;  2N7D A;  2YEP F;  2N7E A;  1WY8 A;  2ZW0 A;  1GOZ A;  1WJN A;  3RFZ B;  1NVI D;  2JYE A;  1WXA A;  4GU2 A;  4MGK E;  4B0M A;  2JT4 B;  3RNC C;  3ZNZ B;  3ZDM C;  4WJN A;  2NBW B;  2WXK A;  4AP4 C;  2KDI A;  4GN1 A;  3ZXR A;  1EF5 A;  3ZLZ A;  3ZNH B;  2RD0 A;  1KRH A;  1QOF A;  3U30 A;  1FXA A;  1WM3 A;  4Q2J A;  4LTU A;  2QIL A;  1FFU A;  3FKY A;  1K8R B;  1MHX A;  3AE5 B;  3CMM B;  4YSZ B;  1T0S C;  2C60 A;  2WX0 A;  2MJ3 A;  1UBI A;  5DPS A;  4B6W A;  3UF8 A;  2L0F A;  1ZDV A;  1WRD B;  5DPT A;  4IM2 A;  1F52 A;  1DYQ A;  2KWD A;  2N9E B;  4IWO A;  2I1K A;  1NEN B;  1Q1O A;  3MFG A;  3JSV B;  4URK A;  3O65 B;  1I35 A;  1EWY C;  2FCQ A;  1RFK A;  2NVU I;  3WAP A;  2WXL A;  2WS3 B;  4JIO U;  1J7B A;  2J42 A;  5L95 C;  3NVY A;  5T8I A;  4NJ7 A;  1WGD A;  2KQ4 X;  4DHJ D;  1YJI A;  3M63 B;  1RAX A;  2LJI A;  4IM3 A;  1WXS A;  1VLB A;  5CHV C;  2ACZ B;  2MP2 B;  1TS2 A;  4HDQ A;  1OEY J;  3U4E G;  3L08 A;  1XEE A;  1LXD A;  3NVW A;  2RPV A;  1XCT L;  1F2R C;  3N9Y C;  3IAM 1;  1IBX B;  3SFE B;  1KLU D;  2D3C A;  1V1P B;  3VR9 B;  4B9K A;  3P63 A;  2REX A;  1GNU A;  2CHW A;  4C56 C;  1F9J A;  3QK0 A;  2ZVO A;  4YSY B;  2LFI A;  2PVG C;  1A5R A;  1V6E A;  3ZJV A;  2AQ1 B;  1RRB A;  2M19 A;  1Y8R C;  2L83 A;  4ANV A;  1E90 A;  2C7N B;  4K1R B;  2IND C;  3B2G A;  4ASW C;  3ZJU A;  2LAS A;  2GBM A;  4ANU A;  4HPP A;  3DVG X;  1S3S G;  1N61 A;  1KTK A;  2JSV X;  4B0E A;  2K8C A;  4DXA B;  2XNA C;  3HRD D;  2DX5 B;  2QCZ A;  1UGJ A;  4EZK A;  4BBN F;  1PUT A;  5D2M B;  1CK1 A;  2FNJ B;  2LHE A;  2FCM A;  2KMA A;  3RD2 A;  4EZL A;  5BYQ A;  4NAW A;  4KIK A;  1WGR A;  4YSX B;  3KVF B;  4GIV A;  3AM9 A;  1EO6 A;  2KT7 A;  3QCA A;  1EWC A;  3TUO A;  4WIP A;  1MFW A;  1ESF A;  2M1M A;  1RLF A;  2A4Z A;  1TKG A;  4EOY A;  3AU5 A;  4DXG A;  2BPS A;  1KFY B;  2WHI A;  1OQR A;  1VD2 A;  1WM2 A;  4GDK A;  4FBJ B;  1RWS A;  1ZOY B;  4PK1 A;  1JRP A;  2I38 A;  2WXJ A;  1FIQ A;  3NUH B;  2WXF A;  2G4D B;  4UDU C;  3I3T B;  3H8H A;  1OQY A;  4N58 A;  1WJ6 A;  2KLG A;  3U7Z A;  2MBQ A;  2MX2 A;  4XDD A;  2CS4 A;  1DGJ A;  1UZX B;  3P4R B;  4YTN B;  3DBR B;  5EDS A;  5AUI A;  2WU2 B;  2KN5 A;  5BMG A;  4XWT A;  2WX1 A;  3VRA B;  2KZR A;  1ZXH A;  3ZGZ A;  4RGT A;  2K39 A;  2O6V D;  2R2O A;  2D3G A;  3SEB A;  3ABV B;  4HVB A;  2RSU A;  3N1Z C;  2W54 A;  2N9X A;  1FMA D;  2BB5 A;  2KJH B;  3SDL C;  3LXF A;  2MA9 B;  4HKZ E;  1L4Z B;  4JLC A;  3IBE A;  3H7S A;  1MG4 A;  1WGG A;  2G45 B;  2K3U A;  1JW9 D;  3Q14 C;  5FR6 A;  2XN9 C;  1L6V A;  5JXV A;  3C8Y A;  1M94 A;  5G55 A;  1H8C A;  5J17 A;  3NHE B;  3RN9 C;  2IY0 B;  2CJN A;  2AWT A;  1TKE A;  2KLC A;  2KJ6 A;  4DDG D;  4G3X B;  1UBQ A;  1SF0 A;  3RZF A;  3P2B A;  1HE8 A;  1HA5 A;  2WU5 B;  4W9C A;  5HHD G;  1XF5 L;  3UIP B;  2JZ3 B;  1B1Z A;  1VR9 A;  4ZRQ A;  2LVP A;  3A33 B;  2KHW B;  4B95 A;  3TMP B;  4KIK B;  1P98 A;  3NS1 A;  3KUZ A;  1XCQ L;  4OVZ A;  3Q8E A;  5JH5 C;  3PPA A;  4C7Z A;  3OG5 A;  1E8Y A;  3MC9 A;  3ZNI D;  4CHK A;  4MSM B;  3RNB C;  1E10 A;  3SFD B;  1TS3 A;  4W9K A;  2J53 A;  3AUL A;  4L1B A;  2R61 A;  3PSE B;  4TQ1 A;  3NY5 A;  1F0Z A;  1FXI A;  3AEE B;  3BVM A;  1JWA D;  4BKG A;  2ZCB A;  2EMT A;  1TY2 A;  2X38 A;  1OFF A;  1UD7 A;  3DBH I;  1GB4 A;  3AU4 A;  4FN2 A;  3JVZ X;  1C78 A;  4ZYN A;  3PTF C;  2W3S A;  1UWX A;  3VXW A;  1SGH A;  2JRI B;  2BYE A;  2GBN A;  1K53 A;  4PS3 A;  1I4G A;  4WH4 A;  2QMT A;  3AE2 B;  2KWV B;  2ZW1 A;  1JAL A;  1WZ0 A;  3V60 A;  1GJZ A;  2FUG 1;  4MEL A;  4XYC A;  3Q2A C;  4I6N B;  4D2K A;  1JML A;  4ANW A;  4P16 A;  1P3Q U;  4YT0 B;  2L32 A;  3EFU A;  3BIN A;  3IHP C;  3ALB A;  2MBB B;  3QAR A;  3AI5 A;  1NI3 A;  2OJW A;  4IM0 A;  3R7Q A;  4HRS A;  1SJH D;  2ZPN A;  5G5G A;  4BKS A;  2AEH A;  2KX0 A;  3Q8B A;  1ISN A;  2CR5 A;  3W5U B;  2FCN A;  2BYT A;  2IO2 B;  5JZE B;  2WYQ A;  1DOI A;  2DHZ A;  1MHH E;  4LNI A;  2LGY A;  3M95 A;  4LCD E;  1V86 A;  3R2I A;  1N62 A;  2IY1 B;  4LJP B;  3NVV A;  1T0Q C;  2D3A A;  2MWS B;  3AED B;  3AEF B;  2BKF A;  4RMA A;  2DAF A;  4PT5 A;  1QQR A;  2N1V A;  3N1Y C;  2IDY A;  5BMH A;  3V3X A;  2ZZP B;  2IJ0 A;  3SD5 A;  1KJT A;  1C1Y B;  2FIF A;  3RPF C;  3VR8 B;  2UU7 A;  4P6V F;  2ASQ A;  3VQI A; 
#chains in the Genus database with same CATH homology
 2K8B A;  4W9J A;  2K25 A;  3MTN B;  4HCP B;  1WR1 A;  4RM8 A;  5DPR A;  3ZO5 B;  5J18 A;  1WJN A;  1SIF A;  2JRH A;  2KTF A;  2J0M A;  1WXA A;  4GU2 A;  4MGK E;  2XEW A;  2HJ8 A;  2JT4 B;  2K6Q A;  3M3J A;  3ZNZ B;  2NS5 A;  3ZDM C;  1WH3 A;  4HXD A;  2LXC A;  3BY4 B;  2LGD A;  2O2V A;  4WJN A;  4CO7 A;  2LUE A;  4BKT A;  2KO3 A;  2NBW B;  4K7U A;  2KQ7 A;  4W9G A;  4W9D A;  4AP4 C;  2XK5 B;  2ZJD A;  4TV3 A;  2KDI A;  4ZRJ A;  4GN1 A;  1EF5 A;  3A4R A;  1GUA B;  4A3O A;  3ZLZ A;  3ZNH B;  2Z59 B;  2BYF A;  3WAO A;  4FJZ A;  2RD0 A;  2KC2 A;  2JVC A;  2L3Z A;  1TZ1 A;  4WJQ A;  3MJW A;  3PLV A;  1RFA A;  1J19 A;  1UEL A;  2KC1 A;  3PGE A;  2IO1 B;  4CYE A;  2GBJ A;  3RUI B;  1YIW A;  3U30 A;  1WM3 A;  1LFD A;  2KJR A;  4G11 A;  4I6L B;  4IC7 B;  3UQB A;  2LI5 A;  3WAM A;  1K8R B;  2IO0 B;  1R4N I;  2Z0E B;  5J2R A;  3CMM B;  1WF9 A;  3K9P B;  1E7V A;  4NQK E;  2C5L C;  1TBE A;  1H4R A;  2C60 A;  2WX0 A;  1UBI A;  4HPL B;  5DPS A;  4B6W A;  3TBL D;  3UF8 A;  2L0F A;  2FID A;  2AYO B;  4HK2 A;  3PS6 A;  2JXX A;  1WRD B;  5DPT A;  4IM2 A;  3ML9 A;  1TTN A;  1V81 A;  1P1A A;  1SE9 A;  1WGH A;  2N9E B;  3T9L A;  1GC6 A;  3WAN A;  2NCN A;  4DHZ E;  4IWO A;  2LVO A;  2I1K A;  1XD3 B;  2M4N A;  4NPN A;  2KFK A;  3A1Q B;  4NJ6 A;  1Q1O A;  2CHZ A;  3JSV B;  4GMV A;  4W9I A;  3W1Y A;  1WJ4 A;  4URK A;  3O65 B;  1I35 A;  4DDI D;  3RZW C;  4DHZ B;  2FCQ A;  3L13 A;  4G50 A;  2NVU I;  2D07 B;  3H7P B;  4FJV B;  3WAP A;  1D3Z A;  4TUU A;  1GC7 A;  5AZF A;  4BBN C;  4JIO U;  1AAR A;  5L95 C;  2LWP A;  2EMS A;  3N32 A;  2MBH A;  4NJ7 A;  4KSL C;  1WGD A;  3UIN B;  4DHJ D;  4W9E A;  3ZNG C;  3M63 B;  1RAX A;  1WXS A;  2K8H A;  4IM3 A;  5CHV C;  5L83 A;  3DVN V;  1ZGU B;  4N9F 4;  2MP2 B;  4HJK A;  4HDQ A;  4AUQ C;  1OEY J;  4NNJ B;  2NR2 A;  3L08 A;  2BYV E;  1LXD A;  5CHW A;  4MSQ B;  1YX6 B;  2BF8 B;  2MBE A;  5CHF A;  3EEC A;  1E8X A;  2HE7 A;  3A9K B;  4HLE A;  4MEM A;  4IG7 B;  4ICU A;  4II2 B;  3QQ8 B;  3KUD B;  4MM3 A;  3R7R A;  3IFW B;  1Z5S B;  2BGF A;  3N30 A;  3DBL I;  4BOS C;  4B9K A;  2REX A;  1GNU A;  2FAZ A;  2CHW A;  2JUO A;  2KOX A;  1F9J A;  3QK0 A;  2ZVO A;  3CSF A;  4KV2 A;  2UWQ A;  2MRP A;  4MGZ E;  1A5R A;  2MBO A;  1V6E A;  2LJ5 A;  2J7Q B;  5LXH A;  1V80 A;  3X23 A;  1RRB A;  1WFY A;  1WX7 A;  1Y8R C;  3SHQ A;  4ANV A;  1BT0 A;  1E90 A;  2C7N B;  3RUL A;  2L05 A;  4K1R B;  5D94 A;  2MCN B;  4GB9 A;  5GMV A;  3OLM D;  4ASW C;  1GG3 A;  3VVW B;  2LAS A;  4TQ0 A;  2GBM A;  4XC2 A;  4ANU A;  4AOF A;  1J8C A;  4M0W B;  3DVG X;  1S3S G;  1IYF A;  3L17 A;  1YJ1 A;  2K1F A;  3JYU A;  3SU8 X;  3R66 C;  2DZM A;  4NQL B;  3ZUN A;  2CHX A;  2KDF B;  1JRU A;  3TIX A;  2RGF A;  2C7M B;  2ZEQ A;  4PS8 A;  3M62 B;  2K8C A;  2PEA A;  3PRP B;  4ZDV A;  4DXA B;  2NPT A;  2O2V B;  2DX5 B;  4EKU A;  2DEN B;  4EZK A;  5JHB A;  3HM3 A;  4BBN F;  3DDC B;  4WQO B;  5D2M B;  5CX3 A;  1WX9 A;  4WJP A;  5IA7 A;  1X1M A;  4HWI B;  1S1Q B;  2FNJ B;  3NZS A;  4NAW B;  2IZV B;  2V3S A;  2FCM A;  2RPQ A;  2YLM A;  2KMA A;  3RD2 A;  3WAL A;  4EZL A;  2ZVN A;  4P7I A;  4BFR A;  4NAW A;  4KIK A;  1LM8 B;  3PRE A;  1WGR A;  4WWP A;  3KVF B;  4GIV A;  4M8N A;  5AZH A;  1EO6 A;  1KM7 A;  2KTR A;  2GBK A;  3QCA A;  4GDK B;  4GSW A;  2M1M A;  4II3 B;  1RLF A;  1OEY A;  2A4Z A;  2N1W A;  3AU5 A;  2IBI B;  3D32 A;  3KUC B;  4G0N B;  2FCS A;  2BPS A;  4GDL A;  4PYU A;  2HTH A;  1VD2 A;  1WM2 A;  4GDK A;  5E6P A;  1V49 A;  3RYT A;  3TCA A;  4KDI C;  4XZ4 A;  1WMH A;  4FBJ B;  4BVU C;  4E74 A;  1E8Z A;  4HPM B;  4JGH B;  4LDT B;  5LLI A;  3S2A A;  3ZDT A;  3VAW A;  4MH0 E;  3HK0 A;  2KFK B;  4F1S A;  1EF1 A;  5KHQ A;  3MHS D;  5AEK B;  2KQS A;  4FHJ A;  1WYW B;  3KW5 B;  3UIO B;  3C0R B;  2G4D B;  1WR6 E;  4M8M A;  4OVV A;  3V6C B;  1WE7 A;  2KK8 A;  1Z2M A;  3H6N A;  4LDT D;  1XT9 B;  3K9O B;  4F7Z A;  3QIJ A;  3I3T B;  4KZC A;  4FA6 A;  4DHJ B;  1OQY A;  2NBV B;  1WJ6 A;  2KLG A;  5C23 A;  2MBQ A;  2MX2 A;  3B0A A;  4KDL B;  1WXV A;  2CS4 A;  5E6N A;  1UZX B;  3VFK A;  1KLV A;  1LQB A;  4FJY A;  4HDO A;  2IYD B;  3APD A;  4TKN A;  3PRM B;  1V2Y A;  3KH0 A;  5HKH A;  2AL6 A;  3ZTD A;  5EDS A;  3V62 A;  2PJH A;  1V5T A;  2CKH B;  2GBR A;  5BO4 B;  4A20 A;  4IWQ A;  2KN5 A;  2DYO A;  4WWN A;  2DAJ A;  2KFJ A;  4KZ0 A;  3U7D A;  3OJ4 B;  1WX8 A;  2GOW A;  3ZW3 A;  2WX1 A;  4KSK C;  2BWE S;  1WGY A;  3L0W B;  4MDK E;  4MJS A;  2KKC A;  2O6V A;  2KZR A;  3GOE A;  1MG8 A;  2WWZ A;  4K81 A;  2K39 A;  2O6V D;  3DOW A;  3IG3 A;  2R2O A;  4K7W A;  2D3G A;  2DYB A;  4EUT A;  4FLH A;  4BOZ B;  4HVB A;  2RSU A;  4JQW C;  2L8J A;  2N9X A;  4PYZ A;  3QX1 A;  2KJH B;  3SDL C;  3Q3F A;  4MGI E;  2MA9 B;  2PE9 A;  1UGM A;  4JLC A;  2KWC A;  3IBE A;  3H7S A;  1WGG A;  2G45 B;  3PLU A;  2D2Q A;  2EKE C;  3H1U A;  3JW0 X;  4FUL A;  3DVN U;  5FR6 A;  1UH6 A;  2KNB A;  4FHK A;  4K7S A;  5AZG A;  2MLB A;  1M94 A;  3DPD A;  3NOB A;  4LJO B;  5G55 A;  1H8C A;  5J17 A;  3NHE B;  2DZI A;  2IY0 B;  4W9H A;  3VH4 B;  2AWT A;  3HIZ A;  2JF5 A;  3EHV A;  2KLC A;  1XQQ A;  2KJ6 A;  4DDG D;  2J0K A;  4G3X B;  1UBQ A;  2NPT B;  3RZF A;  3A9J A;  3VDZ A;  2AL3 A;  2XBB C;  3P2B A;  2V4L A;  1J0G A;  4F8C B;  1HE8 A;  3QWZ B;  4AJY B;  5JHA A;  2M17 A;  3QAQ A;  3EC8 A;  2JWZ A;  1CMX B;  2G4S A;  4W9C A;  5G2N A;  5E6O A;  4GGQ A;  3UIP B;  4J6I A;  1WIA A;  4EEW A;  3R3M A;  3PRZ A;  4E71 A;  2JZ3 B;  3ZKJ C;  3TJP A;  1L7Y A;  2KD0 A;  3ML8 A;  2LVP A;  3DVG Y;  3ZRF A;  1Q0W B;  3A33 B;  4DWF A;  1OGW A;  1YQB A;  3ZVV A;  2KHW B;  3VHT C;  4B95 A;  2Z0D B;  3TMP B;  2LRU A;  4KIK B;  2K6D B;  1ZW7 A;  1P98 A;  1C3T A;  3KUZ A;  2LRW A;  5JH5 C;  2ZNV B;  3PPA A;  2I1J A;  3PZD A;  3ZNI D;  1E8Y A;  2NBU A;  2MQJ A;  5DPW A;  4CHK A;  4MSM B;  2KTR B;  1PQS A;  2LGX A;  3CF6 E;  4IWP A;  2KDE B;  1T0Y A;  4GDL B;  2KDB A;  2B3A A;  3HHM A;  4W9K A;  2LZ6 A;  4XX5 A;  3AUL A;  2HD5 B;  2RR9 A;  3AXC A;  3OAW A;  4JL9 A;  2YVC A;  5LXI B;  3PSE B;  4TQ1 A;  2JY6 A;  2N9P C;  3NY5 A;  4IUM B;  1WMH B;  3Q3J A;  3PT2 B;  2FUH B;  2C9W B;  2MW5 A;  4PS7 A;  4BKG A;  1E5W A;  2ZCB A;  2EMT A;  3RCZ A;  1FXT B;  2XK5 A;  3L16 A;  2DYM A;  2C7H A;  1WZ3 A;  2GMI C;  1G6J A;  1IPG A;  1P0R A;  1UD7 A;  1V5O A;  4E3C A;  3DBH I;  2KAN A;  3L54 A;  4OVU A;  3AU4 A;  3IVF A;  4FN2 A;  3JVZ X;  4ZYN A;  3PTF C;  3KYC D;  5DCN A;  3N3K B;  3LJ3 A;  2LD9 A;  2OJR A;  3ONS A;  1YD8 U;  1OTR B;  1NDD A;  3VXW A;  1I42 A;  3U8Z A;  4EOY A;  3VUX A;  1SGH A;  2JRI B;  3DBS A;  3VUW A;  3ZTC A;  2W9N A;  2BYE A;  2GBN A;  2J0J A;  2PE6 B;  1EUV B;  3L10 B;  5C1Z A;  2PPH A;  1WI0 A;  2L76 A;  3OJ3 A;  3WA0 A;  2L00 B;  2Y5B B;  3APC A;  5IAA C;  3PHX B;  2M0X A;  3QHT A;  2IO3 B;  1IP9 A;  4FAD A;  3PVL A;  2QHO A;  3DCG A;  4PS3 A;  2JZZ A;  2LXA A;  4MGY E;  3LDZ E;  4ANX A;  4ZRK A;  4YL8 A;  3TL5 A;  2ZCC A;  2L0T A;  3NZU A;  4I6P A;  3V6E B;  1KOT A;  2JPH A;  3A4S C;  1YX5 B;  2KWV B;  3VTW A;  4AJW A;  1E8W A;  4EZJ A;  2OOB B;  3QC8 B;  1WE6 A;  2KXJ A;  4MJS B;  2O6V B;  3VH3 B;  1VCB A;  2N4F A;  5TR5 A;  1WZ0 A;  3GZN I;  3V60 A;  1GJZ A;  1WXM A;  4MEL A;  2L7R A;  5D7G A;  4W9F A;  4I6N B;  1Q5W B;  3A1Q A;  4DK5 A;  3JSV A;  5KHO A;  4DBG A;  2CU1 A;  3UQA A;  1L2N A;  3H9D A;  4ANW A;  1E7U A;  3VTV A;  1P3Q U;  3ENE A;  3EFU A;  3BIN A;  3H7P A;  3IHP C;  3B08 A;  2ZNV C;  3ALB A;  2MBB B;  3QAR A;  2WDT B;  1R4M I;  2KMC A;  2VRR B;  3AI5 A;  4GOC A;  4IM0 A;  4ICV A;  3R7Q A;  3ZIM A;  1NBF C;  2V1Y A;  4KVG B;  3UGB B;  2ZPN A;  1NI2 A;  2M8S A;  2D10 A;  2DZK A;  3W1S C;  1QZE A;  4IW0 A;  4BKS A;  2AEH A;  2BWF A;  2KX0 A;  3X0W A;  2MSE D;  1ISN A;  3HM6 X;  4GXB A;  1V9J A;  2CR5 A;  2MP2 A;  2R2Q A;  2FCN A;  2BKR B;  4AWJ A;  2IO2 B;  3CST A;  4ZRI A;  4BKS D;  5JZE B;  2WYQ A;  3A9J B;  3NS8 A;  1TGZ B;  2DHZ A;  3VUY A;  3ZRC A;  3A9K A;  2LGY A;  3M95 A;  3DQV A;  1V86 A;  1ZKH A;  2LVQ A;  3QA8 A;  4LCD E;  3RT3 B;  2UYZ B;  4A3P A;  4EFO A;  5CTR C;  5D6J B;  4W9L A;  2D11 A;  3B1L X;  1WJU A;  2IY1 B;  4LJP B;  3KYD D;  3DBR I;  2A5U A;  3VTU A;  2MWS B;  4RMA A;  3PHW B;  2BKF A;  2KVR A;  2ZPY A;  3W1S A;  2KWU B;  3WIM A;  3V61 A;  2DAF A;  4HCN B;  4WJO A;  4NY0 A;  2N1V A;  3QJZ A;  3ECI A;  1P9D U;  4WAA A;  2ZZP B;  1U4A A;  4WWO A;  3APF A;  4RM9 A;  3SD5 A;  1KJT A;  2KX3 A;  3T8M A;  2N7D A;  1C1Y B;  2FIF A;  2N7E A;  2G3Q B;  4X57 B;  2DZJ A;  3PV1 A;  2ASQ A;  1WY8 A;  3VQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...